Anda di halaman 1dari 169

|

AndreaHirataSangPemimpi
[Hamalan1dari168]

|
AndreaHirataSangPemimpi
KaryaAndreaHirata
CetakanPertama,Juli2006
Penyunting:ImamRisdiyanto
Desaindanilustrasisampul:AndreasKusumahadi
Pemeriksaaksara:YayanR.H.
Penataaksara:lyanWb.
DiterbitkanolehPenerbitBentang
AnggotaIKAPI
(PTBentangPustaka)
Jin.PandegaPadma19,Yogyakarta55284
Telp.(0274)517373Faks.(0274)541441
Email:bentangpustaka@yahoo.com
PerpustakaanNasional:
KatalogDalamTerbitan(KDT)
Sangpemimpi/AndreaHirata;penyunting,ImamRisdiyanto.
Hirata,Andrea

Yogyakarta:Bentang,
x+292hlm;20,5cm

ISBN9793062924
I.Judul.
2006.

II.ImamRisdiyanto.
813

Didistribusikanoleh:
MizanMediaUtama
Jin.Cinambo(CisarantenWetan)No.146
Ujungberung,Bandung40294
Telp.(022)7815500Faks.(022)7802288
Email:mizanmu@bdg.centrin.net.ida

[Hamalan2dari168]

|
AndreaHirataSangPemimpi
Mozaik1
WhataWonderfulWorld

DaftarIsiDarataninimencuatdariperutbumilaksanatanahyang
dilantakkantenagadahsyatkataklismik.Menggelegaksebablaharmeluap
luapdibawahnya.Lalumembubungdiatasnya,langitterbelahdua.Disatu
bagianlangit,mataharirendahmemantulkanuaplengketyangterjebak
ditudungicendawangelapgulita,menjerangpesisirsejakpagi.Sedangkan
dibelahanyanglain,semburanultravioletmenarinaridiataspermukaan
lautyangbisubertapisminyak,jinggaserupakacakacagereja,
mengelilingidermagayangmenjulurkelautsepertireignoffire,lingkaran
api.Dandisini,disudutdermagaini,dalamsebuahruanganyangasing,
akuterkurung,terperangkap,matikutu.

Akugugup.Jantungkuberayunayunseumpamapunchbagyangdihantam
beruntunseorangpetinju.Berjingkatjingkatdibaliktumpukanpeties,
keduakakikutakteguh,gemetar.Bauikanbusukyangmerebakdaripeti
petiamis,diruanganyangasingini,sirnadikalahkanrasatakut.

Jimbronyangtambundaninvalidkakinyapanjangsebelahterengahengah
dibelakangku.Wajahnyapias.Dahinyayangkukuhbasaholehkeringat,
berkilatkilat.Disampingnya,Arai,biangkeladiseluruhkejadianini,lebih
menyedihkan.Sudahduakaliiamuntah.lalebihmenyedihkandarisi
invaliditu.Dalamsituasiapapun,Araiselalumenyedihkan.Kamibertiga
barusajaberlarisemburat,pontangpantinglupadirikarenadikejarkejar
seorangtokohpalingantagonis.Samarsamar,lalusemakinjelas,suara
langkahsepatuterhunjamgeramdiatasjalansetapakyangditaburi
kerangkeranghalus.Kamimengendap.TersengalAraimemberisaran.
Sepertibiasa,pastisaranyangmenjengkelkan."Ikal....Akutakkuat
lagihhh....Habissudahnapasku....Kalianlihatparaparaitu...?"
Akumenolehcepat.Duapuluhmeterdidepansanateronggokreyotpabrik
cincaudanparaparajemurandauncincau.Cokelatdandoyong.Di
berandanya,dahandahanbantanmerundukkuyumenekurinasibanak
anaknelayanyangterpaksabekerja.Salahsatunyaakukenal:Laksmi.
Sepertilaut,merekadiam.DangdutIndiadarikasetyangterlalusering
diputarmeliukliukpiludaripabrikitu.
"Lompatiparaparaitu,menyelinapkewarungALung,danmembaurdi
antaaparapembelitahu,aman...."

Akumeliriknyakejam.Mendengarocehannya,inginrasanyaaku
mencongkelgembokpetiesuntukmelemparkepalanya.
"Hebatsekaliteorimu,Rai!Takmasukakalsamasekali!Jimbronmaukau
[Hamalan3dari168]

|
AndreaHirataSangPemimpi
apakan??!!"
Jimbronyangpenakutmemohonputusasa.
"Akutakbisamelompat,Kal...."
Lebihtakmasukakallagikarenaakutahudibalikparaparaituberdiri
rumahturunanprajuritHupo,Tionghoatulenyangmenjadiparanoid
karenariwayatperangsaudara.Ratusantahunmerekamenanggungkan
sakithatisebabkalahbertikai.Dulu,bersamaCinaKuncit,merekajadi
antekKumpeni,ganasmenindasorangorangKek.Kinidimusuhibangsa
sendiri,dikhianatiBelanda,dandijauhiorangMelayumembuatmereka
selalucurigapadasiapapun.Takseganmerekamelepaskananjinguntuk
mengejarorangyangtakdikenal.Akuhafallingkunganinikarena
sebenarnyaaku,Jimbron,danAraitinggaldisalahsatulosdipasarkumuh
ini.Untukmenyokongkeluarga,sudahduatahunkamimenjadikuli
ngambattukangpikulikandidermaga.Semuanyamemangserbatidak
masukakal.Bagaimanamungkinhanyakarenaurusansekolahkamibisa
terperangkapdigudangpetiesini.Akumengawasisekeliling.Pancaran
mataharimenikamlubanglubangdindingpapansepertibatanganbaja
stainless,menciptakanpedangcahaya,putihberkilauan,takterbendung
melesatlesatmenerobossudutsudutgelapyangpengap.Akumengintip
keluar,15Agustus1988hariini,musimhujanbarumulai.Mendung
menutupseparuhlangit.Pukulempatsorenantihujanakantumpah,tak
berhentisampaijauhmalam,demikiandikotapelabuhankecilMagaidi
PulauBelitong,sampaiMarettahundepan.

SemuanyagaragaraArai.Kurekaperbendaharaankatakasarorang
Melayuuntukmelabraknya.Tapilamatlamatberderakmendekatsuara
sepatupantofel.Akumundur,tegangdanhening,keheninganberaroma
marabahaya.Araimenampakkangejalayangselaluiaalamijika
ketakutan:tubuhnyamenggigil,giginyagemeletuk,dannapasnya
mendengussatusatu.Bayangantigaorangpriaberkelebat,memutussinar
stainlesstadidansekarangpemisahkamidengannasibburukhanya
beberapakepingpapantipis.Ketigabayanganitumerapatkedinding,
dekatsekalisehinggaterciumolehkubaukeringatseorangpriakurus
tinggibersafariabuabu.Ketikaiaberbalik,akumembacanamapada
emblemhitammurahanyangtersematdidadanya:MUSTARM.DJAI'DIN,
B.A.

Akutercekatmenahannapas.Sebelahpunggungkubasaholehkeringat
dingin.Dialahtokohantagonisitu.WakilkepalaSMAkamiyangfrustrasi
berat.IaWesterlingberwajahtirusmanis.Bibirnyatipis,kulitnyaputih.
Namun,alisnyalebatmenakutkan.Sorotmatanyadangerakgeriknya
sedingines.Beradadekatdengannya,akusepertiterembussuatu
[Hamalan4dari168]

|
AndreaHirataSangPemimpi
pengaruhyangjahat,sepertipengaruhyangtimbuldarisepucuksenjata.
PakMustarmenyandangsemuajulukanseramyangberhubungandengan
tatacaralamayangkerasdalampenegakandisiplin.Iagurubiologi,
Darwiniantulen,karenaituiasamasekalitidaktoleran.Lebihdarigelar
B.A.ituiaadalahsuhutertinggiperguruansilattradisionalMelayuMacan
Akaryangditakuti.
"Berrrrandalll!!"
Iamenekandengangusarhardikankhasnya,menjilattelunjuknya,dan
menggosokgosokkantelunjukituuntukmembersihkanemblemnamanya
yangberdebu.Akumelepaskannapasyangtertahanketikaia
membalikkantubuh.

SebenarnyaPakMustaradalahorangpenting.Tanpadia,kampungkami
tak'kanpernahpunyaSMA.lasalahsatuperintisnya.Akhirnya,kampung
kamimemilikiSebuahSMA,sebuahSMANegeri!Bukanmain!Dulukami
harussekolahSMAkeTanjongPandan,120kilometerjauhnya.Sungguh
hebatSMAkamiitu,sebuahSMANegeri!Benarbenarbukanmain!Namun,
PakMustarberubahmenjadimonsterkarenajustruanaklelakisatu
satunyatakditerimadiSMANegeriitu.Bayangkan,anaknyaditolakdi
SMAyangsusahpayahdiusahakannya,sebabNEManakmanjaitukurang
0,25daribatasminimal.Bayangkanlagi,0,25!Syaratnya42,NEManaknya
hanya41,75.
SetelahempatpuluhtahunbumipertiwimerdekaakhirnyaBelitong
Timur,pulautimahyangkayarayaitu,memilikisebuahSMANegeri.
Bukanmain.SMAinisegeramenjadimenaragadingtakhtatertinggi
intelektualitasdipesisirtimur,makaiamengandungmaknadarisetiap
syairlagu"GodeamusIgitur"yangketikamendengarnya,sembari
memakaitoga,bisamembuatorangmerasaIQnyameningkatdrastis
beberapadigit.

PemotonganpitaperesmianSMAiniadalahharibersejarahbagikami
orangMelayupedalaman,karenasaatpitaituterkulaiputus,terputuspula
kamidarimasagelapgulitamatematikaintegralatautatacaramembuat
bukutabelarishitungdagangyangdikhotbahkandiSMA.Takperlulagi
menempuh120kilometerkeTanjongPandanhanyauntuktahuilmudebet
kredititu.KarenaituberbondongbondonglahorangMelayu,Tionghoa,
Sawang,danorangorangpulauberkerudunginginmenghirupcanduilmu
diSMAitu.Tapitaksegampangitu.Seoranglakilakimudananputih
kulitnya,elokparasnya,Drs.JulianIchsanBalia,sangKepalaSekolah,yang
jugaseoranggurukesusastraanbermututinggi,diharipendaftaran
memberimerekapelajaranpalingdasartentangbudipekertiakademika.
"...Ngaimausumbangkapur,jamdinding,pagar,tiangbendera...,"rayu
[Hamalan5dari168]

|
AndreaHirataSangPemimpi
seorangtaukeberbisikagaranaknyayangberNEM28dansampaitamat
SMPtaktahuibukotaprovinsinyasendiriSumsel,mendapatkursidiSMA
BukanMain.
"Aha!Tawaranyangmenggiurkan!!"PakBaliameninggikansuaranya,
sengajamempermalukantaukeituditengahmajelis."SepertiNicholas
Beauraindigoda
berbuatdosadibawahpohon?!Kautahu'kankisahitu?'GairahCintadi
Hutan'?GuydeMaupassant?"
Sangtauketersipu.Diahanyapahamsastrasempoa.Senyumnyatakenak.
"Bijaksanakalaukausumbangkanjamdindingmuitukekantor
pemerintah,agarabdinegaradisanatakbertamasyakewarungkopi
waktujamdinas!Bagaimanapendapatmu?"
Kapitalisitumeliukliukpergisepertidedemitdimarahirajahantu.Dan
saatitulahPakMustar,sangjawarayangtemperamental,takkuasa
menahandirinya.Tanpamemedulikansituasi,didepanorangbanyakia
memprotesPakBalia,atasannyasendiri.
"Takpantaskitaberdebatdidepanparaorangtuamurid.Bicaralahbaik
baik...,"bujukPakBalia.
PakMustaryangmerasamemilikiSMAitumenatapnyadariataskebawah,
artinyakuranglebih,"...Sokidealis.Anakmudabaukencur,tahuapa...."
Benarsaja.
"Sayaberanibertaruh,angka0,25tidakakanmembedakankualifikasi
anaksayadibandinganakanaklainyangditerima,apalahartinyaangka
0,25itu?!"
Anaksaya,katakatayangditindaskuatolehPakMustar.Semuakeluarga,
darisukumanapun,menyayangianak.Namun,anaklelakibagiorang
Melayulebihdarisegalagalanya,sangrembulan,permatahati.Ayahku,
yangmengantarkusaatpendaftaranitu,berusahamembekaptelingaku
dantelingaArai,anakangkatkeluargakami,agartakmendengar
pertengkaranyangsungguhtakpatutini.Tapiakumengelak.Maka
kudengarjelasargumencerdasPakBalia,"0,25ituberartisegalagalanya,
Pak.Angkakecilseperempatituadalahsimbolyangmenyatakanlembaga
inisamasekalitidakmenoleransipersekongkolan!!"

Tersinggungberat,PakMustarmuntabdansertamertamemprovokasi,
"Bagaimanaparaorangtua??Setujudenganpendapatitu?!"lapetantang
petentenghilirmudiksambilbertelekanpinggang.
"TanpasayaSMAinitak'kanpernahberdiri!!Sayababatalasdisini!!"
PakBalia,memangmasihbelia,tapiiapengibarpanjiahlakulkarimah.
Integritasnyataktercela.Iaseorangbumiputra,amtenarpintarlulusan
IKIPBandung.Baginyainisudahketerlaluan,merongrongwibawainstitusi
pendidikan!Gurumudagantenginijadiemosi.
[Hamalan6dari168]

|
AndreaHirataSangPemimpi
"Takadapengecualian!!Takadakompromi,takadakatebelece,dantak
adaaksesistimewauntukmengkhianatiaturan.Inilahyangterjadidengan
bangsaini,
terlalubanyakkongkalikong!!"
DadaPakMustarturunnaikmenahanmarahtapiPakBaliatelanjur
jengkel.
"SeharusnyaBapakbisamelihattidakditerimanyaanakBapaksebagai
peluanguntukmenunjukkanpadakhalayakbahwakitakonsisten
mengelolasekolahini.NEMminimal42,titik!!Takbisaditawartawar!!"
Pidatoitudisambuttepuktanganparaorangtua.Jikawakilrakyat
berwataksepertiPakBalia,makarepublikinitak'kanpernahberkenalan
denganistilahstudibanding.Namun,akibatnyafatal.Setelahkejadianitu,
PakMustarberubahmenjadiseoranggurubertanganbesi.Beliau
menumpahkankekesalannyakepadaparasiswayangditerima.
"Disiplinyangkeras!!ItulahyangdiperlukananakanakmudaMelayu
zamansekarang."Demikianjargonpamungkasyangbertalutalu
digaungkannya.
lajugaselaluterinspirasikatakatamutiaraDengXioPingyangmenjadi
pedomantindakanrepresiftentarapadamahasiswadiLapangan
Tiannanmen,"Masalahmasalahorangmudasepertiakarrumputyang
kusut.Jikadibiarkan,pastiberlarutlarut.Haruscepatdiselesaikandengan
guntingyangtajam!!"

Seninpagiinikuanggaphariyangsial.Setengahjamsebelumjammasuk,
PakMustarmenguncipagarsekolah.Beliauberdiridipodiummenjadi
inspekturapelrutin.Celakanyabanyaksiswayangterlambat,termasuk
aku,Jimbron,danArai.Lebihcelakalagibeberapasiswayangterlambat
justrumengejekPakMustar.Dengansengaja,merekamenirunirukan
pidatonya.Pemimpinparasiswayangberkelakuansepertimonyetsirkus
itutaklainArai!!
PakMustarngamuk.lameloncatdaripodiumdanmengajakduaorang
penjagasekolahmengejarkami.SaatituakudanJimbronsedangduduk
penuhgayadiatassepedajengkinyayangbutut.Sekelompoksiswikelas
satuyangjugaterlambatnongkrongberderetderet.Hanyaakudan
Jimbronpejantandisana.
"Kesempatanbaik,Bron!!"akugirang,celingukankirikanan.
"Takadakompetisi!!"
WajahJimbronyangbulatjenakameronaronasepertibuahmentega.
"Mmhhh...mmhhaa...mainkan,Kal!!"
Takmembuangtempo,segerakamikeluarkansegenapdayapesonayang
kamimilikisecarahabishabisanuntukmenarikperhatianputriputrikecil
semenanjungitu.Jimbronmembunyikankliningansepedanyadan
[Hamalan7dari168]

|
AndreaHirataSangPemimpi
menyiulnyiulkanlagusumbangyangtakjelas.Sedangkanaku,sebagai
siswaSMAyangcukupkreatif,telahlamamemilikitaktikkhususuntuk
situasisemacamini,yaitumengadukkepalakudenganminyak
hijauajaibTanchoyangselaluadadalamtasku,menyisirseluruh
rambutkukebelakang,laludengantangandantenagapenuhmenariknya
kembali.Makamuncullah
bongkahanjambulberbinarbinar.Daninilahpuncakmuslihatanak
Melayukampung:didekatparasiswitadi,akuberpurapuramenunduk
untukmembetulkantalisepatu,yangsebenarnyatidakapaapa,sehingga
ketikabangkitakumendapatkesempatanmenyibakkanjambulkuseperti
gayapembantumembilascucian.Ah,elegan,elegansekali.SangatMelayu!

Sayangnya,gadisgadiskeciliturupanyatelahdikaruniaiSangMaha
Penciptasemacampenglihatanyangmampumenembustulangbelulang,
sehinggabagimerekatubuhkutransparan.Akuadadisana,hilirmudik
pasangaksisepertibebek,tapimerekatakmelihatku,sebabtakseorang
puninginmemedulikanlakilakiyangberbausepertiikanpari.Dan
bukannyamendapatsimpati,ketikamelakukangerakanmengayunjambul
dengansedikitputaranmanissetengahlingkaransepertiaksiJailhouse
RockElvisPresley,akumalahterperanjattakalangkepalangkarenapara
siswididepankumenjeritjerithisteris.Merekamenatapsesuatudi
belakangkusepertimelihatkuntilanak.
Taksempatkusadari,secepatterkamanmacanakar,secaraamat
mendadak,PakMustartelahberdiridisampingku.Wajahnyayangdingin
putihmenyeringaikejam.Akumenjejalkanpijakanlangkahkuuntuk
melompattapiterlambat.PakMustarmerenggutkerahbajuku,
menyentakkudengankerashinggaseluruhkancingbajukuputus.Kancing
kancingituberhamburankeudara,berjatuhangemerincing.Akumeronta
rontadalamgenggamannya,menggelinjang,danterlepas!
Laluwuttthhhh!!!Hanyaseincidaritelingaku,PakMustarmenamparangin
sebabakumerunduk.Akuberbalik,mencurimomentumdengan
menumpukanseluruhtenagapadatunjangankakikanandansedetik
kemudianakumelesatkabur.
"Berrrandallllll!!!"
SuaraPakMustarmembahana.lasertamertamengejarkudanberusaha
menjambakrambutkudengantangancakarmacannya.Keduapenjaga
sekolahtergopohgopohmenyusulnya.Segerombolansiswa,termasuk
AraidanJimbron,semburatberhamburankeberbagaiarah.Danyang
palingsialadalahaku,selaluaku!PakMustarjelasjelashanyamenyasar
aku.Suarapeluitpenjagasekolahmeraungraungmenerorku.
Pritt!!Prriiiiiitttt...priiiiiiiiiittttt!!
Akuberlarikencangmenyusuriteralisekolah.Pengejarkujugasialkarena
[Hamalan8dari168]

|
AndreaHirataSangPemimpi
akuadalahsprinterSMABukanMain.Seluruhsiswaberhamburanmenuju
pagar,riuhmenyemangatikukarenamerekamembenciPakMustar.
Seumurumurakutakpernahdiperhatikanseorangpunputri
semenanjung,namunkinigadisgadismanisMelayuitu,yangtaditak
sedikitpunmengacuhkanaku,melolonglolongmendukungku.
"Ikal!!Ikal!!Ayo!!Ikal,lari!!Lariiiiiiii...!!"
Tenagakuterbakar.Kuliriksejenakjejeranpanjangtakputusputuspagar
nanayu,ratusanjumlahnya,berteriakteriakhisterismembelaku,hanya
membelakusendiri,sebagianmelonjaklonjak,yanglainnyamembekap
dada,khawatirjagoannyaditangkapgarong.
"Lari!!LariKal!!Lari,Sayang...."
Oh,akumelambungtinggi,tinggisekali.Setiaplangkahkuterasaringan
laksanaloncatanloncatananggunantelopTibet.Walaugemetarketakutan
tapiakumelesatsambiltersenyumpenuharti.Bajukuyangtakberkancing
berkibarkibarsepertijubahZorro.Akumerasatampan,merasamenjadi
pahlawan.Danyangterpenting,dalamkepanikanitu,sempatkutarik
pelajaranmoralnomortujuh:Ternyatarahasiamenarikperhatianseorang
gadisadalahkitaharusmenjadipelariyanggesit.
Akumenyeberangijalandanberlarikencangkeutara,memasukigerbang
pasarpagi.PakMustarbernafsumenangkapku,jaraknyasemakindekat.
Akuketakutandantergesagesameloncatipalangbesiparkirsepeda.
Celaka!Salahsatusepedatersenggol.Lalutukangparkirterpanamelihat
ratusansepedayangtelahdirapikannyasusahpayah,rebahsatupersatu
sepertipermainanmendirikankartudomino,menimbulkankegaduhan
yangluarbiasadipasarpagi.Akuterjerembap,bangkit,danpontang
pantingkabur.
Kejarkejaransemakinserusaatakumelintasipelatarandenganpilarpilar
menjulangyangdipenuhipedagangkakilima.Akumelesatmeliukliukdi
antaragerobaksayurdanratusanpembeli.PakMustardankomplotannya
lekatdibelakangku.Suarapeluitmenjeritjerit.Orangorangberteriak
gaduh.AkuberbeloktajamkegangpermukimanKekyangpanjang,berlari
sekencangkencangnyahinggamencapaiakselerasisempurna.PakMustar
ketinggalandibelakangku,semakinlamasemakinjauh.Sebenarnyaaku
dapatlolosjikatakmemedulikanpanggilansialini,"Ikal!!...Ikal!!"
Akuberbalikdantepatdisana,limabelasmeterdariku,barusajaberbelok
darisebuahmulutgang,JimbrondanAraiterengahengahsaling
berpegangan.Jikaberlari,Jimbronyanginvalidharusdibopong.Mereka
yangtadisemburattakmenyadariarahpelariannyamelintasijalur
perburuanPakMustar.
"Ikal...tolong,Kal....Tolong...."
Akuterkesiap,kasihan,dankesal.
"Biangkeladi!Cukupsudahakudengantabiatmu,Rai.Lihat!Macanitu
[Hamalan9dari168]

|
AndreaHirataSangPemimpi
akanmenerkammu!!"
Melihatsasarannomploktibatibamunculdidepannya,PakMustar
sumringahdankembalibernafsumemburukami.JimbrondanArai
terseokseoktakberdaya.AkuinginmenyelamatkanJimbronwalaupun
bencisetengahmatipadaArai.AkudanAraimenopangJimbrondan
beruntungkamiberadadalamlabiringangyangmembingungkan.Kami
menyelinap,hinggaakhirnyadigudangpetiesinilahkamiterperangkap.

PakMustardankeduapenjagasekolahmondarmandirdiluartanpa
menyadarikamiadadidalamgudangpeties.Tatapankulekatpadasetiap
gerakankecilPakMustar.Seakandapatkurasakansetiaptarikan
napasnya.AkumemilikigambaranjelastentangkarakterorangsepertiPak
Mustar.Priapriaberwajahmanisdankekejamanmerekayangtak
terbayangkan.Akupernahmengunjungiuwakkuyangmenjadisipirdi
penjaraKarimun.Dipenjaraitukulihatpesakitanyangsangar,sokjago,
dekil,omongbesar,danbertatodisanasiniberadadiblokA,dikurung
beramairamaisepertiayamkarenamerekataklebihdaripencuriayam
atautukangnyolongjemuran.Namun,merekayangsampaihati
merampokTKWataumembunuhtanpamelepaskanrokokdimulutnya,
beradadiblokB,selisolasi.
PenghuniblokBadalahpriapriakecilyangrapi,pintar,bersih,santun
lisannya,danmanissekalisenyumnya.Sejarahmenunjukkanbahwa
AlexanderAgungyangmembakarribuanwanitadananakanak,Cortez
yangmembantaiorangIndiansampaimenggenangkandarahsetinggi
lutut,semuapenjagalyangdisebutlegendaitutaklainadalahpriapria
tampanberwajahmanis.MakaberurusandenganPakMustaraku
menyadaribahwakamisedangberadadalamsituasiyangtakdapat
diduga.
Tapiakutaktahandikandangmendidihberbauamisini.Punakutak
melihatcelahuntuklolos.Akumenunggukeajaibansebelummenyerahkan
diri.Daniatakdatang,harapankuhabis.Akuberjalanmenujupintu
gudangdiikutiJimbronyangterpincangpincang.
TapitibatibakamiterperanjatkarenadentumanknalpotvespaLambretta.
Dankamipaniktakdapatmenguasaidiri.Benarbenarsialberlipatlipat
sebabpenunggangvespaituadalahNyonyaLamNyetPho,turunan
prajuritHupo,semacamcapo,ketuapremanpasarikan.Iapemilikgudang
inidanpenguasa16perahumotor.Anakbuahnyaratusanpriabersarung
yanghidupdiperahudantakpernahmelepaskanbadikdaripinggangnya.
Beperkaradengannyonyainiurusanbisarunyam.Karenakamitelah
menyelinapdalamgudangnya,pastiiaakanmenuduhkamimencuri.
NyonyaPhobertubuhtinggibesar.Rambutnyatebal,disemirhitampekat
dankakusepertisikat.Alisnyasepertikucingtandang.Bahunyategap,
[Hamalan10dari168]

|
AndreaHirataSangPemimpi
dadanyatinggi,danrautmukanyasepertiorangterkejut.Sesuaitradisi
Hupo,iabertato,lukisannagamenjalardaripunggungsampaikebawah
telinga,bersuraisuraidengantintaCina.Bengis,tega,sokkuasa,dantak
maukalahtersiratjelasdarimatanya.LimaorangpembantusetiaNyonya
PhoParmin,Marmo,Paijo,Tarji,danNasiomembukapintugudang.Gagal
menjadipetanijagung,paratransmigraninibermetamorfosisjadikuli
serabutan.MesinLambrettadimatikandanakudiserangkesenyapanyang
menggiriskan.Jimbronmemelukkeduakakinyadanmulaiterisakisak.
Tubuhkumerosotlemas.Nasibkamidiujungtanduk.Namundalamdetik
yangpalinggenting,akuterkejutsebabadatanganmengguncang
pundakku,tanganArai.
"Ikal!"bisiknyasambilmelirikpeties.Akupahammaksudnya!Luarbiasa
dansinting!!
ItulahAraidenganotaknyayangganjil.Akususpense.Otakkuberputar
cepatmenguraisatupersatuperasaancemas,ideyangmemacuadrenalin,
danwaktuyangsempit.Araimencongkelgembokdanmenyingkaptutup
peti.Wajahkamiseketikamemerahsaatbauamisyangmengendaplama
menyeruak.Isipetimiripremahremahpembantaianmakhlukbawahlaut.
Sempatterpikirolehkuuntukmengurungkanrencanagilaitu,tapikami
takpunyapilihanlain.
"Ikal!Masukduluan!"perintahAraisokkuasa.
TatapankuberkilatmengancamArai.Inginsekaliakumembenamkan
kepalanyakemulutikanhiugergajiraksasayangmengangadidepanku.Itu
penyiksaankarenaberartiakuharusbersentuhanlangsungdenganbalok
esdidasarpetidanmenanggungbebantubuhJimbrondanArai.Berat
Jimbronsendiritakkurangdari75kilo.
"Takadil!IniidemuRai,kaumasukduluan!!"
"Janganbanyakprotes!Badanmupalingkecil.Kalautakmasukduluan,
Jimbrontakbisamasuk!!"

Akumerasaincharge.Akupemimpinpelarianini,makahanyaakuyang
berhakmembuatperintah.
"Taksudi!Bagaimanapendapatmu,Bron?"
Araijengkel."Inibukandemokrasi!Ataukaumauberurusandengan
Capo?!"
Akumelongokkedasarpeti.Akutaksanggup.
"Takbisa,Rai!Bisakudisanakukenaumpanbusukitu...."
Araimenyeringaisepertijinkurangsajen.Habissudahkesabarannyadan
meledaklahserapahkhasnyayanglegendaris.
"Kudisan?!!Kudisankatamu?Kautakpunyawewenangilmiahuntuk
menentukanpenyakit!!"
"Masuk!!"
[Hamalan11dari168]

|
AndreaHirataSangPemimpi
Akumerasakansiksaanyangmengerikanketikaduatubuhkulingambat
denganberattakkurangdari130kilomenindihku.Tulangtulangku
melengkung.Jikabergeser,rasanyaakanpatah.Setiaptarikannapasperih
menyayatnyayatrusukku.Perutkungilusepertiteririskarenadiikat
dinginnyasebatangbalokes.Akumenggigitlengankukuatkuatmenahan
penderitaan.Bauanyirikanbusukmenusukhidungkusampaikeuluhati.
Tatapannanarbolamatamayatmayatikankenangkayangterbelalakdan
kelabumembuatkugugup.NyonyaPhodanpembantunyamemasuki
gudang.
"Min,Mo,angkutyangini!"
Petiitumiringkamitercekattapisamasekalitakterangkat.Pembantu
NyonyaPhomencobaberkalikali,masihtakterangkat.Petiitumembatu
sepertimenhirkeramat.NyonyaPhokecewaberat.DiluargudangPak
Mustardanduaorangpenjagasekolahtaditengahdudukmerokok.Aku
membayangkansebuahkejadianjanggaldanbelumsempatkucerna
firasatku,kejanggalanitubenarterjadi.SuaraNyonyaPhokembali
menggelegarsepertipengkhotbahdipuncakBukitGolgota.
"Bujang!Tolongsini!Angkatpetiinikestanplat.Daripadakalianmerokok
sajadisitu,ayaya...takberguna!"
Sekarangdelapanorangmemikulpetidanpetimeluncurmenujupasar
pagiyangramai.Disekitarpetitukangparkirberteriakteriakmenimpali
obralanpedagangMinangyangmenjualbajudikakilima.Klaksonsepeda
motordankliningansepedasahutmenyahutdenganjeritanmesinmesin
parutdanketukanpaluparatukangsol.Lenguhsapiyangdigelandangke
pejagalanberadunyaringdengansuarabisingdaribalonkecilyang
dipencetpenjualmainananakanak.Dipunggungkukurasakansatuper
satudetakanjantungJimbron,lambatnamunkeras,gelisahdan
mencekam.
BerbedadenganArai.Waktupetimelewatiparapengamenia
menjentikkanjemarinyamengikutikerincingtamborin.Daniatersenyum.
Akumengertibahwabaginyaapayangkamialamiadalahsebuah
petualanganyangasyik.lamelirikkuyangterjepittakberdaya,senyumnya
semakingirang.
"Fantastikbukan?"pastiitumaksudnya.
AkumerasatakjubdengankepribadianArai.Tatapankumenghujambola
matanya,menyusupilensa,selaputjala,danirispupilnya,lalutembuske
dalamlubukhatinya,inginkulihatduniadaridalamjiwanya.
Tibatibaakumerasaseakanberdiridibalikpintu,padasebuahtemaram
dinihari,mengamatiayahkuyangsedangdudukmendengarkansiaran
radioBBC.Lalulagusyahdu"WhataWonderfulWorld"mengalirpelan.
Seiringalunanlaguitudaricelahcelahpetikusaksikanpasaryangkumuh
menjadimemesona.AnakanakkecilTionghoayangmembawakado
[Hamalan12dari168]

|
AndreaHirataSangPemimpi
melompatlompatharmonisbermaintalidikelilingigelembunggelembung
busa.Lalulalangkendaraanadalahserpihanserpihancahayayang
melesatlesatmenembusfatamorganaaurora.Burungburungcamar
mematukicumiyangberjuntaidilubanglubangpeti,terbanglabuh.
Sayapsayapkumbangberkilauanterbiaswarnawarnidedaunanmaranta.
DemikianindahkahhidupdilihatdarimataArai?Beginikahseorang
pemimpimelihatdunia?
"Brragghh!!!"
Lamunankuterhempasdiatasmejabarupualamputihyangpanjang.
Kudengarlangkahparapengangkatpetibergegaspergi.Kamimenunggu
dengantegangdetikdemidetikberikutnya.Jantungkuberdetaksatu
persatumengikutideraplangkahNyonyaPhomendekatipeti.Dantibalah
momenyangdramatisituketikaCapomengangkattutuppetidan
langsung,saatitujuga,iamenjeritsejadijadinya.Wajahnyayangmemang
sudahsepertiorangterkejutmembirusepertianakkecilmelihathantu.
Kamibertigabangkitserentaktanpaekspresi.
NyonyaPhoterngangadanbibirnyabergetargetar.Cerutunyamerosot
danjatuhtanpadayadiataslantaistanplatyangbecek.Kamitaksedikit
punmemedulikannya.
Ratusanpembeliikanterperangahmenyaksikankamiberbarisdengan
tenangdiatasmejapualamyangpanjang:takberbaju,berminyakminyak,
danbusukbelepotanudangrebonbasi.Kamimelenggangtenangdipimpin
seoranglakilakipemimpiyanghebatbukanmain.Ketikakamimelewati
NyonyaPho,iaterjajarhampirjatuh.Mukanyapiasseakaninginmati
berdiri.Tangannyamenunjuknunjukkami.Mulutnyakomatkamit
mengucapkankatakatasepertiorangtercekik.
"Ikkhhhh...ikkhhh...ikkha...ikanduyung!!!"

[Hamalan13dari168]

|
AndreaHirataSangPemimpi
Mozaik2
SimpaiKeramat

Araiadalahorangkebanyakan.Lakilakisepertiiniselalubertengkar
dengantukangparkirsepeda,meributkanuangduaratusperak.Orang
sepertiiniseringdudukdibangkupanjangkantorpegadaianmenunggu
barangnyaditaksir.Barangnyaitudulangtembagabusukkehijauhijauan
peninggalanneneknya.Kalaupolisimencidukgerombolanbromocorah
pencurikabeltelepon,makaorangberwajahserupaAraidinaikkankebak
pickup,dibopongkarenatulangkeringnyadicuncungsepatujatahkopral.
DanjikamenontonTVRI,kitabiasamelihatorangsepertiAraimeloncat
loncatdibelakangpresidenagartampakolehkamera.
WajahArailaksanapatungmukayangdibuatmahasiswabarusenikriya
yangbarupertamakalimenjamahtanahliat,pencetsana,melendungsini.
Lebihtepatnya,perabotandiwajahnyasepertihasilsuntikansilikondan
mulaimeleleh.Suaranyakering,serak,dannyaring,persisvokalis
mengambilnadafalsetomungkinkarenakebanyakanmenangiswaktu
kecil.Gerakgeriknyacanggungserupabelalangsembah.Tapimatanya
istimewa.DisitulahpusatgravitasipesonaArai.Keduabolamatanyaitu,
sangjendelahati,adalahlayaryangmempertontonkanjiwanyayangtak
pernahkosong.
Sesungguhnya,akudanAraimasihbertaliandarah.Neneknyaadalahadik
kandungkakekkudaripihakibu.Namunsungguhmalangnasibnya,waktu
iakelassatuSD,ibunyawafatsaatmelahirkanadiknya.Arai,baruenam
tahunketikaitu,danayahnya,gemetardisampingjasadbekusangibu
yangmemelukeratbayimerahbersimbahdarah.Anakberanakitu
meninggalbersamaan.LaluAraitinggalberduadenganayahnya.
KepedihanbelummaumenjauhiArai.MenginjakkelastigaSD,ayahnya
jugawafat.Araimenjadiyatimpiatu,sebatangkara.Iakemudiandipungut
keluargakami.
Akuteringat,beberapaharisetelahayahnyameninggal,dengan
menumpangtrukkopra,akudanayahkumenjemputArai.Soreituiasudah
menunggukamididepantanggagubuknya,berdirisendirianditengah
belantaraladangtebuyangtakterurus.Anakkecilitumengapitdi
ketiaknyakarungkecampangberisibeberapapotongpakaian,sajadah,
gayungtempurungkelapa,mainanbuatannyasendiri,danbingkaiplastik
murahanberisifotohitamputihayahdanibunyaketikapengantinbaru.
Sebatangpotlotyangkumaliaselipkandidauntelinganya,penggariskayu
yangsudahpatahdisisipkandipinggangnya.Tangankirinya
menggenggambeberapalembarbukutakbersampul.Celanadanbajunya
darikainbelaculusuhdengankancingtaklengkap.Itulahseluruhharta
bendanya.Sudahberjamjamiamenunggukami.
[Hamalan14dari168]

|
AndreaHirataSangPemimpi
Tampakjelaswajahcemasnyamenjadilegaketikamelihatkami.Aku
membantumembawabukubukunyadankamimeninggalkangubuk
berdindinglelakberatapdaunitudenganmembiarkanpintudanjendela
jendelanyaterbukakarenadipastikantak'kanadasiapasiapauntuk
mengambilapapun.Laksanaterumbukarangyangmenjadirumahikandi
dasarlaut,gubukituakansegeramenjadisarangluak,atapnyaakan
menjadilumbungtelurburungkinantan,dantiangtiangnyaakanmenjadi
istanaliangkumbang.

Kamimenelusurijalansetapakmenerobosgulmayanglebihtinggidari
kami.Kerasaktumpahruahmerubungjalanitu.Araimenengokke
belakanguntukmelihatgubuknyaterakhirkali.Ekspresinyadatar.Laluia
berbalikcepatdanmelangkahdengantegap.Anaksekecilitutelahbelajar
menguatkandirinya.Ayahkuberlinanganairmata.Dipeluknyapundak
Araieraterat.Diperjalananakutakbanyakbicarakarenahatikungilu
mengenangkannasibmalangyangmenimpasepupujauhkuini.Ayahku
dudukdiatastumpukankopra,memalingkanwajahnya,taksampaihati
memandangArai.AkudanAraidudukberdampingandipojokbaktruk
yangterbantingbantingdiatasjalansepiberbatubatu.Kamihanyadiam.
Araiadalahsebatangpohonkaraditengahpadangkarenahanyatinggalia
sendiridarisatugarisketurunankeluarganya.Ayahibunyamerupakan
anakanaktunggaldankakekneneknyadarikeduapihakorangtuanyajuga
telahtiada.OrangMelayumemberijulukanSimpaiKeramatuntukorang
terakhiryangtersisadarisuatuklan.
AkumengamatiArai.Kelihatanjelaskesusahantelahmenderanya
sepanjanghidup.Iaseusiadengankutapitampaklebihdewasa.Sinar
matanyajernih,polossekali.Lalutakdapatkutahankanairmataku
mengalir.Akutakdapatmengertibagaimanaanaksemudaitu
menanggungkancobaandemikianberatsebagaiSimpaiKeramat.Arai
mendekatikulalumenghapusairmatakudenganlenganbajunyayang
kumal.Tindakanitumembuatairmatakumengalirsemakinderas.Sempat
kulirikayahkuyangmencuricuripandangkepadakami,wajahbeliau
sembapdanmatanyasemerahbuahsaga.Melihatkupilu,kupikirAraiakan
terharutapiiamalahtersenyumdanpelanpelaniamerogohkan
tangannyakedalamkacungkecampangnya.Airmukanyamemberikesan
iamemilikisebuahbendaajaibnanrahasia.
"Ikal,lihatlahini!!"bujuknya.
Daridalamkarung,iamengeluarkansebuahbendamainanyanganeh.Aku
melirikbendaitudanakusemakinpedihmembayangkaniamembuat
mainanitusendirian,memainkannyajugasendirianditengahtengah
ladangtebu.Akutersedusedan.
Tapibagaimanapunperihakutertarik.Mainanitusemacamgasingyang
[Hamalan15dari168]

|
AndreaHirataSangPemimpi
dibuatdaripotonganpotonganlidiarendandiujunglidilidiitu
ditancapkanbeberapabutirbuahkenarituayangtelahdilubangi.Sepintas
bentuknyasepertiihelikopter.Jalinanlidipadamainanituagaknya
mengandungkonstruksimekanis.AkutergodamelihatAraimemutar
mutarbendaitusetengahlingkaranuntukmengambilancangancang.
Setelahbeberapakaliputaran,sebatanglidibesaryangmenjadituas
konstruksiitumelengkunglalusaatputaranterakhirdilepaskan,ajaib!
Lengkungantadimelawanarahmenimbulkantendangantenagabalikyang
memelintirgasinganehinidengansempurna360derajat,berulangulang.
Lebihserulagiputaranbalikinimenyebabkanbutirbutirkenaritadi
salingberadumenimbulkanharmonisuaragemeretakyangmenakjubkan.
Akutergelak.MataAraibersinarsinar.

Akutersenyumtapitangiskutakredakarenasepertimekanikagerakbalik
helikopterpurbaini,Araitelahmemutarbalikkanlogikasentimentalini.la
justruberusahamenghiburkupadasaatakuseharusnyamenghiburnya.
Dadakusesak.
"Cobalah,Ikal...."
Akumerebutgasinganehitu,mengamatinyadengantelitibukanhanya
sebagaimainanyangmenarikhatitapisebagaisebuahkisahtentanganak
kecilyangmenciptakanmainanuntukmelupakankepedihanhidupnya.
Akumemutargasingitusekali,namunakuterperanjatsebabtibatibaia
berputarsendiridengankerassehinggakonstruksinyabingkas,lidilidinya
patah,danbuahbuahkenariituberhamburankemukaku.Akutelah
memutarnyaterlalukencang.Araiterkekehmelihatku.Iamemegangi
perutnyamenahantawa.Belumhilangrasaterkejutku,Araikembali
merogohkantangannyakedalamkarungkecampang.
"Masihadalagi!!"
Iatersenyumpenuhartikarenatahutelahberhasilmenghiburku.Kaliini
iamengeluarkansebuahcupudarikayumedangyangberlubanglubang.
BiasadipakaiorangMelayuuntukmenyimpantembakau.Takkusangka
cupuitutelahdibelahdansambungannyatakkasat.Araimembukanya
pelanpelan.
"Aiih...kumbangsagu!!"
Akumemekiktakterkendali.Kumbangsagu,seranggamainanlangkayang
susahditangkap.Jikadipeliharadandiberimakanremahkelapa,kumbang
bersayapmengilatsepertitamengpatriotSpartanitudapatmenjadijinak.
TakberkedipakumelihatAraimembiarkankumbangitumerayapi
lengannya.Makhlukkecilyangmemesonaitumeloncatloncatkecilingin
terbang.Araimembelaiseranggakecilitu,menggenggamnyadengan
lembutlalumelemparkannyakeudara.
Ditiupanginkencangdiatastrukkumbangitumeregangkansayap
[Hamalan16dari168]

|
AndreaHirataSangPemimpi
sayapnya,mengapungsebentar,berputarputarseolahmerayakan
kemerdekaannyalalumelesatmenembusrimbundedaunankemangdi
tepijalan.LaluAraimelangkahmenujudepanbaktruk.laberdiritegakdi
sanaserupaorangberdiridihidunghaluankapal.Pelanpelania
melapangkankedualengannyadanmembiarkananginmenerpawajahnya.
Iatersenyumpenuhsemangat.Agaknyaiajugabertekadmemerdekakan
dirinyadaridukamengharubiruyangmembelenggunyaseumurhidup.Ia
telahberdamaidengankepedihandansiapmenantangnasibnya.Jahitan
kancingbajunyayangrapuhsatupersatuterlepashinggabajunya
melambailambaisepertisayapkumbangsagutadi.Iamenggoyanggoyang
tubuhnyabakrajawalidiangkasaluas.
"Dunia...!!Sambutlahaku...!!Iniaku,Arai,datanguntukmu...!!"Pastiitu
maksudnya.
Ayahkutersenyummengepalkantinjunyakuatkuatdanakuingintertawa
sekeraskerasnya,tapiakujugainginmenangissekeraskerasnya

[Hamalan17dari168]

|
AndreaHirataSangPemimpi
Mozaik3
TheLoneRanger

AkudanAraiditakdirkansepertisebatangjarumdiatasmejadanmagnet
dibawahnya.Sejakkecilkamimelekatkesanakemari.Akusemakindekat
dengannyakarenajarakantaraakudanabangpangkuanku,abangku
langsung,sangatjauh.Araiadalahsaudarasekaligussahabatterbaik
buatku.Danmeskipunkamiseusia,ialebihabangdariabangmanapun.Ia
selalumelindungiku.Sikapitutecermindarihalhalpalingkecil.Jikakami
bermainmelawanbajaklautdiSelatMalakadanakusebagaiHangTuah,
makaiaadalahHangLekir.DalamsandiwaramemerangikaumQuraishi
padaacaradibalaidesa,akuberperanselakuKhalifahAbuBakar,Arai
berkerasinginmenjadipanglimabesarHamzah.JikaakuBatman,iaingin
menjadiRobinataupalingtidakmenjadikelelawar.Jikadikampunganak
anakbermainmemperebutkankapukyangbeterbangandaripohonnya
sepertihujansalju,Araiakanmenjulangkudipundaknya,sepanjangsore
berputarputardilapangantakkenallelah,takpernahmaukugantikan.la
mengejarlayanganuntukku,memetikbuahdelimadipuncakpohonnya
hanyauntukku,mengajarikuberenang,menyelam,danmenjalinpukat.
Seringbanguntidurakumenemukankuaci,permengulamerah,bahkan
mainankecildaritanahliatsudahadadisakubajuku.Araidiamdiam
membuatnyauntukku.
DansepertikebanyakananakanakMelayumiskindikampungkamiyang
ratarataberanjakremajamulaibekerjamencariuang,Arailahyang
mengajarikumencariakarbanaruntukdijualkepadapenjualikan.Akarini
digunakanpenjualikanuntukmenusukinsangikanagarmudahditenteng
pembeli.Diajugayangmengajakkumengambilakarpurun(perduyang
tumbuhdirawarawa)yangkamijualpadapedagangkelontonguntuk
mengikatbungkusterasi.Waktuitukamiinginsekalimenjadicaddydi
padanggolfPNTimahtapibelumcukupumur.KamimasihSMP.Untukjadi
caddy,palingtidakharusSMA.SejakmelihataksiAraidibaktrukkopra
tempohari,akumengertibahwaiaadalahpribadiyangistimewa.
Meskipunperasaannyatelahluluhlantakpadausiasangatmudatapiia
selalupositifdanberjiwaseluaslangit.Mengingatmasalalunyayangpilu,
akukagumpadakepribadiandandayahidupnya.Kesedihanhanyatampak
padanyaketikaiamengajiAlQur'an.Dihadapankitabsuciituiaseperti
orangmengadu,sepertiorangyangtakluk,sepertiorangyangkelelahan
berjuangmelawanrasakehilanganseluruhorangyangdicintainya.Setiap
habismagribAraimelantunkanayatayatsuciAlQur'andibawah
temaramlampuminyakdansaatituseisirumahkamiterdiam.Suaranya
sekeringranggasyangmenusuknusukmalam.Rataplirihnyamengirisku,
menyeretkukesebuahgubukditengahladangtebu.Setiaplekukantajwid
[Hamalan18dari168]

|
AndreaHirataSangPemimpi
yangdilantunkanhatimudaituadalahsayatkerinduanyangtak
tertanggungkanpadaayahibunya.
JikaAraimengaji,pikirankulekatpadaanakkecilyangmengapitkarung
kecampang,berbajusepertipercadengankancingtaklengkap,berdiri
sendiriandimukatanggagubuknya,cemasmenungguharapan
menjemputnya.JikaAraimengaji,akubergegasmenurunitanggarumah
panggungkami,kemudianberlarisekuattenagamenerabasilalangmenuju
lapanganditepikampung.Ditengahlapanganituakuberteriaksejadi
jadinya.

Karenaberkepribadianterbuka,memilikimentalitasselaluingintahudan
terusbertanya,Araiberkembangmenjadianakyangpintar.laselaluingin
mencobasesuatuyangbaru.
"Oh,amboi,Ikal...tengoklahini!Modelrambutpalingmutakhir!Aiiihhh....
ToniKoeswoyo,rambutbelahtengahnyaitu!Elokbukanbuatan!Lihatlah,
Kal,semuapemainKoesPlusrambutnyabelahtengah!"
DemikianhasutanAraisambilmengagumifotoKoesPlusdisampulbuku
PKKnya.latelahmenerapkanbelahtengahseminggusebelumnyadantak
sedikitpunkulihatnilaitambahpadawajahnya.TapikarenaAraimemang
diberkahidenganbakatmenghasut,makaakutermakanjuga.Ketika
becermin,akusempattakkenalpadadirikusendiri.Akugugupbukan
mainsaatpertamakalikeluarkamardengangayarambutToniKoeswoyo
itu.Akuberdirimematungdiambangpintukarenaabangabangku
menertawakanakusampaibergulingguling.
"Hahaha!Lihatlahorangoranganladang!!"ejekmerekabersahutsahutan
sepertisegerombolanlutungberebutketelarambat.Rasanyaakuingin
kaburmasukkembalikekamar.Akutakmenyalahkanmerekakarenaaku
memangmiriporangoranganladang.Rambutkuyangikal,panjang,dan
tipisketikadibelahtengahlepekdiatasnyanamunujungujungnyajatuh
melengkunglentikdiataspundakku.Persisekorangsa.Akumenyesal
telahmengubahsisirankudandiambangpintukamarituakudemam
panggungsebelummemperlihatkanpenampilanbarukupadadunia.Tapi
padasaatakuakanmelangkahmundur,Araisertamertamenghampiriku.
"Jangantakut,Tonto...,"iamenguatkanakudengangayaLoneRanger.
Araimenggenggamtangankuerateratdanmenuntunkudengangagah
beranimelewatiruangtengahrumah.DalamdukunganArai,akutak
sedikitpungentarmenghadapibadaicemoohan.Papanpapanpanjang
lantairumahberderakderakketikakamiberduamelangkahpenuhgaya.
Demikianlah,artiAraibagiku.MakasejakAraitinggaldirumahkami,tak
kepalangsenanghatiku.Akusemakingembirakarenakamidiperbolehkan
menempatikamarhanyauntukkamiberdua.Walaupunkamarkami
hanyalahgudangperegasan,jauhlebihbaikdaripadatidurditengah
[Hamalan19dari168]

|
AndreaHirataSangPemimpi
rumah,bertumpuktumpuksepertipindangbersamaabangabangkuyang
kuli,baukeringat,danmendengkur.
Peregasanadalahpetipapanbesartempatmenyimpanpadi.Orangtuaku
dansebagianbesarorangMelayuseangkatanmerekademikiantrauma
padapendudukanJepangmakadisetiaprumahpastiadaperegasan.Padi
didalamperegasansebenarnyasudahtakbisalagidimakankarenasudah
disimpanpuluhantahun.Saatiniperegasantaklebihdarisurgaduniabagi
bermacammacamkutudankeluargatikusberbulukelabuyangturun
temurunberanakpinakdisitu.Namun,jangansekalisekalimembicarakan
soalperegasan.Iniperkarasensitif.Jikasedikitsajakamimenyinggung
soal
peregasan,misalnyakenapapadilapukitutakdibakarsaja,makaibuku,
sambilbersungutsungut,akanmelantunkansabdarutinnyayang
membuatkamibungkam.
Preambul:"Kaliantaktahuapaapasoalkesulitanhidupkecualikalian
hidupdizamanJepang."
Latarbelakangmasalah:"Pernahkahkalianmelihatkaumpriabercelana
karunggonisehinggakulitnyakerassepertikulitbeduk?Aiii...."
Kesimpulan:"Padiituakantetapdisitu.Melihatkeadaannegarasekarang,
bisabisaJepangdatanglagi!!"
Rekomendasi:"MakaBujangbujangku,daripadakaupusingkansoalpadi
itu,lebihbergunahidupmujikakaupetikkanakudaunsirih!!"
ParaorangtuaMelayutahupersisbahwapadididalamperegasansudah
takbisadimakan.Namun,bagimerekaperegasanadalahmetafora,
budaya,danperlambangyangmewakiliperiodegelapselamatiga
setengahtahunJepangmenindasmereka.Ajaibnyasangwaktu,masalalu
yangmenyakitkanlambatlaunbisamenjelmamenjadinostalgiaromantik
yangtakingindilupakan.

[Hamalan20dari168]

|
AndreaHirataSangPemimpi
Mozaik4
BiolaNurmi

Soreyangindah.Perkebunankepalasawitdikakigunungsebelahtimur
kampungkamisepertigarispanjangyangmembelahmatahari.Bagian
bawahnyamenyingsingkanfajardinegerinegeriorangberkulitpucatdan
sisasetengahdiatasnyamenyemburkanlazuardimerahmenyalanyala.
Danpadamomenyangspektakulerituakutengahmembicarakan
persoalanyangsangatseriusdenganAraimelaluitelepon.Kami
membahaskerusakanlingkungankarenaulahPNTimahdanjumlahganti
rugiyangakankamituntutkarenatanahulayatkamirusakberantakan.
"Tigamiliaruntukairminumyangtercemarphyrite,empatmiliaruntuk
risikokontaminasiradioaktif,tujuhmiliarkompensasibebanpsikologis
karenakesenjangansosial,danduamiliaruntukhancurnyahabitat
pelanduk,"usulAraiberapiapi.
Akududuksantaidiatastalangmendengarkanusulannyamelaluipesawat
teleponkalengsusuBenderayangdihubungkandengankawatnyamuk.
AraimeneleponkumelaluikalengBotan,posisinyadikandangayam.
Saatitulahseorangwanitagemukberjilbabyangmatanyabengkak
memasukipekarangan.WanitamalangsetengahbayaituMakCik
Maryamah,datangbersamaputrinyadansepertiibunya,matamereka
bengkak,semuanyahabismenangis.
AkudanAraiberlarimenujuMakCiktapiibukulebihdulumenghampiri
mereka.
"Kakak...,"MakCikmemelas.
"Kalaumasihadaberas,tolonglahpinjamikami...."
AirmataMakCikmeleleh.Kesusahanseakantercetakdikeningnya.Lahir
untuksusah,demikianstempelnya.Putrinyayangterkeciltertidurpulas
dalamdekapannya.Yangtertua,Nurmiyangkurustinggikuranggiziitu,
barukelasduaSMP,samadengankudanArai,tampaktertekanbatinnya.la
memelukeratsebuahkoperhitamlusuhberisibiola.Diaseorangpemain
biolaberbakat.Inginmenjadimusisi,itulahimpianterbesarnya.Bakatdan
biolaitudiwarisinyadarikakeknya,ketuagambuskampungkami.

SudahtigakaliMingguiniMakCikdatangmeminjamberas.Keluargakami
memangmiskintapiMakCiklebihtakberuntung.latakberdayakarena
taklagidipedulikansuaminya,antaralainkarenaiahanyabisamelahirkan
anakanakperempuanitu.
IbukumemberiisyaratdanAraimelesatkegudangperegasan.Ia
memasukkanbeberapatakarberaskedalamkarung,kembalike
pekarangan,memberikankarungberasitukepadaibukuyangkemudian
melungsurkannyakepadaMakCik.
[Hamalan21dari168]

|
AndreaHirataSangPemimpi
"Ambillah...."
MakCikmenerimanyadengancanggungdanberathati.Akutaksampai
hatimelihatnya.Iaberkataterbatabata,"Tak'kanmampukami
menggantinya,Kak...."
LaluMakCikmenatapNurmi.Wajahnyamenanggungkanperasaantak
sampaihatinamunbeliaubenarbenartakpunyapilihanlain.
"Hanyabiolainimilikkamiyangmasihberharga,"ucapnyapedih.
Nurmimemelukbiolanyakuatkuat.Airmatanyamengalir.Iatakrela
melepaskanbiolaitu.
"Nurmi...,"panggilibunya.
Nurmiberupayakerasmenguatnguatkandirinya.Iamendekatiibuku.
Langkahnyaterseretseretuntukmenyerahkankoperbiolanya.Air
matanyaberuraiurai.
IbukutersenyummemandangiNurmi.
"JangansekalikalikaupisahkanNurmidaribiolaini,Maryamah.Kalau
berasmuhabis,datanglagikesini."
Nurmicepatcepatmenariktangannyadankembalimemelukbiolanya
kuatkuat.latersedusedan.KamimengiringiMakCikkeluarpekarangan
danmemandangianakberanakituberjalanmenjauh.Nurmimelangkah
palingcepatmendahuluiibudanadikadiknyaseakaniainginsegera
pulangmenyelamatkanbiolanya.
MataAraiberkacakacamelihatMakCikbergandengantangandengan
anakanaknyasambilmenentengsetengahkarungberas.Laluakuheran
melihatekspresiArai.Sulitkuartikanmaknaairmukanya:dingin,datar,
dangundah.Kulihatketidakpuasan,adajugakilatankemarahan.Lebihdari
itu,kulihatsebuahrencanayanganeh.Instingkumengabaribahwasesuatu
yangdramatispastisedangberkecamukdalamkepalamanusianyentrik
ini.
Benarsaja,tibatibaAraimembantingteleponkalengbotandan
menyeretkukegudangperegasan.Akuterbengongbengongmelihat
tingkahArai.Ibukusibukmenggulungkabelteleponyangkami
campakkan.AkusemakintakmengertiwaktuAraibergegasmembuka
tutupperegasan,mengambilcelenganayamjagonya,dantanparagu
menghempaskannya.Uanglogamberserakandilantai.Napasnya
memburudanmatanyananarmenatapkusaatiamengumpulkanuang
koin.Iatakmengucapkansepatahkatapundanpadadetikituaku
langsungterperangkapdalamundanganganjildarisorotmatanya.Seperti
tersihirakutergodapadaberbagaikemungkinanyangditawarkan
kelakuansintingnya.Tanpaberpikirpanjangakumenjangkaucelenganku
didasarperegasandanmelemparkannyakedinding.Akuterpanamelihat
koinkointabungankuberhamburan,barukaliiniakumemecahkanayam
jagodaritanahHatitu.
[Hamalan22dari168]

|
AndreaHirataSangPemimpi
Araiterkekeh.Akutaktahuapayangtelahmerasukiku.Akujugataksecuil
puntahuaparencanaArai.YangkutahuadalahAllahtelahmenghadiahkan
karismayangbegitukuatpadasangSimpaiKeramatinimungkinsebagai
kompensasikepedihanmasakecilnya.Hanyadenganmenatap,iamampu
menguasaiku.Ataumungkinjugaakubertindaktololkarena
persekongkolankamisudahmendarahdaging.
"Kumpulkansemua,Ikal!!"perintahnyabersemangat."Masukkankedalam
karunggandum."Koinkoinituhampirseperempatkarunggandum.
'Ayoikutaku,cepat!!Pakaiduasepeda!!"Kamiberlarimenujusepeda
sambilmenentengkarunggandumyangberatgemerincing.Kelakuankami
persisperampokteleponkoin.Araimengayuhsepedasepertiorang
menyelamatkandiridariletusangunungberapi.Diluarpekarangania
menikungtajamdalamkecepatantinggi.Akupontangpanting
mengikutinyadenganhatipenasaran.Yangterpikirolehkukamiakan
menghibahkantabungankamiuntukMakCik.MengingatkesulitanMak
Cik,akutakkeberatan.Tapiketikasepedamelewatiperempatan,Arai
berbelokkekiri.Akutersengalsengalmemanggilnya.
"Rai!!Maukemana??!!"JikainginkerumahMakCik,seharusnyaiabelok
kanan.
"Akutahu,Kal.Ikutsaja!!"Makalayarpundigulungdandramadimulai.
Araingebut,sepedanyaterpantulpantuldiatasjalanpasirmeluapkan
debuberwarnakuning.Akuzigzagdibelakangnyauntukmenghindari
debu.AkuterheranheranpadakelakuanAraitapimenikmatiketegangan
pengalamanhebatini.Duaorangbersepedaberiringankejarmengejar
dengankecepatantinggisambilmembawakarunguang.Bukankahkami
sepertiburonandifilmfilm?
Araijelassedangmenujukepasar.Takdapatkudugaapamaksudnya.
BegitulahArai,isikepalanyatak'kanpernahdapatditebak.Didepantoko
ASiongiaberhenti.Diaturundarisepedadanmenghampirikuyang
kehabisannapas.lamengambilkarunguangyangsedangkusandang.
Sambilmengumbarsenyumtengiknyadiamengedipkansebelahmata
sembarimengeluarkansuara"khekkh!!"persistekukurdilindastruk.
LangkahnyapastimemasukitokoASiong.Akuwaswasmengantisipasi
tindakannya.Akutakrelauangjerihpayahberjualantalipurunitu
dihamburkannyauntukhalyangkonyol.Perludiketahui,untukmenebas
purunharusberendamdalamrawasetinggidadadenganrisikoditelan
buayamentahmentah.TapisepertibiasanyaAraiselalumeyakinkan.
Lihatlahekspresidangayanyaberjalan.Akuterhipnotisolehkekuatan
kepercayaandirinya.Akusepertikerbaudicucukhidung,digiring
kepejagalanpunmanutsaja.Bahkanhanyauntukbertanyamulutku
telanjurkelu.Kamimemasukitokoyangsesak.Barangbarangkelontong
berjejaljejaldirakrakyangtinggi.Araiberhentisebentarditengahtoko
[Hamalan23dari168]

|
AndreaHirataSangPemimpi
persisdibawahsebuahfanbesarberdiameterhampirduameterdan
berputarsangatkencang:wuttth...wuttth...wutttthh.IstriASiongbesardi
Hongkong.Hanyafanuntukpabrikituyangmembuatnyabetahtinggaldi
Belitongyangpanas.Araimembukakancingatasbajunya,menengadahkan
wajahnya,danketikaanginfanmembasuhwajahnyayangbersimbah
peluhiaterpejamsyahdu,sebuahgayayangsangatmengesankan.

LaluiamenghampiriistriASiong.Nyonyainisedangmengepangrambut
putrinya,MeiMei.Siapapunyangmelihatgadiskeciliniakansegera
teringatpadatofu.Merekaberduagendutgenduttapicantik.
"Prranggggg!!!"
Araimenumpahkanisikarunggandumtadidiatasmejakaca.Nyonya
Tionghoayangpunyanamasangatbagusitu:DeborahWongmelompat
terkejutmelihatuanglogammembukitsepertitumpeng.
"Ayya...ya...ya...Lui...!!"
IbumertuaNyonyaDeborahyangberumurhampirseratustahundan
sedangdudukjugaterkejut.Nenekinitakpernahtersenyum.Bajunya,
kulitnya,rambutnya,alisnya,gusinyayangsudahtakditenggerisebijipun
gigi,dankucingnya,semuanyaberwarnakelabu.Murung.Itulahkesan
keseluruhandirinya.Agaknya,iamelaluiharidemiharidipenuhiperasaan
muak.Wajahnyaselalukesalmengapamalaikatmauttakkunjung
menjemputnya.Iataktertariklagidengankehidupan.Mendengar
gemerincingkoinyangribut,iamerasaterganggu,mukanyamenyeringai
marah.
"Nyah...,"seruAraipadaNyonyaDeborah.Santundanberwibawa,seolah
iaakanmemborongseluruhisitokodengankoinkoinitu.
"Terigu10kilo,gandum10kilo,gula...."Akuterkejuttakkepalang.
"Rai!Apaapaanini?!"
"Untukapasegalaterigu...."Tangkas,Araimenekanjarinyadiatas
mulutku.
"Sstttt!!Diam,Kal."
"Nyah,janganlupaminyak...."Kutepistangannyadenganmarah,Arai
tersentak.
"Diamlah,Ikal.Lihatsaja...."Langsungkupotong,"Kemanapikiranmu,
Rail!Sudahsetahunlebihkitamenabung!!"
"Tong!Tong!Tong!!Tong!Tong!!"SangibumertuaNyonyaDeborah
menamparnamparkanpiringkalengtempatmakanankucing,menyuruh
kamidiam.
"Sabar,Kal.Nan...."
"Takadasabar!!"
"Inipenting,Kal.Bahanbahaniniakan...."
"Takadapenting!!Lupakahkauuntukapakitasusahpayahmenabung??!!"
[Hamalan24dari168]

|
AndreaHirataSangPemimpi
Araimarahkarenaalasannyakupotongterus.Diageramkarenaakutak
maumendengarpenjelasannya.
"YaTuhan,janganlagiakudipertemukandenganorangini!!!"
Akumelompatmenujutumpukankoin,membukakarunggandumdan
merauppermukaanmejauntukmelungsurkankoinkoinitukembalike
dalamkarung.Araitaktinggaldiam.Disambarnyatangankudan
dikekangnyatubuhkudaribelakangsepertipegulattradisionalIran.
Terjaditarikmenarikyangserumemperebutkangununganuangkoin.
Mejakacabergoyanggoyanghebat.NyonyaDeborahterperanjatmelihat
pergumulangayakoboiditokonya.
"Tagem!!!Taggeeeeeem!!"
NyonyaDeborahmenjeritketakutanmemanggilmanggilTagem,kulinya.
KuliSawangitutengahbersandarkelelahanmengipasidadanyadengan
sobekankardusdipokokpohonseridimukatoko.Lalulalangkendaraan
menelanteriakanNyonyaDeborah.AnehnyaputrikecilMeiMeijustru
senangbukanmainmelihatkamiberaduotot.lacekikikan,bertepuk
tangan,daniajelasmemihakku.Tanpapedulidudukperkaranya,anak
kecilpastiakanmemihakorangyangberpenampilanlebihapik.Bagianak
TKitu,akuyangberkulitlebihterangdankeritingadalahjagoannya,
pangeranpenumpaskejahatan.BentukrahangAraiyanganehpastitelah
membuatnyamendugakalauAraipenjahat.
"Ayo,AbangKeliting,sepak!!Sepak!!Kik...kik...kik...hi...hi...sepak!!
Tendangpelutnya!!"
AdutenagasemakindahsyatkarenaAraiberhasilmengekangkedua
tanganku.Iaunggulkarenabadannyalebihbesar.Iamemitingkudari
belakangdanmemepetkantubuhkukelemaridagangantembakau.Aku
menguikketikaterjajarmenghantamlemariitu.

MeiMeisemakingirang.Gadiscilikyangtakkenaltakutitunaikkeatas
meja.Ibunyahilirmudikketakutan.
"Ayo,tinju,Bang.Taliklambutnya...."
AkudanAraiberusahasekuattenagasalingmengalahkan.MeiMeiyang
gendutberlarilaridiatasmejasepertiwasittinju.Mulutnyaberkicau
kicautakkeruan.
"Saudalasaudala,datanglahbelamailamai!!Inilahpeltandinganantala
pendekalkelitingmelawan...."
MeiMeiterdiammenatapArai.Kamijugaterdiam,serentakmenoleh
padanya.Denganekspresilugunya,putrikecilitumengamatiwajahArai
laluiaberteriakngeri,"Dlakulaaaaaaa...!!!"
Araitersinggungberatdanmenumpahkankekesalannyapadaku.Ia
menjepitleherkudengantekukansikunya.Tapisepertikucingyang
dimasukkankedalamkarung,akumemberontaksejadijadinya.Ibu
[Hamalan25dari168]

|
AndreaHirataSangPemimpi
mertuaNyonyaDeborahmemakimakinamunanehnyakemudiania
tertawa.Pek!!Pek!!Pek!!Pek!!Pek!!Iabertepuktangandenganpinggan
kalengtadisepertiorangmaintamborin.Iamenunjuknunjukakusambil
mengepalkantinjunya,kakinyamenyepaknyepak.Beliaujelasmemihak
Arai.
Karenamendapatdukungan,Araisemakinberingas.Iamendorongkuke
lemaritembakau.Sebaliknya,akusemakinliarmelawannya.Raktembakau
yangterbuatdaribatanganbesisetinggitigameterdenganberatratusan
kilomulaibergoyang.Jikarakinitumbang,seisitokobisacelaka.
"Tageeeeeeeeemmm!!PuikTageeeeeemmmmm!!!"
NyonyaDeborahberteriakhisteris.Karenapanik,NyonyaDeborah
terpaksamemakaikatapuik,sebuahmakiandalambahasaSawang.Tagem
masihtenangtenangsaja.lamalahmelambailambai,menggodairingan
wanitapenjagatoko.Sebaliknya,melihatpertarungansemakindahsyat,
MeiMeigirangtakkepalang.lamenjeritjeritsepertiburungprigantilyang
dicabutibulunya.
"Ayo,AbangKeliting,sepak!!Tinju!!"
Semangatkuterpompa.Akumerasamemilikitenagaekstrasebabaku
yakinsedangmembelakebenaran.Akumerontasejadijadinyadari
kuncianArai,menggelinjangsepertibelutsehinggalemariraksasaitu
limbungdantibatiba....
Shrrrookkkk...braggghhh...brruukkkk!!!Brruukkkk!!!Brruukkkk!!!
Tigakarungkertasyangberisikapukberjatuhandariraklemaritembakau.
Karungkarungitupecahberantakandangumpalangumpalankapukyang
berbentuksepertiawanterhamburmemenuhilantai.Lalutampakolehku
pemandanganyangmenakjubkankarenafanbesarditengahruangan
mengisapkapukdiataslantaidanribuanawanawanputihkecil
berdesinganmelingkarnaikkeatas,indahdanharmonismembentuk
spiralsepertiangintornado.
MeiMeiterpanamelihatpemandanganajaibitu.Mulutmungilnyayang
daritadiberkicaukiniterkuncilalupelanpelanmengangasepertiikan
maskoki.latertegunsaatpusarankapasitumajumundurmendekatinya.
Matabulatbuahhamlamnyabersinarsinarseakaniamelihatsesosok
malaikatyangbesar,tampan,danbersayapmelayanglayangingin
memeluknya.MeiMeipucatpasikarenaterpukaudalamketakutanyang
indah.
PinggankalengyangtengahdigenggamibumertuaNyonyaASiong
terjatuhtanpadisadarinyalalubergulinggulingketengahruangantoko.
NyonyaDeborahsendiriberhentiberteriak.Wutthh...wutthh...wutthhhh
suarafanbesarmenggulungsetiapgumpalankapuksepertijutaankunang
kunangyangserentakberanjak.
Araimelepaskankunciannyadaritubuhku.Iamenengadah.
[Hamalan26dari168]

|
AndreaHirataSangPemimpi
"Subhanallah...."
"SubhanallahIkal,lihatlahitu...."
Kepalakuberputarputarmengikutikisaranangintornadoawanawan
kapukyangterkumpulkeatasdanterapungapungmemenuhiplafon
sehinggatokokelontongitusepertiberadadiatasawan,sepertihanyutdi
langit.Semuaorangyangadadidalamtokobungkamkarenaterperangah.
Kamimemandangilangitlangittokoyangdipenuhikapuksepertiawan
yangrendah.
PemandangansemakinsensasionalketikaNyonyaDeborahmematikanfan
dansaatitupulaawanawankecilituberjatuhan,melayanglayangdengan
lembuttanpabobot.
MeiMeiberteriakteriakgirangsambilmelompatlompat,"Hujan
saljuuuuuuu...."
MeiMeimenangkapawanawankecilyangberjatuhan.Ibunya
menghampirianaknya,memeluknya.Merekamenariberputarputardi
bawahhujansalju.AkudanAraibersandarkelelahan.Dibawahhujansalju
yangmemesonapertikaiankamitelahberakhirdengandamai.
"Arai,kitamemerlukantabunganitu."
"Akutakpunyabanyakwaktu,Kal...."
"Nantikujelaskan.Ikutisajarencanaku,percayalah...."
AkumenatapmataAraidalamdalam.Diamemanganehtapiakutahutak
adabibitculasdalamdirinya.DiluarkamilihatTagemberjalangontai
memasukitoko.Diambangpintuiaberteriak,"PuikTagem!!"laterkejut
melihattokotelahkacaubalaudanmenjadiputih,sementarajuragannya
bersukariabermainmaindibawahhujankapukdanmertuaNyonya
Deborahbertepuktangandenganpiringkaleng.

Kamikembalibersepedadengantergesagesa,meliukliukmembawa
karunggandumdanterigu.DiperempatanAraibelokkiri.Akumasihtak
mengertimaksudAraiwaktuiamemasukipekaranganrumahMakCik
Maryamah.Kamimasukkedalamrumahyangsenyap.Daridalamkamar,
sayupterdengarNurmisedangmenggesekbiola.Araimenyerahkan
karungkarungtadipadaMakCik.Beliauterkagetkaget.Laluakutertegun
mendengarrencanaArai:denganbahanbahanitudimintanyaMakCik
membuatkuedankamiyangakanmenjualnya.
"Mulaisekarang,MakCikakanpunyapenghasilan!"seraAraibersemangat.
MataMakCikbarkacakaca.Seributerimakasihseolahtak'kancukup
baginya.
TubuhkuyangdaritadikakukarenategangmengantisipasirencanaArai
kinipelanpelanmerosotsehinggaakuterdudukdibalikdaunpintu.Aku
menundukdanmemeluklututkuyangtertekuk.Akumerasasangatmalu
padadirikusendiri.Bibirkubergetarmenahanrasaharupadaputihnya
[Hamalan27dari168]

|
AndreaHirataSangPemimpi
hatiArai.Airmatakumengalirpelan.SungguhtaksedikitpunkudugaArai
merencanakansesuatuyangsangatmuliauntukMakCik.Sebuahrencana
yangakankudukunghabishabisan.Sejakitu,akumengenalbagianpaling
menarikdariArai,yaituiamampumelihatkeindahandibaliksesuatu,
keindahan
yanghanyabiasaorangtemuididalammimpimimpi.MakaAraiadalah
seorangpemimpiyangsesungguhnya,seorangpemimpisejati.Dansejak
itu,kaminaikpangkatdaripenebasakarbanardanpencabutrumpun
purunmenjadipenjualkuebasah.Karenasasaranpasarkamiadalah
orangorangbersarung,makakamiberjualandariperahukeperahu.Jika
adapertandingansepakbola,kamiberjualandipinggirlapanganbola.
Penghasilansebagaipenjualkuerupanyajauhlebihbaikdaripenjualakar
banar.Yangpalingmenggembirakan,MakCiktakperlulagimeminjam
beraskemanamana.Bertahuntahunberikutnyakamibergantidarisatu
profesikeprofesilainuntukmembantunafkahorangtua.
Ketikakeluardarikamarnya,Nurmiterkejutmelihatkarungkarung
gandumdantepungterigu.DaniaterhenyakmendengarrencanaArai.
Wajahnyasembap,namunAraisertamertamenghiburnya.
"Adinda,sudikahmembawakansebuahlaguuntukAbang?"
Nurmitersenyum.
"'JuwitaMalam'.Abanginginlagu'JuwitaMalam'."
Kamimengambiltempatdudukdidapuryangkumalitu,siapmenyimak
Nurmi.Dansoreyangsangatindahitusemakinmemesonakarenagesekan
syahdubiolaNurmi.Merindingakumendengarjeritanpanjangbiolayang
meliukliukpilu,jauh,dalam,dantegar.Nurmimembawakannyadengan
sepenuhjiwaseakanAraiadalahpahlawankeluarganyayangbaruturun
daribulan.

Juwitamalum,siapakahgeranganpuan
Juwitamalam,daribulankahpuan....
[Hamalan28dari168]

|
AndreaHirataSangPemimpi
Mozaik5
TuhanTau,tapimenunggu

AkudanAraiberuntungsempatmelihataksinya.Ketikaitukamimasih
kelasempatsekolahdasar.lasungguhsungguhpriatuajempolan.APut
namanya,terpesonaakudibuatnya.Waktuituakumenganggapnya
manusiapalinghebatketigadiduniainisetelahayahkudanseoranglaki
lakiberjanggutlebat,senangmemakaijubah,bermatasyahdumeradang
yangtinggaldiJakartadanmenciptakanlagumerduberjudul"Begadang".
KamimerasaberuntungsempatmenyaksikankepiawaianAPutsebab
ketikaiawafatilmunyaterkuburbersamadirinya.Takadayang
mewarisinya.AnakcucunyamalahmalumembicarakanilmuunikAPut
yangmungkinhanyadikuasainyasendirisejagatrayaini.
SiangituAPutduduksantaimengisapcangklong.Sarungbawahannya,
kauskutangbajunya,sandaljepitalaskakinya,tujuhpuluhtahunusianya.
Pasiennyanongkrongmeringisringispersisanakanakkucingterceburke
kolamkangkung.APutadalahdoktergigikampungkami,dukungigilebih
tepatnya.Mengakumendapatilmunyadariperitempayan,lakilakiHokian
itusungguhsaktimandraguna.NamanyakondangsampaikeTanjong
Pandan.Bagaimanatidak,iamampumenyembuhkansakitgigitanpa
menyentuhgigibusukitu.Bahkantanpamelihatnya.Alatdiagnosisnya
hanyasepotongbalok,sebilahpalu,dansebatangpaku.Ruangpraktiknya
adalahlingkarteduhdaunpohonnangkadaniahanyaberpraktik
berdasarkansuasanahati.Gigigiginyasendiritonggoshitamhitam.
"Ini?Inikatamu!Aya,ya...tololsekali!Yangbetul!Ini?Disini?Yakin?"
BegitupertanyaanAPutpadapasiennya.Iamenggerusgeruspermukaan
balokdenganujungpaku,mencaricarisatutitikposisigigiyangsakit.
Makabalokituadalahrepresentasigusiorang.Hebatluarbiasa.Sang
pasienmerasaseakansebuahbendabergerakgerakdalammulutnya,
merabasetiapgiginya.Ini
adalahkomunikasitelepatikantarasepotongbalok,sebatangpaku,
seorangdukunnyentrik,dansebuahtekakbusuk.Jikabendaimajineritu
terasamengenaigigiyangsakit,sangpasienberteriak,"Yah...hooh,hooh!!
Disitu!!"
APutsertamertamemukulkepalapakudengankeras,
menghunjamkannyakedalambalokdandetikitupulabyarrr!
Abrakadabra!Simsalabim!Taktahukarenacampurtanganjin,ilmuhitam,
berkahsajenpadarajasetan,atausugesti,rasasakitpadagigiitudijamin
lenyapsaatitujuga,menguapsepertidompetketinggalandistasiun,aneh
bintiajaib!!Takadasebijipunobat,bahkantakperlumembukamulut!
SuatuketikaantreanpasienAPuttelahmelampauipagarkandang
babinya.ParatetuaMelayukasakkusukdanpagipagisekaliesoknya
[Hamalan29dari168]

|
AndreaHirataSangPemimpi
merekamengantarsenampanpulutpanggang.
"Selamat,DokterAPut.Pimpinlahkampungini,semogasejahtera,
Kawan...."
JikaAPutmemakanpulutpanggangitu,makasaatitupulaiadilantikjadi
kepalakampung.Demikianlahprosesidikampungkami,sangatfungsional.
Jikahujanberkepanjangan,pawanghujanakanmendapatkirimanpulut
panggang.Jikabuayamulainakal,makadukunbuayadinobatkanjadi
kepalakampung.JikaanakanakMelayubanyaklahir,sangparaji,
penguasatalipusaritu,dipastikanjadiketuaadat.APutmendapat
kehormatanjadipresidenkampungkamikarenatahunitukasusborok
gigimelonjaktajam.
Kepemimpinanberdasarkanperintahalamituberakhirsampaiorang
orangPasaimembawaIslamkesukusukuMelayupedalaman.Paradukun
danpawangbangkrutpamornyadigantikanolehpenggawamasjid.
Belakangankamidikenalkanpadamodeldemokrasianehyangmungkindi
duniahanyaadadirepublikini.
PetinggidiJakartamenyebutnyaDemokrasiTerpimpin!Mengadaada
tentusaja.SejakitukampungkampungorangMelayudiserbumanusia
manusiakirimandariPalembang.Merekatakkamikenal,ratarata
bergelarB.A.Merekamenjadicamat,bupati,sampaiketuaKUA.Tapiitu
puntaklama.Segerasetelahmahasiswamengobrakabrikkejahiliahan
penyelenggaraannegara,kamidipimpinolehbumiputrayangdalam
pemilihandiwakiligambarjagung,pisang,dankacangkedelai.Para
mahasiswayanghebatitutelahmenebarkankenikmatandemokrasi
sampaijauhkepulaupulauterpencil.
SaatiniKacangKedelaimemimpinkampungkami.ladicintaidanberkuasa
karenalegitimasinyapenuh,dejurehanyadejure,sebabkenyataannya
penguasatertinggikampungkami,taklaintakbukan,defacto,takdapat
diganggugugat,tetaplahpenggawamasjid.Parapenggawamasjidsangat
disegani.Merekasepertitriaspolitika:TaikongHamimsangeksekutifatau
pelaksanapemerintahanmasjidseharihari,HajiSatarpembuataturan
sehinggasepertilembagalegislatif,danHajiHazaniselakuyudikatif.
Namun,dalampraktikmerekaadalahrobotrobotbudipekertiyang
menganggapbesipanasmerupakanalatyangsetimpaluntukmeluruskan
tabiatanakanakMelayuyangtelahterkorupsiakhlaknya.Merekakeras
sepertitembaga.Setelahpulangsekolah,janganharapkamibisa
berkeliaran.MengajidanmengajiAlQur'ansampaikhatamberkalikali.
DanjikasampaitamatSDbelumhafalJuzAmma,siapsiapsaja
dimasukkankedalambedukdanbeduknyadipukulkeraskerassehingga
ketikakeluarberjalanzigzagsepertiayamkeracunankepitingbatu.
Merekalebihkejamdariorangtuakamisebabmerekalahyangmengajari
orangtuakamimengaji.BahkanPakKetuaKacangKedelaitakberkutik
[Hamalan30dari168]

|
AndreaHirataSangPemimpi
padatriaspolitikakarenayangmenyunatbapaknya,dengankulitbambu,
adalahTaikongHamim.DalambudayaorangMelayupedalaman,siapa
yangmengajarimumengajidanmenyunatperkakasmuadalahpemilik
kebijakanhidupmu.
AkudanAraiseringdihukumTaikongHamim.Karenanapaskutakpanjang
kalaumengajipadasuatusubuhyangdingin,akudisuruhmenimbaairdan
mengisitongsampaipenuh,laluakudipaksamenyelamkedalamtongitu
membawajerikenlimaliter.Leherjerikenitukecilsekalidanakutakboleh
timbulsebelumjerikenitupenuh.Akumegapmegapdenganbibir
membirudanmatamaumeloncat.Arailebihparah.Karenaterlambatsalat
subuh,iadisuruhberlarimengelilingimasjidsambilmemikulgulungan
kasur.Kamiterpingkalpingkalmelihatnyaberlarisepertiorangkebakaran
rumah.

Dalamkancahkawahcandradimukamasjid,dibawahpemerintahantrias
politikaitulah,kamimengenalJimbron.Jimbrontaklancarberbicara.la
gagap,tapitakselalugagap.Jikaiapanikatausedangbersemangatmakaia
gagap.Jikasuasanahatinyasedangnyaman,iaberbicarasenormalorang
biasa.Jimbronbertubuhtambun.
SecaraumumiasepertibonsaikambojaJepang:bahulandai,lebar,dan
lungsur,gemukberkumpuldidaerahtengah.Wajahnyasepertibayi,bayi
yangmurung,sepertibayiyanginginmenangisjikamelihatnyalangsung
timbulperasaaninginmelindunginya.
Jimbronadalahseseorangyangmembuatkamitakjubdengantigamacam
keheranan.Pertama,kamiherankarenakalaumengaji,iaselaludiantar
seorangpendeta.Sebetulnya,beliauadalahseorangpastorkarenabeliau
seorangKatolik,tapikamimemanggilnyaPendetaGeovanny.Rupanya
setelahsebatangkarasepertiArai,iamenjadianakasuhsangpendeta.
Namun,pendetaberdarahItaliaitutaksedikitpunbermaksud
mengonversikeyakinanJimbron.Beliaumalahtakpernahtelatjika
mengantarkanJimbronmengajikemasjid.NasibJimbrontakkalah
menggiriskandenganArai.Dangagapnyaituberhubungandengansebuah
ceritayangmemilukan.Dulubicaranyanormalsepertianakanaklainnya.
Jimbronadalahanaktertuadaritigabersaudara.lamemilikiduaadik
kembarperempuan.IbunyawafatketikaJimbronkelasempatSD.Jimbron
sangatdekatdansangattergantungpadaayahnya.
Ayahnyaadalahorientasihidupnya.Suatuhari,belumempatpuluhhari
ibunyawafat,Jimbronbepergiannaiksepedadiboncengayahnya,masih
berkendaraayahnyaterkenaseranganjantung.KononJimbronpontang
pantingdengansepedaitumembawaayahnyakePuskesmas.laberusaha
sekuattenaga,panik,danjatuhbangunterseokseokmembonceng
ayahnyayangsesaknapassambilkesusahanmemeganginya.Sampaidi
[Hamalan31dari168]

|
AndreaHirataSangPemimpi
PuskesmasJimbron,anakkelasempatSDitu,kehabisannapasdanpucat
pasiketakutan.lakalut,taksanggupmenjelaskansituasinyapadaorang
orang.Lagipulasudahterlambat.
BeberapamenitdiPuskesmasayahnyameninggal.SejakituJimbrongagap.
PendetaGeovanny,sahabatkeluargaitu,lalumengasuhJimbron.Kedua
adikkembarperempuannyamengikutibibinyakePangkalPinang,Pulau
Bangka.

KeheranankamiyangkeduaadalahJimbronsangatmenyukaikuda.Kata
orangorang,iniberhubungandengansebuahfilmditelevisibalaidesa
yangditontonJimbronseminggusebelumayahnyawafat.Dalamfilmkoboi
itutampakseseorangmembawaorangsakituntukdiobatidengan
mengendaraikudasecepatanginsehinggaorangitudapatdiselamatkan.
BarangkaliJimbronmenganggapnyawaayahnyadapattertolongjikaia
membawaayahnyakePuskesmasdenganmengendaraikuda.
DikampungkamitakadaseekorpunkudatapiJimbronmengenalkuda
sepertiiapernahmelihatnyalangsung.Jimbronadalahpemudayang
mudahmengantuktapijikasedikitsajaiamendengartentangkuda,maka
telingalayunyasontakberdiri.Jimbronsegeramenjadipencintakudayang
fanatik.Iatahuteknikmengendaraikuda,asalmuasalkuda,danmengerti
maknaringkikankuda.IahafalnamakudaAbrahamLincoln,
namakudaNapoleon,bahkannamakudaSyaidinaUmarbinKhatab.
Denganmelihatgambarwajahkuda,ialangsungtahujeniskelamirmya.
TakadasatupunhallainyangmenarikdiduniainibagiJimbronselain
kuda.JikakamimenontonfilmZorrodiTVbalaidesa,makajangan
tanyakanpadaJimbronjalanceritanya.Iataktahu.Tapitanyakanjumlah
kudayangterlihat,berapakudahitamdanputih,bahkanberapakali
terdengarsuarakudameringkik,iaingatbetul.Jimbronterobsesipada
kuda,penyakitgilanomor14.
"Kud....Kudddaaaadd...addaalah...kendarrraanperrranggg,Kal!!
"He...he...hewanyang...mm...mmemenangkan...pph...ppe...pperrrang
Badarrrrrr...."
Iainginmelanjutkanceritanyatapikelelahanolehgagapnya.Semakinia
excited,semakinparahgagapnya.
Akuprihatinmelihatmukanya.Sebuahwajahyangmenimbulkanperasaan
inginselalumelindunginya.Polos,bersihsepertibayi.KudugaJimbrontak
'kanpernahtampaktuawalaupunnantiusianyatujuhpuluhtahun.
"BinatangyanggagahberaniBron,hebatsekali,akusetuju,"kuringankan
bebanhidupnyadenganmengakuibahwakudamemanghebat.Ia
sumringah.Takperlulagimeyakinkanakumeskipunsesungguhnyaaku
sudahsangatbosan.Jikaberjumpadengannya,takadaceritaselainkuda,
daripagisampaisore.
[Hamalan32dari168]

|
AndreaHirataSangPemimpi
"Kitatakbisasembarangandengankuda,bisabisakualat.Begitukan
maksudmu,Bron?"
Ah,Jimbronmenganggukangguk,tersenyumlebarsambiltersengal
menahankatayangterperangkapdalamkerongkongannya,terkuncidalam
gagapnya.Iamenatapkusaratarti:akusayangpadamu,Sahabatku.
Sungguhpenuhpengertian!
DansuatuhariTaikongHamimmarahbesarsebabdimejaJimbron
berserakangambarkudadantakadalembarkosongdibukuTPAnya
selainlukisankuda.Jimbrondisuruhmajuketengahmadrasah,
dipertontonkanpadaratusansantridandipaksameringkik.Matanyayang
lugu,tubuhnyayanggemukdanbahunyayanglungsurtampaklucuketika
tangannyamenekukdidadanyasepertibajing.Dankamidilanda
keherananketiga:Jimbronsenangbukanmaindenganhukumanitu.
MeskipunJimbrongembiradenganhukumanapapunyangberhubungan
dengankuda,bagikamiTaikongHamimtetapantagonis.Beliauselalu
menerjemahkanaturanHajiSatarsecarakakutanpaperasaan.Maka
dengansegalacara,kamiberusahamembalasTaikong.Otakpembalasan
initentusajaArai.Carayangpalingaman,sehinggapalingsering
dipraktikkanAraiadalahmengucapkanamindengansangattidak
tuma'ninah.Carainisebenarnyasangatketerlaluan,tapimaklumwaktuitu
kamimasihSDdanAraimemangmemilikibakatterpendamdibidang
nakal.SetiapTaikongHamimmenjadiimamsalatjamaahdantibapada
bacaanakhirAlFatihah:"Whaladdholiiiiiin...."
MakaArailangsungmenyambutdenganlolongansepertiserigala
mengundangkawin.
"Aaammmiiinnn...mmiiinn...mmiiiiiiiinnnnn...."

Araimeliukliukkansuaranyadanterangteranganmerobekrobek
wibawaTaikong.Suaranyayangnyaringdanparauberkumandangdengan
lucumembuyarkankekhusyukanumat.Kamitakbisamenahancekikikan
sampaiperutkaku.KejahataniniamanmenurutAraisebabTaikongtak
bisamenentukansiapapelakunyadiantararatusananakanakdisaf
belakang.DankamiselalukompakmelindungiArai.Menurutkami,caraini
adalahpembalasansetimpaluntukTaikong.
Namunlihatsaja,kejahatanini,belasantahunkemudianakandiganjar
TuhandengantunaimelaluicarayangsecuilpuntakterpikirkanolehArai.
TaikongHamimmemangtaktahutapiTuhanmencatatdanTuhanakan
membalas.SepertikataAntonChekov:Tuhantahu,tapimenunggu.

[Hamalan33dari168]

|
AndreaHirataSangPemimpi
Mozaik6
AkuHanyaInginMembuatnyaTersenyum

KarenadikampungorangtuakutakadaSMA,setelahtamatSMPaku,Arai,
danJimbronmerantaukeMagaiuntuksekolahdiSMABukanMain.Pada
saatitulahPNTimahBelitong,perusahaandimanasebagianbesarorang
Melayumenggantungkanperiukbelanganya,termasukayahku,terancam
kolaps.GelombangbesarkaryawandiPHK.LedakanPHKitu
memunculkangelombangbesaranakanakyangterpaksaberhentisekolah
dantakpunyapilihanselainbekerjauntukmembantuorangtua.
Anakanakyangkuattenaganyamenjadipendulangtimah.Seharian
berendamdidalamlumpur,mengadukadukaluvial,merabarabaurat
timahdibawahtanah,mempertaruhkankelangsunganhiduppada
kemampuanmendugaduga.Merekayangkuatnyalinyabekerjadibagian
tengahlaut.Pekerjaanberbahayayangberbulanbulanbarubisabertemu
keluarga.Merekayangkuattenagadankuatnyalinyasiangmalam
mencedokpasirgelasuntukmengisitongkang,makansepertijembeldan
tidurdibawahgardantruk,melingkarsepertibiawak.AnakanakMelayu
inipalingmirisnasibnya.Karenasesungguhnyasetiapbutirpasiritu
adalahmilikulayatnya,setiapbongkahkuarsa,topas,dangalenaituadalah
harkatdirinyasebagaiorangMelayuasli,tapisemuanyamerekamuat
sendirikeatastongkanguntukmenggendutkanperutparacukongdi
Jakartaataupejabatyangkongkalikong.Menjadipendulang,nelayan
bagan,dankulipasir,berartimengucapkanselamattinggalpadaTutWuri
Handayani.
Merekayangmasihbersemangatsekolahumumnyabekerjadiwarungmi
rebus.Mencucipiringdansetiapmalampulangkerjaharusmenggerus
tangantujuhkalidengantanahkarenaterkenaminyakbabi.Ataumenjadi
buruhpabrikkepiting.Berdirisepanjangmalammenyiangikepitinguntuk
dipaketkankeJakartadenganrisikodijepitihewannakalitu.Atau,seperti
aku,Arai,danJimbron,menjadikulingambat.Sebelummenjadikuli
ngambatkamipernahmemilikipekerjaanlainyangjugamemungkinkan
untuktetapsekolah,yaitusebagaipenyelamdipadanggolf.Tentususah
dipahamikalaukampungkamiyangmiskinsempatpunyabeberapa
padanggolfbahkansampai24hole.Dantentuanehdipadanggolfada
pekerjaanmenyelam.OrangorangkayabarudariPNTimahyangtak
berbakatdandatanghanyauntukmenegaskanstatusnyatakpernah
mampumelewatkanbolagolfmelampauisebuahdanaubekasgaliankapal
kerukditengahpadanggolfitu.Penjagapadanggolfakanmembayar
untuksetiapbolagolfyangdapatdiambilpadakedalamanhampirtujuh
meterdidasardanau.Bolagolfdidasardanaudenganmudahdapat
[Hamalan34dari168]

|
AndreaHirataSangPemimpi
ditemukankarenaindahberkilauan,persoalannya,danauituadalah
tempatbuayabuayasebesartongberumahtangga.Lalukamiberalih
menjadiparttimeofficeboydikomplekskantorpemerintah.Mantap
sekalijuduljabatankamiitudanhebatsekalijobdescriptionnya:masuk
kerjasubuhsubuhdanmenyiapkanratusangelastehdankopiuntukpara
abdinegara.Persoalannya,lebihsadisdariancamanreptilcretaceousitu,
yaituberbulanbulantakdigaji.
Sekarangkamibahagiasebagaikulingambat.Karenapekerjaaninikami
menyewasebuahlossempitdidermagadanpulangkerumahorangtua
setiapduaminggu.
Ngambatberasaldarikatamenghambat,yaitumenungguperahunelayan
yangtambat.Parapenangkapikanyangmerasamartabatprofesinyaharus
dijagabaikbaiksampaibatasdermaga,takpernahmaurepotrepot
memikultangkapannyakepasarikan.Laluyangmerekatindashabis
habisanuntukmelakukanpekerjaansangatkasarberbaubusukitudisebut
kulingambat.Selainanakanakyangtekadinginsekolahnyasekeras
tembaga,pemangkujabatankulingambatumumnyaadalahmerekayang
patahharapan.Takditerimakerjadimanamana,karenasakingtololnya
sampaitaktahunamapresidenrepublikini,ataukarenasakingjelek
konditenyabahkanperkumpulancalokarcisyangjugamerupakan
gerombolanbromocorahtakmaumengajakmereka.Setiappukuldua
pagi,berbekalsebatangbambu,kamisempoyonganmemikulberbagai
jenismakhluklautyangsudahharustersajidimejapualamstanplatpada
pukullima,sehinggapukulenamsudahbisadiserbuibuibu.Artinya,
setelahitukamileluasauntuksekolah.
Setiappagikamiselalusepertisemutkebakaran.Menjelangpukultujuh,
denganmembersihkandiriseadanyakarenaitukamiselaluberbau
sepertiikanparikamitergopohgopohkesekolah.Jimbronmenyambar
sepedanya,yangtelahdipasanginyasuraisehinggabaginyasepedajengki
reyotituadalahkudaterbangpegasus.AkudanAraiberlarisprintmenuju
sekolah.Sampaidisekolah,semuakelelahankamisertamertalenyap,
sirnatakadabekasnya,menguapdiisapolehdayatariklakilakitampan
ini,kepalasekolahkamiini,gurukesusastraankami:BapakDrs.Julian
IchsanBalia.Sebagaianakanakyangsejaksekolahdasardiajarkanuntuk
menghargaiilmupengetahuandanseni,aku,Arai,danJimbronsungguh
terpesonapadaPakBalia.Berpostursedang,berkulitbersih,170cm
kuranglebih,PakBaliaselalutampilprimakarenaiamencintaiprofesinya,
menyenangiilmu,danlebihdariitu,amatmenghargaimuridmuridnya.
Setiaprepresentasidirinyaiaperhitungkandengantelitisebabiajuga
pahamdidepankelasiaadalahcenterofuniversedankarenayang
diajarkannyaadalahsastra,muarasegalakeindahan.Wajahnyaelegan
penuhmaknaseperrisampulbukuensiklopedia.Tulangpipiyanglonjong
[Hamalan35dari168]

|
AndreaHirataSangPemimpi
membuatnyatampaksehatdanmudaketikatimbangannyanaikdan
membuatnyaberkaraktermenawanwaktuiakurus.Warnacokelatadalah
sandangkesenangannyasebabseiramadenganwarnabolamatanya.Ilmu
yangterasaholehusiayangsenantiasabertambah,menjadikanduabola
kecilcokelatyangteduhitubakperigiyangmemeramketinggianilmu
dalamkebijaksanaanumur.Kreatif!Merupakandayatarikutamakelasnya.
Ketikamembicarakansyairsyairtentanglaut,beliaumemboyongkamike
kampungnelayan.Mengajarikamimenggubahdeburanombakmenjadi
prosa,membimbingkamimerangkaibaitpuisidarisetiapelemen
kehidupanparapenangkapikan.Indahmenggetarkan.
Takpernahmaukelihatanletihdanjemumenghadapimurid.Jika
kelelahanbeliaumohondirisebentaruntukmembasuhmukanya,
mengelapnyadenganhandukputihkecilbersulamkannamaistridan
putriputrinya,yangselaludibawanyakemanamana,laludibasahinya
rambutnyadandisisirnyakembalirapirapibergayaJamesDean.Sejenak
kemudianbeliaumenjelmalagididepankelassebagaipangerantampan
ilmupengetahuan.
"Whatwedoinlife..."kataPakBaliateatrikal,"...echoesineternity...!!
Setiapperistiwadijagatrayainiadalahpotonganpotonganmozaik.
Terserakdisanasini,tersebardalamrentangwaktudanruangruang.
Namun,perlahanlahaniaakanbersatumembentuksosoksepertimontase
AntoniGaudi.Mozaikmozaikituakanmembangunsiapadirimudewasa
nanti.Laluapapunyangkaukerjakandalamhidupini,akanbergema
dalamkeabadian....
"Makaberkelanalahdiatasmukabumiiniuntukmenemukanmozaikmu!"
MataharisorekuningtuaberkilatdimatacokelatPakBalia.Sinarnyayang
terangtapilembutmenghalausisasisasiang.Dilapangansekolahkami
dudukrapatrapatmerubungnya.Terpesonaakankatakatanya.Kamilena
dibelaiujungujungputihperdukapasyangbergelombangditiupsepoi
anginbakbuihlautan,lenadisihirkalimahkalimahsastrawigurukamiini.
Dantakdinyana,apayangdikatakandandiperlihatkanPakBaliaberikut
inibakbatusafiryangterhunjamkehatikudanArai,membuathatikami
membirukarenakilaunya.Menahbiskanmimpimimpiyangmuskilbagi
kami.
"JelajahikemegahanEropasampaikeAfrikayangeksotis.Temukan
berliannyabudayasampaikePrancis.Langkahkankakimudiatasaltar
sucialmamaterterhebattiadatara:Sorbonne.IkutijejakjejakSartre,
LouisPasteur,Montesquieu,Voltaire.Disanalahorangbelajarscience,
sastra,dansenihinggamengubahperadaban...."
AkudanAraitakberkedipwaktuPakBaliamemperlihatkansebuah
gambar.Dalamgambaritutampakseorangpelukissedangmenghadapi
sebidangkanvas.
[Hamalan36dari168]

|
AndreaHirataSangPemimpi
Adasedikitcoretanimpresi.Dannundisana,dibelakangkanvasitu,
berdirimenjulangMenaraEiffelseolahmenundukmemerintahkanSungai
Seineagarmembelahdirimenjadiduatepatdikakikakinya.Sungaiitu
punpatuh.Riakriakkecilnyamembiaskancahayaseumpamajutaanbola
bolakacayangdituangkandarilangit.
Padasaatitulahaku,Arai,danJimbronmengkristalisasikanharapanagung
kamidalamsatustatementyangsangatambisius:citacitakamiadalah
kamiinginsekolahkePrancis!Inginmenginjakkankakidialtarsuci
almamaterSorbonne,inginmenjelajahEropasampaikeAfrika.Harapan
iniselanjutnyamenghantuikamisetiaphari.Begitutinggicitacitakami.
Mengingatkeadaankamiyangamatterbatas,sebenarnyalebihtepatcita
citaitudisebutimpiansaja.TapididepantokohkarismatiksepertiPak
Balia,semuanyaseakanmungkin.
PakBaliamengakhirisessionsoredenganmenyentaksemangatkami.
"Bangkitlah,wahaiParaPelopor!!.Pekikkanpadakukatakatayang
menerangigelapgulitaronggadadamu!Katakatayangmemberimu
inspirasi!!"ParaPelopor!!PanggilanPakBaliauntukkamisebagaisiswa
angkatanpertamaSMANegeriBukanMain.
Panggilanitusenantiasamembuncahkantenagadalampembuluhdarah
kami.TangantanganmudaMelayusertamertamenudinglangit,puluhan
jumlahnya,berebutaningintampil.
"Makruf!!"
Beruntungsekali,iaterpilih.KetuaPramukaSMABukanMaininimeloncat
kedepan.KatakatanyapatahpatahmenggelegarsepertiprajuritTNI
ditanyajataholehkomandankompi.
"KaumMuda!Yangkitabutuhkanadalahorangorangyangmampu
memimpikansesuatuyangtakpernahdiimpikansiapapun!JohnR
Kennedy,PresidenAmerikapalingmasyhur!"
"Hebatsekali,Ruf!Hebatsekali!Oke,Mahader!!"Mahadersudahseperti
cacingkepanasandaritadi.Sepertiaku,Arai,danJimbron,iatermasuk
dalamgelombangbesarendemikkemiskinanyangmelandaanakanak
parakulitimahketikaperusahaanitumulaidiintaikolapspertengahan80
an.Mahadertaksabaringinmengabarkanpadaduniakatakatayang
membuatnyatabahbangunsetiappukultigasubuhuntukmenggoreng
getasdanmenjunjungnyakelilingkampung.Wajahnyasendunamuntegar
selayaknyaorangyangmenanggungbebankesusahanmenghidupiadik
adiknya.Katakatanyagaraudansyahdu,penuhtekananseperti
deklamasi.
"Kesulitan....Seluruhkesulitandalamhidupini...adalahbagiandarisuatu
tatananyangsempurnadansifatyangpalingpastidarisistemtatasurya
ini....
"PierreSimondeLaplace,bisakitasebutsebagaiseorangastronomnomor
[Hamalan37dari168]

|
AndreaHirataSangPemimpi
satu...."
Saktinyasastra,ungkapanseorangastronomduaratuslimapuluhtahun
yanglaludinegeriantahberantahdapatmenjadipenyebarsemangat
hidupseoranganakMelayutukanggetasyangbahkantakdapatmenyebut
namanyadenganbenar.Kamibersuitsuitmendengarkatakatayang
berkilauanitudanselanjutnyatakterbendungkatakatanegarawan,
ilmuwan,danpahlawanmembanjirikelasPakBaliayangmemesona.
"ZakiahNurmala!!"
DitunjukPakBaliamembuathidungnyakembangkempis.lamelonjak
berdiri,suaranyamelengking,"IShallreturn!JenderalDouglasMac
Arthur,pahlawanPerangDuniaKedua!!"
Itulahkalimatkeramatyangdiucapkansangjenderalbesarituuntuk
menyemangatitentaraAmerikadiFilipina.Katakatayangmembakar
semangatsetiaporanghinggakini.Tibatiba,tanpadimintaPakBalia,Arai
melompatbangkit,melolongkerassekali,"Taksemuayangdapatdihitung,
diperhitungkan,dantaksemuayangdiperhitungkan,dapatdihitung!!
AlbertEinstein!Fisikawannomorwahid!"
Tinggi,runyam,membingungkan.MatanyameliriklirikNurmala.PakBalia
terpanadanberkerutkeningnya,tapimemangsudahsifatalamiahbeliau
menghargaisiswanya.
"Cerdassekali,AnakMuda,cerdassekali...."
AkutahutaktiktengikArai.lamenggunakankatakatalangithanyauntuk
membuatNurmalaterkesan.
KembangSMABukanMainitutelahditaksirnyahabishabisansejak
melihatnyapertamakaliwaktupendaftaran.Meskipunseumurumurtak
pernahpunyapacartapiAraipunyateoriasmarayangsangatcanggih.
"Perempuanadalahmakhlukyangplinplan,Kal,makapertamatama,
buatlahmerekabingung!!"
SehebatmuslihatCasanova,kenyataannya,setiapmelirikArai,Nurmala
tampaksepertiorangterserangpenyakitanginduduk.
"Ikal!!"
Oh,PakBaliamenunjukku.Daritadiakutakmengacungkarenaakutak
punyakatakatamutiara.Akutaksegerabangkit.Akupanik.
"Ya,kau,Ikal...."
Semuamatamemandangkumelecehkan.TakpernahPakBaliaharus
memintaduakali.Memalukan!Akugemetarkarenataksiap.Tapiaku
tetapharusberdiri.Takmungkinmengkhianatieuforiakelasini.Danpada
detikmenentukan,akusenangsekali,eureka!!Sebabakuteringatakan
ucapansenimanbesarfavoritku.Akankukutipsalahsatusyairlagunya.
Akuberdiritegaktegak,berteriak,"Masamuda,masayangberapiapi!!
HajiRhomaIrama!"

[Hamalan38dari168]

|
AndreaHirataSangPemimpi
SetiapmemandangianakanakSungaiManggaryangberkejaranmenuju
muaraakuterusteringatdengangambarSungaiSeinedariPakBaliadulu.
AnakanakSungaiManggaritu,muara,danbarisanhutanbakauadalah
pemandanganyangterbentangjikakamimembukajendelaloskontrakan
kamididermaga.Namun,takseindahceritaromansaSungaiSeine,muara
ituadalahmuaraairmata.BeberapatahunlalusebuahkeluargaMelayu
berkebundipulaukeciltakjauhdarimuara.Dalamperjalananpulang,
perahumerekaterbalik.Duaharikemudianorangmelihatsosoksosok
mengambangpelan,lekatsatusamalain,mengikutianakSungaiManggar.
Sangayah,dengankeduatangannya,memeluk,merengkuh,menggenggam
seluruhanggotakeluarganya.Istrinyadanketigaanaknyasemuanya
beradadalamdekapannya.Iainginmenyelamatkansemuanya.Sebuah
upayayangsiasia.Tapianaktertuanya,Laksmi,selamat.Gadiskecilitu
taksadarkandiri,tersangkutdiakarakarbakau.Sejakitusemenanjung
tempatkeluargaituditemukandinamakanorangSemenanjungAyah.
LaksmidipungutseorangTionghoaTongsanpemilikpabrikcincaudania
bekerjadisitu.TapisepertiJimbrondenganPendetaGeo,bapakasuh
LaksmijustrumenumbuhkanLaksmimenjadimuslimahyangtaat.
Sayangnyasejakkematiankeluarganya,kehidupanseolahterenggutdari
Laksmi.Iadirundungmurungsetiaphari.
Jelas,meskipunsudahbertahuntahunterjadi,kepedihantragedidi
SemenanjungAyahmasihlekatdalamdirinya.Danselamabertahuntahun
itupula,takpernahlagitakpernahwalauhanyasekaliorangmelihat
Laksmitersenyum.

Senyumnyaitusangatdirindukansemuaorangyangmengenalnya.Karena
senyumnyaitumanissebabwajahnyalonjongdanadalesungpipityang
dalamdipipikirinya.Tapikejamnyanasibhanyamenyisakansedikit
untukLaksmi:sebuahpabrikcincaureyot,masadepantakpasti,dan
wajahnyayangselalusembap.Laksmiselalumenampilkankesanseakan
takadalagiorangyangmencintainyadiduniaini,padahal,diamdiam,
Jimbronsetengahmaticintapadanya.JimbronbersimpatikepadaLaksmi
karenamerasanasibmerekasamasamamemilukan.Merekaberdua,
dalamusiademikianmuda,mendadaksontakkehilanganorangorang
yangmenjaditumpuankasihsayang.Kepedihanyangmenghunjamdalam
dirimerekamenyebabkanLaksmikehilangansenyumnya,danJimbron
kehilangansuaranya.Merekaberduamengandungkehampaanyangtak
terkirakiradalamhatinyamasingmasing.SetiapMinggupagiJimbron
menghamburkepabrikcincau.Dengansenanghati,iamenjadirelawan
pembantuLaksmi.Tanpadimintaiamencucikalengkalengmentega
Palmboomwadahcincauitujikaisinyatelahkosongdanikutmenjemur
daundauncincau.Sepertibiasa,Laksmidiamsaja,dingintanpaekspresi.
[Hamalan39dari168]

|
AndreaHirataSangPemimpi
DiantarakalengkalengPalmboommerekaberduatampaklucu.
Jimbronyanggemukgempal,sumringah,danrepotsekali,hanyasetinggi
bahuLaksmiyangkurusjangkung,berwajahlembut,dantakpeduli.Sering
JimbrondatangkepabrikmembawakanLaksmibuahkwenidanpitapita
rambut.Jimbroninginsekali,bagaimanapuncaranya,meringankanbeban
Laksmimeskipunhanyasekadarmencucibaskom.
Jikapembelisepi,Jimbronberaksi.Bukanuntukmerayuataumenyatakan
cinta,bukan,samasekalibukan,tapiuntukmenghiburLaksmi.Dari
kejauhanakudanAraiseringterpingkalpingkalmelihatJimbron
bertingkahsepertikelinciberdiri.Takdiragukan,diasedangmeringkik,
sedangmenceritakankehebatanseekorkuda.Laksmisemakindatar
karenakudasamasekaliasingbaginya,asingbagisemuaorangMelayu.

Kadangkadang,denganpenuhsemangat,Jimbronmemamerkanaksesori
barusepedajengkinyapadaLaksmiyaitusadelnyayangiabuatseperti
pelanakuda.Kulitkambingdidapatnyadaribedukapkir.Lengkappula
dengankantongkeciluntukmenyelipkansenapanmeskikenyataannya
diisinyabotolair.Atausepatunyayangiapasangiladamjadisepertisepatu
kuda,atauaksesoriberupatanduksapiyangdiikatkanpadasetang
sepedanya.Laksmihanyamenggelenggelengkankepalanya.
SeringJimbronmenghampiriPakBaliauntukmemintaceritacerita
komedi.Bersusahpayah,terbatabata,Jimbronmembacacerpen"Lelucon
MusimPanas"karyaAlbertoMoraviaatau"Karma"karyaKhushwant
SinghuntukLaksmi,Laksmitetapsajamurung.Jimbron,aku,Arai,atau
siapapun,bagaimanapunkamitelahmencoba,takpernahsekalipun
berhasilmemancingsenyumLaksmi.Laksmitelahlupacaratersenyum.
SenyumLaksmitelahtertelankegelapannasibnya.Jikamendengarkami
mengisahkanfabeldanparodi,Laksmimemalingkanwajahnya,miris
memandanglangit,gamangmelaluiharidemihari,perihmemandang
sulursuluranakSungaiManggardiSemenanjungAyahnya.Bertahun
tahunsudahJimbronberusahamenarikLaksmidarijebakanperangkap
kesedihan.TapiLaksmisepertiorangyangsudahterjebakjiwanya.Kami
mulaicemas,sekianlamadalamkungkungandukayanggulita,jangan
janganLaskmimulaitergantungpadaperasaanyangmengharubiruitu,
bahkanmulaimenyukainya.SepertiveteranPerangVietnamyang
kecanduanpadarasatakut.Menurutkami,sudahsaatnyaLaksmi
ditanganiorangyangahli.Setiapkamisinggungkemungkinanitupada
Jimbron,dengantujuanagariatidakkecewa,agartakterlalumemendam
harap,iaterpuruk,terpurukdalamsekali.
"Akuhanyainginmembuatnyatersenyum...,"katanyaberat.

[Hamalan40dari168]

|
AndreaHirataSangPemimpi
Mozaik7
Afghanistan

DitelevisibalaidesakamimenyimakulasanIbuToetiAdhitamatentang
sepakterjangseorangpatriotmudaMujahiddinyangbarusaja
menumbangkankomandanresimenutaraTentaraMerahRusia.Pemuda
MujahidituOruzganMouradKarzani,berasaldariklanKarzanidanputra
pahlawanZahidJirgaKarzani.Zahidadalahimamkarismatikyang
terpandangdibagianlainAfghanistan,Baloch.Keluargainituruntemurun
memimpingerilyawanBalochsehajAfganistanmelawanpendudukan
InggrisdansampaisaatterbuhuhnyakomandanRusiaitu,sudahhampir
sepuluhtahunmerekamenggempurinvasiRusia.
KejadiaanyaberlangsungdiLembahTowraghondi,sebuahzonaperang,dua
ratusmeterdiluargarisbatasAfghanistandanTurkmenistan.Oruzugan
yangseusiadenganaku,Arai,danJmbronbaru17tahunternyata
pemimpinpasukaneliteMujahiddin.Oruzgantelahmenapakijejak
kepahlawanankeluarganyasejakbelia.
TerbunuhnyakomandanresimenutaraTentaraMerahmenjaditonggak
pentingdirebutnyakembalizonautaradaripenaklukanTentara
Merah,sekaliguspemicuhengkangnyaRusiadariAfghanistantahun
berikutnya.Oruzgandisambutbakpahlawan.Dalamwaktusingkat,ia
menjadiimambesarbaloch.Iamewarisikarismaayahnyayangmampu
merangkulsubsubetnikPashtuns,Tajik,Hazara,AimakdanBalochyang
seringkonfliksatusamalain.Sayangnya,karenafriksidengan
Taliban,Oruzgandanpengikutnyaharushengkangdari
Afghanistan.MerekamendapatsuakadisebuahNegaraasing.
KetikamenontonberitaitutaktebersitolehkudanAraibahwa
pertempurandiTowraghondiitu,yangterjadipadawaktuyangsama
ketikakamidikejarPakMutarsampaikegudangpeties:15Agustus
1988,akanmenjadipotonganmozaikhidupkami.Kamijugataksadar
bahwahariitulangittelahmengisapteriakanikanduyungsangCapo
sepertilangitmengisapteriakanAraiyangmelatunkanaminsecarakurang
ajaruntukmembalasTaikongHamim.Diamdiamlangitmenyimpannya,
pelanpelanhanyutmengintaiakudanArai,dansuatuharinantiakan
menumpahkannyakesekujurtubuhkamisebagaikutukan.

[Hamalan41dari168]

|
AndreaHirataSangPemimpi

Mozaik8
BajuSafariAyahku

Ibuku,jelaslebihpintardariayahku.Ibukupalingtidakbiasamenuliskan
namanyadenganhurufLatin.Ayahku,hanyabisamenuliskannamanya
denganhurufArab,hurufArabgundul.Dantandatangannyapunseperti
hurufshot.Tahu,kan?Sebelumthodanzhoitu.Danayahhkuadalahpria
yangsangatpendiam.Jikaberadadirumahdenganibuku,rumahkami
menjadipentasmenolongibuku,berpenontonsatuorang.Namun,belasan
tahusudahjadianaknya.Akubelajarbahwapriapendiamsesungguhnya
memilikirasakasihsayangyangjauhberlebihdisbandingpriasokngatur
yangmerepetsajamulutnya.

Buktinya,jikatibaharipembagianrapor,ayahkumengambilcutiduahari
darimenyekopxenotimdiinstalasipencuciantimah,wasrai.Hari
pembagianraporkuadalahharibesarbagibeliau.Tanpabanyakcincong
haripertamabeliaumengeluarkansepatunyayangbermerekAngkasa.
Dijemurnyasepatukulitbuayayangrupanyasepertitatakankuesempret
itu,dipolesnyalembutdenganminyakremdicampurtumbukanarang.lalu
ikatpinggangnya,dariplastictapimenirumotifular,jugamendapat
sentuhansemiristimewaitu.Dijemurnyapulakauskakinya,sepasangkaus
kakisepakbolayangtebalsampaikelutut,berwarnahijautua.

Setelahitu,specialsekali,beliauakanmenuntunkeluarsepedaRally
RobinsonmadeinEnglandnyayangmasihmengilap.Sejakdibeli
kakeknyatahun1920,takhabishitunganjaritangankakisepedaitu
pernahdikeluarkan.Diperiksanyadengantelitibandanrantainya,
dicobanyadynamodankliningnnya,dantaklupa,sepedaitupunmendapat
kehormatandipolesramuansemirmerekbeliausendiritadi.Danyang
terakhir,hanya,sekalilagihanya,untukacarayangsangatpenting,beliau
mengeluarkanbusanaterbaiknya:bajusafariempatsaku!Bajuinipunya
nilaihistoriesbagikeluargakami.Akuingat,setelahbertahuntahun
menjaditenagalangkong,semacamcalonpegawaiPNTimah,akhirnya
ayahkudiangkatmenjadikulitetap.

Bonuspengangkatanituadalahkainputihkasarbergarisgarishitam.Oleh
ibukukainitudijadikanlimapotongcelanadanbajusafarisehinggapada
harirayaIdulFitriayahku,aku,adiklakilakiku,dankeduaabangku
memakaibajuseragam:safariempatsaku!Kamisilahturahmikeliling
[Hamalan42dari168]

|
AndreaHirataSangPemimpi
kampungsepertirombonganpetugascacar.Saatpembagianrapor,ibuku
puntakkalahrepot.Seharisemalambeliaumerendamdaunpandandan
bungakenangauntukdipercikkandibajusafariempatsakuayahkuitu
ketikamenyetrikanya.

Persiapanayahkumengambilraporakanditutupdenganberangkatke
kawasanlospasarikanuntukmencukurrambutdankumisubannya.Di
sana,sambilmemperlihatkanamplopundangandariPakMustar,wakil
kepalasekolahkamiitu,beliausedikitbicara,sepertiberbisik,padakawan
kawandekatnya,parapejabattriaspolitikaMasjidAlHikmah.
Besok,akanmengambilraporAraidanIkal.
Senyumayahkuindahsekali.KarenabaginyaakudanAraiadalah
pahlawankeluargakami.
Oh...siKancilKeritingitu,PakCik?

TaikongHaminselalumenatapayahkulamalamauntukmengharapkan
lebihbanyakkatameluncurdarimulutbeliau.itulahorangpendiam,kata
katanyaditungguorang.Sebenarnya,denganmemperlihatkanisiamplop
ituayahkubisamembualsejadijadinya.Karenadalamundangantertulis
akudanAraiberadadalambarisanbangkugardadepan.Siswayangtak
burukprestasinyadiSMANNegeriBukanMain.Tapibagaiayahku,tujuh
kataitu:besok,akanmengambilraporAraidanIkal,yangterdiriatastiga
puluhempatkarakteritu,sudahcukup.Padaharipembagianrapor,ayah
ibukutelahmenyiapkansegalanya.Suamiistriitubangunpukultiga
pagi.Ibukumenyalakanarangdalamsetrikaan,mengipasngipasinya,dan
dengangesitmemercikkanairpandandanbungakenanga,yangtelah
direndamnyaseharisemalam,disekujurbajusafariempatsakukeramat
itu.Ayahkukembalimelakukanpengecekanpadasepedanyauntuksebuah
perjalananjauhyangsangatpenting.

Usaisalatsubuhayahkusiapberangkat.Dengansetelanlengkapnya:ikat
pinggangbermotifulartanah,sepatukulitbuayayangmengilap,dankaus
kakisepakbola,sertabajusafarijahitanistrinyatahun1972,yangsekarang
berbauharumsepertikuebugis,kesanseorangburuhkasardiintalasi
pencuciantimahmenguapdariayahandaku.Sekarangbeliauadalah
mantricacar,syahbandar,ataupalingtidak,tampaklaksanajurutulis
kantordesa.Ibukumenyampirkankarungtimahberisibotolairminum
danhandukuntukmenyekakeringat,lalubeliaubersepedakeMagai,ke
SMANegeri.Bukanmain,30kilometerjauhnya,untukmengambilrapor
anakanaknya.

Dibawahrindangdedaunanbungur,didepanaulatempatpembagian
[Hamalan43dari168]

|
AndreaHirataSangPemimpi
rapor,sejakpagiakudanAraimenungguayahku.Akumembayangkan
beliau,yangakanpensiunbulandepan,bersepadapelanpelanmelalui
hamparanperduapitapit,kebunkebunliar,danjejeranpanjangpohon
angsanareklamasibumiBelitongyangdihancurkanleburkanPN
Timah..Lalubeliauberistirahatdipinggirjalan.Beliaupastimenuntun
sepedanyawaktumendakiBukitSelumar,dantetapmenuntunnya
ketikamenuruniundakanitusebabterlalucuramberbahaya,Beliau
kembalimelakukanhalyangsamasaatmelewatiBukitSelinsing,dan
kembaliterseokseokmengayuhsepedamelawananginmelaluipadang
sabanabelasankolometermenjelangMagai.

Tapitakmengapa,sebabkesurupanbeliauakankamiobatidisini.Didalam
aulaitu,PakMustarmengurutkandengantelitiseluruhrangkingdaritiga
kelasangkatanpertamaSMAkami.Darirangkingpertamasampaiterakhir
160.Semuaorangtuamuriddikumpulkandiauladengannomorkursi
besarbesar,sesuairangkinganaknya.Nomoritujugadicatumkandalam
undangan.BukanPakMustarnamanyakalautidakkerasseperti
itu.Makapembagianraporadalahacarayangdapatmembanggakanbagi
sebagianorangtuasekaligusmemalukanbagisebagianlainnya.
PakMustarmenjejersepuluhkursikhususdidepan.Disanalahberhak
dudukparaorangtuayanganaknyameraihprestasisepuluhbesar.
SepuluhterbaikituadalahanakanakMelayuavantgarde,garda
depan,katanyabanggaketikamengenalkankonsepnyapadarapat
orangtuamurid.Dankebetulan,akudanAraiberadadigardadepan.Aku
urutanketiga,Araikelima.AdapunJimbron,mempersembahkannomor
kursi78untukPendetaGeo.Biasanyaacarapembagianraporakan
berakhirdenganmakianmakiankasarorangtuapadaanak
anaknyadibawahjajaranpohonbungurdidepanaulatadi.
Beraniberaninyakaududukkanbapakmudikursinomor147!
Apakerjamudisekolahselamaini?!
Bikinmalu!Semesterdepankaucaribapaklainuntukmengambil
rapormu!!

MetodePakMustarmemangkeras,tapiefektif.Anakanakyangdimaki
bapaknyaitubiasanyabelajarjungkirbalikdalamrangkamemperkecil
nomorkursinya.Merekasadarbahwamukabapaknyadipertaruhkan
langsungdidepanmajelis.AkudanAraiserentakberdiriketikamelihat
sepedaayahku.Sepedaitumudahdikenalidarikaplampualumunium
putihyangmenyilaukanditimpasinarmatahari.Beliaumelihatkami
melambailambaidanmengayuhsepedanyamakincepat.Limameter
menjelangkami,dadakusejukberbungabungakarenaaromadaun
pandan.
[Hamalan44dari168]

|
AndreaHirataSangPemimpi
Beliauturundarisepeda,sepertibiasa,hanyasatuucapanpelan
Assalamualaikum,takadakatalain.Beliaumenepuknepukpundakkami
sambilmemberikansenyumnyayangindah.Beliaumengelap
keringat,merapikanrambutnyadengantangan.danberjalantenang
memasukiauladengangayajalannyayangpengkor,mencarikursinomor
tiga.Tepuktanganramaibersahutanketikanamaayahkudipanggil.Setelah
menerimaraporku,PakMustarmempersilakanayahkumenempatikursi
nomorlimayangkosong,dantepuktangankembalimembahanawaktu
namanyakembalidipanggiluntukmengambilraporArai,Tidakterlalu
buruk,seorangtukangsekopdiwasraidipanggilduakaliolehKepalaSMA
NegeriBukanMain.Kulihatsenyummenawanayahkudanakutahu,saat
ituadalahmomenterbaikdalamhidupnya.

Selesaimenerimarapor,ayahkukeluardariauladengantenangdandapat
kutangkapkeharuansekaliguskebanggaanyangsangatbeasrdalam
dirinya.Beliaumenemuikami,tapitetapdiam.Daninilahmomenyang
palingkutunggu.Momenituhanyasekilas,yaituketikabeliaubergantian
menatapkamidandenganjelasmenyiratkanbahwakamiadalahpahlawan
baginya.Dankamiingin,inginsekalidenganpenuhhati,menjadipahlawan
bagibeliau.Laluayahkutersenyumbangga,hanyatersenyum,takada
sepatahkatapun.Senyumnyaitusepertiucapanterimahkasihyang
diucapkanmelaluisenyum.Beliaumenepuknepukpundakkami,
mengucapkanAssalamualaikumdenganpelansekali,laluberanjak
pulang.Mengayuhsepedanyalagi,30kilometer.Kupadangipunggung
ayahkusampaijauh.Sepedanyaberkelakkelokdiatasjalanpasir.Betapa
akumencintailakilakipendiamitu.Setiapduamingguakubertemu
dengannya,tapisetiaphariakumerindukannya.

[Hamalan45dari168]

|
AndreaHirataSangPemimpi
Mozaik9
Bioskop

BerbagaibangsatelahmerapatkeDermagaMagai:Arab,Afrika,Cina,
India,Pakistan,bahkanorangorangperahudariKamboja.Yangpaling
seringadalahorangorangbersarung.Jikamusimbuah,merekamembawa
kweni,pisang,danmanggis,menjualnyapadapenampungdistanplatlalu
pulangkepulaupulaukecilyangtersebardiBelitongtimurmembawa
minyaktanahdanberas.Merekatinggaldiperahudanmemakaisarung
sampaimenudungikepala,seiringdengansengajamerekamenutupi
wajah.Hanyaitulahadatnyayangkukenal.JikamerapatdiDermagaOlivir
Magaimakaperadabanpertamayangditemukanorangadalahsebuah
gedungbioskop.HiburanpalingtopdiMagai.Memutarfilmduakali
seminggu,filmIndiadanFilmJakarta,kataorangMelayu,SpeakerTOAdari
dalambioskopitumelolongkansuarasampaiterdengarkeloskontrakan
kami.Darisitulahakutahukatamutiara:masamudamasayangberapiapi
dariRhomaIramaketikafilmGitarTuanyadiputartakhentihentiselama
tigabulan.Orangbersarungberduyunduyunmenontonnya.Satulagi
adatnyayangkukenal,merekagemarsekalimenontonfilmJakarta.Mereka
memohonpadapemilikbioskopuntukterusmemutarfilmBeranak
dalamKubursampaifimitukeriting,hangustakdapatdiputarlagi.
Sebenarnya,gedungbioskopituberadapersisdidepanloskontrakankami.
Tapisedikitpunkamitakberanimeliriknya.Sebabmenontonbioskop
merupakansalahsatularanganpalingkerasPakMustar.
SangatberbahayaSangatberbahayadanmenjatuhkanmartabatmu,
anakanakMelayubangsapujangga.jikamenontonfilmyangdengan
melihatnamapemainnyasajakitasudahdapatmendugaceritanya.
Filmtakpakaiotak!Aktingtaktahumalu!Takadamutunyasamasekali.
Lihatlahposternyaitu!Auratdiumbarkemanamana.Filmsepertiituakan
merusakjiwamu.Pakaiwaktumuuntukbelajar!!Awas!!Sempat
tertangkaptangankaunontondisitu,rasakanakibatnya!!
MakatakadasiswaSMANegeriBukanMainyangberanidekatdekat
bioskopitu.Membicarakannyapunsungkan.Tapisoreiniberbeda.Aku,
Jimbron,danAraibarupulangsekolahdansedangduduksantaidiberanda
loskontrakankamiwaktumelihatparapetugasbioskopmengurai
gulunganterpalbesarberukuran4x3meter,sebuahposterfilm
baru.Ujungkirikananterpaltelahditautkanpadasudutsudutpapan.Agar
balihoraksasaitutakberantakan,parapetugasharuspelanpelan
membukagulungannya.Mulanyakamihanyamelihatgambarduapotong
betisyangputih.Namun,pemandangansemakinmenariksebabseiring
[Hamalan46dari168]

|
AndreaHirataSangPemimpi
dengansemakinpanjangterpaldiuraidasnsemakinkeatasbetisitu
tampak,semakintakadatandatandapakaianmenutupinya.
Kamibertigamelototwaktuterpaldibukamelewatilututwanitaitu.Diatas
tempurunglututnya,jantungmudakami,yangtelahlepaspantangsunat
ini,berdetaksatusatumengikutilekukankakimulusyangnaiklagi,naik
lagi,terusnaiklagisampaikeareapahadantetaptaktampakselembar
punbenangmembalutnya.Kamiterpakudenganmulutterngangawaktu
terpalterbukasampaikeataspaha.MyGod,akumaupingsan!Disana,ya,
disana,hanyaadacarikkecilberwarnamerah.Bukaanterpalnaiklagi,dan
didadanyajugahanyadililitcarikmerahberupatalitemali.Akuterbelalak.
JimbronmenggenggamlenganAraikuatkuat,lalumenggigitnya.Araisudah
takbisalagimerasakansakit.Matirasa.Mulutnyasepertianjingmelihat
tulang.Akucepatcepatmenutupmatakudengankaduatanganku.Tapi
aneh,jarijarikubergesersendiritakterkendali.Akudipaksaolehdiriku
sendiriuntukmengintipdariselaselajariku.Kututupkembalijariku,tapi
jarijariitumelawantuannya,Akumengintiplagi.Akumaludanmerasa
sangatbersalahpadaBuyaKiaiHajiAchmadDahlan,pendiri
Muhammadiyah.

Postertergelarpenuhdanhanyalimapuluhmeter,tepatdidepanpintulos
kamarkontrakankami,wanitaberbikiniitumelirikpenuhgodaansambil
menggendongseekoranjingpudel.Disampingnyaterterajudulfilmyang
penderitasakitgilanomor6sekalipunidiotdapatlangsungmenebak
nasibparapemerandifilmitu.Danadajuganamaprodusernya(seperti
merekpuyer),dannamasutradaranya(sepertinamapemainseruling
sebuahdangdut).Diapastimenyamarkantabiatrendahnyadibaliknama
sepertinamasurau.

Jikakamimembukapintudanjendelaloskontrakan.wanitaitulangsung
menyerbukamidengangelembunggelembungmemabukkan:tak
terjangkautapimenjanjikan,singgahsebentartapimengajak,digdayatapi
murah.Sementarasangpudeltampaktenteramsekalidiharibaandua
gelembunglaindidadanya.Bermingguminggukamitersihirpandangan
matawanitadiposteritu.Sungguhgodaanyangtaktertahankan.Setiap
gerakankecilkamidiloskontrakanseakandiikutiolehkeduabola
matanya.Setiappulangsekolahkamimemandanginya.Takberkedip.
Mendugaduga;apayayangdikerjakannyakalautidaksedangbermain
filmtolol?Anjingsiapakahyangdigendongnya?Apakahdiabisa
mengaji?

Lalusuatupagibuta,kelelahansetelahpontangpantingmemikulikan.
Kamidudukbertiga,nanarmengamatiincidemiincilekukanmautwanita
[Hamalan47dari168]

|
AndreaHirataSangPemimpi
ituyangtampaksemakinmembiusdisiramicahayalampuneon.Kamidiam
melamundenganpikiranmasingmasing.Pikiranyangsemburat
menerobospelosokpelosokgelaptakbermoral.Laluperlahanlahan
senyumgenitwanitadiposteritumakinmerekah.iahidup!Berbicara
lembutkepadakami,lembutsekalibakbusabusasabun.

Haiidisanaaiiiih,siapanamamu?Ah,sudahlah,takpenting,tapitak
tahukah?hiduphanyasekaliOh,lihatlahdirimu:muda,perkasa,tampan,
tersiasiaKamimelongo.

Kauhabiskanwaktumudamuhanyauntukmembantingtulang?Aiiiih
mengapakerassekalipadadirimusendiri??

Akubisadipecat!!Apatakkautengokpengumuman,anaksekolah
dilarangmasuk!!

Danmemang,darimulaipagarbioskopsampaipintumasuk,bertebaran
peringatankerasanaksekolahdilarangmasuk.
PakMustarpunyamatamatadimanamanajangancobacoba.Kalian
takakanbisamasuk!!
PakCikmuntab.Rupanyaiasendirimuakdenganfilmfilmmurahanitu.

Anaksekolahmacamapakalianini!!??Maunontonfilmnauzubillah
macambegini???

Ketikakamimelompatkabur,iamasihsempatmelolong,Pulang
sana,mengaji!!Dankau.Keriting,akukenalBapakmudiwasrai.Kulaporkan
tabiatmu!!
Bioskopituhanyamemilikisatuakses,yaitupintumasuknya.PakCikdanA
Kiunadalahpalangpintunyadankeduanyagagalkamidekati.Kami
memutarotakdengankeras.Araipunyarencanagila.
Tengahmalamkitabongkaratapnya,masuk,dansembunyidalambioskop
sampaidiputarfilmbesokmalam.
Kawan,tadisudahkubilangkelenjartestoteronadalahakarsegala
kejahatan.Dansimaklahbetapamengerikannyamoduskriminalyang
dimotivasikelenjaritu.Karenadenganmodusituberartikamiharus
sembunyipalingtidak20jamdidalambioskop
yanggelap.Danmembongkaratapurusanbisarunyamsebabbioskopitu
milikCapoLamNyetPho.Berartirencanainijugagagal.
Kamifrustasi.Doronganuntukmenyaksikannasibduacarikmerahitu
menggebutapikamitaktahucaramasukbioskop.Kamibencimenjadi
anaksekolahyangtakkunjungdewasa.Kamibencipadawaktuyang
[Hamalan48dari168]

|
AndreaHirataSangPemimpi
seakanbekutakberanjak.Masaremajaterasaselamanyatakhabis
habis.Dansetiapmalam,dariloskontrakan,kamibencimelihat
orangorangberkerudungmengantretikettanpakamisadaribahwasolusi
briliansesungguhnyakasatdidepanmatakami.hanyaJimbronyangselalu
kamiragukankapasitasakalnyayangjustrumelihatsolusiitu.Suatu
malam.ketikaorangorangberkerudungsedangantre,diamenghamburke
dalamloskontrakan,mengagetkanakudanAraiyangsedangtidur.

Agghh...rrrrh..rrhh...grrrtt...eerhhgg!!Errgghh!!

Jimbronmendengusdenguskerasserupakucingberahi.Mukanyapucat
tegangsepertikucingberahi.Mukanyapucattegangsepertitelahmenelan
bijidurian.Gagapnyakumatparahjikaiabersemangat.Iamenunjuknunjuk
orangorangbersarung,tangannyamemberiisyaratsepertiorang
menudungikepaladengansarung.Dankamisegerapaham
maksdunya.Kamimelonjaklonjak.
Genius!!Geniussekali,Broni!!

Kamiakanmasukbioskopdenganmenyamarsebagaiorang
berkerudung.!!

Esoknyakamisibukmencarisarungtanganyangpalingbauyang
berbulanbulantakdicuciagarAKiundanPakCiktakbetahdekatdekat
kami.Haribesaritupuntiba.LaguinstrumenSepatuKacaCinderella
bergemadarispeakerTOA,tandafilmsegeradimulai.Kamimenyelinap
dalambarisanpanjangorangberkerudungyangmengantre
tiket.Merekariuhrendahdenganbahasanyasendiridankamigemetar,tak
sabarmemenuhiundanganwanitayangmenggendonganjingpudel
itu,inginsegeramenemuinyadidalambioskop.

Betapasempurnapenyamarankami.Sarungbusukitukamitudungkandi
ataskepaladankamilipattepiannyamenutupiwajahsehinggayang
tampakhanyamatadansedikitlubanghidung.IntelMelayuyangpalingjeli
sekalipuntakkandapatmengenalikami.Dimanaadakemauan,disituada
jalan.Pepatahlamayangdianutsemuabangsadimukabumi,benaradanya
Sungguhbenaradanya.Sempatkuliriklagiposterwanitayang
menggendonganjingpudelitudaniatersenyum.Kaliinibukansenyum
mengajaktapisenyumkemenanganhasratmaksiatatas
gembelenganakhlakyangkemitempuhsejakkecil.Iniadalahmalamyang
amatmenyedihkansesungguhnya.

Akugugupketikamendekatiloketkarcisyagnberjeruji.Suaraku
[Hamalan49dari168]

|
AndreaHirataSangPemimpi
menggumamtakjelaswaktumenyodorkanuangrecehsambil
menunjukkantigajari.Mendapatsemburansemerbakbausarungku.AKiun
mendadakmemundurkankursinya.Mukanyamerahdancepatcepat
menyerahkankarcis.Melihatkupuniatakberminat.Sukses!tahap
pertama,dansekarangyangpalingmenentukan.melewatitukangsobek
karcisPakCikBasman.Danternyatamudahsekali.Kamimasihtigameter
darinyadanialangsungmenutuphidung,memalingkanwajahnya.
Masuk,masuk!!

Kamimenundukketikamelewatinya.PakCikmalahtakmaumenyobek
karciskami.Danserasatakpercaya,sekejapkemudiankamitelahberadadi
dalambioskop.kamigirangsepertiorangberhasilmelewatitembok
berlin.Kamimengambiltempatdudukditengah.baupesingterciumdari
sudutsudutbioskop.Kamitetapmemakaisarungkamisepertiorang
memakaicadardandaribalikcadar,kamiterpesonamelihatadatistiadat
dalambioskoporangdewasa.

Pertamatama,munculgerombolancaloangkutanumum.Merekaterbahak
sekehendakhatinyadanmembakarobatnyamukdekatmereka
duduk.Kakidinaikkankeataskursidansemuanyamerokoksepertikereta
api.Lalumunculbeberapapasanglakilakidanperempuanyangdari
bajunyakitasegerapahambahwamerekaadalahpenggemarberat
musikdangdut,Laluterakhirgerombolanbesartakputusputusorang
berkerudung,ingarbingar,sebelumduduk,merekamenyemprotcelah
celahkursidengansemprotanseranggauneukmenghindarigigitan
tuma,Kinibaupesingbercampurdenganbauminyaktanah.Adapulayang
menggeruskapurbarusdanmenebarkangarammengelilingi
tempatdudukmerekauntukmenghindariserbuankecoak.Inilahfilm
Indonesia,inilah
bioskopnya,daninilahparapenontonnya.
LaguinstrumenSepatuKacaCinderellasontakberhenti,Lampu
dimatikan,para
penontonterdiam.Kamileluasamembukakerudung.Mulanyabeberapa
ekortikusgot
melintascepatdibawahlayardansekeluargakecoakmerayapdusudut
sudutnya.Kupikir
merupakanbagiandarifilm,rupanyabukan,habitathewanhewanitu
memangberadadi
dalamgedungbioskopini,Filmdimulaidenganadeganseorangbapakyang
gendutdan
botak,nyonyarumah,dankeduaanakremajanyasedangmakan.Seekor
anjingpudelyang
[Hamalan50dari168]

|
AndreaHirataSangPemimpi
telahkamikenaldenganbaikberlarilarimengelilingimejamakan.Tapi
kamitak
menemukanwanitadiposterfilmyangmengundangkamimasukkedalam
bioskop
bobrokini.Kamiterkejutkarenapenontonyangmenyesakibioskopriuh
bertepuk
tangan,bersuitsuit,dandaribaliktiraimuncullahwanitaposteritusambil
membawa
dandangnasi.Orangorangberkerudungyangtelahberulangkali
menontonfilmini
bertepuktangansebelumtiraiituterbuka.Kamilangsungtahubahwa
wanitapujaankami
ituberperansebagaibabu.Danduadetikmenontonfilmini.ketikabelum
sepatahdialog
pundiucapkan,kamijugalangsungtahubahwaseluruhceritananti
hanyalahsoalsang
majikanyanggendutbotakitumenggodababunya.
Benarsaja,Jikanyonyarumahpergikesalon,anakanakberangkat
sekolah,sangmajikan
beraksi.Iamengejarngejarpembantunyayangjinakjinakmerpatidi
dapur.Wanitaposter
inisamasekalitakpandaiberaktingtapitampakjelassutradaranyatak
mengalami
kesulitanjikamenyuruhnyamembukakancingbajunya.iaterampilsekali
dalamhal
mengumbarauratnya,merendahkandirinyasendiri.Danjikasangbabu
dikejar
majikannyauntukdigagahi,bioskopsemarak.Parapenontonperempuan
menjeritjerit.
Aauuu....lari..lari...awasdiadibelakangmu!!
Setiapsangbabutertangkap,merekamengumpat,lakilakiberengsek!tak
tahumalu!

Tapiparapenontonpriamalahmendukungsangmajika,heiitu
dia!sembunyidibalik
pintu!aduh,bodohnya!itudia...
Nah,jikanyonyarumahdananakanaknyapulang.adegankembalikemeja
makan.Belum
20menitfilmberlangsung,sudahkulihatlimakaliorangmakan.Film
Indonesiaternyata
banyaksekalisoalorangmakan.Lalusorenyanyonyarumahpergilagi
untukarisandan
[Hamalan51dari168]

|
AndreaHirataSangPemimpi
anakanaknyalespiano,sigendutbotakkembalibereaksi.Iamengejar
ngejarbabunyadi
garasi,ditaman,ataudidekatkolamrenang.Malamnya,seluruhanggota
keluargapulang
dansemuanyamakanlagi!Begitulahjalanceritanyaberulangulang.
TanpakusadarifilminilahsesungguhnyacetakbirufilmIndonesia.Para
prosedurfilmtak
tertarikuntukmemproduksifimberbobotyangmisalnyamerekonstruksi
sejarah.Karena
hanyaakanmengurangimargindansutradaradalamfilmyangkami
tontoninijelastak
mampumengarahkansetiaporangagartidakmembawakandialogseperti
membaca
deklamasi.Namun,dansutradaratelahberkonspirasimengumpulkan
rupiahdemirupiah
daripenontonyangbodohatauyangmerekabodohi.Sungguhberuntung
dapatkuambil
pelajaranmoralnomordelapandarifenomenaini:jikaAndaseorang
produserfilmingin
untungbesar,maka,pakailahseorangsutradarayangotaknyabebal.
Penontonbertepuktanganlagi,gegapgempita,ketikawanitaposteritu
munculkembali
membawasekeranjangcucian.Oh,inilahpuncakceritanyakarenakaliiniia
hadirdengan
pakaiansepertitampakdiposter.Carikkecilmerahyangkami
rindukan.Kulirik
Arai,keringatdidahinyamengucurderas,hidungjambuairnyakembang
kempis,rahangnyakerasdanmajubeberapaincikedepan,matanya
melotot,Adapun
Jimbrontubuhnyakaku,mulutnyamenganga,napasnyamendengus
pendekpendek.Dan
akumenutupmatakudengantanganwaktuwanitaitumelenggaklenggok
menuju
jemuranhanyaditutupiduacarikkecil.Tapijarijarikukembalimelawan
tuannya.Disela
selajemarikubolamatakurasanyainginmeloncat.Betapamenyedihkan
keadaankami
sebenarnya,Waktuituumurkamihampirdelapanbelastahundan
tergagapgagapmelihat
pemandangansepertiini,padahaldibelahandunialainanakanakSMP
sudahbiasa
menontonfilmbiru.
[Hamalan52dari168]

|
AndreaHirataSangPemimpi
Wanitapembantuitubernyanyinyanyikeciltapikamitakpedulipada
lagunya.Mataku,matakami,hanyalekatpadacarikcarikmerahdi
tubuhnya.Kurasakan
pahaku,pinggang,sertaperutkupenatsebabseluruhsulursulur
urat,darah,danototyang
adadisanatertarikkesatutitikdanpadatitikitukurasakanngiluyang
dalam,panas
bergelora.Seluruhisiperutkuseakannaikpengumpuldiulu
hatiku.TampakjelasAraidan
Jimbronmengalamihalyangsama.Tujuhbelastahunusiakami,pertama
kamiberdiri
palingdekatdenganpengalamanseksual.Makaditempatdudukhabitat
tumaini,di
bawahtipudayasutradarabejatini,kamiadalahlabuairyangmatangdi
tangkainya.Kami
adalahkanonyangsiapmeledakdahsyatkapansaja.
Dansibotakpunitumuncul,mengejardiCarikMerah.parapenonton
wanitaberteriak
teriakhisterismenyuruhnyalari,Pergisana,Dayang,masuklagikedalam
rumah!!
Sebaliknya,penontonpriabersuitsuitnyaring,menyokongsiBotakhabis
habisan,Ayo,Gendut!!Tambahkanhatimu!!Kejar!!Buktikankemampuanmu
kali
ini!!Garapdia!!
PenontonriuhdalamadeganpenuhketeganganwaktusiCarikMerah
meliukliukdi
antarajemurancucian.
PudelmenyalakisiGendut,galakdanpanik,Affh..affh..affh..dankami
terpakudi
tengahbioskopmenungguapayangakanterjadipadacarikcarikmerah
itu.Takberselang
lamaparapenontonpria,gegapgempitasampaimengguncangguncang
tempat
duduknya,menimbulkankehebohandigedungbioskopkarenasigendut
akhirnyaberhasil
menangkapsiCarikMerah.Denganmudah,iamerenggutcarikcarik
pertahananterakhir
babunyaitu,menggagahinya,dansaatitupula,denganamatjeli
menghindariguntingtajam
BadanSensor,sangsutradaralemahimanitumengalihkankameradari
adeganporno
majikandanbabukepadasipudeldanmenyuruhnyamelolong.Hewan
[Hamalan53dari168]

|
AndreaHirataSangPemimpi
kecillucuyang
malangitumenurutsajaperintahsutradara.
Auuuffhhh...auuuuuufffhhh...aauuuuuuuuuuuuffffhhh....

Parapenontonpriabertepuktanganmeriahmenyambutlolongan
pudel.Setiapmajika
gendutmengulangilagikelakuanrendahitu,sangpudelkembalimelolong
seakanmelihat
hantugentayangan,penontonpriadengankompakmenimpalinyadengan
sorakan.Sementarapenontonwanitamenyumpahnyumpah,Anjing
Kurap!!Biarnanti
kaudanmajikabotakmuitudibakardineraka!!
Aku,Arai,danJimbrontakmenghiraukanpenontonpriadanwanitayang
gaduhdalam
pertentangan.Beberapadiantaramerekasampaiberdiriperang
mulut.Kamihanyasangat
inginmelihatkemungkinansutradaramelakukankesalahansedikit
saja,yaitu
memperlihatkanadegansiCarikMerahsedangdiperkosa
majikannya.Dengansegala
asumsiselerarendahsemuamanusiayangterlibatdalamproduksifilm
ini,kamimerasa
kemungkinanituada.Makakamitakberkedip.Sarafkamisemakintegang
mengikuti
adegantaksenonohdilokasijemurancuciandanagaknyakamerasudah
akanmenyorot
siCarikMerahyangsekarangsudahtakbercarik.Seru!Inilahmomen
puncakyangkami
tunggutunggu,tapisialtigabayangangelapmanusiatibatibamenghalangi
pandangan
kami.
PakCik,duduklah!!Kamimaunonton!!Araimenghardikmarah.
Dandetikitujugalayarpadamdan
brrtth...brrth..brrth...depp!Depp!Depp!Deppp!Seluruhbatanglampuneon
didalam
bioskopmenyala,Penontonserentakbersorakkecewatapilangsung
diam.Ketigasosok
yangdekatsekalididepankamiitumemakaijaketkulithitammurahan
yangbiasa
dikenakanpolisiintel.Semuanyaberlangsungsangatcepat.Salahsatu
sosokitumenoleh
kepadakami,tepatdidepanwajahku.Matanyamenghunjamtajamke
[Hamalan54dari168]

|
AndreaHirataSangPemimpi
mataku.Darahku
surut,tubuhkugemetar,danhatikumenjadidingin.Akutakpercayaapa
yangkulihatdi
depanhidungku.IaPakMustar.
Akutergagapkarenaterkejutyangamatsangat.Pandagankuberkunang
kunang.Kepalaku
pening.Perutkumualkarenaketakutan.Araipias,pucatpasiseperti
mayat.Kening,mata,hidung,pipi,dandagunyaseakanmeleleh,giginya
gemelutuk.Dan
Jimbronmengigilhebat.MatanyaterkuncimenatapPakMustarseperti
orangkena
tenung.Iatergagapgagaptakkendali,Pppp...pppp..
pppphhhh...pppphhhaaa...
Lalumasihsempatiamenutupikepalanyadengansarung.Iasepertianak
ayamyangingin
bersembunyididepanhidungelang.PakMustarmenyentaksarungnya
sambil
berteriak.Suaranyabergemaseanterobioskop,Berrrandaalll!!!
Kamimenciut.Seisigedungbioskopterhenyakmembisu.jangankan
kami,bahkanseluruh
penontontakberkutikdibuatPakMustar.Iamemangtokohyangdisegani
siapasaja.
Inirupanyakerjakalian??!!Takmalukaliansebutdirisendiri
pelajar??!!Pelajarmacam
apakalian!!
Kamisepertipesakitandiruangsidang,sepertimelingtertangkapbasah
membongkar
kandangayam.Semuamataterhujampadakami.Kamimenundukkarena
takutdanrasa
maluyangtaktertanggungkan.
TeriakanPakMustarsemakinkencang,Merendahkandirisendiri!!Itulah
kerja
kalian!!Merendahkandirisendiri!!
Kamiberusahamenutupiwajahsepertuiparakoruptormenghindari
jepretan
wartawan.PakMustarmerampassarungkami.
lihatlahmukanyabaikbaik,Saudarasaudara!BeginilahanakanakMelayu
zaman
sekarang!
MartabatkamidiobralPakMustarhabishabisan.Parapengunjungbioskop
mengangguk
angguk.Kamiberusahamerunduk.
[Hamalan55dari168]

|
AndreaHirataSangPemimpi
Keluarrrrr!!

PakMustardanpenjagasekolahmenggelandangkamisepertiternak.Kami
ketakutantak
berdaya.DilayarmunculslidedengantulisanspidolHadirin
hadirin,maaf,pilemperai
sebentar,anaksekolahtertangkap,ttdAKiundankaliini,para
penonton,lakilakidan
perempuan,larutdalamsepakat.Takadapertentanganpendapat.Semuanya
berdiri
bertepuktangan.Barangkalimaksudnya:memangtakpantas,anakanak
mudaIndonesia
menontonfilmnegerisendirijikafilmnyasepertidramacarikmerahini.
Sebelummeninggalkankami,dipintubioskopPakMustarmasihsempat
melontarkan
ancamandengandingin.Ancamanyangmembuatkamitidakbisatidurdua
malam
berikutnya,Ingintahusepertiapanerakadunia?Lihatsajadisekolahhari
senin
pagi,Berandal!!

[Hamalan56dari168]

|
AndreaHirataSangPemimpi
Mozaik10
Action!!

PakCikBasmandasnAKiunberdirirapatdipintukeluarbioskop.Waktu
kami
digiring,merekamemandangkamidenganperasaanbersalah.Mengapatak
kalian
hiraukanperingatankami?Bodohsekali.Orangorangbaikitutelah
terjebakdalam
lingkaranmaksiatindustrifilmnasionaldanmendapatikami,para
siswa,termanipulasidi
dalamnya,membuatmerekajijikdenganprofesinya.
Masalahinigawat.Dariasistenjururiaspengantin,bianggossipkampung
kami,kami
mendengarbahwaPakMustarbelakanganmengetahuikelakuankamidi
petiestempo
hari.Tapiiatakmauributributkarenadalamkejadianitujelasiatelah
kamitipumentah
mentah.Hargadirinyaterlalutinggiuntukmengakuibahwaiatelah
terpedayakegeniusan
Arai.Iayangmemburukamijustrumenyelematkankami.Namun,diam
diamia
menyimpankekalahannyadistanplatitu,meninmbunnyamenjadigunung
dendamyang
berlipatlipatkepadakami.
MalamMingguini,tukangjagungyangtelahbertahuntahunbercokoldi
depanbioskop
melihatsarungdenganmotifyangbeda.MotifMelayubukanmotiforang
pulau.Baunya
punlain.Bauapekgudangperegasan,bukansepertibausarungorangpulau
yangbau
laut.Iatahubahwatigapendatangharamtelahmenyelundupkedala,
bioskopbobrok
itu.PakMustaryangisengisengmematrolisiswanyamalamitusedang
bernasibbaik.Ia
dilaporitukangjagung.Iatersenyumpadatukangjagung,DewiFortuna
tersenyumpada
PakMustar,dankamidikhianatitukangjagung.
Makakamitertangkaptangan,tertangkapbasah,basahkuyup.Positifnya
adalahbahkan
[Hamalan57dari168]

|
AndreaHirataSangPemimpi
tukangjagungpedulipadaintegritaskamisebagaisiswa.Makakatayang
lebihtepat
bukanlahtukangjagungyangmengkhianatikamitapikamiyang
mengkhianatidiri
sendiri.BeritaitudengancepatmenyebarseanteroMagai.Dalamwaktu
singkat,los
kontrakankamidipenuhiparatamu,handaitolansesamemonyetsirkus
SMANegeri
BukanMain.Merekatidakdatinguntukmenunjukkansimpati,takpula
tertarikdengan
momenmomenketikakamitertangkap.Mereka,sepertijugakami,hanya
ingintahusoal
nasibduacarikmerahitu.Kamiyangtelahberhasilmenontonfilmitu
merekaanggap
sebagaipenziarahyangbarupulangdariBabyloniadanmembawakabar
yangakan
memuaskanfantasihewanimereka.Paramonyetsirkusinibertumpuk
tumpukmenyesaki
loskontrakan.
Mengapaiamenggendonganjingdenganpakaiansepertiitu,Kal?tanya
ChongCin
Kiongpolos.

Tidakkahiamalu?belumsempatakumenjawab,Mahader
memberondong.

Kaliantahuapayangterjadidibawahjemurancucian?Ah,direbusPak
Mustardalam
panicyangmendidihpunakutakkeberatan,Araimemanasimereka.
Mahadertukanggetasmemekik,Demitukangjagungsialan
itu,ceritakan,Kawan!!Cepat!!

MonyetmonyetsirkusmenahannapasnyawaktuArai,dengangaya
khasnyayangsuka
membesarbesarkan,menceritakanketidaksenonohandibawahjemuran.
MasyaAllah,astagfirullah...,Mahaderkomatkamit.Iatersandarlayu.

Ketikamerekapulang.Kamihanyutdalammalamyangmengerikanakan
bayangbayang
hukuman.Palingtidak,PakMustarmemilikiwaktuduahariuntuk
memikirkan
pembalasandendamnyayangmemuncaklaluiaakanmenumpahkannya
[Hamalan58dari168]

|
AndreaHirataSangPemimpi
padakamihari
Senin,saatseluruhwargaSMANegeriBukanMainapelbagi.Danmenjelang
hari
timbangankeadilanitu,haripembalasanitu,kamimasihmemilikidua
malamuntuk
menyesaliperbuatantololkami.Duamalamyangsangatpanjang.
*********

Seninpagi,aku,Arai,danJimbrondibariskanterpisah.Danseninpagiinitak
adasiswa
yangterlambatapelkarenasemuanyainginmenyaksikantigapesakitandi
eksekusi.Pak
Mustarnaikpodium.Darimicrophoneyangterusmenerusfeed
back,suaranyabertalu
talu.
Setelahkutelitibaikbaik,SMAinirupanyamemilikisebuahgengtengik
beranggotakan
tigaorangcecunguk,yangtakpernahberhentimembuatkerusakan
kerusakan!!ketiga
orangituadalahkampiunmasalah,parajuarapembuatonar!!
Kamihanyamenundukpasrahmenungguputusanhukuman.Akutakjub
padafluktuasi
popularitaskudisekolahini.AkupernahmenjadianakMelayukampung
yangtak
dipedulikansiapapun,lalumenjadiantelopTibetyangdieluelukangadis
gadis
semenanjung,dankinisemuaorangseakanberkonspirasi
memunggungiku.Dilapangan
ininasibkudiujungtanduk.
Menontonbioskopmengandungrisikosepertimenelanbuah
khuldi,hukumannya
diusir!!
Araitegangwajahnya.jelassekaliguratpenyesalanyangdalam.Danaku
tahu,seperti
pikiranku,daritadiiahanyamemikirkanayahku.
Hanyakarenaduadiantaranyapenghunigardadepandansudahkelas
tiga,makakalian
tidakkudepakdariSMAini,paham?!!
Ugghhh!!Kamilolosdarilubangjarum.tapikamipahamPakMustartak
mungkin
meloloskankamibegitusaja,Dikepalanyapastiadasebuahrencana
dahsyat.
[Hamalan59dari168]

|
AndreaHirataSangPemimpi
IkaldanJimbron,bersihkanWClamaitu!!Agarbisadipakailagi,sikat
lainnyasampai
mengilap!!DankauArai,bersihkankotorankelelewardilangitlangit
seluruhsekolah!!
Ah,takmungkin!Nontondibioskopadalahpelanggaranberat.Hukuman
hukumanini
terlaluringan.SangattidakPakMustar.Siswasiswalainyangpernah
diperlakukanlebih
kejamkarenaperbuatansepelelangsung
memprotes.Sebaliknya,aku,Arai,danJimbron
waswas.KamiyakinPakMustarpastipunyarencanalainyanglebih
spektakulardan
terbuktikemudian.
Danuntukpemanasan,pagiinikalianakansedikitberakting!!Kalianakan
menjadi
bintangfilmIndonesiamurahanitu!!Hebat,bukan??
Serentakratusansiswabertepuktangan.belumbelummerekasudah
tertawakeraskarena
kanmenyaksikanhiburankonyol.Kamigemetarberkeringatdingin.Inilah
hukumankhas
PakMustaryangsangatkamitakuti:dipermalukanditengah
majelis.Hukuman
pemanasansebenarnyaadalahintidarirencanahukumanyangtelah
beliaupikirkan
masakmasaksejakmalamMinggu.
DitengahlapangansekolahPakMustartelahmenyiapkanlokasi
shooting.Talijemuran
beliausambungkanantaraduapohonbungurdandisanatersampircucian
penjaga
sekolah.Beliaujugatelahmenyiapkanpropertiberupasebuahbangku
untukanjingpudel
dudukdantelahmelakukancastingdengansangatbrilian,yaituaku
sebagaibabu,Jimbron
yanggemuktentusajamenjadimajikan,danAraiberperansebagaianjing
pudel.
SeluruhcividasacademicaSMANegeriBukanMain:hampirseribu
siswa,puluhan
guru,karyawantatausaha,satpam,parapenjagasekolah,petugas
kebersihan,danpetugas
kantintumpahruahmenyaksikankamiberakting.
Denganmenggunakanmegaphone,PakMustarbertindakselakusutradara.

[Hamalan60dari168]

|
AndreaHirataSangPemimpi
Kaliantentutaklupaadegandijemurancucianitu,bukan??

Mengerikan.Sungguhakutaksanggupmelakukannya.Benarbenar
memalukan.Aku
demampanggung.Tapibagaimanapunkamimerasainilebihbaikdaripada
dikeluarkan
darisekolah.Artipendidikankami,artisekolahinibagiayahku,dansenyum
kebanggaan
beliauyangbersemayamdisudutsudutkepalaku,membuatkukuat
menujulokasi
shootinh.Danketikakamimelangkahsiapberaktingtepuktangan
bergemuruh.Pak
Mustarmenjelaskankepadaparapenonton,sepertiterjadidibioskop
pesingitu,bahwa
penontonlakilakiharusmendukungsangmajikanjimbrondan
penontonperempuan
harusmembelasangpembatuseksiaku,beliaujugamenjelaskanjalan
ceritafilm
itu,yangamatbeliaubenci,termasuktentanganjingpudelyangmelolong
saatsang
majikanberhasilmenggagahipembantunya.Parapenontonsangat
antusias,Mereka
berdesakdesakanmajukedepan,rapatmengelilingilokasishooting.
PakMustarmenempatkanAraidibangku.Iadisuruhberdiridiatas
lututnyadengan
tanganmenekuksepertianjingpudel.PakMustarmengetessalaknya
beberapakali.
Aff...aff...,salakAraimalumalukucing.

Kurangkeras,kurangmantap,keluhPakMustartaksabar.

Affff...!Affff...!Afffff!!!

Nah,begitu,bagussekali.

Penontontertawakeraskerastakbiasamenguasaidirinya.Belumapaapa
merekasudah
sakitperut.Dibalikpohonbungurakusiapdengansekeranjangcucian.Di
sana,Jimbron
bersembunyimengintaikudibalikjemurandasteristripenjaga
sekolah,siap
menyerbu,Araiberdirisepertibajingdiatasbangku,siapmenyalak.
[Hamalan61dari168]

|
AndreaHirataSangPemimpi
Action!!

Barusajakumulaimelenggaklenggok,parapenontontakmampumenahan
tawanya.Dan
tawamerekasemakinkerasmeledakledakwaktuJimbronmengejarku
danakuberlari
meliukliukdiantarajemuran.
Araimenyalaknyalak,Affhhh!!Affh!!Afffhh!!Affhh!!

WajahAraiyangjenaka,modelrambutnya,dansuaranyayangkering
sangatmiripdengan
anjingpudel.Peransebagaianjingamatpasuntuknya.
Akuterengahengahdanberaktingantaragugup,takutpadaPak
Mustar,danmalutak
terkira.
Cut!!Cut!!Apaapaanini?!!teriakPakMustarkecewadenganaktingku.

Danadegandiulang.Seorangsiswakelassatuyangtertangkapmerokok
beliautugasi
memegangpapanpencatatatadeganyangbisaditangkuptangkupkanitu.
Ikal,ah!Kauharusmelenggangdenganseksi,bukansepertiorangmau
nagihutang
begitu.DanArai,manasalakmu?

Affhhhh!!!Affhhhh!!!

Sekalilagi.

Aaffffhhhh!!

Nah,begitu.
PenontonterbahakbahakmelihatAraidigerakgerakkansepertirobot
anjingolehPak
Mustar,iamenyalaknyalaklagi.RupanyaNurmalameransekkedepandan
terpingkal
pingkalmenunjuknunjukArai.
Afffhhh!!!Afffhhhhh!!!AraibersemangatmengonggongNurmala.Arai
pada
Nurmala,takubahnyaJimbronpadakuda.
Kamikembalibersiap.

Action.
[Hamalan62dari168]

|
AndreaHirataSangPemimpi

Cut!Cut!

Kaliiniyangkeliruaku.Karenamalu,akutetaptakdapatberaktingsesuai
harapanPak
Mustar.
Action!

Akhirnya,akujengkelpadaPakMustaryangtakpunyaperasaan,Makaaku
bertekad
menghayatiperanku.Akumelenggaklenggokdengangayayangsangat
seksisepertisang
pembantusemlohaidifilmmurahanitu,Ekspresiku,gerak
gerikku,suaraku,semuanya
meniruseorangwanita.dantahukah,kawan,halinijustrumenimbulkan
kehebohanyang
luarbiasadilapangansekolahkami.Parapenontontertawamelihatku
sampaikeluarair
matanya,Sebaliknya,Jimbron,sangataneh.
Iasangatmenikmatiperannya.Memangsudahsifatmenganggapsesuatu
selaluserius.Ia
beraktingsungguhsungguh.Otaktumpulnyasamasekalitaksadarkalau
dirinyasedang
dikerjaiPakMustar.iabenarbenarmengejarku,bersemangat
ingin
memerkosaku.DemikianpulaArai.iatakpedulisedangdipermalukan.Ia
hanyaingin
menyalaksehebatmungkinkarenaNurmalamemerhatikannya.Kadang
kadangia
menggerampenuhgaya,padahaldifilmsangpudeltidakbegitu.
Grrhh...grrrhhhhafhh!Afh!

Lalusepertibioskopdulu,parapenontonpriagegapgempitamendukung
sang
majikan.Merekaberteriakteriak,Ayo,Bro.Tangkap,Bron!!Sitabajunya!!!
Sebaliknya,parapenontonwanitamenjeritjerithisteris,Lari
Kal.Lariiiiii....

Lapangansekolahkamiriuhrendaholehsuararatusanyangmanusia
menyaksikan
hiburankocakpalingspektakuler.TakpernahSMABukanMainsemeriah
ini.Teriakan
[Hamalan63dari168]

|
AndreaHirataSangPemimpi
penontonmemekakkantelinga.Merekamelonjaklonjak,tertawasampai
terdudukduduk
melihatakuterbiritbiritdikejarJimbronyangseriusingin
memerkosaku.SementaraArai
menyalaknyalakpanikcampursenangkarenaNurmalatertawageli
sepertianakkecil
melihatnya.SempatkulirikPakBalia,beliautertawasambilmemegangi
perutnya.Dan
parapenontonmencapaipuncakhisteria,terbahakbahaksampai
bergulinggulingsaat
Jimbronberhasilmenangkapku.Iamenindihkurapatrapat,tubuhnyayang
gempal
berenangrenangpenuhgairahdiataskuyangterjepitberdengik
dengik,danAraiyang
berdiridibangkusepertitupaimelolonglolongpanjang
dan
merdu,Auuuufffhhh...auuuuuufffhhhh...aauuuuuuuuuuufffhhhhh....

[Hamalan64dari168]

|
AndreaHirataSangPemimpi
Mozaik11
Spiderman

Jikakitaditimpabuahnangka,ituartinyamemangnasibkitaharusditimpa
buah
nangka.Takdapat,sedikitpun,dielakkan.Dulu,jauhsebelumkita
lahir,Tuhantelah
mencatatdalambukuNyabahwakitamemangakanditimpabuah
nangka.Perkarakita
harusmenghindariberadadibawahbuahnangkamatangsebab
tangkainyasudahrapuh
adalahperkaralain.Takapaapakitaduduksantaidibawahbuahnangka
semacamitu
karenatohTuhantelahmencatatdalambukuNyaapakahkitaakan
ditimpabuahnangka
atautidak.
Nah,Kawan,denganmentalitassepertiitulahJimbronmemersepsikan
dirinya.Barangkali
adabenarnyadisatusisi,tapitakdapatdimungkiripandanganitu
mengandungkanaifan
yangmahabesar.Bagaimanamungkinseorangmanusiamemilikiakal
sepertiitu?Besar
dugaankukarenakemampuanmengantisipasisuatuakibatmemang
memerlukan
kapasitasdayapikirtertentu.Diperlukanintegelensiayangtinggiuntuk
memahamibahwa
buahnangkamatangyangmenggelembungsebesartong,dengan
tangkainyayangsudah
rapuh,dapatsewaktuwaktujatuhberdebamhanyakarenadihinggapi
kupu
kupu.IntegelensiaJimbrontaksampaikesana.
MakamenerimahukumanapapundariPakMustarJimbronikhlas
saja.Disuruh
berakting,yadiaberaktingsebaikmungkin.takadaalasanuntukmain
main.Disuruh
membersihkanWCyanglubangnyadibanjiribakteriekoli,iajugasenang
senang
saja.Semuanyaiajalanidengansepenuhjiwasebabhukumanitubaginya
merupakan
bagiandarimatarantainasibyangdianugerahkansangMahaPenciptadi
langituntuknya
[Hamalan65dari168]

|
AndreaHirataSangPemimpi
danmemangtelahtercatatdalambukuNya.
LapangnyasuasanahatiJimbrondapatdiketahuidarikelancarannya
berbicara.Sambil
mengalungkanselang,menentengembersengbesar,berkauskutang,dan
berkeringat,wajah
jenakabuahmenteganyarianggembira.Iabahkantakterganggusedikit
pundenganbau
busukWClapukitu.Gagapnyanyaristaktampak.Denganekspresipenuh
keagunganatas
ceritanya,mulutnyatakberhentiberceloteh.
Amboi...kudaLibya...,katanyasambilmemelukember.Kudayangpaling
hebat!!Kau
tahusebabnya,Kal??Tahu??
Daritadi,sejakduajamyanglalu,iaterusnyerocostentangkuda,Mulutdan
hidungku
tertutuprapatsaputanganuntukmenghalangibaubusukyangmenusuk
nusuk.Saputanganitusudahkulumuriremasandaunbluntasdanmasih
takmampu
melawanbauWC.
ManamungkinkautahutentangkudaLibya,Kal...
SetiapmenundukuntukmenyikatlantaiWCakumenahannapas.Hebatnya
baubusukini
hinggaseakaniamenjelmamenjadisuatusosokpadatyangmeremas
remasmataku
sampaiberair.AkujengkelsetengahmatipadaJimbronyangmenikmati
hukumanini.Aku
bencipadasenyumkekagumannyapadakudasaatakumenderita.Akujuga
sakithati
padaPakMustaryangketatmengawasipekerjaankami.
Bolehsajarangkingmutinggi,tapisoalkuda?Kautaktahuapaapa,Kal!!!

SementaranuntinggidilangitlangitWCadamanusialabalaba.Spiderman
Araisedang
merayapiplafon.Tubuhnyadiikattalitalitemali.Iamenyumpahnyumpah
sambil
mengikiskotorankelelewar.Sungguhhukumanyangmenggiriskan.
Kautakpunyajawabannya,kan?Baiklah,kalaubegitu..kubukarahasia
kehebatankuda
Libyapadamu!!
Wcinisudahhampirsetahundiabaikankarenakeranairyang
mampet.Tapimanusia
manusiacacing,paraintelektualmudaSMANegeriBukanMainyang
[Hamalan66dari168]

|
AndreaHirataSangPemimpi
tempurungotaknya
telahpindahkedengkul,nekatmenggunakannyajikapanggilanalamitu
tak
tertahankan.Denganhanyaberbekalsegayungairsaatmemasukitempat
sakralitu,mereka
menghinakandirinyasendiridihadapanagamaAllahyangmengajarkan
bahwa
kebersihanadalahsebagiandariiman.Dansekarangkamilahyang
menanggungsemua
kebejatanmoralmereka.
Bron!!Air!!Aiiiiiirrrrr!!

Selesaimengikisbidangbidangkecilubindenganpahatdanmenyikatnya
dengansikat
gigi,akuberlarikeluar.Melepaskansaputanganyangmelilithidungkudan
mengambil
udarasegardalamdalam.LaluberteriakagarJimbronmenyiramnya.Laki
lakilemah
lembutitukeluardariWCdengansantaisaja.Iamelenggangmenuju
sumur.
Jawabannyakar...karena...kud..kudaLibyaadalahkudayanghot!!

BetapaakumembenciWC.DimanamanakitaselalumenjumpaiWCyang
takkeruan.Di
rumahrumah,disekolahsekolah,dijambanumum,diterminal,dikantor
kantor
pemerintah,bahkandirumahrumahsakit.Mengapakitabegitujorok?
KudaLibyabisasembunyididalampasirpadasuhuempatpuluhlima
derajat,empat
puluhlimaderajar,Kal!!!Dapatkahkaubayangkanitu??!!Kalaukau
menguburdirimu
dalampasirpadasuhuempatpuluhlimaderajat,gusimubisamatang,Kal!!
Telingakupanastapiakudiamsaja.Bertahuntahundekatdengan
seharusnyadiatahu,aku
diampertandamarah.
TapiyanglebihhebatadalahkudaKanada,Kal.Bukanmainbinatangitu.
Aiiiihhh...bukanmainmamaliaitu!!!KudaKunadamandisaljupadasuhu
minusduapuluhderajat,Kal!!???Kalaukaumandidalamsuhuminusdua
puluhderajatKal,itulahmandimuyangterakhir!
InginakumenggosokgigiJimbrondengansikatubinWCini,tapiakumasih
sabar.

[Hamalan67dari168]

|
AndreaHirataSangPemimpi
KudaMongolia!!Ehmmm,Ikallebihhebatlagidarikuda
Kanada!!BerkelanadiGurun
Gobi,hewanliariruadalahbinatangbuas!!
Menundukmenekuriubinmembuatkepalakupening,ditambahbaupesing
yang
menyiksa.Setiapkalibangkitpandangankugelapberkunangkunang.Cerita
Jimbron
sepertiterorditelingaku.Suaranyakudengartimbultenggelam.Akumau
semaput.
TahukahriwayatkudaGalapagos,Kal?Binatangituawalnyaadalah
manusiadanpada
harikiamatnantiakanbangkitlagisebagaimalaikatseriburupa!
Perutkumual,Jimbronterusmemberondongkutanpaampundengan
beruparupacerita
kuda.
Kudabalap...kudasembrani...kudaJengishKhan...kudaIndia..tapalkuda...

Dansetiapakumendengarsatukatakuda,makasatuanaktanggaakunaik
kepuncak
kemarahan.Suatukemarahankarenarasabosanakanceritakudadari
Jimbronyangtelah
kutahansejakduajamyanglalu,sejakbertahuntahunyanglalu.Cerita
kudaJimbron
adalahtetesanairyangterusmenerusmenghujambatukarang
kesabaranku.Dansetelah
sekiantahun,sianginibatukarangituretak,beberapatetesairlagiiaakan
terbelah.
....KudaPersia...kudaAfrika...kudatroya...diperkuda..kudasiluman...

Akukelelahandanstres.Akutaktahanlagidengansiksaanhikayat
kuda.Semuakisah
kudaharusdihentikanhariinijuga!!
...Kudastallion...kudapegasus...kudabeban...keretakuda..Jimbron
terkekehkekeh
menceritakannya.
Karenabaupesingtaktertahankan,akubekerjasambilmenahan
napas.Akumegapmegap
sepertiikanterlempardariakuarium,menggelepardiatasubinini.
TapikudaAustralia!!Ya,kudaAus...tra..lia,adalahyangterhebatdari
semuajeniskuda
yangadadimukabumiini,Kal!!KudaAus...tra..lia!!!Bestofthebestofthe
bestofthe
[Hamalan68dari168]

|
AndreaHirataSangPemimpi
best!!Hewanitulebihtampandarimanusia!!
Darahkumendidih.Akumencapaipuncakemosi.
YangdapatmenandingikudaAustraliahanyakudaArab,Kal!!Tahukah
kaumengapa
piajantandijulukikudaArab?!!AstagaKal,kakibelakanghewanituseperti
ada
tiga!!Kaupahammaksudku??
Akhirnya,batukarangkesabarankuterbelah.Akumeledak.
Diaaaaaaaaaaaaaaaaaaaaaammmmmmmmmmmmmmmmm!!!Aku
bangkit,berteriak
sekuattenagamembentukJimbronsambilmembantingsikatgigi,lap,dan
pahat.
Brughh!!Araiyangtengahmengumpulkankotorankelelewar
terperanjat.Jikatidak
mengikatkandirinyapadabalokplafon,diasudahterhempaske
lantai..Kotorankelelewar
daritasAraitumpahsepertihujanbubukbelerangmenimpakepala
Jimbronyangberdiri
gemetar.Iatakmampubergerakkarenakagetpadagertakanku.
Akusudahmuak,Bron!!Muak!!Muak!!Muaaakk...denganceritakudamu
itu!!Apasudah
takadatopiklain?!!Taktahukahkau,Bron?Jiwamutelahdirasukisetan
kuda!!
Jimbronberdirimematung,pucatpasi.Iaseakantakpercayaakutega
membentaknya
sekerasitu.Iatakpercayakatakatakasarituterhamburdarimulutkudan
ditumpahkan
untuknya.Bibirnyabergetar,wajahnyapucatdansembap.Airmatamenepi
di
pelupuknya.Napasnyacepat.Diasangatterkejut,diasangattersinggung.Dia
tahuakutak
pernahmarahdanlebihdariituakutahupersisJimbronyangbesar
sepertipintu,yang
gempaldanpolos,adalahlakilakilemahlembutyangtakpernahdikasari
siapa
pun.PendetaGeovannytelahmembesarkannyadenganpenuhkehalusan
budidantutur
kata.
Kejadianiniterjadisepertirefleks,sangatcepatdiluar
kendaliku.Kemarahansetinggi
puncakgunungterjadididalamsatudetikdansekarang,padadetik
berikutnya,hatiku
[Hamalan69dari168]

|
AndreaHirataSangPemimpi
dinginsepertisebongkahes,terpurukjauhdalamjurang
penyesalan.Jimbrontakpernah
dihardikdengankerasolehsiapapundanakutakpernahberteriakseperti
kelakukan
oranggeladakkapalitu.
Ah!!AkutelahmelukaihatiJimbron.Hatinyayanglunakdan
putih.Bukankahakuselalu
berjanjipadakusendiriakanselalumelindungiJimbron?Akumenendang
emberdi
dekatkukarenamarahpadadirikusendiri.Akusedihmenyadariadasosok
laindalam
dirikuyangdiamdiamsembunyi,sosokyangtakkukenal.Sosokitu
menjelmadengan
cepat,lalumendadallenyapmeninggalkanakuberdirisendirididepan
Jimbrondi
tumpukibertontonperasaaanbersalah.BersalahpadaJimbron,bersalah
padaPendeta
geo,bahkanpadaArai.Lututkulemas.Akumerasasebagiandirikutelah
mengkhianati
bagiandirikuyanglain.
Akumenghampirinya,Melepaskansiangyangmelingkarilehernyadan
membimbingnya
keluar,Tubuhnyamasihbergetar.Sambilkueluselus
punggungnya,kubimbingiaberjalan
menujukantinssekolahyangtelahsepi.Jimbrontersedusedantanpaair
mata.Dadaku
sesakdibuatnya.Kupesankantehmaniskesenangannyadengancangkir
terbesaryang
ada.Jimbronmasihshock.Iabenarbenarterpuku.
Maafkanaku,Bron...,katakulembut.Tapimemangsudahsaatnyakau
berhenti
memikirkankuda...
Jimbronmemalingkanwajahnya,jauhmemandangpadangrumput
sekolah.Iaseperti
berkontemplasi,merenungkanketidaknormalannyaselamaini.
Lihatlah,apayangkitadapatdaripembicaraantentang
kuda?Pertengkaranyangburuk
inilahyangkitadapat,Kawanku..,kuusahakangayabicaraku
sebijaksana
mungkin,sepertipenyuluhKUAmenasihatiorangyangingintalaktiga.
Hanyamudharat,Sahabatku..,danmenyebutsahabatkuitu,kubuat
nadakuselembut
[Hamalan70dari168]

|
AndreaHirataSangPemimpi
sutradariKashmir.Jimbronmenunduk.Tampakberpkirkeras
mempertimbangkan
sesuatu.Tampakpulaguratpenyesalandalamdirinya.
Kisahkudainisudahketerlaluan,Kawan....Tidakkahkauingat.sejakkita
SDdiajar
mengajiolehTaikongHamim,sejakitutakadahallainyangkaupedulikan
selain
kuda?SekarangkitasudahtidakSDlagi,Bron.Sebentarlagikitadewasa.Kau
tahukanarti
menjadidewasa,Bron?Akilbalighmenurutketentuanagama?
Jimbronmenganggukhalus.Kulihatupayakerasdalamdirinyauntuk
memahami
kesalahandanpenyakitnya.Melihatreaksinyayangsepertiinginsekali
sembuhdari
penyakitobsesikuda,akusemakinbersemangatmenasehatinya.
AkilBaligh,artinyasemuaperbuatankitatelahdihisabolehAl
ah,Bron.Dan
Kawanku,Allahtidaksukasesuatuyang
berlebihan.Ingat,Kawanku,ketidaksenangan
AllahakanhalitudifirmankandalamAlQuranNulKarim.Bukankahkau
sependapat
kalaupersoalankudainisudahberlebihlebihan,Kawanku?
Ah,hebatsekalowejanganku.TaksiasiaulanganFikihkudapatnilaitujuh!

Jimbronterenyuh.Dadanyanaikturunmenahankanrasa.Wajahnyayang
polosdilanda
keharuanyangdalampadanasihatku.Iaberkalikalimenariknapas
panjang.Danyang
palingmenyenangkanku,wajahnyaberangsurcerah.Iasepertiorangyang
barusadardari
sebuahmimpiyanggelapgulita.Matanyamulaibersinar.Akumakin
menjadijadikarena
akumelihatpeluangkaliiniakanmampumembuatperubahanpada
Jimbron.
Sahabatku,banyakhallainyanglebihpositifdiduniaini.Banyakhallain
yangamat
menarikuntukdibicarakan,misalnyatentang...mengapakita,orang
Melatu,yanghidupdi
atastanahtimahkayarayatapikitasemakinmiskinharidemihari,atau
tentang...bupati
kitayangbaruitu,apakahiaseoranglakilakisejatiatautaklebihdari
seorangmaling
[Hamalan71dari168]

|
AndreaHirataSangPemimpi
sepertiyangsudahsudah,atautentangcitacitakitamerantaukeJawa,naik
perahu
barang,dantentangrencanakitasekolahkePrancis!!MenginjakEropa
sampaike
Afrika!KitaakanjadiorangMelayupedalamanpertamayangsekolahke
Prancis!!Bukan
mainhebatnya,Bron!!

DanakugembirasekalikarenatibatibadisudutbibirJimbrontersungging
senyum
kecil.Kesedihannyamenguap.Matanyaberbinar.Iamenganggukangguk
mafhumseakan
iasetujupadasaranpositifkuitu,seakaniamengakuikesalanhannya
selamainidan
sangatmenyesal.Iamemegangkepalanya.Rautwajahnyaberubahmeriah
danlapang
karenasesosokbebangelapyangberatbarusajaterbangmeninggalkan
jasadnya.Sim
salabim!Jimbrontelahmendapatpencerahansekaliguspenyembuhan!Aku
takjubdan
girangtakkepalang.Janganjangansepertiorangmeregangnyawayang
bisadihidupkan
lagidengandayakejutlistrik,shockkarenagertakankutadijustrutelah
mengobati
Jimbrondarisakitkhayalankudayangakut.
Oh,betapasukacitanyaaku.Akutelahmendobrakruangpekatdikepalanya
dimanaia
terkuncidalamperangkapobsesifkompulsifterhadapkuda.Akutelah
membebaskannya
daripenderitaanyangtelahbelasantahunmenderanya.obsesifkompulsif
adalahsiksaan
yangtakterperikan,apalagiterhadapkuda.Takterbayangkanbagaimana
Jimbrondapat
bertahansekianlamatanpamenjadisinting,Syukurlah,Jimbron,sahabat
yangpaling
kusayangi,hariinitelahsembuhdaripenyakitgilakuda!!Ingingrasanya
akumerayakan
hariyangluarbiasainidenganberdermakepadaseluruhanakMelayu
yatimpiatu.
Jimbronmeraihtanganku,menyalamikudenganerat,danmengguncang
guncang
tanganku.Senyumnyamanisdanpasti.Ekspresinyajelasmengesankan
[Hamalan72dari168]

|
AndreaHirataSangPemimpi
bahwaiatelah
meninggalkanmasalaluyangkelammencekamdansiapmenyongsong
masadepanyang
cerahbercahaya,Kamisalingberpandangandalannuansayangsangat
menyentuh,sampai
akumenitikkanairmata.Akubenarbenarterharukarenaakutahusudah
banyakorang
berusahamenyembuhkanJimbrontapimerekasemuagagal.Bahkan
Jimbronhampir
dimandikandengankembangtujuhrupauntukmenghilangkanbayang
bayangkudayang
terusmenerusmenghantuinya.Kinidadakuinginmeledakrasanya.Pada
momeninikami
memahamibahwapersahabatankamiyanglamadanlekatlebihdari
saudara,berjuang
senasibsepenanggungan,bekerjakerasbahumembahusampaititik
keringatterakhir
untuksekolahdankeluarga,tidursebantalmakansepiring,susahsenang
bersama,ternyata
telahmembuahkanmaslahatyangtakterhinggabagikami.Persahabatan
berlandaskan
cintakasihitutelahmerajutikatanbatinyangdemikiankuatdalam
kalbukudansaking
kuatnyasampaimemilikitenagagaibpenyembuhan.
Ikal...!!panggilnyahalussekali,penuhrahasia,danbersemangat.Sebuah
panggilan
bermaknaungkapanterimahkasihyangbesarkarenaaku
telah
menyelamatkannya,sekaligusmengandungpermohonanmaafyangtulus
sertaharapan.Ia
sangatterharuterhadapkemampuankumenyembuhkanpenyakitgila
kudanyayangtelah
kronis.
Ya,Jimbronsaudarakuyangbaikhati...,jawabkulembutpenuhkasih
sayang.Rasanya
inginsekaliakumemeluknya.
Sudahpernahkahkuceritakanpadamusoalkudaponi?

[Hamalan73dari168]

|
AndreaHirataSangPemimpi
Mozaik12
SungaiLenggang

Akuselaluberlari.Akumenyukaiberlari.Parakulingambatadalah
pelari.Ikanhiudan
pariyangpanjangnyaseringsampaiduameterakanmengayunbamboo
pikulanseperti
goyanganpenyanyidangdutdandayatendingayunannyahanyabisa
distabilkandengan
memikulikanikanpanjangitusambilberlari.Taksusahbagikuuntuk
terpilihjadi
sprinterSMANegeriBukanMain.
Akuberlariberangkatsekolah.Amboi,akusenangsekaliberlarimenerobos
hujan,seperti
selendangmenembustiraiairberlapislapis.Akutakpernahkelelahan
berlari.Tubuhku
ringan,kecil,danramping,denganrambutikalpanjangdankancingbaju
yangseringtak
lengkap,jikaberlariakumerasasepertiorangIndian,akumerasamenjadi
layangankertas
kajangberwarnawarni,akumerasaseumpamabendaseniyangmeluncur
deras
menerabasangina.
Akuselaluberlaripulangsekolahtapisiangini,didepanrestoranmi
rebus,langkahku
terhenti.Akuterkejutmelihattigaorangdidalamrestoran:aku
sendiri,Arai,danJimbron
tengahmembereskanpuluhanpiringkotoryangberserakandiatas
meja.Akuberlari
lagi,memandangitigaorangyangkukenalitusampaijauh.
Akukembaliterhentimelihattigamobilomprenganreyotdidepankantor
syahbandar.TigaorangkernetnyaArai,Jimbron,danakusendiritermangu
mangu
menunggupenumpangkeTanjongPandan.Akuketakutanmenyaksikan
oranglaintelah
menjelmamenjadidiriku.AKukaburpontangpanting,Sampaidilos
kontrakanaku
kehabisannapas.Dannundisana,diSemenanjungAyah,akumerinding
melihat
Arai,Jimbron,danakusendiriberpakaiancompangcamping,memikul
[Hamalan74dari168]

|
AndreaHirataSangPemimpi
karungbuahkweni.
Berharihariakumemikirkankejadiananehitu.Dansianginiaku
menemukan
jawabannya.Karenasianginiakuberhasilmembongkarsuatu
rahasia.Sekarangaku
mengertimengapahokummembolehkanorangberusiadelapanbelas
tahunkeatas
menimbunidirinyadenganberuparupakeborokan,sebabpadausiaitu
manusiasudah
bisabersikaprealistis.Itulahrahasiayangkutemukan.Ajaib,bagaimana
manusia
meningkatdarisatusituasimoralkesituasimorallainnya.Hariinisayap
sayapkecil
tumbuhdibadanulatkepompong,akubermetamorfosisdariremajake
dewasa.Aku
dipaksaolehkekuatanalamuntukmelompatogarisdarimenggantungkan
dirimenjadi
mandiri.AKudipaksabelajarbertanggungjawabpadadirikusendiri.Satu
lapisantipis
seolahtersingkapdimatakumembukatabirfilosofisyangpastimenjadi
orangdewasa
yaitu:hidupmenjadisemakintakmudah.
Akusendiri,Jimron,danAraiyangkusaksikanmembersihkanmejadi
restoran,menjadi
kernet,danpedagangkwenitaklainadalahmanifestasidarisikapkuyang
telahbisa
realistis;karenausiakutelahmenginjakdelapanbelas.Kiniakusadar
setelahmenamatkan
SMAnasibkuakansamadengannasibkeduasahabatkuwaktu
SMP;Lintangdan
Mahar.LintangyangcerdasmalahtaksempatmenyelesaikanSMP.Sungguh
takadil
duniaini;seorangsiswagardadepansekaliguspelarigesitberambutikal
mayangakan
berakhirsebagaitukangcucipiringdirestoranmirebus.
BeradadalampergaulanremajaMelayuyangseharianmembanting
tulang,mendengar
pandanganmerekatentangmasadepan,danmelihatbagaimanamereka
satupersatu
berakhir,lambatlaunmemengaruhikuuntukmenilaisituasikusecara
realistis.Namun,tak
pernahkusadarisikaprealistissesungguhnyamengandungbahayasebab
[Hamalan75dari168]

|
AndreaHirataSangPemimpi
iamemiliki
hubunganlineardenganperasaanpesimis.Realististaklainadalahpedal
remyangsering
menghambatharapanorang.
Sekarang,setiapkaliPakBaliamembuaikamidenganpuisipuisiindah
Prancisakuhanya
menunduk,menghitunnghariyangtersisauntukmemikulikandan
menabung.Dansampa
diloskontrakan,melongokkedalamkalengcelengankuyangpenuh,penuh
olehuang
receh,darahmasamudakuyangberapiapiperlahanpadam.Akusangat
Mafhum,bahwa
tabungankuitutakakanpernahmampumembawakukeluardaripulau
kecilBelitong
yangbaukaratini.Bagikami,harapansekolahkePrancistakubahnya
pungguk
merindukandipelukpurnama.serupakodokingindiciumputriagar
berubahjadi
pangeran.AltarsucialmamaterSorbonne,menjelajahEropasampaike
Afrika,hanyalah
muslihatuntukmeniputubuhyangkelelahanagartegarbangunpukuldua
pagiuntuk
memikulikan.Kamitaklebihdariorangyangmenggadaikanseluruh
kesenanganmasa
mudapadakehidupandermagayangkeras,hiduptanpapilihandanbelas
kasihan.
Kiniakutelahmenjadipribadiyangpesimistis.Malasbelajar.Berangkat
danpulang
sekolahlarikutaklagideras.Hawapositifdalamtubuhkumenguapdibawa
hasutan
hasutanpragmatis.Untukapaakumemecahkankepalakumempelajari
teoremabinomial
untukmengukurbilangantakberhinggajikayangtakberhinggabagiku
adalah
kemungkinantakmampumelanjutkansekolahsetelahSMA,jikayangakan
kuukurnanti
hanyajumlahikanyangtelahkupikulagarmendapatbeberapaperakuang
recehdari
nakhoda.Buatapaakubersiteganguratleherberdebatdikelassoal
geometriruang
Euclidianyangrumit,jikayangtersisauntukkuhanyasebuahruanglos
sempit2x2
[Hamalan76dari168]

|
AndreaHirataSangPemimpi
meterdidermaga.Pepatahkusekarangadalahpepatahkonyolkulikuli
Meksikoyang
pataharangdengannasib:ceritakanmimpimu,agarTuhanbisatertawa.
Tapisebaliknya,demiTuhan,sahabatkuJimbronmemangmakhlukyang
luarbiasa.Meski
peningkatanprestasinyaamatmengesankaniabarusaja
mempersembahkantempat
duduknomor128padaPendetaGeodarinomorkursi78semester
sebelumnyatapiia
sangatoptimis.
Soreiniiasudahberdiritegakdidermagamenunggukapanbarang.Minggu
laluia
memesansesuatupadamualimkapal,sahabatnya.
PakCik,tolongbelikanakucelengankudadiJakarta.
Jimbronmenjadisahabatmualimkarenatelahmembantunyamenyetrika
tatonya.Setelah
tuadaninginsalatsangmualimbarumenyadariketololanmasamudanya
menato
tubuhnya.
Duabuah,PakCik,duabuah...
Takcukuphanyasatu,Bron??
Dua,PakCik,kalaubisayangberwarnaputihdanhitam.

Sudahtahukesintingannnyaakankuda,mualimitutaklagibertanya
mengapasatu
celengankudasajatakcukup.Satucelengankudaadalahapayangkita
sebut
normal,adapunduacelengankudakitasebutobsesif
kompulsif.Abnormalitasadalahisu
yangpasuntukJimbron.Danhariiniiasenangtakterperikarenacelengan
sebesaranak
kambingitudatang.
Celenganuntukmelanjutkansekolah!!pekiknyabersemangat.
Kamimengamatikudadaritanahliatdalamgendongannya.Takberminat
membahasnya,tapiJimbronsudahsepertiorangkebeletpipis,takkuat
menahancerita
kudanya.
Ah,inihanyakudakudalokalsaja,Kawan,tapicantikjugabukan...???
Seakankamibertanya,seakankamipeduli,seakankamisangattertarik.
YanginijelaskudaSumbawa...danyangputihini,kalaukutengok
hidungnya,ah,ini
ku..kudasandelsaja,populasinyabanyakdiJawaBarat,biasadipakaiuntuk
[Hamalan77dari168]

|
AndreaHirataSangPemimpi
hiburan
delmankelilingkota..
Banggasuaranya,senanghatinya,dancerahwajahnya.Ia
melenggang,memindahkan
tabungannyadaribawahkasurdanmembaginyarataduabagian.Masing
masingbagian
itudimasukkankedalamkudahitamdankudaputih.Nantisetiapia
mendapatupahdari
nakhoda,dibaginyaduadenganratadandimasukkannyakedalamkedua
celengankuda
itu.Kamihanyabisamenggelenggelengkankepala.
Meskipunkaupenuhicelengansebesarkudasungguhan,sahabatku
Jimbron,takkan
pernahuanguangrecehitumampumembiayaimusekolah
Perancis...,demikiankata
hatiku.Dandengarlahitu,Kawan.Siratankalimatsinisdariorangyang
pesimis.Sungguh
berbisasengatansikappesimis.Iaadalahhantuyangberacun.Sikapitu
mengekstrapolasi
sebuagkurvayangturunkebawahdanakanterusturunkebawahdan
telahmembuatku
menjadipribadiyanggelapdanpicik.Seyogyanyasikapburukyang
berbuah
keburukan:pesimistismenimbulkansinis,laluiri,laludengki,lalumungkin
fitnah.Dan
dengarlahini,Kawan,akibatnyanyatasikapburukitu
Tujuhpuluhlima!!Sekalilagi75!!Itulahnomorkursiayahmusekarang...
AkudipanggilPakMustar.DengangayaorangMelayutulenaku
disemprotnyahabis
habisan,Hanyatinggalsatusemesterlagitamat
SMA,memalukan!!Memalukanbukan
buatan!!
Keterlaluan!!OrangsepertimupatutdibuatsekandangdenganMalin
Kundang,Itulah
orangsepertimu,kalaukauingntahu!!Sangkamukausiapa??Pythagoras
apa?DiSMA
yangketatbersainginikaupikirbisamenjagakursimudenganbelajar
sekehendak
hatimu!!??
Suaranyaberatpenuhsesal.Iamemanggarangtapisemuaorangtahu
bahwa
sesungguhnyaiapenuhperhatian,hanyacaranyasajayangkeras.
[Hamalan78dari168]

|
AndreaHirataSangPemimpi
Kinikauterdepakjauhdarigardadepan??
Iamenatapkugeram.Marah,takhabismengerti,adasatukilatan
kecewa,kecewayangsakit
jauhdidalamhatinya.Iamemandangjauhkeluarjendela.Diam.Laluia
berbalik
menatapku,suaranyatertahan,Tahukkahkau,Bujang??Sepanjangwaktu
akubermimpi
anakkududukdikursigardadepanitu...
AkuterharumelihatmataPakMustarberkacakaca.

KiniiasekolahdiTanjongPandan,diSMAyangmonyetpunjika
mendaftarakan
diterima!!Dankau,kausiasiakankehormatangardadepanitu!!??Mengapa
kauberhenti
bercitacita,Bujang?Pahamkahengkau,berhentibercitacitaadalahtragedi
terbesardalam
hidupmanusia!!
Akumenundukdiammenekurikatakatayangamatdalam
maknanya.Katakataitu
menusuknusukporiporiku.
Suratundangansudahkuposkanpadaayahmu,dapatkaubayangkan
perasaanbeliau
sekarang??
Danketikanamaayahkudisebut.Akusontaksadar,sikappesimistelah
mengkhianatiku
bulatbulat.Akukecewa,kecewayangsakitjauhdidalamhatiku.
Akuberanibertaruh,ayahmutakkansudidatang.

Akumenciut,lemasditikamperasaanbersalah.

Wanprestasi!!Ciderajanji!!Anakyangtakmampumemenuhiharapan
orangtua!!Tak
tahukahengkau,Bujang??Takadayanglebihmenyenangkanayahmuselain
menerima
rapormu??
Hatikusakit,perihsekali.
Kamulahharapanbeliausatusatunya,Ikal.
Seluruhairyangadadalamtubuhkunaikkekepalaku.
Ah,ayahmu,Ikal,diundangpelantikanbupatipunbajusafarinyatakbeliau
keluarkan.HanyauntukmuIkal,yangterbaikdaribeliauselaluhanya
untukmu...
Airitutumpahruahberlinanganmelaluimataku.MalamturundiMagai
[Hamalan79dari168]

|
AndreaHirataSangPemimpi
sepertihanya
untukku.KatakataPakMustarlaksanagelapyangmengikatkurapat
rapat,menyiksaku
dalamdetikdemidetikyangamatlamaseumpamapergantian
musim.Akankahesok
ayahkudatang?Akumengutukidirikusendiri.
Taksepicingpunakudapattidur.Akuterpurukdalamsekali.Takpernah
akumengalami
malamyangtakkunjungberakhirsepertiini.Dalamsituasimoralyang
paling
rendah,kenanganlamayangpedihseakanhidupkembali,menyerbuku
tanpa
ampun.Bayanganitusepertifilmyangberputarputar
mengelilingiku,menarinariseperti
hantu.AkumelihatAraianakkecilyangmenunggukuditengahladang
jagung,aku
teringatperpisahandengansahabatku,Lintangyangmenghancurkan
hatiku,akuteringat
nasibpiluseoranglakilakibernamaBodenga,danakusadarbetapasejak
kecilkamitelah
menjalanikehidupanyangkerasdemipendidikan.
***********
PagipagisekaliakudanAraitelahmenungguayahkudenganharapan
yangamattipis
beliauakandatang,Dankamimaklumjikabeliauengganbersusahpayah
berangkatpagi
butamengayuhsepedatigapuluhkilometer,melewatiduabukitdan
padang,hanyauntuk
dipermalukan.
Sejakmengetahuiakuterdepakdarigardadepankarenakepicikanku
sendiri.Araisudah
malasbicaradenganku.Akugelisahmenyaksikanparaorangtuamurid
berduyunduyun
menujuaula.Matakulekatmemandangijalandiluargerbang
sekolah.Ayahkutak
kunjungtiba.Araimenatapkubenci.Hatikuhampa.
Tapitibatibamatakusilaumelihatkaplampualuminiumputihdari
sepedayangdikayuh
seorangpriaberbajusafariempatsaku.Iamengayuhsepedanya
kelelahanm,terseok
seok,dansemakincepatketikamelihatkami.Berhentididepankami,pria
itumenyeka
[Hamalan80dari168]

|
AndreaHirataSangPemimpi
keringatnya.Akutertegundandadakusesalmelihatlipatanmengilap,serta
kumisdan
rambutnyayangdicukurrapi.Beliauakandudukdikursinomor75namun
beliautetap
cutiduahari,dantetapmelakukanproseduryangsama,dengansuasana
hatiyang
sama,untukmengambilraporku.Harumdaunpandandaribajusafari
ayahkumembuatair
matakumengalir.meskipunakankupermalukan,ibukutetapmerendam
daunpandan
seharisemalamuntukmenyetrikabajusafariayahku.Danayahkudengan
senanghati
datangjauhjauhmengambilraporkudenganbajunyayangterbaik,dengan
bajunyayang
palingwangi.Akutakmampubicaraketikabeliaumenyapakamidengan
salampelan

Assalamualaikumtersenyum,danmenepuknepukpundakkamidengan
bangga,persis
samasepertikebiasannyaselalu.
Membayangkanapayangdialamiayahkudidalamaula,kurasakanseakan
langit
mengutukkudanbangunansekolahrubuhmenimpaku.Taklagikudengar
tepuktangan
ketikanamaayahkudipanggiluntukmengambilraporku.Yangkudengar
hanyaorang
kasakkusukbertanyamengapaprestasisekolahkusampaianjlok
begitu.Bagaimana
ayahkuyangpendiamakanmenjawabberondonganpertanyaanyang
hanyaakan
menyakitihatinya?Akuterpurukdalampenyesalan.Betapaakuinianaktak
berguna!!Betapasampaihatipadaayahku.
Sungguhberatdetikdemidetikkulaluimenungguayahkukeluardari
aula.Dan
akhirnya,beliaumeninggalkanaula.Langkahnyatetaptenangsepertidulu
akumasih
berprestasi.beliaumenghampirikamidantersenyum.Senyumituadalah
senyum
kebanggaankhasbeliauyangtaksedikitpunluntur,persissepertidulu
ketikakumasihdi
gardadepan.Ketikabeliaumenatapkamisatupersatu,masihjelaskesan
bahwaapapun
[Hamalan81dari168]

|
AndreaHirataSangPemimpi
yangterjadi,bagaimanapunkeadaankami,kamitetaplahpahlawan
baginya.Beliau
senantiasamenerimaapapunadanyakami.Akutertundukdiam,hatiku
hancurdanair
matakukembalimengalir.Sepertikebiasaannya,beliaumenepuknepuk
lembutpundak
maidanmengucapkansepatahsalamdenganpelan.Akutersedusedan
melihatayahku
menaikisepedanyadantertatihtatihmengayuhnya
meninggalkanku.Dadakuingin
meledakmemandangipunggungayahkuperlahanlahanmeninggalkan
halamsekolah.
Puaskahkausekarang!!??Araimenumpahkankemarahannyapadaku.
Akumembelakanginya.
itukahmaumu?Melukaihatinya??
AkumasihmembelakangiAraikarenaakutakinginmelihatpipikutelah
basah.
Apayangterjadidenganmu,Ikal??Mengapajadibeginisekolahmu?Ke
manasemangat
itu??Mimpimimpiitu??!!
Araigeramsekali.Iatakhabismengertipadaku.
Biarkautahu,Kal,orangsepertikitatakpunyaapaapakecualisemangat
danmimpi
mimpi,dankitaakanbertempurhabishabisandemimimpimimpiitu!!
Akutersentakdanterpakumemandangiayahkusampaijauh,bentakan
bentakanArai
berdesingandalamtelingaku,membakarhatiku.
Tanpamimpi,orangsepertikitaakanmati...
Akumerasabeku,serasadisiramseemberaires.

MungkinsetelahtamatSMAkitahanyaakanmendulangtimahatau
menjadikuli,tapidi
siniKal,disekolahini,kitatakakanpernahmendahuluinasibkita!!
Mendahuluinasib!Duakatayangmenjawabkekeliruankumemaknaiarah
hidupku.Pesimististaklebihdarisikaptakaburmendahuluinasib.
Kitalakukanyangterbaikdisini!!Dankitaakanberkelanamenjelajahi
Eropasampaike
Afrika!!KitaakansekolahkePrancis!!Kitaakanmenginjakkankakidialtar
suci
[Hamalan82dari168]

|
AndreaHirataSangPemimpi
almamaterSorbonne!Apapunyangterjadi!!
Araiberteriak.Suaranyalantangmemenuhilapanganluassekolah
kami,menerobosruang
ruanggelapkepicikandalamkepalaku.KataKatanyaitusepertisumbuaki
yangmen
chargebateraidalamtubuhku.
Seketikamatakuterbukauntukmelihatharapanbesaryangtersembunyi
didalamhati
ayahku.Ayahkuyangselaludiam,tapernahmenuntutapapun.Aku
bergetar.Kupandangi
jalanlurusdidepanku,berpuluhpuluhkilometermenujukampungku.Aku
inginmenyusul
ayahkudanakumulaiberlari.Akumelintasihalamanhalaman
sekolah,kompleks
perkantoran,danpasar.Akuberlarimelaluikampungkampungkecil
sampaikeluar
Magai,tapiakutakmelihatayahku.Beliaujauhdidepan.Mataharisudah
condong,aku
berlaridiatasaspalyangpanas,akumaratontakberhenti.Akumenolak
ajakankendaraan
kendaraanyangmelewatiku.Akukelelahantapiakuakanberlaridanterus
berlarisampai
kujumpaiayahku.Kiniakusampaidijalanpanjangyangtampakseperti
garishitam
membelahpadangsabanayangluas.Semakbelukarmeliukliukkeemasan
disirami
cahayamatahari,bergulunggulungdiadukanginyangterlepasbebas.Di
sana,diujung
garisyangsunyiitukulihatsatunoktah,ayahku!!Akuberlarisemakin
kencangseperti
layangankertaskajangberwarniwarni,sepertiorangIndian,Akuberlari
sampaiperih
kakikakiku,Akuberhasilmenyusulayahkuketikabeliausudahberadadi
tengah
jembatanLenggang.Saatakuberlaridisampingsepedanya,ayahkuterkejut
dan
tersenyum,Sebuahsenyumlembutpenuhkebanggaan.
Ikal...,katanya
Kuambilalimengayuhsepedanya,beliaududukdibelakang.Tangankulinya
yangkasar
dantuamemelukpinggangku.Ayahkuyangpendiam:ayahjuarasatu
seluruh
[Hamalan83dari168]

|
AndreaHirataSangPemimpi
dunia.Mataharisoreyanghangatbercampurdengananginyang
dingin,membelaibelai
kamimelaluijembatankayu.DibawahkamisungaipurbaLenggang
mengalir
pelan.Gelapdandalam.Hulunyamenyimpansejarahpiluorangorang
miskin
Melayu,anakanaksungainyaadalahmisteriyangmengandungtenaga
mistis,danriak
riaknyayangberkecipungsiangdanmalamadalahnyanyiansunyirasa
sayangkuyang
takbertepiuntukayahku.

[Hamalan84dari168]

|
AndreaHirataSangPemimpi
Mozaik13
PangeranMustikaRajaBrana

PernahkahKawanmelihatorangdisambarpetir?Akupernah,beberapa
kalo.Kamitinggal
dekatlaut,memilikihamparanpadangdandibawahpadangituberlipat
lipatmaterial
tambang.Komposisisemacamitumungkinmenimbulkangodaanbagi
anakanaklisrikdi
langituntukisengisengberkunjungmenciumtanahBelitong.Danbagi
siapapunyang
menghalangimuhibahnya,tanpaampun,Byarrrrrr!!!!Setrumribuanvolt
langsung
membuatsetengahtubuhlebamhitam.Jikayangkenasambarpendulang
timah,diperlukanpalingtidakduaoranguntukmelepaskandulangdari
genggaman
jasadnya.
Orangyangdisambarpetirmemilikiekspresidansikaptubuhyanganeh
seolahtubuhnya
dimasukimakhlukasingdanmakhlukasingitumengambilalihjiwanya.Di
atasfondasi
kepercayaansepertiitulahorangorangMelayutempodulumeletakkan
carayang
spektakuleruntukmenyelamatkankorbansambaranpetir.Jikaadakorban
petiryangtak
langsungtewas,dukunMelayu,dalamhalinidukunlangit,segera
menyalakanapidi
bawahtungkuyangpanjang.Ditungkuitudijejerdaundaunkelapayang
masihhijau
lengkapdenganpelepahnya.Dandiatasdaunkelapaitulahsangkorban
dipanggang,di
barbuque.Maksudnyauntukmengusirdedemitlistrikdaridalam
tubuhnya.Percayaatau
tidak,carainiseringsukses.Penjelasanlogisnyabarangkaliadapada
seputarreaksiantar
asap,panasapi,listrik,sugesti,dantipumuslihatduniagelap
perdukunan.Adapunyangtak
sempattertolong,sepertiyangterakhirkulihat,seorangpencarinira
disambarpetirsaat
memanjatpohonaren.Iawafatditempat,lekatdipohonitu,kedua
tangannyatakdapat
[Hamalan85dari168]

|
AndreaHirataSangPemimpi
diluruskan.Iadikafanidandikuburkandengansikaptanganseperti
seorangdirigen
orkestrasedangmengarahkanlaguAkuseorangKapiten.
Dangestursepertiitulah,kakutakbergerak,yangditampilkanJimbron
waktumendengar
kabaryangamatmengejutkannyasiangini.Akutergopohgopohmembawa
beritaitu
padanya.
Bron!!Sudahkahkaudengarkabaritu??
Kabarapa,Ikal...?jawabnyalembut.Walaupunlangitakantumpah,ia
selalutenang.Ini
salahsatusifatnaturalnya.WaktuituJimbrontengahmenyiangilabuyang
akansegera
digarapnya.Iamemunggungiku.
Capoakanmemeliharakuda!!
TubuhJimbronmendadaksontakmenjadikayu.Miriporangdisambar
petir.Tangannya
menggantungpersisdirigen,atausepertirobotkehabisanbaterai.Ia
menolehpadakutapi
tubuhnyatakberbalik,hanyalehernyayangberputardenganukuran
derajatyangtak
masukakal.Hampirseratusdelapanpuluhderajat!iasepertiburunghantu.
Ja...ja...ja...jajajaja...
Diatakdapatmelanjutkankatakatanya.Gagapmenerkamnya.Tapiaku
tahu
maksudnya,jangankaumainmain,Kal!!

Serius,Bron.Kudengardipasar,semuaorangmeributkannya!!

Min...Min...,maksudJimbrontentuMinar.

Ya,Minar.

Minar,asistenjururiaspengantin,hululedakgosipkampungkami.Jikaada
gosipdiPasar
Ikan,pastidiabiangnya.
Ta..ta..ta..ta..ta..

Takadatapi,Bron.

Ber...ber..

[Hamalan86dari168]

|
AndreaHirataSangPemimpi
Tujuhekor!!

Kap...kap...dar..dar..

Duaminggulagi,danpercayalahkau,Bron??DariAustralia!!

Jimbronsepertiorangyangmaupingsan.Napasnyacepat,bolamatanya
mengembang,dan
telinganyategak.Kuambilkaniaairminum.Tangannyamasihseperti
dirigen.
Beritatentangkudaitusegerahangatdimanamana.Diwarungwarung
kopi,dibalai
desa,dipasar,dandikantorkantorpemerintah,setiaporang
membicarakannya.Banyak
komentar,memangkegemaranorangMelayu.Tapialasannyautamanya
adalahkarena
siapapundikampungkamitakpernahmeliharseekorkudahidup
hidup.Bagikami,kuda
adalahmakhlukasing.DikampungorangMelayupedalamantakada
kuda.Jangankan
kuda,keledaipuntidak.ZamanduluorangMelayubepergiannaikperahu
atauberjalan
kaki,Kudatakpernahsecuilpundisinggungdalammanuksripkuno
Melayu.Kudabukan
merupakanbagiandarikebudayaanMelayu.
Ributributsoalkudasebenarnyabukanbarukaliini.Sejakadatanda
tandaBelitongakan
bernasibsepertiBabyloniakarenaPNTimahmulaimegap
megap,pemerintahberusaha
mencarikanjalankeluarbagiorangMelayupedalamanagartidakberakir
serupaorang
Etiopia.Parapetugaspertanianberdatanganmemberipenyuluhantentang
cocoktanam
danbudidaya.BeberapamahasiswaBelitongyangtengahkuliahdiJawa
danbercitacita
muliamembangundesanyasehingganasibpendudukBelitongjadilebih
baik,pulang
kampung.Masyarakatdikumpulkandibalaidesa.Merekaberebutan,berapi
api,memberi
petuahyangmerekadapatdaribangkukuliah.
Jikadikerukterus,timahdibawahtanahsanaakanhabis,Bapakbapak!!Ia
tidakakan
[Hamalan87dari168]

|
AndreaHirataSangPemimpi
beranakpinaksepertikitakitaini,MakaBapakbapakharusmen
transformdirisendiri
dariseorangburuhtambangdenganmentalitaskulimenjadipetani
denganmentalitas
pedagang...:
Demimendengarkatatransformitu,parakulimentahmenghirupkopi
pahitnya,berpandangansesamamereka,lalutersenyumdansaling
menunjukkansatujari
telunjuknya.
Kitaharusmembangunirigasi!Harusbelajarmenanamjagungdan
bersawah!Paradigma
kerjasemuasektorharuspuladiubah.Mulaisekaragnkita,orangMelayu
pedalamandi
Belitongini.harusberpikir,berjiwa,danbertabiatsepertipetani!!Kitaakan
segeramenjadi
komuniatasagraris!!
Parahadirin:kepaladesa,carikjurutulis,penghulu,asistenjururias
pengantin,para
pesira(jurumasakkenduri),paradukun,danratusankulitambangtadi
bertepuk
tangan.Padakesempataninihadirseluruhdukunberbagaikeahlian:dukun
buaya,dukun
angin,dukunapi,dukunlangit,dukungigi,dandukunhujan.Rupanyapara
dukundi
kampungkamisudahmenerapkanspesialisasijauhharisebelumahliilmu
manajemen
PeterDruckermenyarankanhalyangsamapadaindustrimodern.
Parahadirinitusenangsekalimendengarkatayangbarupertamakali
mereka
dengar:Paradigma.Kedengarannyasangatrenyah,beradab,tinggi,dan
sangatbuku.Hebat
sekalididikanorangJawamemangjempolan.meskipunpernahkutemuidi
beberapabuku
Jawadisebutsebagaiimperialismodelbaruditanahairtapidalam
mendidiksaudara
saudaranyadidaerahmerekacanggihbukanmain.Danparahadirinpun
serentak
menunjukkanduajarinya.Akumasihbelummengertimaksudmereka.
Selaindaripadaitu...

Mahasiswayangsatuinigayanyalain.Iatidakmeledak
ledak,Kalem,menurut
[Hamalan88dari168]

|
AndreaHirataSangPemimpi
keyakinannyaadalahcerminpribadiberpengetahuanmumpuni.Dania
pastimenirugaya
seorangprofesorkaratandiJawadenganmengayunsukukataterakhir
darisetiapkata
yangdikhotbahkannya.Sungguhintelekkedengarannya.
Bapakbapak,kitaharusbelajarmengomersialkanintelectualcomodity!!
Artinyakita
harusbersaingdengandaerahlaindenganmulaimenjual
keahlian,kepandaian,dan
berbagaijasa.Kapasitasintelektualkitaharuskitatingkatkansecara
signifikan.Kitatidak
bolehhanyabergantungpadalaut,tambang,dantaniyangresourcesnya
terbatas.Dengan
bagitu,pembangunandesainidapatberkembangsecarasimultandan
sustainabledisemua
bidang!!
Tepuktanganriuhsekali.Hadirinberebutanmenunjukkanjarinya,adayang
lima,tujuh,ada
puladelapan.Rupanyaitulajjumlahkatayangtakmerekapahamidalam
kalimat
mahasiswamahasiswaingusanitu.APut,sangdukungigi,takragu
menunjukkansepuluh
jarinya.Iabahkanmengangkatsebelahkakinya.Palingtidaklimabelaskata
mempandi
kepalanya.
Jikadaperlombaanceramah,akuberanijaminorangMelayuakan
juara.Takterhitung
banyaknyadarimerekayangmenderitasakitgilanomor21:keranjingan
pidato.Dan
sampaidisitusaja.Setelahpidatoyanggilanggemilangitulalutakada
seorangpun
melakukanapapun.SangMahasiswasibukmencarikatakataanehbaru
untukpidato
berikutnyadanparakulitambangmenghabiskanwaktuberminggu
minggumendebatkan
artisetiapkataanehmerekaitudiwarungwarungkopi.Kemampuan
berpendapat
ternyatamerupakankompetensiyangarahnyasamasekaliberbeda
dengankompetensi
berbuatsesuatusecaranyata.CapoLamNyetPho,sebagaiseorang
wiraswastawantulen
jelasmemilikikompetensiyangterakhirkutuliskan.
[Hamalan89dari168]

|
AndreaHirataSangPemimpi
Itulahpenyakitkalian,OrangMelayu.Manjabukanmain,banyakteorikiri
kanan,ada
sedikitharta,adasedikitilmu,sudahsibukbersombongsombong...
Capotakpernahsekolah.Adikadiknyalahyangsetengahmatiia
sekolahkan.Iajungkir
balikmembangunklannyadarinol.Danklannyaituterkayasekarangdi
kampungkami.Ia
kenyangasamgarampengalaman.BesarcurigakuCapohanyabisa
menghitung,takbisa
membaca.TaksepertimahasiswaMelayusokpintaritu,iaberbicarapelan
sajasambil
menyedotcerutunya.Pilihankatanyasederhana,gampangdicerna,tajam
memukul
sasaran.Setiapiaangkatbicara,parapedagangikandistanplatmelepaskan
apapunyang
sedangdikerjakan.Nasihatintanberliansesungguhnyaberadadidalam
mulutorang
sepertiCapo.
Lihatkami,orangKek.Kamihidupdenganjiwaperantau.Akusudahpunya
bioskoptapi
setiapmalammasihmenghadapililinuntukmembungkuskacang.Kalian
orangMelayu
manamaubegitu.
OrangKekbekerjakeras,takmaubergantugpadaapapun.

Kalautimahtaklaku.kalianorangMelayumati,kamihidup...

AkumengagumidayasurvivalbangsaTionghoakek.

TidakkahkalianlihatdiBelitong?Terserakseribudanaubekasgalian
tambang,terhamparpadangsabanaseluasmatamemandang,semuanya
beriburibu
hektare,takbertuan.
Parapenyimaknyamerenung.
Kuda,peternakankudaadalahyangpalingpas.Hewanitumemerlukan
kebebasandi
tempatyangluas.Dankalauinginsedikitrepot,peternakanbuayajuga
sangatcocok.Tujuh
ekorkudaAustraliaakandatangdariTasmania.Akuakanbeternakkuda!!
ItulahCapo:sederhana,takbanyakcincong,dankemampuannya
merealisasikanide
menjaditindakannyatajauhlebihtinggidariparainteleketualmuda
[Hamalan90dari168]

|
AndreaHirataSangPemimpi
Melayumana
pun.Mengajarkanmentalitasmerealisasikanidemenjaditindakannyata
barangkalidapat
dipertimbangkansebagaimatapelajaranbarudisekolahsekolah
kita.PembicaraanCapo
dipasaritukemudiandikicaukanMinarkemanamana.
*********

DanakumenyesalmengabarkanberitakudaitukepadaJimbronkarenaia
mendadak
menjadipendiam.Iabekerjalebihkerasduakalilipatdaribiasanyadan
tidurlebihmalam
darijamtidurnya.Menjelangtiduriagelisah,bergulinggulingtakkeruan.
JelassekalisetiaphariJimbrondihantuiberitakudaitudaniabereaksi
dengancaratak
inginmembicarakannya,sebabiacemas,iatakdapatmenerimajikaberita
itudusta.Benar
benartipikalobsesifkompulsif.Padahalsegalakemungkinanmasihbisa
terjadidalamdua
mingguini.Danjikamemangberitaituhanyagosipmakaakuakan
menanggungrisiko
dimusuhinyaseumurhidup.Apapunyangberhubungandengankudaamat
sensitifbagi
Jimbron.Makhlukberkakiempatyangpandaitersenyumituadalahjiwa
raganya.
KarenakhawatirdengankondisipsikologisJimbron,akuberusaha
mengonfirmasikan
beritaitupadaMinar.Luarbiasawanitamenorini.iamemenuhisemua
kriteriasebagai
bianggosip.Mulutnyasepertisenjataserbusemiotomatis.Sepertibiasakita
dengardari
tukanggosip,nadabicaramerekaselaluberfluktuasidalamjarakyang
lebar.Kadang
kadangmerekabicaramenjeritjeritdandetikberikutnyamerekaberbisik.
KIRAMUAKUBERDUSTA,BOI?AKUDENGARSENDIRIDARINYONYA
PHO,ITUSUDAHBERITABASI!!
SuaraMinarmelengkingsehinggaakumalukarenasemuaorang
menoleh.Boiadalah
panggilangauloranMelayu.Danperhatikanlahciriutamatukangisu,jika
bicaramereka
sukamenolehkirikanansepertiburungserindit.
BILANGITUPADAJIMBRON!!Tapi,Boi...,Minarberbisik,Kausudahtahu
[Hamalan91dari168]

|
AndreaHirataSangPemimpi
berita
terbarubelum...!!??Salahsatubupatiyangkalahpemilihankemaren
ternyataijazahnya
PALSU!!PALSU,BO!!!GelarS1nyamungkinsajabenartapigelarS2
nya...yangia
deretkantanpatahumaludibelakangnamanyaitu,jelasPALSU!!PALS
U!!KAU
DENGARITU,BOI!!!??
Minarmengejasatupersatukatapalsuitu.Tukanggosipadalahsakitgila
nomor
18:Kecanduansensasi.
DankuragukanjugagelarS1nyaitu!!KARENAAKUKENAL
DIA,BOI!!!DULU
KAMISEKELASDISDINPRES,SAMPAIKELASTIGADIAMASIH...
KepalaMinarberputarputarmemantausituasilaluiamenatapkutajam
dan
mendesis,Takbisamembaca...!!
MANAMUNGKINDIABISAJADISARJANA?!!BERANIBERANINYADIA
MELAMARKERJADIBUPATI!!DIAITU..penipu,BOI!!Penipu...!!BIAR
SAJA,SEBENTARLAGIDIADICIDUK...polisi...!!
Minarcelingukan,takutkalaukalauadaaparat.Soalkudasudahmelebar
tak
keruan.Pelajaranmoralnomorsembilan:JikaAndaseringditanggap
berbicaradidepan
umumdankeraptulalitkarenakehabisantopik,makabelajarlahdulujadi
tukang
gosip.AkutakmaulamalamabicaradenganMinar,takmauakumenambah
dosa.Aku
beranjak.Minarmasihbelumpuas,teriakannyabertalutalumengiringiku
pergi.
LAINKALIDIADATANGLAGIDARIJAKARTA,MENCALONKANDIRINYA
JADIBUPATI!!PASANGHURUFHBESARDIDEPANNAMANYA,MENGAKU
DIRINYAHAJI???!!PADAHALAKUTAHUKELAKUANNYA!!WAKTUJADI
MAHASISWA,WESELDARIIBUNYADIPAKAINYAUNTUKMAINJUDI
BUNTUT!!!
Akusudahjauhberlarimeninggalkannyatapimasihkudengar
lolongannya,ITULAH
KALAUKAUMAUTAHUTABIATPEMIMPINZAMAN
SEKARANG,BOI!!BARU
MENCALONKANDIRISUDAHJADIPENIPU,BAGAIMANAKALAUBAJINGAN
SEPERTIITUJADIKETUA!!???
*******
[Hamalan92dari168]

|
AndreaHirataSangPemimpi

BenderakapalBINTANGLAUTSELATANtelahtampakdihorizonsejak
pukultiga
soredanmulaipukulduadermagatelahdipadatiorangorangMelayuyang
inginmelihat
langsunghewanyanghanyapernahmerekalihatdalamgambar.Seisi
kampungtumpah
ruahkedermaga,ratusanjumlahnya,diantaramerekatampak
bupati,camat,lurah,kepala
desa,danparadukunberbagaispesialisasilengkapdenganbajudinasnya
masingmasing.
Pelataranpanjangyangmenjulurkepintukapaltelahdibangun.Ini
merupakanpekerjaan
besartapitakmengapakarenamemanguntukperistiwayangamat
penting.Jikaketua
panitiapenyambutanadalahJimbron,makakupastikandipelantaranitu
sudahtergelar
karpetmerah,jugadisiapkannyatarianSerampungDuaBelassertagadis
gadis
semenanjungberbajuadatuntukmengalungkanbungadileherkudakuda
itu.
Jimbronbolossekolah.Usaisalatlohordiasudahhilirmudikdi
dermaga.Takinginia
kecolongansatudetikpunmelihatkudakudaituturundarikapal.Tapi
anehnyaiatak
tampakdideretandepanparapengunjung.Iaadadisudutsana,diantara
tongtong
aspal,agakjauhdibelakang.Kepalanyatimbultenggelamdibaliktongtong
ituseperti
orangmainpetakumpet.Sesekaliiamenampakkanwajahnyauntuk
melihatkapalyang
semakindekat.Iasepertimaludilihatorang.Jikasampaihampirsenewen
makaiamerasa
sedikittakutkeinginannyaakansegeraterwujuddidepanbatang
hidungnya.Pastiitulah
yangdialamiJimbron.Sepertikataibuku:gilamemangadaempatpuluh
empatmacam.
BINTANGLAUTSELATANmerapat.Pintuutamanyadipaskanpadaujung
pelataran
sehinggaterciptajembatanantaradermagadengakapal.Sinarmatahari
soreterbiaspada
permukaanlautmembentukpitaberwarnajinggayangmemukaudari
[Hamalan93dari168]

|
AndreaHirataSangPemimpi
dermagasampaike
kakilangit.JikatamutamuterhormatdariTasmaniaitumelenggangdiatas
jembatan
tadi,pastiakanmenambahpesonasorebersejarahdikampungkamiini.
Pintukapaldibuka.Semuamatatertujukepintukapanitudanruangandi
dalamnyayang
gelap.Taktampakapapun.Parapengunjungtegangdansenyapmenunggu
kudakuda
hebatAustraliamelangkahkeluar.KepalaJimbrontaktampaksama
sekali.Tibatiba
sebuahbayanganhitamberkelebat.Dandarikegelapanituterdengar
samardengusan
yangberatsepertidengusanbeberapaekorsinga.Lalubergemasuara
gemeretakdilantai
kapal.Gemeretakitumeningkatmenjadihentakanhentakanyangsangat
kuatseperti
logamsalingberadu.Gaduhbertubitubimemekakkantelinga,membahana
keseluruh
kapalsampaikedermaga.Parapengunjungterkejutketakutandan
sebagianmerekayang
berdiridibarisandepanmundur.Belumsurutketerkejutan
pengunjung,secarasangat
mendadak,seekormakhlukhitamberkilatyangsangatbesarmelompatke
mulutpintu.
Parapenontonserentakberteriakhisteris.Hhaaaaahhhhhhh...!!!
Astaga!!Diambangpintukapaltibatibaberdiriseekorkudahitamstaliion
dengantinggi
hampirtigameterdanpanjangbadansekitarempatmeter.Hitampekat
berminyak
minyak,serupakayumahoniyagdipernistebal,licinmengilapseperti
seekorkumbang
jantan.Iatakpedulipadaratusanpasangmatayangmemelototinya.ia
berputar
sedikit,sombongsekali,tapiindahmemukau.Kakikakinyakukugbesar
seperti
pilar.Wajahnyagarangtapitampan.
SungguhdiluardugaankuseekorkudaAustraliaternyataamatbesar
sepertigajahdania
demikianmengagumkan.PadadetikituakumenyadaribahwaJimbron
kerajinganpada
kudakarenaalasanyangsangatmasukakal.Danakulangsungmemaklumi
kesintingannyaselamaini.Obsesifkompulsifagaknyalebihcocokbagi
[Hamalan94dari168]

|
AndreaHirataSangPemimpi
orangyang
tergilagilapadakambing.Karenakuda,khususnyakudaAustralia,sungguh
makhlukyang
luarbiasa.Hewanyangmampuberlarimengalahkanangin.Sementara
kulihatkepala
Jimbrontimbulsebentar,cepatcepatsembunyi,lalutimbullagi,persistikus
tanahmewanti
alapalap.
LalumunculseorangpriaAustraliasetengahbayabertopikoboi.Ia
menenangkanstalion
itudanbersuitsuit.Parapenontonbertepuktanganuntuknyadantepuk
tangansemakin
semarakketikakudakudalainnyabermunculandiambang
pintu.Kebanyakanberwarna
cokelat.Merekasepertirombonganperagawati.Tapihanyaenam
ekor,bukankah
seharusnyatujuhekor?Danbelumtuntaskekagumankupadaenamekor
makhlukelok
itu,akuterlompatkagetmendengarpenontonberteriakhisteris,
Hhaaaaaahhhhh...!!!Subhanallah....AlahMahabesar!!
Penontonbersoraksoraimelihatsesosokmakhlukseumpamagunung
saljuyangmegah
memesona.Seekorkudaputih!Kudajantanputihbersihyangganteng
bukanmain.Besar
sekaliberkilauandengansuraiyanggondrongberkibarkibar.Iameloncat
loncatkecil
memamerkandirinyadidepanorangorangMelayuyangterpaku
menatapnya.Ia
menderamderamdalammenggetarkanhatisetiaporang.Sungguh
indah,takadasatupun
noktahditubuhnyayanglembuthalus.Bangunantubuhkudaputihitu
amatartistik.Ia
adalahbendaseniyangmemukau,setiaplekuktubuhnyaseakandiukir
seorangmaestro
denganmengombinasikankemegahansenipatungmonumentaldan
karismakejantanan
seekorbinatangperangyanggagahberani.
Siputihgagahperkasainitahukalaudirinyaflamboyan,pusat
perhatian,makaia
menyeringaiseolahtersenyum.iamenggeretakkankakinyamenikmati
pujipujianyang
tumpahruahmelumuritubuhnya.ialahbintangkejorapertunjukkansore
[Hamalan95dari168]

|
AndreaHirataSangPemimpi
ini.Surainya
laksanajubahputihyangmengibasmengikutitubuhnyayang
menggelinjang
gelinjang.Ekornyaberayunberiramaseumpamaseikatselendangdan
sulursulurototnya
yangtelanjangberkelindandalamkoordinasiyangmemikat.Kulirik
Jimbron,iamenutup
wajahnyadengantangan.Mungkindadanyainginmeledak,tapiyangpasti
ia
menangis.Airmatanyabercucuran.
Capomenunjukkudaputihitudanberseru,PangeranMustikaRaja
Brana!!Itunama
yangkuberikanuntuknya...
Parapengunjungbertepuktanganmendengarnya.Tepuktangantak
berhentimelihattujuh
ekormakhlukindahmemesona,tinggibesarberkilapberbarisdiatastitian
muhibah
negaraasingAustraliamenujudermagakampungorangMelayu
pedalamandiPulau
Belitong,Saatmerekamendekatdaritubuhmerekaakumenciumbau
angin,bauhujan,bau
malam,danbaukebebasanberlarimembelahilalangdipadangluastak
bertepi.Sinar
mataharimenyiramidelegasiterhormatdariTasmaniaini,mereka
melangkahanggun
laksanatujuhbidadariturundarikhayangan,DipunggungsangPangeran
sinarmatahari
memantulseakandirinyasebongkahmutiara.Kudakudaitudinaikkanke
atastrukdandi
sudutsanakulihatJimbronberdiritegakdiatastongaspal.Denganlengan
bajunya,ia
berulangkalimengusapairmatanyayangberlinangan.
***********

PangeranMustikaRajaBranadanrombongannyadibawahkeranchCapo
dipinggir
kampung.Pertunjukanspektakuleryangmungkinsuatuharinantiakan
mengubahcara
hiduporangMelayu,ataupalingtidakmengubahcaramereka
berpikir,telahusai.Hariini
tujuhekorkudadariTasmaniameretasjalanmemasukibudayaMelayu
pedalaman.Hari
[Hamalan96dari168]

|
AndreaHirataSangPemimpi
inisepertihariColumbusmenemukanAmerika.Takpernahsebelumnya
seorangpun
berpikiruntukmemulaiusahadenganmendatangkankudadari
Australia.Capoadalah
seorangpendobrak,seorangyangpatutdikalungimedali.Possibility,itulah
mentalitas
Capo:positifdanpercayapadasemuakemungkinan!
Parapengunjungberduyunpulangdenganfantasidanriuhrendah
komentar.Dermaga
kembalilengang,yangtersisahanyaseorangpriatambun,denganbobot
matihampir80
kilogram,berdirimematungsepertimenhirdiatastongaspal.Kegilaan
yang
menggelembung,meluapluap,dantersedusedanitukinimemandangipita
jinggayang
bergelombangmengalunkakilangit.Barubeberapamenityanglalu
PangeranMustika
RajaBranaberanjak,bahkanbauangin,bauhujan,danbaumalamdari
tubuhpesonaputih
itumasihbelummenguapdaridermaga,tapidisana,padawajahberbinar
yangbasaholeh
airmata,darihatimudayangmenemukankebahagiantakterkiradari
seekorkuda,kulihat
jelaskerinduanyangmembuncahpadakudakudayangberubeberapa
menitlalu
pergi.Kinihatinyayangluguituhampa,hampaseperitongtongaspal
tempatnyaberdiri.
Dansemingguberikutya,loskontrakankamimenjadikuburaneuforia
karenaJimbron
mendadaklesudarah.Jikasebelumkudakudaitudatangiajadipendiam
dangiat
bekerja,sekarangiajadilebihpendiamdanmalasbekerja.Sepanjangwaktu
iahanya
melamun.Iamerindukankudakudaitu,Tidurnyamakingelisahdansering
kamiterkejut
tengahmalamkarenaJimbronmengigaumeringkikringkik.Iahanyabisa
disadarkanjika
hidungnyadijepitdenganjepitjemuranyangbergerigi.
SesekalikamidengarorangorangkepercayaanCapomembawakudakuda
Australiaitu
berjalanjalankelilingkampung.Tapikamitakpernahmendapat
kesempatanmelihatlagi
[Hamalan97dari168]

|
AndreaHirataSangPemimpi
makhlukmakhlukmemesonaitu.Selebihnyahewanitudipeliharasecara
intensifdi
tempatyangtakbisadilihatdariluar.
SeringlamalamaJimbronhanyamemandangigambarkepalakudadi
dindinglos
kontrakankami.Iamulaimalasmakandanlupabahwakedudukan
sebenarnyaadalah
sebagaiseorangpenuntutilmudiSMANegeriBukanMain.Pekerjaan
rumahpunsudah
takmaudisentuhnya.AkudanAraitakdapatmenemukancarauntuk
menghiburnya,Jimbrontelahberubahmenjadioranglainyangrusak
vitalitasnyagara
garamerindukankuda.MelihatkemerosotanmentalJimbronsetiap
hari,akumulai
percayajanganjanganteoriibukubahwapenyakitgilaadaempatpuluh
empatmacam
memangbenaradanya.KeadaansemakinparahkarenaAraimemutuskan
untukberhenti
sementaramenjadikulingambat.
AdakerjaborongansebentardiGedong,takkanlama,bisakerjasetiap
pulang
sekolah.Orangstafdisanamaumembayarharian,baguspulabayarannya
itu...
Bukankahkitaharusbanyakmenabunguntuksekolahke
Prancis!!begitu,kan
saudaraku,Jimbron??
Takkanlama,hanyaduabulan,nantikitangambatlagi...

AkutermanguJimbrontakpeduli.Duabulanberikutnyaadalahsiksaantak
terkirabuatku
karenasemakinharikeadaanJimbronsemakingawat.Jikadiajak
bicara,makaakuhanya
bicarasendiri.Sorehari,padajamketikakudakudaitudatang,matanya
sayumemandangi
dermaga.Dadakusesakmelihatnya.bahkansepedajengkikebanggaannya
yangtelahia
sulapmenjadikudakinidigantungnya.Iaberjalankakimalasmalasan
berangkatsekolah.
Araiselalupulangmalamdanlangsungmendengkurtakmaumendengar
keluh
kesahku.AkucemasakankeadaanJimbronyanguntukpertama
kalinya,susutberat
[Hamalan98dari168]

|
AndreaHirataSangPemimpi
badannya.Setiaphariakuberdoamengharapkankeajaibandan
tahukah,Kawan,keajaiban
itudatang!Keajaibanyangmengejutkansepertijutaanbintang
meledak,terangbenderang
berwarniwarni,tumpahruah,berlimpahlimpah,keajaibanyangturundari
langit!
WaktuituhariMinggu.Kebiasaankamiadalahkembalikeperaduanseusai
salat
subuh,nantibangunlagijikabeduklohormemanggil.Semacambalas
dendamsetelah
membantingtulangsampaiteteskeringatterakhirseminggupenuh.Baru
beberapamenit
terlelap,akumendengarketukanpelandijendela.Dinihariitusunyisepidi
dermaga.Ketukanitubergantimenjadigesekanbendatajammenggerus
dinding
papan.AkudanJimbronterbangun,salingberpandangan.kamiketakutan
karenabukan
barusekaliwargadermagadidatangihantulaut.Diyakinikarenabadai
terusmenerusdi
laut,hantuitusenanggentayangankerumahpendudukkalaumusim
hujan.Diluarmasih
gelapdannyalikamisemakinciutsaatterdengarsuaragemeretakdiluar
jendelalos
kontrakan.AkudanJimbronduduksalingmerapatkarenadegupanitu
semakin
dekat.kemudiandiamsenyap.Bersamakesenyapanituanginberembus
pelanlalusamar
samarmengalirbauangin,bauhujan,danbaumalam.Akumelompat
menyerbu
jendela,cepatcepatmembukanyadanmasyaAlla!Jantungkuseakan
copot.Akuterlompat
dannyarispingsankarenahanyasejangkaudarikumenggelinjang
gelinjangnakal
sesosokmakhlukputihyangsangatbesar.Tubuhnyabergelombangseperti
layarbahtera
diterpaangin.Iamenolehpadakudanakumenjeritsejadijadinya.
PangeranMustikaRajaBrana!!
AkutercekatmenahannapasdansangPangeranmenganggukangguk
takzimdengan
anggunsekali.Ekspresinyabersahabatdansangatriang.Yangpaling
istimewa,di
punggungnyaduduksumringahpenuhgayaseorangpahlawanMelayu
[Hamalan99dari168]

|
AndreaHirataSangPemimpi
yangtampan
bukanmain:Arai!Sangkesatrialangitketujuhituterkekehkekehgirang
memamerkan
gigigigitonggosnya.PangeranMustikamenderamderamgembira
menimpalituannya
yangcekikikan.
SimpaiKeramat..

Akutakmampuberkatakatalagi.AkuberbaliksontakmelihatJimbron.Dan
disituia
duduktakberbaju.Seluruhrangkatubuhnyamengerassepertiorang
dikutukmenjadi
batu.Napasnyaberatpendekpendek,matanyaterbelalak,mulutnya
ternganga.Wajah
bulatnyamemasukijendelakamar,hanyasejengkaldidepanhidung
Jimbron.Jimbrontak
berkutik.Menggeserduduknyapuntakmampu.JikaPangeraningin
menelannyamentah
mentah,iaakanpasrahsaja.BulubuluhalusditengkukJimbronserentak
berdiri.Matanya
berkacakaca,Adakerinduanyangterpecahberuraiurai.
Pakaibajumucepat,Bujang.marikitaberkuda!!serukesatriatonggositu.

DidepankamarkontrakanJimbrontaksabarmendekatiPangeran
Mustika.Hewanitu
menunduk,mengertidirinyaakandibelai,dantahukalaukamitakdapat
menggapai
kepalanyayanghampirsetinggitiangvolley.KamiterharumelihatJimbron
menyentuk
lembutsuraiPangeran.Diusapnyaseluruhtubuhkudaitudengan
takjub,dandibelai
belainyawajahkudaputihitu.SangPangeranmenyunggingsenyumlebut
penuh
persahabatan.
AraimengendaraiPangeranmenyusuritepianpantai,Lautpasangmalam
dansurut
pagi.kudaputihituberlarikecilmeningkahiriakgelombangsepanjang
pesisiryang
landaiberatusratusmeter.Dalambalutanhalimundiataspermukaanlaut
yang
diam,Pangeranseakanmakhlukajaibyangbaruturundaribulan.Jimbron
lekatmengikuti
[Hamalan100dari168]

|
AndreaHirataSangPemimpi
langkahPangerandenganmemegangiekornya,Tercepukcepukberlaridi
belakang
hewanitubersamaanakanaknelayanyangbersorakgirangmelihat
makhlukyangtak
pernahmerekalihatditepilaut.
Pagimerekah.bayangankudadankesatriamembayangsepertisiluetdi
tengahsebuah
bendabulatmerahjinggayangmunculpelanpelandikakilangit.Inilah
pagiterindah
yangpernahkusaksikan.PagisemakinistimewakarenaAraimemberi
kesempatanpada
JimbronmengendaraiPangeran.BerdebardebarJimbronmeletakkan
kakinyadipijakan
sanggawediuntukmenaikiPangeran.Anehnya,Pangeranmenekuk
lututnyauntuk
memudahkanJimbron.Sekejapkemudianlakilakitambunitumenjelma
seolahbaginda
rajadiatastunggangankaunningrat.TakcanggungsedikitpunJimbron
langsungdapat
menguasaikudaputihitu.Mungkinkarenadalamkhayalannyaiatelah
berlatihratusan
kalibagaimanamenunggangkuda.Jimbrontakberhentitersenyum.Ia
bahagiatakterkira
mendapatkanpengalamanyangtelahbelasantahundiidamkannya.Mula
mulaia
berputarputartapitibatiba,tanpakamiduga,JimbronmemacuPangeran
keluargaris
pantai.Kamipanikdantergopohgopohmenyusulnya.
Bron!!Bron!!Maukemanakau!!Araiberteriak.
GawatJimbronmelarikankudaputihraksasaitumenujupasar.Jikatak
dapat
mengendalikannyadenganbaik,hewanitupastiakanmengobrakabrik
pasar.Pangeran
berlarikencangmenembuskawasanpedagangsayuryangmenggelegar
dagangandi
emperantoko.Parapedagangyangterkejutmendadaksontaksemburat
tak
keruan.Namun,merekasenangbukanmainmelihatPangeranMustikaRaja
Brana.Mereka
mengikutiakudanAraiyangpontangpantingketakutanmengejar
Jimbron.
Jimbrontakmengurangikecepatan.Iameneroboskeramaianpasar
[Hamalan101dari168]

|
AndreaHirataSangPemimpi
pagi.SuraiPangeran
berkibarkibarberkilauanketikaiamelesatmelintasitikungandimuka
stanplatyang
ramai.Parapembelidanpedagangikanbersoraksorai,riuhbertepuk
tanganmelihat
Jimbronberaksidiataspunggungkudapersisperampokbankyangdikejar
shriffdalam
filmkoboi.Jimbronmenimbulkankehebohanyangluarbiasa.Seekorkuda
putihAustralia
belariberderapderapdipasarkampungorangMelayu,sungguh
pemandanganyangsulit
dilupakansiapapun.Kendaraanyanglalulalangberhenti
mendadak.Orangorang
khawatirsekaligusterpesonamelihaPangeranmeliukliuk,bergelombang
diantara
pedagangkakilimadanpengunjungpasar.Jimbronberteriakteriak
memacu
Pangeran.Pangeranberlarisecepatanginmenujukeutara,teruske
utara,dankamisegera
tahutujuannya:pabrikcincau!!
DidepanpabrikcincauJimbronberhenti.Pangerangemeretakjalandi
tempat.Laksmi
yangtengahmencucibaskomterngangamulutnya.Parapengunjung
warungwarungkopi
disekitarpabrikberhamburan,bergabungdenganorangorangyangtadi
ikutmengejar
Jimbron,merekamengelilingiPangeran.Laksmitertegun.Iatakpercaya
denganmatanya
sendirimelihatJimbrontibatibahadirdiataspunggungPangeranMustika
RajaBrana
yangkondang.IaselalumenganggapJimbrontelahsenewenpadakudadan
hanyabisa
membualkanbinatangitu.
Jimbrontersenyumbanggalaluiamenyentaklesyangtersambungpada
kadaliyang
mengekangmulutPangeran.Pangeranpahamperintahsobatbarunya
ini.Kudaputihitu
menaikkankeduakakidepannyatinggitinngi.Menakjubkan!Hewan
denganberatlebih
darisetengahton,tinggidanbesarsepertigajah,mengangkat
setengah
tubuhnya,menendangnendangkankakinyakeudara,lalumeringkik
[Hamalan102dari168]

|
AndreaHirataSangPemimpi
dahsyatmemecah
langit.Semuaorangterjajarmundur.Laksmiterkagumkagum.Pangeran
mendaratkanlagi
kakinya,berdebammenggetarkantiangtiangpabrikcincaudisambut
suitandantepuk
tangangegapgempitaparapenonton.Laksmiterkesimalalusamarsamar
iatersenyum.Ia
memandangiJimbrondansemakinlamasenyumnyasemakinlebar.Orang
orang
terhenyak,setelahbertahuntahunberlalu,pagiiniuntukpertamakalinya
merekamelihat
Laksmitersenyum,ya,Laksmitersenyum!Dansenyumnyaitumanissekali.

[Hamalan103dari168]

|
AndreaHirataSangPemimpi
Mozaik14
WhenIFallinLove

Luassamudradapatdiukurtapiluasnyahatisiapasangka.ItulahArai.Dua
bulania
menyerahkandiripadapenindasanCapoyangterkenalkeras,semuanya
demi
Jimbron.KerjadipeternakanCaposepertikerjarodi,makasetiappulang
malamArai
langsungtertidursebabiababakbelur.Waktuiamengatakaninginbekerja
diGedong
temoharisebenarnyadiamdiamiamelamarkerjapadaCapodengansatu
tujuanagar
JimbrondapatmendekatiPangeran.Danbelakanganakutahubahwa
bermingguminggu
AraimembujukCapoagarmemberikesempatanpadaJimbronuntuk
mengendaraikuda
putihitu.Iamerahasiakansemuanyakarenamengertiperkarakudasangat
sensitifbagi
Jimbron,disampingiainginmemberikankejutanpadasahabattambunnya
itu,sebuah
kejutanyangmanistakterperi.ItulahArai,dulupernahkukatakan
padamu,Kawan:Arai
adalahsenimankehidupanseharihari.
DantakdidugarencanamenyenangkanJimbronberbuahsenyum
Laksmi.Sepertihalnya
keburukan,kebaikanpunseringkaliberbuahkebaikan.Dansatukecil
kerappula
menyebabkanperubahandemikianbesar.Setelahmengendarai
Pangeran,Jimbron
mencopotgambarkudasenyumdidindingkamarkami,kemudiania
berusahakeras
melukiswajahseorangwanitakurusyangcantikdengansenyum
manisnyayang
menawan.Akhirnya,terciptalahlukisanwajahwanitasepertizombie.Tapi
disudutkanan
gambaritudenganbanggaJimbronmengukirsebuahnama:LAKSMI,Maka
dilos
kontrakankamisekarangterpajangtigatokohidolakami:Jimfavorit
Arai,Laksmicinta
[Hamalan104dari168]

|
AndreaHirataSangPemimpi
Jimbron,danKakRhomaIrama,senimankesayanganku.
SetelahmembawaPangeranMustikaRajaBranakeharibaanJimbron,Arai
meletakkan
jabatannyadipeternakanCapodaniakembalimenyumbangkantenaga
danpikirannya
sebagaikulingambat.Saatiatertidurmeringkukkelelahanaku
memandangisepupu
jauhkuini,Iaorangyangtidurlupa.Orangyangketikadudukatau
berbaringtak
merasakanapapunsaattubuhnyadipelukgelapkarenatubuhitutelah
remukredam
keletihanmembantingtulang.
Araisemakinjangkung,semakinkurus.SimpaiKeramatyangyatimpiatuini
badannya
kumaldanbau.Kukukukunyahitam,potonganrambutnyatak
keruan,diguntingsendiridi
depancermindengangayaasaltidakgondrong.Dilehernyamelingkar
daki,tapimasya
Allah,hatinyaputihbercahaya,hatinyaituselaluhangat.Iaorangyang
selalumerasa
bahagiakarenadapatmembahagiakanoranglain.Laluapayangtersisa
untuknya?Tak
ada.Sepertiucapannyapadaku:Tanpamimpidansemangatorangseperti
kitaakanmati
.Ya,tergeletakdiatasselembartikarpurun,denganseragamputihabuabu
yangdipakai
untuksekolahdanbekerja,bangunpukulduapagiuntukmemikul
ikan,yangtersisa
untuknyamemanghanyasemangatdanmimpimimpi.
AkuinginmembahagiakanArai,akuinginberbuaysesuatusepertiyangia
lakukanpada
Jimbron.Sepertiyangselaluialakukanpadaku.Akuseringmelihat
sepatukuyang
mengangasepertibuayaberjemurtahutahusudahrekatkembali,Arai
diamdiam
memakunya.Akujugaselaluheranmelihatkancingbajukuyanglepastiba
tibalengkap
lagi,tanpabanyakcincongAraimenjahitnya.Jikaterbangunmalam
malam,akusering
mendapatikutelahberselimut,Araimenyelimutiku.Belumterhitung
kebaikannyawaktuia
membelakudalamperkararambutbelahtangahToniKoeswoyosaataku
[Hamalan105dari168]

|
AndreaHirataSangPemimpi
masihSD
dulu.BertahunlewattapiakutakkanlupaRai,akankubalaskebaikannmu
yangtak
terucapkanitu,jasamuyangtakkenalpamrihitu,ketulusanmuyangtak
kasatmataitu.
Danakutahupersiscaranya,sebabakupahamsaatinikebahagiaanArai
sesungguhnya
terperangkapdalamsebuahpeti.Kuncipetiituberadaditanganwanita
ini:Zakiah
NurmalabintiBerahimMatarum.CintaAraipadaNurmalaadalahsalah
satudarikisah
cintayangpalingmenyedihkandimukabumiini.Cintayangpatah
berkepingkeping
karenaselingkuhdanpengkhianatankahyangpaling
menyakitkan?Bukan.Cintayang
dipaksaputuskarenaperbedaanstatus,hartabenda,danagamakahyang
paling
menyesakkan?Masihbukan.Cintayangmenjadidingin
karena
penyakit,penganiayaan,dankebosanankahyangpaling
menyiksa?Tidak.Ataucintayang
terpisahkansamudra,lembah,dangununggemunungyangpaling
pilu?Samasekali
tidak.Bagaimanapunpedihdilaluikeduasejolidalamempatkeadaanitu
merekamasih
dapatsalingmencintaatausalingmembenci.Namun,yangpaling
memilukanadalahcinta
yangtakpeduli.Karenaituseorangfilsufyangsiangmalammerenungkan
senimencinta
telahmenulislovemeorjusthateme,butsparemewithyourindifference
cintaiakuatau
sekalianbenciaku,asaljangantakacuhkanaku.Malangnyayangterakhir
itulahyang
dialamiArai.
SejakpertamakalimelihatnyawaktuharipendaftarandiSMAAraitelah
jatuhhatipada
Nurmala.Cintapadapandanganpertama.Dansejakituiatelahmengirimi
kembangSMA
kamiituberatusratuskalisalam.Taksatupunditanggapi.Iajugatelah
mengirimkanpuisi
bahkanpantunyangmemikat:
Jangansamakanladadanpala
[Hamalan106dari168]

|
AndreaHirataSangPemimpi
Berbedarupa,takpadanrasa
RelaKandamenginjakbara
DemicintaDindaNurmala
Takterhitungsyairgurindam,lirikliriktembangsemenanjung,bahkan
bunga,mulaidari
bungamerantiyangamatlangka,hanyabersemitujuhtahunsekalidan
harusdipetikdi
dalamrimbapadaketinggiansehinggaseluruhtepianPulauBelitong
kelihatan,sampai
bungabungahalusmuralisyangrajintumbuhdigunungankotoran
kerbau.Semuanya
telahAraicoba.Bungaitubiasanyadiamdiamialetakkandikeranjang
sepedaNurmala
besertasepucuksurat.Danalangkahperihhatikumelihatnyadihamburkan
Nurmaladi
tempatparkir.Adapunsuratnya,takkalahmengenaskannasibnya,tanpa
pernahdibuka
sampulnyadilipatNurmalaberbentukpesawatdandilepaslandaskannya
menujukolam
sekolah.TapibukanArainamanyakalautakberjiwapositif.
NurmalaadalahtembokyangkukuhKal...,kilahnyadiplomatis.

Danusahakuibaratmelemparkanlumpurketembokitu,sambungnya
optimis.

Kausangkatembokituakanrobohdenganlemparanlumpur?tanyanya
retoris.

Tidakakan!Tapilumpurituakanmembekasdisana,apapunyang
kulakukan,walaupun
ditolaknyamentahmentah,akanmembekasdihatinya,kesimpulannya
filosofis.
SejakkelassatuSMAsampaikinikamihampirtamatsegalacaratelah
ditempuh
Arai,semuanyatakmempan,termasukteoribingungnyayangabsurd
dulu.Kenyataan
sekarangAraiyangbingungmenghadapiNurmalayangindifferent,tak
acuh.Mungkin
sajaNurmalainginbersimpatipadaAraitapiiabencipadateorinya
itu.Nurmalabersikap
sepertiharimaukarenainginmerobohkanbangunanhipotesisArai
terhadapsifatsifat
[Hamalan107dari168]

|
AndreaHirataSangPemimpi
perempuan.Iataksetujudenganupayaupayatakbermutudalam
mendefinisikan
kapasitaskaumnya.Rupanyateori,optimisme,danfilosofitidaklahcukup
bagiAraiuntuk
menaklukkanNurmala.Araitelahmenisbatkanpermasalahandengan
berasumsibahwa
perempuanmudahdipahami.Iataktahu,bahkanSigmundFreud,setelah
tigapuluhtahun
merisetjiwafeminim,masihmengatakanbahwaiatakmengertiapayang
diinginkan
perempuan.Persoalanyangberhubungandenganperasaanperempuantak
sesederhana
sepertiselaludidugakebanyakanorang.
Sikappragmatis!Itulahsesungguhnyasolusimasalahini,takgunalagi
berpanjang
panjangteoridanfilosofi,akumencobamenyakinkanArai.
KaukenalBangZaitunkan,Rai??tanyaku.

Araimenjawabheran,PimpinanOrkesMelayuPasarIkanBelokKiriItu..?

Kesanalahkauharusbergurusoalcinta...

Araitersenyum.SiapatakkenalBangZaitun,priaflamboyanyangkondang
dalamdunia
persilatancinta.DiBelitongadaempatkampungbesar,disetiapkampurig
ituiapunya
istri.Lakilakipositifmencernasetiapusulan,memikirnyadenganlapang
dada.Arai
menatapkucerah.
KauyakinBangZaitunpunyacukupwewenangilmiahuntuk
memecahkanmasalahku
ini,Kal?

Takadasalahnyamencoba,Kawan,jauhlebihterhormatdaripadake
dukun!!

Ah,Keriting,barukutahu,kaucerdassekali!!
***************

KamimemasukiruangtamuBangZaitunyangdipenuhiberagampernak
pernik,bingkaibingkaifotohitamputih,danmainankertasberwarnapink
yang
[Hamalan108dari168]

|
AndreaHirataSangPemimpi
digantunkanseanteroruangan.Ruanganitudicatmencolok
merah,kuning,danhijau.Di
lantailekatkarpetplastikmerahmudabermotifanyelir.Kembang
kembangplastik
diletakkansekenanyadirakkotakkotak,berdesakdesakandengan
berbagaibenda
keramiktakbermutu:kendi,asbak,piring,danburungkoakmalamyang
telahdikeraskan
tapimatanyabolong.Penerangannyaadalahjalinanlampukecilyangbiasa
dililitkanpada
pohonnatal.Sinarnyaberkelapkeliphijaudanbiru,menjalarjalardi
seluruhdinding
serupaketelarambat.Saatmemasukiruanganituakumerasamenjadi
mempelai
pria.Semuapropertidalamruanganditatasesuaiselerayangterisnspirasi
olehpanggung
orkesMelayudanpelaminan.BarangkaliiniyangdisebutearlyMexican
brothel(dekorasi
rumahbordilorangMeksikomiskin).
InirumahBangZaitundenganistrikeempatnya.Istrinyaituhitam
manis,bergelora,masih
sepertianakSMP,dansibukmengunyahpermenlollypop.Secaraumumia
mengingatkan
akupadabuahmempelam.Sejenakinginakumembatalkanseluruhcita
citayangsudah
ataubelumterikrarkan.YangtelahdicatatTuhanatausedangditimbang
timbang,aku
inginmenjadipemainorkessaja.KudengarkabardariMinarkalauBang
Zaitunakan
segeramenambahistrilagi,yaitupenyanyinyayangbaru,yangdapat
bergoyangdangdut
sehinggaperahukaram.Oh,betapainginakujadipemainorkes.
BangZaitunorangnyahumorisdansenangsekalibicara,persis
radio.Dandanannnya
nyentriktipikalorangmusik.Kepalaikatpinggangnyadaribesiberbentuk
gitar.Motif
bajunyatutstutspiano.Celananyacutbrai.Jarijarinyabertaburancincin
batuakikbesar
besar.Beliaudengansengajamencabutkeduagigitaringnyayangsehat
dan
menggantinyadengangigiemasputih.Sungguhbenarucapankomedian
JerryLewis:Ada
[Hamalan109dari168]

|
AndreaHirataSangPemimpi
kesintinganpadasetiapsenimanyangkaratnyalebihtinggidari
kebanyakanorang.
JikabicaraBangZaitunselalusambiltertawa,dantawanya
itu...hi...hi...hi...hi,dengan
tujuanuntukmemamerkankeduagigiemasputihitu.Meskipunrahang
atasnyasedikit
majukedepantapiiayakinkeduabilahgigi,emasputihnyamerupakan
duakutubmagnet
dirinya.Dandemiduakutubmagnetitu,BangZaitun,dengansepenuhhati
bersedia
tertawawalaupuntakadahalyanglucu.Namunlebihpentingdariitu,di
soreyang
mengesankanini,BangZaitunmenyambutkamidengansangatramah.Di
mana
mana,kelompokprofesiyangpalingramahadalahmusisi,yangpalingbebal
adalah
politisi,danyangpalingmenyebalkanadalahpenerbitbuku.
SenangrupanyamainmusikBang...,akubertanya.

Ah,Boi...rumputtetanggaselalulebihhijaubukan??Hi..hi...hi...hi....

SuaraBangZaitunparau,sepertiorangberbisikdengankeras.Kulitnya
kisutdaniajelas
penyakitan.Itulahyangterjadijikaseringkenananginmalam.Melaluilagu
BegadangKakRhomatelahmewantiwantiakibatburukanginmalam
padagenerasi
mudaRepublikini.
Abangtengokguru,inginabangjadiguru,taktahubagaimanarasanya
mengurusanak
anakyangsenewentingkahnyahi...hi..hi...Abangtengoklagipolisi,maujadi
polisi
rasanya,taktahubagaimananantimenanggungbebanbatinkalautua
pensiun.Lihat
nelayaninginjadinelayan,tapiAbangtakpernahmaujadianggota
Dewan,Bou.Orang
orangituselaludianggaptakbecus.Kasihanmereka,bukan??Hi...hi...hi.
Abangsudahmainorkestigapuluhtahun,Boi.Kalauhitunganpegawai
negeri,Abang
sudahdiundangkeIstananegara,diajakjalanjalankeTamanMinisama
presiden...hi...hi...hi.Abangmalangmelintangdaripanggungke
panggung,darikampung
kekampung,membawakanlaguituitusaja.Taktahukah
[Hamalan110dari168]

|
AndreaHirataSangPemimpi
engkau,Boi?Abangmuinisudah
jadijukebox!
Sedetikberkelebatkepahitanpadawajahlakilakicekingyangsangat
menyenangkan
ini.Tersiratbebanpadanadabicaranya.Bebanyanginginiatumpahkan
padabukanorang
musik.
Kautahujukebox,kan??Mesinmusik!!Sepertitampakfilmfilmbarat
itu.Kaumasukkan
uanglogamlalumesinitubernyanyi.Abangmuinisudahjadimesin
musik...hi...hi...!!
Sekarangakumengertimengapapemainmusik,terutamapemain
bas,seringkelihatan
melamun.Rupanyaiamuakmembawakanlaguyangsamaratusankali,ia
muakharus
selalutersenyumpadapenontonyangegois,iaterjeratmenjadirobot
irama.
YangnamanyalaguDarahMudaRhomaIramamungkinsudahduaratus
kaliAbang
bawakan.Penontonmendesakterus,sementaraAbangsudahmatirasa
dengannadanada
laguitu...hi...hi...hi.
MendengarnamaKakRhomaIramadisebut,telingakuberdiri.Inginaku
melakukan
requestpadaBangZaitununtukmembawakanlaguitu.Tapiakutakingin
menambah
bebanhidupnya.AkutakjubkarenaBangZaitunmampumenertawakan
kepedihannya
sekaligusdemikianbahagiagaragaraduabilahgigipalsu.Sungguh
beruntungmanusia
yangdapatmengailkesenangandarihalhalkecilyangsederhana.
Hi...hi...seharusnyaorangtidakmempelakukandandiperlakukanmusik
sepertiitu
ya,Boi...Tapiapabolehbuat..begitulahtuntutanperiukbelanga.Maka
jangankausangka
jadimusisiitumudah.Dibaliksenyumdantawadipanggungituada
siksaantertentu
yangtakdilihatorangdariluar...hi...hi...hi.
Bebal,Boi!!Orangbisamenjadibebaljikamenyanyikanlaguyangsama
duaratus
kali!!Hi...hi...hi.
Usaimenyeruputkopi,bubukhitamlekatdiselaselagigiemasputihBang
[Hamalan111dari168]

|
AndreaHirataSangPemimpi

Zaitunkontras
sekali.LaluasaptembakauWarningbergelunggelungdalammulutnya.Ia
adalahprasasti
mentalitasmanusiaantikemapanan.Dudukdidepannyaakutakpercaya
padamataku
sendiri,lakilakitakberijazahinipernahmemilikienampuluhtujuhorang
pacar!Sungguh
sebuahrekoryangfantastis.Iabahkanpernahberpacarandengandelapan
wanitadalam
waktubersamaan.
Jangancobacobameniruku,Boi.Repotbukanmain,akupontangpanting
sepertikucing
taksengajamendudukiRheumason!!Hi..hi..hii.
Kitabisaberadadisatutempatyangsamapadabeberapa
kesempatan,tapikitatakbisa
beradadibeberapatempatdalamsatukesempatanyangsama.Ituhukum
fisika,Boi,karenaTuhansesungguhnyamemerintahkanmakhluknyauntuk
setia.Paham
maksudku?
Uniknyadarisetiapmantanpacarnya,iamintaditinggalikenang
kenangan,yaitupernak
pernikyangbergelantungandiruangtamuini:jep
rambut,gincu,sisir,bando,slayer,saputangan,danberpuluhbendakecil
lainnya.Sang
mempelam,masihdenganlollypopdimuluntya,banggamembelaipernak
pernikitu
seakaninginmengatakanbahwadarisekianbanyakwanitayangsenewen
padaBang
Zaitun,dialahyangberuntungmeskipunhanyasebagaiorangnomor
empat.Justruia
sendiriyangmemajangpernakpernikitudiruangtamu.bagaimana
perempuan
memersepsikanpersaingansesamamerekamungkinmerupakanwilayah
gelapyang
palingtakdiketahuilelaki.DalamkasusbangZaitun,hanyadapatdipahami
satuhalyaitu
buahmempelamitumemilikikualifikasicantikbercampurdengantolol
takterkirakira.
AkumulaikagumpadaBangZaitun.Diamdiamaku
menyelidikinya.Dimanakahinti
dayatarikplayboycapDuaculaini?JelasReputasinyasebagaiCasanova
tidakdibangun
[Hamalan112dari168]

|
AndreaHirataSangPemimpi
berdasarkanpenampilannya.Iamelengkungdanterlalu
kurus.Dandanannya
norak,rambutnyasepertisuraiuburubur,wajahnyahanyawajahorang
Melayu
kebanyakan.DanmenurutdefinisitampanversiorangMelayu,yang
disandarkanpada
citraRahmatKartolo,makaiajugajauhdaricitraitu.Uang?Tak
mungkin.Bendapaling
mahaldirumahnyahanyasebuahpersider,istilahorangMelayuuntuk
lemaries,itupun
sudahmenjadirakpiring.Ramah?OrangMelayuratarataramah.Tatapan
matanya
memangmenenangkantapimataitutelahkeruholehasaprokok.Apayang
menyebabkan
wanitakocarkacirdibuatnya?Misterius.Janganjanganbatuakikdi
jemarinya
itu?Tidak,ibadahnyamemangkacautapiiabukanmusyrikin.Sungguhaku
penasaran
ingintahu.KusampaikanpadaBangZaitunmaksudkunjungankamidan
terangterangan
menanyakankiatbeliauberjayadalamasmara.BeliaumenatapArai
denganharu.
Delapanbelastahunbelumpernahpacaran?Malangbetul
nasibmu,Boi...Hidupmemang
takadilkadangkadanghi....hi...hi...!!
Gigitaringemasputihituberkilaunmengerikan.tukmu.Takpernah
kubocorkanpada
siapapun!!

WajahBangZaitunpenuhrahasia.Inilahyangkamitunggutunggu.

Tapidiperlukanupayayangkerasuntukdapatsukses!!
AstagabangZaitun,sungguhtakkusangkatabiatmuselamaini.Apakah
engkau
mengajarkanilmupeletnansaktimandraguna?Apakahharuspuasaempat
puluh
hari?Atauharusmengambiljimatberupakutubetinadaripunggungkera
putihyang
hanyahidupdipuncakgunungGudha?Tapiapapunitu,tentusebuahresep
yangsangat
istimewasehinggaseorangbohemiandapatpunyapacarenampuluhtujuh
orangdan
[Hamalan113dari168]

|
AndreaHirataSangPemimpi

hampirberistrilima.
Tunggusebentar..

BangZaitunmasukkedalamkamarnya.AkudanAraitegang
menunggu.BangZaitun
kembalimembawasebuahkotakbesar.
Inilahrahasianya,katanyasantaisambilmembukakotaitu.Didalamnya
terbaring
sebuahgitar.
Kamibingung.

Ya,gitar,hanyagitar,itulahrahasiakecilkukalaukaumautahu
Boi,hi...hi..hi.

BangZaitunmembelaigitarakustikitudenganlembutseolahbendaitu
salahsatu
istrinya,istrinyayangtermudatentusaja.Gitarseringdianggapsebagai
repsentasiwanita
bertubuhindah.Apakahinigitarsaktiyangtelahdijampijampidan
dilumuripengasihan?
BangZaitunmembacaprasangkakami,Bukan,Boi,Kalaumaksudmu
magic,makatak
adamagicdisini.Inigitarbiasasaja,sepertigitargitarlainnya.
BangZaitunmemelukgitaritudanmeraihpick,lalutanpabanyakcincong
mulailah
memetikdawaidenganpenuhperasaansambil
bergumam,....Hmmm...hhmmm...hhmmm...hhmmmmmmmm....Beliau
meretasintro
denganlebutmenawandanmulaibersyair.Kamiterlena.
Padabarpertamaakulangsungtahulaguitu,laguMelayuDiAmbang
Sore,ciptaan
IsmailMarzuki.
Dalamrenungankusorang
Diambangsorenanlalu
Tiadabisikantenang
Tamasyaindahkubisu..
Danmulaibarkeduaakusudahtakmelihatlagilakilakinorakbergigi
palsuemasputih
itu,sebabiatelahmenjelmamenjadisosoklain,sesosokkeindahanbernilai
seni
tinggi.SuaraBangZaitun,lagusyahdusemenanjung,dannadanadayang
terpantuldalam
[Hamalan114dari168]

|
AndreaHirataSangPemimpi
lekukanruangkayubalsaperutgitaritumenjadisatupaketyang
memikat.BangZaitun
hadirdidepankamiseumpamareinkarnasiFrankSinatra.

PadasetiaptarikanmelodiyangmenguikBangZaitunmenaikkansebelah
aslinya
sembarimengumbarsenyumtermanisyangiamilikidansaatitupulahati
perempuan
yangmemandangnyapatahberkepingkeping.Perempuanyangbelum
khatamQurandan
kurangmantapimannyadipastikanrelamenyerahkankewarasannyapada
dawaidawai
gitaryangdipelintir.Takperlubanyakwaktuuntukmemahamipendapat
bangZaitun
bahwagitaradalahrahasiadayatariknya.KamibertepuktanganusaiBang
Zaitun
bernyanyi.Iakembalimembelaibelaigitarnya.
Jikabisamemanfaatkannyasecaraoptimal,gitarsesungguhnyaadalah
bendayangbesar
pengaruhnyadalamkesuksesanromansa,hi...hi...hi.
Terbuktibanyaksekaliwanitacantikyangsehatwalafiatjiwa
raganya,reladiusir
keluarganyagaragarajatuhcintasetengahmatipadapemain
gitar.Padahalpemaingitar
itumasadepannyasamarsamar,penampilannyalebihjelekdarijin
Afrit,berminggu
minggutakpernahmandi!!Itulahmengapagaibpengasihanyang
dikandungsebuah
gitar,kalaumautahu,Boi,DantunjukkanpadakuBoi,kalauadagitarisyang
pacarnya
burukrupa.Takada..takada,Boi!!
Kamimanggutmanggut.Takjubdanterkejut.Kamibarusajamendengar
sebuahpendapat
yangkonyol,tapikamitakmelihatadanyasatupunkemungkinanyang
tidaklogisdari
seluruhpendapatitu.Karenajikadiujisecarailmiahdengansurvei,kami
yakinratarata
gitarismemangpunyapacaryangcantik.
[Hamalan115dari168]

|
AndreaHirataSangPemimpi
Belajarlahmaingitar,Boi.Pilihlagumusendiriyangpalingindahdan
mainkandengan
baik,dengansepenuhjiwa,padamomenyangpalingtepat,lebihbaguslagi
jikadirancang
sedikitkejutan,Nurmalapastimenolehpadamu...hi..hi..hi...
Araisumringahdanmendapatidirinyadiendorseolehseorangpakar
asmara,kepercayaandirinyamelejit.Sungguhbesarfaedahperbincangan
kamidengan
BangZaitun.Akusemakinsetujudenganpendapatbahwaseringkalihal
yangsangat
bermanfaattakdidapatdisekolah.Tapipembicaraansederhana
berdasarkanpengalaman
pahitmanisseseorangjustrumemberipetunjukpraktismanual
kehidupan.Universityof
Lifeadalahungkapanyangpalingpasuntuksituasiini.Sekolahtidak
mengajarkanhalhal
apayangharuskitapikirkan,tapimengajarkankitacaraberpikir,demikian
gunasekolah
barangkali.

******************

MasalahnyaAraisamasekalitakmemilikimusikalitas.Memeganggitarpun
barusekali
ini.Ketikakamidatanglagiesoknya,BangZaitunbertanya,Sudah
kautemukan
lagumu,Boi??
Sudah,Bang,jawabAraimantap.
Apaitu?
WhenIFallinLove.Bang.

AkutahupersisalasanAraimemilihlagiitukarenaliriknyamewakili
semuayangingin
iasampaikanpadaNurmala.Terutamabagian:whenIgivemyheart,itwill
becompletly...
MengerutlahkeningBangZaitun.

Laguyangindah,tapitahukahkauBoi,chordnyabanyakmengandung
mayortujuh,agak
miringmiring,bernuansajazzy,danmenyanyikannyasedikitsusah
hi...hi..hi.
Mengapatakcobalaguyanglebihmudahdulu,Boi?Cocokbagipemula
[Hamalan116dari168]

|
AndreaHirataSangPemimpi
sepertimu.Bagaimanakalaulagisepasangmatabola??
BukanArainamanyakalaugampangmenyerah.Padahalgitarisprofesinal
sekalipun
belumtentudapatmembawakanWhenIFallinLovedenganbaik,apalagi
sambil
menyanyikannya.BangZaitunmeminjamiAraigitarbesertasebuahkarton
besaryang
digambarinyasenardenganpetunjukterperinciyangmanasajadan
denganjariapaArai
harusmemencetnyaagarmendapatkankuncinadayangbenar.
JariAraimelepuhkarenatakbiasamemencetsenargitar.Duaminggu
pertamaiamasih
belumbisamemperdengarkansatupunkuncinadadenganbenartapitak
sedikitpun
surutsemangatnya.KadangkadangBangZaitundatangmemantau
kemajuannya.Melihatnyamaingitar,sangPlayboyhanyatertawa
hi...hi...hi...hi...
DuamingguberikutnyaAraibarumencobabernyanyi.Makasetiapmalam
kepalakami
peningmendengarsuaranyayangkeringparaumelolonglolong.Lagu
WhenIFalin
Lovekeutaradansuaragitarnyakeselatan.Berjamjamiaberlatihsampai
iabercucuran
keringatnya,sampaiputussenargitarnya,sampaitimbuluraturat
lehernya.Berminggu
minggudiulangnyalaguyangsamaberpuluhpuluhkali,dantakpernah
sekalipuniamau
mencobalagulain.Seorangkuliyangbutanada,yangsadarbetuldirinya
takkanpernah
bisamaingitar,ternyatamampumendedikasikandirinnyasepenuhhati
padamusikhanya
untukbisamembawakansatulagu,satulagusaja,semimenyampaikan
jeritanhatinya
padabelahanhatinya.Itulahkekuatancinta,itulahkekuatanjiwaseorang
lakilaki
bernamaArai,sungguhmengharukan.
Duabulantelahberlalu,Araitakjugamenunjukkankemajuan.
Tinggalsebulahwaktuku,Ka;katanyapadakusambilmemeluk
gitarnya.14
September,ulangtahunNurmala,akusudahharusbisamembawakanlagu
itu!!
DansepertidisarankanBangZaitun,ternyataAraitelahmerencanakan
[Hamalan117dari168]

|
AndreaHirataSangPemimpi
suatukejutanyang
sangatmanisuntukNurmala.Idekiniklasiksajadanseringditerapkandi
film
film.Tanggal14Septembermalamkamiakanmenyelinapdekatkamar
tidurNurmala
laludiluarjendelakamarnyaAraiakanmelantunkanlaguWhenIFallin
Love.Oh,alangkahindahnya.Kamisampaitakdapattidurmemikirkan
kecantikan
rencanaitu.
Sebaliknya,dalamtigapuluhhariwaktutersisaAraiberlatihhabis
habisan.Seminggu
menjelangtanggal14September,walaupunmasihsumbangminta
ampun,akhirnyaArai
mampu,akhirnyaAraimampumembawakanlaguitusampaiselesai.Bukan
kepalang
senangnyaArai.
KaliiniNurmalapastibertekuklutut,Kawan!!
IamenyalamiakudanJimbroneraterat,BangZaituntertawa..hi...hi..hi...
UsaisalatisyaAraisudahberdandanrapidaniatelahmenyiapkanseikat
bunga.Kami
mengendapendapdikebutjagungdantibadisebuahrumahVictoriayang
besar.Hujan
soretaditapisekaranglangitcerah,purnamatimbultenggelamdiantara
gumpalan
gumpalanawan.Lampulampududukdidalamrumahmembiaskansinar
temaram.Suasanasepidansendu,sungguhsempurnauntuklaguWhenI
Fallin
Love.Kamisembunyidibalikpohonsaga.Antarakamidansebuahjendela
yangsangat
tinggiterdapatlapanganrumputhijauyanglandaidanterpelihara
rapi.Darisiripsirip
jendelaitukamimelihatNurmalahilirmudik.
KeringatAraibercucuran,dadanyaturunnaik.Iaberusahakeras
menenangkandirinya.

Arai...tabahkanhatimu,inilahsaatnya!!

Araimelangkah.Ditengahlapangan,antaraakudankamarNurmala,ia
berhenti,menyampirkanbangitardipundaknyadansiapberaksi.Ia
memberiisyarat
padakudanJimbron,artinyakamiharusmelemparjendeladengan
kerikil.Teknikini
[Hamalan118dari168]

|
AndreaHirataSangPemimpi
sudahdicontohpuluhankalidalamfilmdiTVRIdanAraipunmemulai
lagunya.
Hhhmmmmmm...hmmmmmm...hmmmmm....

Nurmalayangtengahhilirmudikterhentilangkahnyadanmenolehke
jendela.Arai
mengeraskansuaranya.Sayangnya,mungkinkarenagugupiabernyanyi
sepertiminggu
ketigalatihan.Suaranyaketimur,gitarnyakebarat,dantemponyake
selatan.
Nurmalamengintipdaricelahsiripjendela.LolonganAraisemakinkeras
sepertijeritan
kumbang.DantibatibaNurmalaberbalik,meninggalkanjendela.Taklama
kemudiandari
dalamrumahkudengarsamarsamarsuaraorkestra.Puluhanbioladancel
omengalunkan
sebuahintrodenganhalusdanharmonis,lalumasuklahvokalyangmegah
menggetarkan.
WhenIfallinlove
Itwillbeforever...
Intherestlessdaylikethis,
Loveisendedbeforeitsbegun
WhenIgivemyheart
Itwillbecompletely
RupanyaNurmalamemuatpiringanhitamnatKingCole,vokalisjazz
terbaiksepanjang
masa,yangmembawakanlaguWhenIFallinLovedengankeindaanyang
takada
bandingannya.
Araipanictapitetapmelolong,sekarangsuaranyabergulung
gulung,Tempo,bunyi
gitar,dansuaranyasemburattaktentuarah,sumbang
bergelimpangan.Semakinkerasia
melolong,semakintinggiNurmalamenaikkanvolumegramophone
nya.Akuterpana.Ini
adalahpembunuhankarakterpalingsadisyangpernahkusaksikan.Aku
danJimbron
tertawagelisekaligustaksampaihatimelihatAraiyangtakberhenti
bernyanyi.
Iasemakindemampanggungtapisedikitpuntakmaumundurmeski
harusbersaing
melawansanglegendaNatKingCole,meskihatinyatelahtersungkur.Aku
[Hamalan119dari168]

|
AndreaHirataSangPemimpi
danJimbron
berusahamenahandiritaktertawaagarAraitaktersinggung.Araiterus
melolongdengan
gagahberani.SuaranyabersahutsahutandenganNatKingColedan
semakinlama
semakintakkeruan.Akhirnya,akudanJimbrontakdapatmenahandiri
karenakinisuara
Araiberbelokketimurlaut,gitarnyaterbiritbiritkebaratdaya,dan
temponyatersesat
jauhketenggara.AkutaktegamelihatAraiyangbercucurankeringatnya.Ia
sendiri
tampakkesusahanmenahantawanya.Suaranyamelemah.IasadarNatKing
Colesama
sekalibukantandingannya.Kugenggamstanggitar
Arai,senyap.Kusadarkaniabahwa
rencanamanisnyatelahgagaltotal.Dawaidawaigitarberhentibergetar
danwanita
indifferentdidalamrumahVictoriaitutaksedikitpundapatdidekati.
Araimenunduklesu,megapmegap,kelelahanmengendalikansuaranya
yangtelah
pontangpanting,Kugandengiameninggalkanlapanganrumput.Kami
pulangmelintasi
kebunjagung.Dahandahannyayangbasahmenyayatlengankami,gatal
danperih.Nat
KingColemasihkudengarsampaijauh:Merduseakandentingharpadari
surga.Sungguh
mengerikanhidupinikadangkadang.

[Hamalan120dari168]

|
AndreaHirataSangPemimpi
Mozaik15
EkstrapolasiKurvayangMenanjak

TakperlubelajarmatematikasampaikeSMAhanyauntukmenghitung
semuarencana
masadepanyangkamigantungkanpadatabunganuangreceh,setelah
dikurangi
membantukeluargamembelisembako,adalahtakmasukakal.Kamitahu
banyakorang
yangmemilikisumberdayamembuatrencanayangdetaildan
realistis:pengeluaranuntuk
kuliah,hidup,mudik,danentertainment,termasukposluarbiasajikasakit
misalnya.Rencanaitudibuatrapiuntuklimatahun,ditambahcadangan
konservatifselama
duatahunsebagaistatisticrataratawaktusarjanaIndonesiamenganggur
setelahlulus
kuliah.
Namun.daritempataku,Jimbron,danAraiberdirirencanakonvesionalitu
tidak
berlaku.Karenakamiadalahparapemimpi.Seandainyatidakdipakaiuntuk
sekolah
pun,tabunganitu,yangdikumpulkanselamatigatahundaribekerjasejak
pukulduapagi
setiapharimemikulikan,takkancukupuntukmembuatkamihiduplebih
dari
setahun.Dandaritempatkamihiduplebihdarisetahun.Dandaritempat
kamiberdiri,di
PulauBelitongyangterpencildanhanyaberdiameterseratuslimapuluh
kilometer
ini,citacitakamisekolahkePrancis,menjelajahiEropasampaikeAfrika
adalah
potonganpotonganmozaikyangtakdapatdihubungkandenganlogika
apapun,bahkan
denganpikiranyangpalinggilasekalipun.
Namun,sekarangakumemilikifilosofibarubahwaberbuatyangterbaik
padatitikdimana
akuberdiri,Itulahsesungguhnyasikapyangrealistis.Makasekarangaku
adalahorang
yangpalingoptimis.Jikakuibaratkansemangatmanusiasebuah
kurva,sebuah
grafik,makasikapoptimisakanmembawakurvaituterus
[Hamalan121dari168]

|
AndreaHirataSangPemimpi
menanjak.Sebaliknyaaku
semakinterpatridengancitacitaagungkami:inginsekolahke
Prancis,menginjakkankaki
dialtarsuciAlmamaterSorbonne,menjelajahiEropasampaikeAfrika.Tak
pernahsedikit
punterpikiruntukmengompromikancitacitaitu.
Palingtidak,karenatenagadarioptimisme,padapembagianraporterakhir
saattamat
SMANegeriBukanMainhariini,akukembalimendudukkanayahkudi
kursinomor
tiga.Araimelejitkekursidua.Tidaklahterlaluburukkeadaankamidi
antaraseratusenam
puluhsiswa.AdapaunJimbronsedikitmembaikprestasinya,darikursi128
menjadikursi
47.Nurmalakaratandikursinomorsatusejakkelassatu.MendapatiArai
cengengesandi
sampingnyaNurmalamemandangkakuluruskedepansepertiorangtidur
salah
bantal.Sakitlehernyajikamenoleh.
NurmalaakansegerameninggalkanBelitonguntukmenjalanirencanalima
tahunplus
duatahunkonservatifnya,danmenjelangmalamperpisahansekolahArai
telah
menyiapkansebuahrencanalagiuntukNurmala.Akusalutpadakekuatan
mental
Arai.Idenyaadalahkamiakanmenyerbumelaluikebunjagungitulagidan
Araikembali
akanmelantunkansebuahlagudiperkaranganrumahNurmalatapikaliini
secaralip
synch.Sebuahideyanghebatbukan?Laguyangkamipilihasangatindah
takterkira:I
CantStopLovingYou.CukuplahArailatihanbergayasepertiBarry
Manilowdan
biarlahyangmengurussuaranyaRayCharles.
BerharihariAraimelatihgayanyadibawaharahanBangZaitun.

Kalaubisa,jikamenyanyi,wajahmujangancengarcengirsepertiunta
begitu.Boi,hi...hi....hi...hi....,saranBangZaitun
BangZaitunsangatkomitpadapenampilanAraikaliinisebabiamerasa
bertanggung
jawabpadakegagalanAraiyangpertama.MakaBangZaitunmeminjamkan
setelan
[Hamalan122dari168]

|
AndreaHirataSangPemimpi
panggungnyayangsangatistimewa.Setelanituadalahsetelanjaslengkap
satupaket.Kaus
kaki,sepatuputihberhaktinggi,pantaloonyangsangatbagus,ikat
pinggang,bajukemeja
lenganpanjanguntuklapisandalam,danjas,ditambahsebuahslayer
panjang,Semua
sandangitu,semuanya,termasukikatpinggangdanslayeritu,berwarna
putihmengilat.
HarapkaupahamBoi,setelaninihanyakupakaikalaumembawakanlagu
Fatwa
PujanggauntukmenyambutgubernurdariPalembang
Dantaklupa,Hihihihi..

Sebagaisuatutambahanyangmemikat,BangZaitunjugameminjamkan
sebuahtopi
sombreroberwarnamerah.SombreroadakahtopiorangMeksikoyang
sangatlebar.Tidak
matchingsesungguhnyakarenasaatseluruhsetelanitudicobaArai
tampakseperti
benderamerahputih.TapiAraisenangsekali.
Usaimagribkembalikamimenerobosladangjagung.Akumemikultape
wirelessbesar
yangkamipinjamdarikantordesadanJimbronmenentengaki.Arai
melangkahhatihati
karenatakmaumengotorisetelanjasputihnya.
Kamimengendapdibalikilalangsetinggilututyangmembatasikebun
jagungdan
halamanrumputperkaranganrumahNurmala.Daricelahcelahsirip
jendelakayutak
tampakgerakanapapundidalamrumah.Araimengambilposisiditengah
lapangan
rumput,akudanJimbronmenyambungkanakipadatapewireless.Arai
menjentikkan
jemarinyadanakumemencettombolplay.Diawaliteriakanseraknyayang
khas,mengalirlahkeudaralengkingansyahduRayCharles.
Icantstoplovingyou..
Ivemadeupmymind..
SungguhhebatRayCharlesbernyanyi.Priabutaituseakanmenumpahkan
seluruhjeritan
jiwanyamelaluisuaranyayangberatterseretseret,penuhderitasekaligus
harapankarena
takkuasaberhentimencintaiseseorang.Danbelumhabisbaitpertama
[Hamalan123dari168]

|
AndreaHirataSangPemimpi
kudengarsuara
langkahtergopohgopohmenghampirijendela.Akumerasategangwaktu
seseorang
membukajendeladengantergesagesa.Laludiambangjendelayangtinggi
berdirilah
ZakiahNurmala.Cantik,anggunsemampaisepertiGabriellaSabatini.Ia
tercengangsambil
memilinrambutnyayangbergelombangdantergeraitakteratur.Lalu
merekah,namun
segerapadam,danmerekallagi,kemudianpadamlagi,dankembali
merekahsenyumyang
susahpayahiatahantahan.Manistakterperikan.Sepertimadupada
musimbunga
meranti.JelassekaliiapencintaberatRayCharlesdanwajahnyaseakan
bertanya,BagaimanakalianbisatahuakupenggemarRayCharles?
Dandisana,ditengahlapanganrumput,demimelihatNurmalasenang,Arai
beraksi
semakinmenjadijadi,meliukliuksepertiikanleleterlemparke
darat.Putihberkilauan
bergelombanggelombang.Topisombreronyaialepaskan,ialambai
lambaikanlalu
dikenakannyakembali.Demikianberulangkali.Tidaklahburukpenampilan
Araikalu
ini.BahasaInggrisnyamemanjagosehinggaiamemahamiartisetiapkata
yang
dilantunkanRayCharles.Mulutnyamonyongmonyongkesanakemari
sesuaipengucapan
Ray.Dangayanyamemesona:Iamembungkuk,menepuknepuk
dada,mengibasngibaskan
tangannya,berlutut,menengadahkelangitsambilmembekapkedua
tangannyadidada,dan
berlarilarikecil.LebihdariituiamampumenghayatimaknasetiapsyairI
CantStop
LovingYousebagaiungkapanhatinyapadaNurmala.AkudanJimbron
tertegun
menyaksikanpemandanganindahyangmenyentuhhatiitu:seoranlaki
lakiyangsama
sekalitakberbakatseni,berdandansepertiingintampilditelevise,tak
mampu
membawakanlagucukuplahdenganmembawakangaya,tapiiatampil
dengansepenuh
jiwa,iapentasdilapanganrumputhanyauntukpujaanhatinya
[Hamalan124dari168]

|
AndreaHirataSangPemimpi
seorang.Nurmala
cekikikandantakberhentitersenyumsampaibaitterakhirlaguitu.
Thesaythattime
Healsabrokenheart
Buttimehasstoodstill
Whenyouareapart
Lagupunusai.Nurmalamundurdanpelanpelanmenutupjendela.Laluia
mematika
lampukamarnya.AkudanJimbronmembereskantapedanaki.Arai
melilitkanSlayer
putihdileherpanjangnya.Iatersenyummelihatjendelayangtertutup
rapat.Ia
berbalik,langkahnyayangcanggungtapianggunsepertibelalangsembah
meninggalkan
lapanganrumput.Kamiberlaludalamdamai.

[Hamalan125dari168]

|
AndreaHirataSangPemimpi
Mozaik16
Ciputat

Kebiasaanadalahracun,rutinitastaklainadalahseorangpembunuh
berdarahdingin.Aku
memandangipasarikanyangpesingketikapanasdanbecek
mengambangkansegala
jenislimbahketikahujan,bioskopbobroksarangberbagaijeniskutudan
hewan
pengerat,kamarsempitkontrakankamiyangnyamuknyasudahkebal
padaberbagaijenis
racunseranggadariyangdibakar,disemprot,ataudilistrik.Beradadi
dalamnyahanya
tertahankandengancepatcepatmenutupmata,memasukifrekuensi
dengancepatcepat
menutupmata,memasukifrekuensimimpi,tidursambilmendengkur.Tapi
masya
Allah,akugamangketikaakanmeninggalkansemuakekumuhanitu.
Merantau,kitaharusmerantau,berapapuntabungankita,sampaidiJawa
urusan
belakangan,Araiyakinsekalidenganrencanaini.

KamiinginmengunjungiPulauJawayanggemahripahlohjinawiitudan
berspekulasi
dengannasibkami.Untuksementarakeinginankuliahvolumenya
dikecilkandulu.Dan
tanpakeluargasertasahabatyangditujudiJawakamimemperkirakan
uangtabungan
kamihanyacukupuntukhidupenambulan.Jikaselamaenambulanitu
kamitak
mendapatkanpekerjaan,makanasibakankamiserahkanpadaPencipta
Nasibyang
bersemayamdilangititu.KamiakanberangkatdariDermagaOlivirke
Tanjung
Priok,naikkapalBINTANGLAUTSELATAN.Kapalitubukankapal
penumpang
melainkankapalbarangdagangankelontongdanternak.Kamibisa
menumpangkarena
mualimnyakamikenal.Mualimtelahnegosiasidengannakhodaapakah
padamanifest
pelayaranternakdariKarimunsinggahdiBelitongdanteruske
[Hamalan126dari168]

|
AndreaHirataSangPemimpi
Jawa,manusiabisa
ditambahkan?Hasilnya,untuksementarakaliandianggapmamalia
sehinggaboleh
numpangasalkalianbantumemasak,mengepeldekdanpalka,serta
membersihkanWC.
Danjangankausangkagampang,Boi.Nantikapaliniakanmenarik
tongkang,takbisa
cepat,apalagiinimusimbarat.Kitaakanterapungapungpalingtidaklima
haridi
laut.Siap,kau?
Bukantakabur,bang,tapikamisudahsusahsejakkelopakmatakamidapat
melihatdunia
ini,bahkansejakdalamkandungan,pekerjaansemacamitubiasakami
kerjakandi
darat.Apabedanyadikerjakandiataskapalselamaempathari?Makakami
setuju.
TahuapakaliansoalJakarta,pernahkesana?Adayangdituju?Mualim
bertanya.

Kamimenggeleng.

Aduh,gawat!!
Kenaparupanya,Bang?

Ah,beginisaja.PokoknyatujulahJakartaSelatan.Tempatitulumayanaman
dibanding
wilayahJakartalainnya,SampaidiPriok,caribuskeTerminal
Ciputat.TerminalCiputat
adadiJakartaSelatan.
Hanyaitulahpetunjukyangkamipegangdalamrantauanmengadunasib
ini:Ciputat.Aku
danAraipulanguntukberpamitanpadaayahdanibuku.Keduaorangtualu
takbanyak
komentar.Merekahanyamenitipkansatupesanyangmerekaucapkan
hampirbersamaan.
Yangpertamaharuskalianlakukanadalahtemukanmasjid...

Ketikamembereskantas,JimbronmenghampiriakudanArai.

Kud...kudaSumbawainiuntukmu,Ikal...

Akuterkejut.JimbronmenyerahkantabungankudaSumbawanyauntukku.
[Hamalan127dari168]

|
AndreaHirataSangPemimpi

Dankudasandeluntukmu,Arai...

Kamiterpanadantaksanggupmenerimanya.

Daridulutabunganitumemangkusiapkanuntukkalian...

AirmukaJimbronyangpolosmenjadisembab.Iatampaksangatterharu
karenadapat
berbuatsesuatuuntukmembantusahabatnya,

Kalianlebihpintar,lebihpunyakesempatanuntuksekolahlagi,kalian
berangkatsajake
Jawa.Pakailahuangitu,kejarlahcitacita...
Kamiterhenyak.KamitakmendugasedikitpunniattulusJimbronselama
ini.

Jangan,Bron.kausudahbekerjakerasuntuktabunganitu?

DanJimbronsedih.

Ambillah,biarlahhidupkuberarti.Jikadapatkuberikanlebihdaricelengan
itu,akan
kuberikanuntukkalian.Merantaulah.JikakaliansampaikePrancis
menjelajahiEropa
sampaikeAfrika,ituartinyaakujugasampaikesana,pergibersamasama
dengankalian.
Lalukausendiribagaimana,Bron?Araibertanya

AkudiMagaisaja.Lagipulaakusudahditerimabekerjadipeternakan
Capo.Akuakan
menguruskuda!!
Kamitersentuh.KamimenghampiriJimbrondanmemeluknya.Jimbron
yangberhati
lunakdanputih.Dulu,denganpenuhsemangat,iamemesanduacelengan
kudaagar
dibelikanmualimdiJakarta,dansempatkamitertawakanketikacelengan
kudaitu
datang,Ditabungnyaupahbekerjakeraspalingtidakselamadua
tahun.Diisinyakedua
celenganitudenganrata.Taksepatahkatapuniasempatiaucapkan
maksudnya.Kini
[Hamalan128dari168]

|
AndreaHirataSangPemimpi
diberikannyamasingmasinguntukkami.ItulahpengorbananJimbron
untukkami.Kami
berjanjiakanmenuliskannamanyaditanah,digedung,dipohon,di
jalan,kemanapunkami
sampai.
**********

Ketikaberpisah,ayahkumemelukAraidanmendesapkukuatsekali.Tak
adakatakata
untukkami,hanyasenyumlembutkebanggaan,danmatanyaberkaca
kaca.Beliau
kehilangankarenatakpernahsebelumnyakamimeninggalkannya.Pak
Baliamemberikan
padakusebuahgambaryangselaludiperlihatkannyadidepan
kelas:pelukis,menara
Eiffel,danSungaiSiene.Beliaudiamsajadanakumengerti
maksudnya.Prancisbukan
hanyaimpiankudanAraitapijugaimpiansepibeliau.
Janganpernahpulangsebelumjadisarjana....,pesanIbuMuslimah,guru
SDku.Di
sampingbeliauPakMustarmenganggukangguk.Merekatersenyumketika
kami
menyalamimerekaerateratkarenamerekatahuitupertandakami
menerimatantangan
itu:takkanpernahpulangkePulauBelitongsebelumjadisarjana.
AkudanAraimemelukcelengankudadanberdiridihaluanwaktukapal
menarik
sauh.Pelanpelankapalhanyutmeninggalkandermaga.Kulihatdarijauh
loskontrakan
kami,bioskop,pasarikan,TokoSinarHarapan,pabrikcincau,danorang
orangyangtak
berhentimelambaikami:ayahibuku,sahabatsahabatSDkuparaanggota
Laskar
Pelangi,Jimbron,PakBalia,parapenjagasekolah,puluhankolegasesama
kuli
ngambat,Mahader,AKiun,PakCikBasmantukangsobek
karcis,Taikong
Hamim,Capo,PakMustar,BangZaitun,PendetaGeovanny,danLaksmi.Ramai
sekali
pengantarkamitapimerekahanyadiam.Merekabergandengantangan
melepasduaanak
pulauyangakanmengadunasibkeJawa.Hatikumenjadidingin,pipikami
[Hamalan129dari168]

|
AndreaHirataSangPemimpi
basah,betapa
kamiakanmerindukanmereka.
Mataharimerahturundibelakangjajaranpohonbakauketikakamikeluar
dari
SemenanjungAyah,terlepasbebasdaritelukyangsempitberliku
liku.Bentangan
gelombangmembentukanakpanahketikalunaskapalmembelah
permukaansungai
cokelatyangtenang.Warnacokelatitupelanpelanberubahmenjadi
kelabusaatkapal
mengarungimuara,danpudardisapwarnabirukarenakamitelah
menembusLautCina
Selatan.
Darijauhmasihkulihatorangorangmelambai.Semakinlebarlaut
memisahkan
kami,semakinmengembangruanghampadalamhatiku.Tanganmereka
mengalunseperti
pelepahpelepahnyiur.Kupandangipulaukecilkuyangporakporanda
karenakerakusan
manusia.Semuanyaadadisitu:ayahibuku,sanak
keluargaku,sahabat,guruku,kebanggaa
danjatidiriku,tangisdantawaku,inangnasibku,dansemuaperasaan
sayangyangada
dalamhatiku.Barisanpohonsantigimengajakhnggapburungburung
punai
samak,bersambungdenganpadangilalangyangbergelombangdigelayuti
burungburung
pipit,laluperduapitapit,jalansetapak,rumahpanggung,pelanduk,buah
bintang,telagaair
payau,danbatubatupurbayangmempandimakanwaktu,yanglebihliat
darisangwaktu
itusendiri.PulauBelitongtumpahdarahku,terapungsamudradahsyat
yangbergelora
mengurungmu,Belitongyangkukuhtakterkalahkan,kapankahakuakan
melihatmulagi?
BINTANGLAUTSELATANtelahdipeluksamudra.Nakhodamenghidupkan
mesin
utamadandiburitankulihatluapanbuihmelonjaklonjakkarenatiga
balingbaling
raksasamenerjangair.Akudisergapsepiditengahbunyigemuruhdanaku
berpegang
eratpadabesipagarhaluansaatkapalmulaidiayunombakmusim
[Hamalan130dari168]

|
AndreaHirataSangPemimpi
barat,kepalakutak
berhentimengingatsatukata:Ciputat.Pelayarankamitakkanpernah
kulupakankarena
itulahempathari,secaraterusmenerus,detikdemidetik,kamididera
siksaan.Siksaan
pertamakarenakamitelahmabukketikabarubeberapajam
berlayar.Penyebabnya
gelombangyangbesardandapurkapalyangjorokluarbiasa,ditambah
bonusaroma
tengikdarigunungankelapabusuk,yangdisebutkopra.sertadariberton
tonkaretmentah
yangdimuatdalamkapal.MabukjugadisumbangkanolehlaguSenjadi
Kaimanayang
berpuluhpuluhkalidiulangolehnakhodayangtelahdisekappenyakit
obsesifkompulsif
padalaguitu.
Sampailimahariberikutnyakamimabukterusmenerus.Dandalam
penderitaanitukami
harusmengepeldekdanpalka,membersihkaWC,danmemasakempatkali
sehari,Lagi
pulanakhodarewelsekalidalamsoalmakanan.Alisnyamengerutjika
sedikitsaja
sayurankeasinan.Sedangkankamimemaksakandirimakanterusmenerus
karena
makananituakantermuntahkanterusmenerus.AjaibsekaliakudanArai
tidaksakitdan
masihterusbersemangatmelakukankewajibankamisebagaikompensasi
menumpang
kapalternakini.Itulah,Kawan,kalaumautahutenagadari
optimisme,tenagadari
ekstrapolasikurvayangmenanjak,tenagadarimimpimimpi.
Jikakamikeluarpalkauntukmenghirupudarasegar,makakamisemakin
pusingkarena
yangterlibathanyahorizonbuih,bahkankakilangittaktampak,hanya
biru,danbiru,lalu
silaumenusukmata.Kamisepertitakkanpernahmencapaitujuan.Kami
sepertihanya
diamditempat,tercepukcepukdalamsebuahcawanraksasaberisiair
biru.Kamiseperti
telahsalaharah,tersasarkeplanetairyangtakmemilikidaratan.
Dikapalinisatujamrasanyasepertisetahun.Berhariharihanyawarna
biru.Belumapa
[Hamalan131dari168]

|
AndreaHirataSangPemimpi
apaakusudahrindupadaBelitong,padaJimbron,padaPangeran,danpada
Ayahku.Betapa
mengerikannyaberadaditengahsamudra.Apayangadadalampikiran
merekayang
memutuskanbekerjadilaut?jawabannyaadalahpertanyaandaripara
pelaut:apayangdi
pikiranmerekayangmemutuskanbekerjadidarat?Jikabadaidatang,aku
danArai
muntahhinggatakadalagiyangbisadimuntahkansehinggayangkeluar
hanyacairan
kuningyangpahit.Istilahnyamuntahkuning.Dalamkeadaanini,mau
dilemparkankelaut
punsudahtakberdayamelawan.Muntahkuningadalahpuncaktertinggi
prestasimabuk
laut.Jikasudahmuntahkuning,kamibolakbalikkekamar
radioa,menjengkelkan
Markonisdenganterusterusanmenanyakanberapalamalagikamiakan
sampaike
Jakarta?kamimerasasedikitmendinganjikamualimmenggosokkami
denganminyak
kayuputihdansedikitteknikpijatanyangbiasaditerapkannyajika
mendempul
perahu.Salutjugaiadenankamiyangtahanbanting.
Kalaukalianbisabertahandikapalini,kalianakanmampubertahandi
Jakarta,ucapannyasungguhmembesarkanhati.
Harikeenam,pukulsatusiang,akuyangsudahbabakbelur,compang
camping,isengiseng
mendongakkankepalakeluarlubangpalkadanalangkahterkejutnya,nun
jauh
disana,sayupsayup,digarishorizonbiruitukulihatbendakotakkotak
bermunculan
timbultenggelam.
Akumelompatdanberteriaksejadijadinya.

Araiiiii....Jakartaaaaaaaaa....

Araiyangsedangmengaduksayurnangkadidalamdandanglangsung
kabur
menghampiriku.Wajahnyatakjubmemandangjauhpadabarisankotak
yangsemakin
dekat.Iamelonjakdanmemelekkueraterat.Kamicepatcepat
menyelesaikanmasakan
[Hamalan132dari168]

|
AndreaHirataSangPemimpi
lalumandi.Berulangkalikamimengintipkotakkotakyangrupanya
bangunanbangunan
tinggiJakarta.Semuaperasaanmualdanlelahmenguapkarenaekstase
akansegera
sampaidiJakarta.
Kamimemakaipakaianterbaikkami.Kunjungankeibukotatakbisa
dengan
sembarangansaja.Presidentinggaldisitu.Iniperistiwapenting.Aku
berbajusafariempat
sakuhadiahdariayahku.Bersepatu,menyisirrambutkusetelah
mengaduknyadengan
Tancho.Akutersenyumsenyumsendiripadacermin.Akumenyemprotkan
minyakwangi
kelokasilokasiyangmasukdalamradiusjangkauanpenciumanorang
orang
terdekat,mempersiapkankoperbesarku,danmenjinjingcelengankuda.
Araimelakukanhalyangsama,Sepatupantofelnyaberkiliaunkarena
disemirtebal.Siang
itupanassekalitapibajuAraidualapis.Bajudalamnyaadalahkaustebal
lenganpanjang
pasbadanberwarnakuningtuamencolokdengankerahbergendatgendat
menutupi
seluruhlehersampaikedagu,sepertikausorangpadamusimsalju.
Kerenbukanmainkausitu,khusudibeliAraidiTanjongPandanuntuk
kunjunganke
Jakartaini.Lengankausitubersetriphijaubesarsepertibajuolahragadan
dibagian
dadanyaadatulisanasyoi,denganhurufyangdiukurberseniseperti
kaligrafi.Bajuluar
AraiadalahjastebalberwarnacokelathibahdariTaikongHamim.Jas,yang
berbausedikit
apekitu,biasaTaikongpakaijikamenjadikhatibjumat.Ketika
melangkah,Araitampak
sepertiseorangdutabesar.Araijugamenjinjingkoperbesarduakuncidi
tangan
kanannyaberjalandengananggunmenujuhaluan.
Paraanakbuahkapalcekikikanmelihatkamitapikamitakpeduli.Kami
berdiritegakdi
hidunghaluan,menantangpanasnyasinarmataharipukulduasiang,siap
menyongsong
jakarta.Dariwaktukewaktukamimenunggutapibayangankotakkotak
itumasihseperti
[Hamalan133dari168]

|
AndreaHirataSangPemimpi
beberapawaktuyanglalu.Semakinlamatetapsajatakberarti.Kami
terpanggang
matahari.Tanchodikepalakumulaimeleleh.Keringatmengucurderasdan
kamikelelahan
berdiri.Araimembukajasnya.Kamidudukbersandarpadatiangbesipagar
haluan.Kami
barusadar,danitulahyangditertawakanpadaABK,Jakartasebenarnya
masihsangatjauh.
Setelahempatjam,menjelangmagrib,barukapalmerapat.AkudanArai
berdiritegakdi
haluandangemetarmelihatdemikianbanyakmanusiadiTanjung
Priok.Tuamuda,laki
lakidanperempuan,hilirmudik,bergerakgerakcepatkesanakemari.Tak
jelasapa
urusannya.
SelamatdatangdiJakarta,Boikatakelasiyangberbajusepertibaju
DonaldBebek
sambilmenibarsebongkahbesitambatankapaldibibirdermaga.Kamitak
pedulipada
ucapannyakarenategangakanmenginjakJakarta.Akumemegangkoper
dancelengan
kudaeraterat.Kapalmerapatkebibirdermagalalukelasitadimenibar
jalinanjalayang
disambutduaorangdibawah.iamemberiisyaratpadakamiagar
turun.Kami
melemparkankoperkoperkamikeatasjalaitudanmerayapke
bawah.Dengan
Basmallah,kamimenginjakJakarta.NakhodadanparaABKberkumpuldi
haluan,melambailambaikantangannya.Limahariyangmengesankan
denganmereka.

HatihatidiJakarta,Boi...katanakhoda.

KalautaksanggupdiJakarta,bulanJulikesinilagi,kamiangkutlagike
Belitong!!seru
mualim.
AkudanAraimelangkahpergi.Masihkamidengarteriakanmualimyang
samarkarena
tertelanbunyipeluitkapaldaningarbingarratusanmanusia.
Ciputat,Boi.JanganlupaCiputat!!

AkudanAraiterpanamelihatkapalkapal
[Hamalan134dari168]

|
AndreaHirataSangPemimpi
besarKambuna,Lawit,Sirimau,danberbagai
namaberujungloyld.KapalBINTANGLAUTSELATANyangkamianggap
sudah
sangatbesartakadaartinyadibandingkankapalkapalini.Seperti
perbandingannyaayam
dengangajah.Bunyipelutikapalyangmembahanamenggetarkandada
kami.Waktuitu
paspuncakarusbaliklebaran,ratusanorangberseliwerandengantergesa
gesa,hiruk
pikuk,Kamitakberkatakatakarenaserbaterheranheran.Kamiseperti
anakbebekyang
tersasarkekandangkuda.Lalusuatugelombangbesarmanusiayangbaru
turundarikapal
yangsangatbesarmelewatikami.Kamiterdesakdesak.
Akubertanyapadamerekayanglalulalang,KemananaikbuskeCiputat?

Seseorangmenyuruhkumengikutisuaturombonganyangtakputus
putus.Dikejauhan
akumelihatmobilbusbesarbesar.KamiberjalanmenujuTerminal
Tanjung
Priok,Sampaidisanakamisemakintercengangkarenamanusiasemakin
banyak.Diantara
kepulanasapknalpotbusbusitukamikebingungan.Tibatibaseseorang
merampastasku
dantasArai,kemudianmelemparkannyakedalambus.
Naik!!Naik!!perintahnya.
KeCiputat,Pak?
Ditakmenjawab,hanyamenatapkamidariataskebawah,lalumenariklagi
tasorang
lain.BagiorangMelayu,takmenjawabberartisetuju.Kamimeloncatke
dalambus.Bus
meluncurkeluarterminal.Klaksonsanasini,berkelakkeloktanpa
ampun,dantancap
gas.Kamidudukdidepan,terantukantuk,danlagilagitercengang,melihat
demikian
banyakorangmenjejalibus.Laluperasaanheranituberubahmenjadi
takjubmenyaksikan
perkampungankumuhdiseputarPelabuhanTanjungPriok.Begitudahsyat
tenagayang
adadibalikkemiskinansehinggaorangmampuhidupdiatasairberwarna
hitam
membeku,didalamruangruangkardusyangsempit,meminumair
[Hamalan135dari168]

|
AndreaHirataSangPemimpi
limbah,danmenghirup
udararacun.
Malamturun,Satupersatupenumpangmenghilang,bussepi.Ciputattak
kunjung
sampai.AkudanAraiyangkelelahantertidurpulas.Jikaadayangingin
mengambilkoper
dancelengankudakami,kamitakkantahu.Tibatibakamiterperanjat.
Bangunbangun!Sudahsampai!bentakseseorang.

AkumembangunkanArai.Kamitibadisebuahterminalyangjauhlebih
sepidari
TerminalTanjungPriok.Sebuahjamyangadaditamanmenunjukkan
pukul12
malam.Rupanyabustelahberhentilamadiberbagaitempatnamunkami
taksadar.Udara
dinginsekali.Araimengancingkanjasnya.Denganmenentengkoperdan
celengan
kuda,kamikeluarterminal.Sebuahplangbesartergantungdigerbang
terminaldanada
duabuahlampuneonpanjangmenyinaritulisannamaterminal
itu:TerminalBusBogor.
*************

MisipertamamenemukanTerminalCiputatgagal.Kamiterdampardi
tempatyangtak
pernahkamirencanakansebelumya,Bogorsamasekaliasingbagi
kami.Kamihanya
pernahmembacadibukuHimpunanPengetahuanUmumwaktumasihSD
dulu:Bogor
adadiJawaBarat,penghasiltalas,adaistanapresiden,danKota
Hujan.Hanyaitusaja
pengetahuankamitentangBogor.SekarangkamiterdampardiBogorpada
tengah
malam.Taktahuakanmenujukemana.Bahkankamitaktahudimana
barat,timur,utara,danselatan.
KamiberjalanmeninggalkanTerminalBogortaktentuarah,terseokseok
menyeretkoper
yangsangatberat.Kamimelangkahdenganlimbungkarenamasihdilanda
mabuk
laut.Pakaianrapijalikamiuntukmengunjungiibukotatelahkusut
masai.JasAraitampak
timpangdanbajusafariempatsakuayahkutaklagilicinlipatan
[Hamalan136dari168]

|
AndreaHirataSangPemimpi
setrikanya.
BelumjauhmeninggalkanTerminalBogor,disebuahpersimpanganyang
tengahnya
berdirisebuahtuguyangtinggi,akudanAraiterhentimelihatsebuahtoko
yangsangat
indah.Kamiberduatertegundanterkesimadidepantokoitu.Takmampu
berkata
kata,Takpernahseumurhidupkamimelihattokoseindahitu.Cat
bangunannyasangat
memesonadandidalamnyaterangbenderang.Banyaksekali
lampunya.Bermacammacam
lampu.Adalampukecilyangmerambatrambatkesanakemari,naikturun
berputarputar
sampaikeluar,berkelapkelip,sepertidirumahwargaTionghoakampung
kamiyang
sedangmengadakanpestaperkawinan.Didalamtokoadabalonbalon
yang
lucu,bertebaranmenyundulnyundulplafonyangdihiasipitapita
berjuntai.Dinding
didekorasigambargambarcantikyangmendidikdiselaseladeretan
lemarikacaberisi
bonekaboneka.Mejayangmengilatberjejerjejer.Tokoinitelahtutup.Dari
luarkami
melihatparapegawaiberseragammembersihkanlantaiyangberkilauan
danmengelap
lemarilemarikaca.Merekaadalahanakanakmudalakilakidan
perempuanyang
rupawan.Meskipunbekerjasampailarutmalamtapimerekatersenyum
bahagia.Segala
penatdanpeningkepalakarenamuntahmuntahdikapalselamaenam
hariseakan
menguapdemimelihattokoyangmemukauini.Dimukaatasbangunan
terdapatlipstang
besarnamatokoyangmemesonaitu:KENTUCKYFRIEDCHICKEN.
Diambangpintumasukadapatungseorangbapakyanggendut.Ia
bertongkatdan
berkacamata.IajugaberjassepertiArai,bedanyaiamemakaidasikupu
kupu.Iatampak
kayaraya.Namun,patungitutidakmemilikiteksturwarna.Hanyaputih
saja,terutamapada
bagianwajahnya.Denganwarnapolosbegitu,pastilahperancangpatungini
berusaha
[Hamalan137dari168]

|
AndreaHirataSangPemimpi
menghilangkanseringaikapitalisdariwajahbapakitu.
AkudanAraimasihterpaku,takmampumengalihkanpandangandaritoko
yangindah
sepertiistanaperiini.Akhirnya,kamidudukdipinggirjalandiataskoper
kulitbuaya
kami,sambiltetapmenggendongcelengankuda.Pikirankamimasing
masing
melayang.KamitahuKentuckyadalahnamasebuahtempatdiAmerikatapi
kamitak
familiardengankatafriedchicken.Mungkinkarenamasihdipengaruhi
mabuklaut,maka
kamitakmenyadaribahwafriedadalahsebuahkatapasif.Akumembantah
khayalanku
sendiriyangmendugatempatitupeternakanbibitayamdari
Kentucky,atausebuahpabrik
pakanayammodelbarubuatanUSA,atautokountukparakolektor
ayam.Mungkin
saja,karenaorangkotabanyakyangtergilagilapadakoleksianeh
aneh.SepertinyaArai
jugatenggelamdalamanganangannyasendiri.Danakhirnyaiaangkat
bicaramemecah
limabelasmenitterakhirhidupkamiyanglenadibiuspesonasebuahtoko.
Tahukahkau,Ikal...?katanyapelansambilmengancingkanjaswarisan
TaikongHamim
itu.
Iniadalahsebuahrumahmakan,sebuahrestorankhususuntukorang
kaya...

Oooh..,jawabkudalamhati.

Untukdapatmakan,disiniharusdenganperjanjiandulu,harusmemesan
nomor
meja,palingtidaktigaharisebelumnya!
Masukakal...,jawabkudalamhatilagisambilmenggelenggelengkagum
padatokoitu.

Memesannomormejanyapunhanyabisamelaluitelepon!Jikadatang
langsungtakkan
dilayani!
Akumengertiiapastimendapatsemuapengetahuanitudaricerita
sandiwararadio
Singapurayangsiarannyaseringtembussampaikekampungkami.
[Hamalan138dari168]

|
AndreaHirataSangPemimpi
Selesaimakan,jangankaukirabisamembayardenganuangbiasa!

Laludenganapa,Rai?

Dengankartuanggota!!

Kalaukukatakanpadamusyaratmenjadianggota,kauakanterbelalak,Kal!

Jangankausangkagampangmenjadianggotarestoranini,Boi...Antaralain
harusada
buktiseringbepergiankeluarnegerinaikpesawat!
Akutersentakdanterngangmendengarnya.Takpernahsekalipuntebersit
dalam
pikirankubahwamanusiamodernbisaterjebakdalamsuatusituasiyang
sangatrunyam
hanyauntukmengisiperut.Suasanahening.Kamikembaliterpekur
mengontemplasikan
satupersatukehebatanRestoranKentuckyFriedChicken.
LaluAraimenyambungdenganpelantapipasti,Dantahukahkau,Ikal?

Akumenolehpadanya,memohoninformasibaruyangpastiakan
membuatkutercengang
lagi.
PemilikrestoraniniadalahMr.Fredyanggendutitu!

Ochhh...

Akumengangguktakzim.

Luarbiasa...sungguhluarbiasa.

Dankamipunberlalu.Menyeretlagikoperkulitbuayakamisambil
menggendong
celengankuda.Taktahumaukemana.
TentusajasaatituakutakmengertikalauAraihanyasoktahu.Ia
mengambilnama
Mr.FreddariFriedChicken.Belakanganketikaakutahunamalakilaki
gendutituadalah
KolonelSanders,akujadimendapatbahanuntukmeledekAraisepanjang
waktu,sepanjanghidupnyamalah.Namun,kiniyangtertinggaluntukkami
ditengah
malambutainihanyasebarispesandariorangtua.
[Hamalan139dari168]

|
AndreaHirataSangPemimpi
Danhujanpunturun.Gerimis,gelap,lelah,dandingin.Mashtaktentu
arah,kamihanya
melangkahsajasekenanyaberpegangpadapesanorangtuauntuk
menemukan
masjid.Nasibbaik!Belumjauhdariterminalkamimenemukansebuah
gedungdengan
tulisanyangmembuatkamisenangkarenadiSMANegeriBukanMain
kamisudah
seringmendengarnya:InstitutPertanianBogor(IPB).Lebihmenyenangkan
karenadi
belakangnyaadamasjid.
Esoknyadenganmudahkamimenemukankamarkosdisebuahkampung
dibelakang
IPB.Namakampunginisangatistimewa:BabakanFakultas.Mungkinkarena
dekatdengan
berbagaifakultasdiIPB.Kampunginimerupakansebuahlembahyang
dihunioleh
mahasiswadariseluruhIndonesia,denganjumlahyanglebihbanyakdari
pendudukasli
setempat.Makababakaniniadalahsebuahlembahyangintelek.Kamarkos
berdinding
gedekbambudanberlantaisemenyangsebagiantelahmenjadi
tanah.Kamaritumilik
seorangjuraganbawangdiPasarAnyarBogor.Ketikamembukakoper
kamimenemukan
jawabanberatnyakoperitu.Rupanyaibukutelahmenjejelinyadenganikan
asin,beras,botolbotolmadu,pilAPC,Naspro,obatcacingAskomin,pompa
sepeda,rupa
rupabumbudapur,bahkanlumpangdanalunya.
SungguhmenyenangkantinggaldiBabakanFakultas.Barupertamakali
akumelihat
kehidupanmahasiswa.ApalagimerekaadalahmahasiswaIPB,mahasiswa
mahasiswa
pintaryangbermututinggi.Dimasjidatauwarungmerekabicaratentang
ujian,rencana
penelitian,bimbinganskripsi,danpraktikum.Ketikamerekabicaratentang
kalkulus,kultur
jaringan,teoripeluang,danmekanikarindukumembuncahakanbangku
sekolah.Di
babakanFakultasakukembalimerasasepertianggotagardadepan.Aku
danAraitergoda
padasetiaokatakatailmumereka,namunkamisadarbelumwaktunya
[Hamalan140dari168]

|
AndreaHirataSangPemimpi
kamibergabung
dengancivitasacademica.Saatinikamihanyamemilikiduataskulit
buaya.sedikituang
untukbertahanhidup,danduacelengankuda.Tapiwalaupunterbatas
keadaankami,kami
yakindapatkuliah.Sekarangsatupersatusajadulu,yaitubagaimanaagar
segeradapat
pekerjaan,berpenghasilan,dandapatmakantigakalisehari.
Danharihariberikutnyaadalahmalammalamtakbisatidurdantakenak
makanwaktu
menemukankorankoranmerahyangmemuatwartadangambar
penggorokan,perampokan,danpemerkosaandisanasiniyanghampir
setiaphariterjadidi
kota.DemikiansemaraknyakriminalitasdiBogor,Jakarta,atau
Tangerang.Seakankota
kotainiakanmenjadikotamatijikaseharisajatidakterjaditindak
kejahatan.Namun,anehnyalambatlaunmenjaditerbiasa.bahkanketika
neneknenek
dirampok,dicabuli,dandibunuh,akutelahmenjadisepertiorang
kebanyakan:sekali
menariknapaspanjang,semenitkemudianbahkanlupainisialnenekitu.Ini
adalah
kemorosotanpalingbesaryangkutemukandalamdirikudenganhidupdi
kota.
Kamitakpedulimungkinkarenapanikakankeadaankami
sendiri.Berbulanbulandi
Bogor,berbekalselembarijazahSMA,kamitakkunjungmendapatkan
pekerjaan,BerbulanbulandiBogor,berbekalselembarijazahSMA,kamitak
kunjumg
mendapatkanpekerjaan.Bahkanhanyasekedaringinmenjadipenjagatoko
susahnya
mintaampun.Padabulankeempat,dengansangatterpaksakami
memecahkancelengan
kudaSumbawadansandelitu.Tebersitperasaanbersalahkupada
Jimbron.Tapiapaboleh
buat,melamarkerjapunperlubiaya.Jikamasihbegini,napaskamitinggap
tigabulandi
Jawa.AkuteringatpesanmualimuntukkembalikeTanjungPriokpada
bulanJulijika
Jawatakbersimpatipadanasibkami.DanbulanJulimasihtujuhbulan
lagi,berartiselama
empatbulankamiharusberhibernasisepertihewanpengeratmarmot
[Hamalan141dari168]

|
AndreaHirataSangPemimpi
yanghidupdi
PegununganAlpenketikamusimsalju.Hiduphanyadaricadanganlemak
dalamtubuh
mereka.Sayangnyakamiterlalukurus.
Beruntungpadabulankelimakamimendapatpekerjaanyang
istimewa.Karenasang
juraganmemberikamibajuseragamyangelok:Sepatuhitam(walaupun
plastikyang
mengilattapibisadibuatsemakinbagusjikadisemirdenganair).,celana
panjang
hitam,bajuputihlenganpanjang,dandasi!Seutasdasiyangdipakaidengan
cara
direkatkan.Setiappagikamididropdiberbagaiperumahankelas
menengahdiBogor,lalu
kamimengetukpintudemipintuuntukmenjualwajanteflonserta
berbagaiperalatan
dapur.Manissekalikonseppekerjaaninitapipelaksanaannya,bagikudan
Arai,susah
bukanmain.jauhlebihsusahdarimemikulikan.Masalahnyadoortodoor
salesman
adalahsuatuprofesiyangmenuntutkeahlianberdagangtatapmuka
dengandukungan
komunikasikomersialtingkattinggi.Dulang,laut,danau,danuraturat
timah,denganhal
halsemacamitulahwatakkamiterbangun.Kamitakmemilikisecuilpun
kualifikasi
negosiasidagang.Sebulanpenuhkamitakmampumenjualsebilahsendok
pun.Maka
berdasarkanperjanjianyangtelahditeken.diatasmaterai,kamiharus
bersediadipecat
sebabwanprestasi.
Lalukamimendapatpekerjaandipabriktali.Pabrikinimemproduksirupa
rupatalimulai
darijalinanramiyangtakmungkinputusdengandiameterhampirsetenga
meterdanbiasa
dimanfaatkanuntukmenambatkapaldenganbobotmatilimaributon
sampaitalifavorit
parapenggantungdiri:nylonplastikberdiameter30milimeter,dapat
menahanbobot,plus
momentumhentakan,ketikakursiditendang,sampaiseratuslimapuluh
kilo.Sayangnya
pabrikharustutupsebabbangkrut.Keadaankamisemakin
[Hamalan142dari168]

|
AndreaHirataSangPemimpi
kritis.Beruntunglagi,ketika
uangkamihanyacukupuntukmakanduaharilagi,seorangtetanggakos
mengajakkami
bekerjadikiosfotokopinyadiIPB.Hidupbersambunglagi.
Kamiberdiridaripagisampaimalamdidepanmesinfotokopiyang
panas.Sinarnyayang
menyilaukanmenusikmata,membiaskanpengetahuanbotani,fisiologi
tumbuhan,genetika,statiska,danmatematikadimukakami.Lipatanaksara
ilmupada
kertaskertasyangtajammengiriskemarikami,menyayathatikamiyang
bercitacita
besaringinmelanjutkansekolah.kamikelelahanditumpukibukubuku
tebaldari
mahasiswabarutingkatpersiapansampaiprofesoryangakanpensiun
dalameuforia
akademikayangsedikitpuntakdapatkemisentuh.Pekerjaanfotokopi
menimbulkan
perasaansakitnunjauhdidalamhatikami.
SuatuhariakudanAraitertawaterbahakbahakketikakamimemfotokopi
sebuah
brosur.Rupanyaadasebuahseminarhebatdengantemailmiahyang
sangat
bombastis:MEMBONGKARKEPALSUANETIKAPATRIARKAL:UPAYA
KULTURALUNTUKMENGANGKATHARKATDANMARTABAT
PEREMPUAN
DARIDOMINASILAKILAKI.
Didalambrosurituadatulisankeynotespeaker:Pengamatdanpembela
harkatdan
martabatwanita.Dibawahkalimatituadasangkeynotespeaker.Rupanya
fotodiambil
ketikasangpembelatengahberpidatodisebuahseminaryangjuga
bertemapembelaan
harkatwanita.Dalamfotoitu,tangannyamengepalkeudarasepertiorang
meneriakkan
merdeka!Mulutnyaberapiapi,matanyamenyalanyala.Iahobisekali
membuatseminar
semacamini.Kamiterkesiapkarenakamimengenaldenganbaiksang
pembelaharkat
ini.Iataklainadalahwanitayangmenggendonganjingpudel,tak
berpakaianapaapa
kecualiduacarikkecilmerah,dibioskopkecoakwaktukamiSMAdulu.
Sungguhmenakjubkanbagaimanaorangbisamemutarbalikkancitranya.Ia
[Hamalan143dari168]

|
AndreaHirataSangPemimpi
yangsama
sekalitakpandaiberakting,dandisepanjangfilmmurahanitutampakjelas
sutradaratak
mengalamikesulitansedikitpununtukmemintanyamelucuti
bajunya,lenggaklenggokdi
tempatjemurancuciandenganhanyamemakaiduacariktalitemaliuntuk
menutupi
kehormatannyayangterakhir,takragusedikitpunmerendahkanharkat
danmartabatnya
sendiri,kiniiaberubahmenjadipejuangharkatperempuan.Kamiikut
senangingin
mengucapkanselamatuntuknya.SepertiNasio,Marmo,dkk.yangdikirim
pemerintahke
Belitongsebagaitransmingrandankemudianbermetamorfosismenjadi
kuli
serabutan,wanitacarikmerahitupunrupanyatelahpula
bermetamorfosis,telahtobat
lebihtepatnya.Kinirambutnyadipotongpendeksepertiwanitayang
banyak
menghabiskanwaktuuntukberpikirdaniaseringmemakaikacamata
minuspersegi
panjangagartampakterpelajar.Yangmembuatkamitertawaterbahak
bahakadalakarena
teringatbagaimanakamimemerankantokohtokohdalamfilmbejatitu
waktudihukum
PakMustar.
Auuuufff...auuuuuffffh...auuuuuuuuuuufffhhhhhhh,lolongArai.

********************

Waktuitumasihpagi,fotokopiKangEmodtempatkamibekerja,sepi
karenamahasiswa
sedanglibur,pekanteduhmenghadapiujian.

Mang,duapuluhkaloya,bolakbalikperintahseorangibumuda.Iabaru
sajaturundari
sebuahmobildinasberwarnataxiorange.
Amboi,akusukamelihatgayanya.Gayanyaitukarenabajunya.Baju
seragambagiorang
yangmenyediakandiriuntukberlelahlelah,berkotorkotor,taksegan
turunlangsungke
lapangan,membereskansegalahal.Bahannyadrillbirumudayang
[Hamalan144dari168]

|
AndreaHirataSangPemimpi
tebal.Dinginjika
dipakai.Adaduasakumodelkemejalelakidansatusakukeciluntuk
pulpendilengan
atasnya.Diatassakukanannyaadagambarburungmerpatidantulisan
POSdanGIRO.
YangdifotokopiadalahpengumumanpenerimaanpegawaibarudiKantor
PosBogor.

Kalauberminat,bolehsajamelamar...,kataibuitu,Iameninggalkan
sebuahcopy
untukku.

MinatadalahkatayangtidakrelevanuntuksituasikudanArai.Karenaagar
dapat
bertahanhidup,selamamasihhalal,kamisudahsampaitahaprela
mengerjakanhalyang
palingtidakkamiminatisekalipun.Possibility,sesuaidenganfilosofi
Capo,adalahkata
yanglebihtepatuntukkami,yaitukemungkinanyangharuskamilihat
mengingat
berbagaiketerbatasanataumungkinkelebihannyayangkamimiliki.Kami
melamardan
Araigagalpadateskesehatan.Itumembuatkucemaskarenaadayangtak
beresdengan
paruparunya.Sedangkanaku,ketikatesterakhirberupatesfisiklomba
lari,langsung
yakinakanditerima.
Araikembalimemfotokopidanaku,besertapuluhacalonpegawai
pos,dinaikkanke
sebuahtrukberwarnahijau,digelandangkePusatPendidikan
PerhubunganAngkatan
DaratdiCimahi.Laluseseorangmengunduliaku,menyuruhkuberguling
gulingdiair
bekascucianmobil,menyuruhkupushup,merayap,danlompat
kodok.Merekajuga
melarangkuberjalanlebihdarilimalangkah,harusberlari.Setiapbangun
subuhaku
berlari,tengahharisebelummakanberlarilagi,sepanjangsoreberlari,dan
takbolehtidur
jikabelumberlari.Akumenjadikurustapikerasberisi,hitamlegamseperti
aspal.Sebulan
penuhakumenjalanipendidikandasarmiliteragarnantidiJawatanPos
[Hamalan145dari168]

|
AndreaHirataSangPemimpi
dapatdisiplin
melayanimasyarakat.

[Hamalan146dari168]

|
AndreaHirataSangPemimpi
Mozaik17
WewenangIlmiah

Selamapengalamankubekerja,sejakduaSMP,menjadipegawaiPosadalah
puncak
karierku.Meskipunhanyasebagaitukangsortir,daninitakkusukai,tapi
akuadalah
seorangpegawaijawatan!Tahukah,Kawan,artinyaitu?Ituartinyaaku
adalahseorang
amtenar!SeorangKomis!Susahkupejamkanmatakumalammalam
memikirkan
kehebatanlompatankarierkudarikulingambatbeberapabulanyanglalu
sekarangjadi
amtenaryangberangkatkerjadenganbajuseragam.
Mandorku:OdjiDahroji,asliCitayamBogor,sangatpenuh:perhatian.Pria
yangsudahdua
puluhtujuhtahunmenjadiKetuaEkspedisiinimemilikiperawakantinggi
besar.Sangar.Rambutnyaluruskaku,wajahnyakeras,dankumisnya
baplang.Jalannya
tegapsepertiKhrushchev.Memangpenampilanyangdiperlukanuntuk
mengendalikan
ratusanpengantarpos.Tapisenyumnyamanissekalidantakdinyana
suaranya
kemayu,haluslembutsepertiputrikeraton.Iatakjemujemumemompa
semangatku.Hari
iniparatukangsortir,petugasposkelilingdesa,danparapengantarpos
bersepeda
dikumpulkannya.
Jurusortir...,katanyberlogatSundaBogor,sepertiibugurudidepananak
SD.Untuk
membesarkanhatiku,iamemakaikatajurubukantukang.
Adalahtugasyangpenting,pentiiiiing...pisan.Suratpanggilankerja,surat
cinta,surat
gadai,pokonamahsagalamacemsurateuy,ayadimejasortir...

Masadepanorangadaditanganente,Kang...

Parapengantarposmemandangkupenuhhormat.

Jurusortirtheaa...,pujimerekahampirserentak.

[Hamalan147dari168]

|
AndreaHirataSangPemimpi
Ya,bermacammacamsuratadadiatasmejasortirku.Ribuansurat
bertumpuktumpuk
setiaphari.Namun,setiapkalikantongposdicurahkanauselaluberdoa
denganpedih
semogaadasuratdariAraiuntukku.Araitakmeninggalkanalamatdantak
pernah
memberikabar.Akumencariinformasitentangsahabatnyadipabriktali
dulutapilaki
lakiituhanyaseorangperantaudariKalimantanyangtakjelas
identitasnya.Aku
kehilanganjejakArai.
IbumengirimkusuratmengatakanbahwaAraisesekalimengirimiibuku
suratbahkan
wesel,capposnyadariKalimantan,tapiiatakmemberialamatnya.Pesan
ayahkupada
suratibukuagarakumencariAraisemakin
merisaukanku.Sebenarnya,pernahaku
dikirimiAraisurattapiiajugatidakmemberialamatnya.AkumengertiArai
sering
merahasiakansesuatukarenasenangmemberikejutan,akujugapaham
kalauiaterobsesi
untukhidupmandiridengancaranyasendiri,tapisetidaknyaiamemberi
tahuadadi
mana,AkusedihdankehabisancaramenghubungiArai.Akutaktahu
kemanarimbahnya
Arai.
Yangmenghiburkuhanyajikamenyortirakumenemukansuratdanwesel
dariBelitong
untukbeberapamahasiswaBelitongdiIPB.Seiringmerekadatangke
kantorposjika
bermasalahdenganKTPsehinggasusahmencairkanwesel.Makadengan
sebuahcap
karetberukirannamadannomorindukpegawaiku,akumemberiotorisasi
dibelakang
weselitu:DIKENALPRIBADI.Banggamintaampunakudenganprivelege
sebagai
pegawaipositu,selainsenangdapatmemberibantuankeciluntukrekan
sekampung.Tapi
kesenanganinipuntakberlangsunglama,sebabsejakawal1990anPN
Timah
lumpuh.Akuprihatinmelihatuangweselmahasiswayangberangsurturun
setiap
[Hamalan148dari168]

|
AndreaHirataSangPemimpi
bulan.Anakanakcerdasitumegapmegap.Beberapaorangdiantaranya
malahtaklagi
datangweselnya.
TahunberikutnyaakuditerimadiUI.Akumengaturjadwalshiftmenyortir
suratsesuai
dengankesibukankuliah.AkumerindukanAraisetiapharidaningin
kukirimkankabar
padanyabahwajikaiakembalikeBogoriadapatkuliahkarenaakutelah
berpenghasilan
tetap.Walaupunsangatpaspasantapijikaiajugabekerjaparttime,aku
yakinkamidapat
samasamamembiayaikuliahkami.
DiUIDepokakusempatbertemudenganseorangwanitacantik.Waktuitu
akusedang
melintasikerasakdanpepohonankaret.Akumemotongjalanmenuju
FakultasEkonomi
melewatijalursutrasebabdijaluritubertaburanmahasiswiFISIP.
Ikal!Ikal!panggilnya

Akumenolehdanterkejut.ManamungkinWanazizah
mengenalku?MustahilKate
Winsletmemakaikerudung!Ketikamelihatkutadiiasedangtertawatawa
dengan
temannya,priadanwanita,yangsemuahaldalamdirimereka
menunjukkankemasakinian
dansetiapkatayangmeluncurdarimulutmerekaadalahinformasiyang
terupdatedalam
hitunganmenit.Dariduakualitasitu,akutahukelompokmanusiaitu
adalahmahasiswa
jurusankomunikasi,administrasiniaga,danteknikinformatika.Ia
mendekatdan
laguWhenIFallinLovemenyelinapditelingaku.
Hatikuberbisik,ZakiahNurmalabintiBerahimMatarum...

AkusenangberjumpaNurmalaapalagisekarangiaberjilbab.Bagikujilbab
adalahpiagam
kemenangangilanggemilang,kemenanganterbesarbagiseorang
perempuanIslamatas
dirinya,atasimannya,danatasdunia.
Apakabarmu,Ikal?Apakabarayahmu?
Nurmalatetapramah.
AkukuliahdiFisip,katanya.
[Hamalan149dari168]

|
AndreaHirataSangPemimpi
Danrupanyaiajugatelahmasukbarisanwanitawanitacerdasyang
semlohaidiFISIP
UI.Sesuatuyangbagikusepertipengejawantahanmakhlukyangasingdan
jauh.Kami
berbincangbincang.Menyenangkansekalibertemusahabatlama.Apalagi
iabanyak
membawaberitadarikampungkarenaiaseringpulang.Danmendengar
kisahnya,aku
terpuruk.
PNTimahsudahkolaps,puluhanribuorangdiPHK.
Apayangakanorangorangdipulaukecilitulakukan?Tanahnyakurang
cocokuntuk
pertanian.Hasillautterbatas,Sayangnya,akudanNurmalaharus
berpisah.Kamibertukar
alamatdandiamdiamakusenangiataksedikitpunmenanyakanArai
karenaakutak
tahubagaimanaharusmenjawab.ZakiahNurmalabintiBerahimMatarum
tetap
indifferentpadaArai,danakurespekbukanbuatanpada
konsistensinya.Tapiaku
keliru.Iatelahberjalanmenjauhikuketikaiaberbalik.
Aii,Ikal,bagaimanaberitanyaArai?

Dandetikitujuga.Disitu,takjauhdariku,diwajahnyajelaskutangkap
sebersitkilatan
yanganeh.Jelassekali,walauhanyasedetik.Makaakumemberanikandiri
bertanya,Rindukahrupanya?
Pipiperempuancantikitumemerah.

Ha!Itukatamu!Bukankataku!Akuhanyamenanyakankabarnya...

RayCharles...kemanakahRaiCharlesitu?

Iatersenyummalumalu.Akuterusmenggodanya.

ICantstopLovingYou,pheewwbenarkahadayangsepertiitu,Ikal?

Benar,kalauyangmengatakannyaArai

KalauArai,mengaparupanya?

Integritas,jawabu.
[Hamalan150dari168]

|
AndreaHirataSangPemimpi

Sonow,Arai,amanifintegrity....,katakatanyamengambangdiudara.Jelas
iainginaku
mengobralinformasilebihbanyaksoalArai.

Dandialoyal.

AkusengajamembuatNurmalapenasaran.Kupanaspanasi
dia,Oughh,integritasdan
loyalitas!WhatcanIexpectmorefromaman?

Arai,gitu?Themosteligiblebachelorinthewholeworld!Begitukah
maksudmu,Ikal?

Nurmalafrustasikarenakelelahanmelawanhargadirinyauntuktidak
nyatanyata
menanyakanArai.
Iaterkurungdalamkepongahannya.Danakusemakin
menyengsarakannya.

InginkusampaikansalammuuntukArai?

Ahaha!Itumaumu!BukanMauku!Akuhanyamenanyakankabarnya!

Nurmalaterusmenyangkalwalaupunmatanyapenuhragu.Dankautak
salahdengan
kesansatudetikyangkutangkaptadi.SekarangwajahNurmalakakusarat
penderitaan
karenainginsekalitahukabarAraidankarenaegoyangmulaitercabik
cabik.Tapi
semuanyadapatiakendalikandenganbersembunyidibaliktemboktebal
gengsinya,yang
justrusemakinmembuatnyamenderita.Women!Sekarangakumengerti
mengapa
SigmundFreudtakdapatmemahamikeinginanwanitameskipuntelah
melakukan
penelitiantentangwanitaselamatigapuluhtahun,semuanyakarenaa
wanitasendiri
seringtaktahuapakeinginannya.
KalauakujumpaArai,nantikusampaikankaumenanyakankabarnya,oke?

Nurmalamenjadigenit,Oke,tapijanganbilangadasalamdarigue.
[Hamalan151dari168]

|
AndreaHirataSangPemimpi

Gue?AnakMelayubilanggue.Sungguhbesartuntutanpergaulan.Beberapa
orangsampai
haruskehilanganidentitas.
DibayarberapaloeamaAraibuatjadiPublicrelationnyabegitu?

Ah,ah,akusenangpembicaraansepertidalambukupopliterature
ini.Barangkalisetelah
iniiaakanmenanyakan:Araisudahpunyapacarblom?Ataukapanelo
terakhirketemu
doski?
Danperutkumelilit.

Kapansiheloketemudoilagi?

*******************

Waktuyangpandaimenipudemikiancepatberlalu.Takterasaakutelah
menyelesaikan
kuliahku.Sekarangakumerasamemilikitenagabaruuntukmenemukan
potongan
potonganmozaiknasibku.Pekerjaansortirdanhidupkusecara
keseluruhanmulai
kurasakansepitantangannya.Akuinginmenghadapisuatukesulitanyang
membuatky
terusberkembang,akuinginmenjadibagiandarisesuatuyangpentingdan
besar.Aku
berpikiruntukmeninggalkanpekerjaansortirdankembali
mengekstrapolasikankurva
semangatkuyangterusmenanjak.
Akubarusajaluluskuliah,masihsebagaiploncofreshgraduate,ketika
membacasebuah
pengumumanbeasiswastrataduayangdiberikaUniEropakepada
sarjanasarjana
Indonesia.Possibility!kataCapo,makataksedikitpunkulewatkan
kesempatan.Aku
belajarjungkirbalikuntukbersaingmemperebutkanbeasiswaitu.Setelah
melalui
berbagaitesyangpanjang,akusampaipadawawancaraakhiryang
menentukan.Pewawancarakuadalahseorangmantanmenteri,seorang
profesoryang
kondangkecerdasannya.Iamasihaktfimengajardiprogrampascasarjana
[Hamalan152dari168]

|
AndreaHirataSangPemimpi
Universitas
IndonesiadanmenjadidosenluarbiasadiHarvardBusinessSchool.Di
mejanyatergelar
daftarriwayathidup(CV)danproposalpenelitianku.
ProfesoritutampaktertekanbatinnyawaktumelihatCVku.Iaseakantak
relamelihatku
sampaipadatingkatakhirtesbeasiswaini.Akumaklumdengansikapnya
itusebab
beberapahariiniiasudahmembacaCVbegitubanyaksarjanacemerlang
tamatan
universitasuniversitastopnegeriin,bahkanmerekayangmenamatkan
sarjananyadiluar
negeri.Dalamriwayathidupmerekatentutercantumpengalaman
riset,riwayatkerjadi
kantorkonsultan,kariersebagaimanagerdiperusahaan
multinasional,publikasibuku
bukuberbobot,danpenghargaanilmiahdaridalamdanluarnegeri.Maka
melihatCV
ku,yangberdasarkansaranseorangsahabatharusdibuatsedetail
mungkin,iamengucek
matanyaberkalikalisaatmembacapengalamankerjaku:salesmanalatalat
dapur,karyawankontrakdipabriktali,tukangfotokopi,danjurusortir.Ia
takberminat
samasekali,keninggeniusnyaberkerutkerut.IamalasmenyentuhCVku.
Namun,kawan,saatwajahyangditutupikacamatapersegiempat
berbingkaititanyang
mahalitumenolehbarangsepuluhderajatkearahpukultiga,ke
permukaanproposal
risetku,satupersatukerutandidahinyaterurai.Lalukeningnyajadi
padat,licinbersinar
sinarserupabuahpearshandong.Dibaliklensaminusyangtebalkulihat
bolamatanya
berdenyutdenyutmembacakatademikatadalamproposalku
itu.Kepalanyamenoleh
cepatkekirikanankarenamembacacepatdanwajahnyakaku.Hidung
mancungyang
terpelajaritumengendusenduspersisidubukmenciumairkencing
wilayahkuasa
landak.Mulutnyakomatkamit,Iamelungsurkanbingkaikacamatanyake
tengahbatang
hidungnyakarenainginmelihatkulangsung.Teriakannyatercekatdalam
duabiji
[Hamalan153dari168]

|
AndreaHirataSangPemimpi
jakunnyayangbergerakgerakturunnaiksepertisempoa.
Maksudmutransferpricing!???
Akutaksempatmenjawabkarenaiamelompatdaritempat
duduknya.Bergegaske
arahku,berdiritegaklurustepatdidepanhidungku,menatapkunanartak
percaya.Kaliini
iatakmenahanteriaknya.Suaranyakencangsekalisampaikeruangan
sebelah.
Maksudmysemuabaganiniadalahmodeltransferpricing!!???

Akuterpanakarenaantusiasmeprofesorini.Akumenjawab
pelan,iya,Pak...

Daniamerepetpanjang,keras,dancepatsepertirentetanpeluru,:Short
term
equilibrium!!!?MengukurIRRdengankatalisatoroutputrange!!??Apaitu
output
range??Apaitu!!Lalu,iniapa!Profitabilitymap!!??
Akutaksempatmeresponnyakarenaiasepertiorangkesurupan.

Shorttermequilibrium!??astagamengapaakutakpernahberpikirke
sana!!??Shortterm
equilibriumuntukmodeltransferpricing??!!Luarbiasa!!Luarbiasa!!
Siapakauini,AnakMuda??

Terus,terus,bagaimanamatematikanya??Nah,ini,ini,bagaimanaini?

Iadilandahisteria.Dadanyaturunnaik.Iasepertimenemukansesuatuyang
telahdemikian
lamaiacari.Dibolakbaliknyalimahalamanproposalrisetkudengan
dengancepatsampai
kertaskertasitulecektakkeruan.Iakembaliberteriak,Sadarkahkau,Anak
Muda!!??Modelmuiniberpotensiuntukmenjaditeoribarudalamilmu
ekonomimikro!!
Ektaseseorangilmuwanmeluapluapdalamdiriprofesortuaini.Ia
mengadukaduk
rambutputihnya.
MasyaAllah!!Sudahbertahuntahunakumendalamitransfer
pricing,mengapalogikaini
takpernahterpikirolehku??
Iatersenyumriangpenuhsemangat,hilirmudiksepertibebek.Ia
mengenggampropsolku
[Hamalan154dari168]

|
AndreaHirataSangPemimpi
seumpamasebuahtemuanilmiahyangpenting.
Bagussekali!!Takadalagiorangyangdapatmembuatteoribarudalam
ilmuekonomi
mikrosetelahFisher,Edgeworth,danAntonelli,dantahukahengkau,Anak
Muda??Itu
sudahterjadihampirduaratustahunyanglalu.Takberlebihan
kukatakan,jikasemua
hipotesismuinidapatdibuktikan,jikasemuapremisdanasumsimu
valid,makarisetmuini
bisamemenangkanpenghargaanilmuiah!!
Akumerindingmendengarnya.Tapitakmungkinprofesorinimembual.

Luarbiasa!!Karyawankontrakpabriktali!!ledaknya.

Akutenggelamdalameuforiaintelektualsangprofesor.Kawan,bukan
bermaksud
sombong.Begini,sebenarnyaapayangkulakukanberangkatdariideyang
sederhana
saja,akuhanyamembuatmodeluntukmenemukanmetodeyangpalingpas
untuk
menentukanhargaproduktelekomunikasi,tarifSLJJ
misalnya.Nah,penentuantarif
telekomunikasiselalumenemuikesulitankarenasifatsifatalamiahdari
bisnis
telekomunikasiitusendiri,yaitujasanyasampaikepadakonsumensering
harusmelalui
banyakoperatortelekomunikasiyangpopulerdisebutinterkoneksi,dan
telekomunikasi
merupakanusahajasayangsulitditentukanstrukturbiaya
operasinya.Penentuanharga
produkuntukbisnisyanginterkonektifsepertitelekomunikasidisebut
transfer
pricing.Transferpricingmerupakansalahsatutopikpalingrunyamdalam
teorimaupun
praktikekonomimikro.Kesulitaninidialamipulaindustritelekomunikasi
sehinggajika
operatormenentukansuatutarifselaluterjadiperselisihanantara
konsumen,legislatif,dan
operator.
Impressive!!Bagaimanakaubisamencapaiidebarusepertiini,Salesman
perabotdapur
daripintukepintu?Jikasemuanyaberjalansesuairencana,perusahaan
[Hamalan155dari168]

|
AndreaHirataSangPemimpi
perusahaan
telekomunikasiitutidakbisalagimenjualkucingdidalam
karung!!Ha...ha...setuju,Anak
Muda??
Profesoryakinakanhalitusebabmodeltransferprocongkudapat
mengobservasiapakah
operatormenetapkantarifinterkoneksiyangterlalutinggiatauterlalu
rendahsesama
operator,atauapakahsuatutarifterlalutinggibagikonsumensehingga
operatordapatdi
dugunakankonsumenuntukmengadvokasitarif.Profesormengguncang
guncang
bahuku.Wajahnyacerah,bahagiasekali.Iayangjauhlebihmengertidariku
soaltransfer
pricingmampumelihatkemungkinanyangluas,kemungkinanaplikasi
modelkupada
seluruhbisnisinterkonektif,tidakhanyatelekomunikasi.
Dansekarangiaraguragu,Iamenatapkudarirambutkubergayakuno,baju
seragamlusuh
poskuyangbergamabarburungmerpati,celanabaggykampunganyang
dipakaiorang
rabunmodeberbadanpendek,sampaiketalisepatubataputihkyang
kepanjangan.
Kauyakindapatmelakukanrisetini,JuruSortir?tanyanyaprihatin.Kau
tahu,kan??magnituderisetiniluarbiasa,overwhelming!!Didalamnyaakan
ada
pengumpulandatayangluas,studiregulasi,kajiantekonologiyang
rumit,danyangakan
memecahkankepalamukarenamodelmumerupakanmodel
multivariat,makaakan
terlibatmatematikadinamikyangsangatrunyam!Ah,manissekali!!
Takadaalasanbagikuuntuktersinggungkarenaakusadarbetulmateri
risetyang
kumasuki,Pembuktianseluruhhipotesisdarimodelrancangankuini
ditujukanuntuk
menemukanteoribaru,makaiatidakbolehhanyasekadarpembuktian
melalui
simulasi,tapiharusdibuktikanmelaluiteoremamatematika,matematika
dinamikpula.
Tapiakutakkansurut,Tokohtokohhebattelahmempersiapkankuuntuk
situasiini.Bu
MuslimahguruSDkuyangtelahmengajarikuagartaktakutpada
[Hamalan156dari168]

|
AndreaHirataSangPemimpi
kesulitanapa
pun,ayahkudengansenyumlebutnyayangmembakarjiwaku,PakBalia
yang
menunjukkanpadakuindahnyapenjelajahanilmu,danAraiyang
mengingatkankuagar
takmendahuluinasib.
Karenaitu,akuharusdapatbeasiswaini,pak,agarakumenjadipintardan
mempu
melakukanrisetku.
Profesoritutersenyum.

Seandainyahanyakeputusanku,kaupastidapatkanbeasiswabergengsi
ini!Tapikau
tahu,AnakMuda,dewanpengujilahyangmenentukan.

Suaranyalirihpenuhharaptapitibatibaiaterperanjat,Ah!Garagara
proposalmuaku
sampailupa,kauharusjugadiinterviewolehpenyandangdana.Hatihati
menjawab.Nasib
beasiswamuditangannya.Tunggusebentar.
ProfesoritumeraihteleponPanasonicmultifungsidi
sampingnya,menghidupkan
speakernyadanmemutarnomordengankodenegaraBelgia.Iaberbicara
denganseorang
madameberlogatIrlandia.
Dr.MichaellaWoodwardinginmewawancaraimu.Bicarayangefektif,dia
sedang
sibuk!!Profesormenyerahkangagangteleponpadaku.
Helo...hello...helloooo,suaradisanaputusputusdantaksabar.Akuagak
tegang,baru
kaliiniakuditeleponseseorangdariluarnegeri.Seorangdoktorekonomi
pula,pejabat
UniEropapula.
Hello...hello..,jawabkutertahan,gugup.

Hello!!suaradiBelgiatergesagesa.

Ha,Mr.Hirata...

Maam...

Hmm...hm..mmm...
[Hamalan157dari168]

|
AndreaHirataSangPemimpi

Oke,Mr.Hirata!ApapendapatAndasoalpenyakitsapigila??!!

Akuterpana,Penyakitsapigila?Sungguhpertanyaanyangtak
kuduga.Kupikiriaakan
bertanyatentangmanfaatrisetkunantibagikemaslahatanumatmanusia
dinegaramiskin
yangsenangsekaliberutangini.Akutergagapgagap,kehilangankata
kata.Akuhanya
menjawab,Hmmm....hmmm..mmmm...
Oooppss,maafkanaku,Mr.Hirata,akuterlalulangsung,Begini...UniEropa
sedang
bingungmenghadapipenyakitsapigilaini.Kebijakaneksterminasidengan
memusnahkan
sapigilasangatmengganggukeseimbanganekonomiEropaBarat,tapijika
penyakititu
menjadiepidemikyangmemengaruhikesehatanmanusiasungguh
merupakanrisikoyang
sangatmahal.MisalkanAndaseorangpembuatkebijakandisini,bagaimana
kiranya
tindakanAnda?
Akukehilangankatakata.Karenaiatahubidangkuekonomi,tentuia
menginginkansuatu
tindakanyangmengandungperspektifekonomi.Tapipersoalansapigila
iniadadalam
areaekonomimakro,sesuatuyangtakbanyakkutahu.Inginaku
mengarangngarang
menghubungkanendemiksapigiladenganpersoalanpenganggurandan
sedikirteori
kurvaAngel,tapiyangkuhadapiadalahdoktorekonomipejabattinggiUni
Eropa.Sedikit
sajaakukeliru,diaakanlangsungtahukalauakumengadaada.
Bagaimana,Mr.Hirata??
Iamendesakdanakugugup,taktahuharusmenjawabapa.Tibatiba
dengangerakan
diamdiamsepertibajing,sangprofesormelompattangkaske
depanku,tangannya
disembelihsembelihkannyakelehernyasendiri,lidahnyamenjulurjulur
lucu.
Akumengertimaksudnya,akuberteriak,Killthemall,Maamyes,killallthe
madcows...

[Hamalan158dari168]

|
AndreaHirataSangPemimpi
Profesormengacungkanduajempolnyapadaku.

DrWoodwardterdiam.Dikantornyayangmungkinberhiaskanlukisan
Rembranddi
Belgiasanaiaterpakumendengarpendapatseorangsarjanaekonomibau
kencurdari
sebuahnegaramiskin.Crak!Dr.Woodwardmembantingtelepon.
Profesorterkekehkekehdisampingakuyangbengong.

Janganhiraukandia,AnakMuda.

Profesormengakhiriwawancaranyadenganku.

Tunggusajapengumumannya.Dewanpengujiakanmengambilkeputusan
dalam
sebulan.Adaseratuslimapuluhorangyangsampaipadainterviewakhir
ini.Dankautahu
sendirihanyalimabelasorangyangakanmendapatkanbeasiswa
itu.Seratuslimapuluh
orangitusudahdisaringdariribuanpelamar.
Rencanarisetmumemangbagustapiseratuslimapuluhorangini
sungguhhebat
hebat.Merekajugamemilikirencanarisetyangluarbiasa.Yankucemaskan
adalah
profesimu.BiasanyaorangBarathanyatertarikmemberibeasiswakepada
merekayang
profesinyaberkontribusibesardalam
masyarakat:dosen,peneliti,konsultan,pekerja
LSM,jurnalis,tokohtokohpemuda,kaderkaderpartaipolitik,manager,atau
paraseniman
berbakat.Takpernahakutahubeasiswadiberikanpadatukangsortir.
Profesormengantarkukepintukeluar.

Persoalanlainnya,kalaupunkaululus,adalahmencariuniversitasyang
inginmenerima
risetmu.Inibukanpersoalanmudahkarenarisetmusangat
spesifik.Universitasituharus
memilikiekonommikroyangmengertibisnistelekomunikasiuntuk
menjadi
supervisormu.UniEropaberanggotakanpuluhannegaraEropa.Dalamsatu
negara,paling
tidakadaduapuluhperguruantinggi,kamiakanmencarisatudiantara
[Hamalan159dari168]

|
AndreaHirataSangPemimpi
ratusanuniversitas
yangcocokuntukmu,tapiitupunkalaukaumendapatkanbeasiswaini.
Akumengucapkanterimahkasihdanmemohondiri.

Goodluck,YoungMan,kataprofesoryangsangatmengesankanitu.

Akuberjalansantaimelewatisebuahkoridordenganpintuberbarisdi
pinggirkiri
kanannya.Iniadalahgedungdimanapembangunannasionalrepublikini
direncanakan.Di
balikpintupintuituparaintelektualmudayangbersaingketat
memenangkanbeasiswa
beraduargumendenganparaprofesorpenguji.Merekaberusaha
meyakinkanpenguji
bahwamerekapantasdiberibeasiswa.Suaramerekakadangkadang
terlemparkeluar.Dan
didepansebuahruanganakutertegun,langkahkuterhentikarenaaku
mendengarsuara
yangsamartapikukenal.
...Teorievolusisebenarnyasudahbangkrut,Pak..

...Teoriitutaklebihdarisebuahilusi...penipuan
arkeologi...superficial...berdasarkan
kebetulan??
Akuterperangahmenyimakkatakatayangtimbultenggelam.

...Risetkuiniadalahrisetbiologidenganspektifreligi,Pak...

...Didalamnyaakuakanmengoreksipandangantentangbentukbentuk
repsentatifyang
menyesatkadariDarwin.
Suaraitunyaring,kering,takenakdidengar.Padasetiapuntaiankatayang
pecah.aku
semakinyakin.
...TidakhanyaberdasarkanayatayatsuciAlQurantentangproses
penciptaan,tapiaku
jugaakanmengemukakanargumentasihebatdarikalanganKristen
Victoria...
Itu,untaiankatakataitu,adalahsuaraArai!PastiArai!Danakusemakin
yakinketika
kudengarargumentasidahsyatnya.
...HarunYahyamemilikiwewenangilmiahuntukmenjustifikasiteoriteori
[Hamalan160dari168]

|
AndreaHirataSangPemimpi
yang
dibualkanparaevolusionis!!
Hatikubergetar.Gagangpintuberputar.AkutahupastiAraiadadisitu.

Halo,Boi...,sapanyalembut.

SimpaiKeramat..

Kamiberpelukan.betapaakumerindukansepupujauhkuini.Seseorang
yangsering
kubencitapiselalukuanggapsebagaipahlawan.Araijelastampaklebih
dewasa.Sinar
matanakalyangisengitutakberubah.Tapiwanakulitnyaterang.
AkubekerjadalamruangandiKalimantan,:katanyaMenggosokbatuakik
dipabrik
jewelry.

Dansekarangiatampan.Hidungyangdulumengumpulditengahwajahnya
dankening
yangmenonjolkinitertarikkebawahmengikutimukanyangtumbuh
lonjong.Iakuliahdi
UniversitasMulawarman,JurusanBiologi,luluscumlaude.Jikamengenal
Arai,tidakaneh
sebenarnyabahwaiatahuakuakanmelamarbeasiswaini,dantelah
melihatkuketika
pelamarbeasiswatumplekbelkdistadionsaatseleksiawal.Diamdiamia
kosdiJakarta
danmemangberniatmenemuikusaatwawancaraakhirini.Itulah
Arai,senimankehidupan
seharihari.AkumengundurkandiridariKantorPosBogor.AkudanArai
untukpertama
kalinyapulankampungkeBelitong.Kamitelahmemenuhitantanganguru
Sdku,Bu
Muslimah,danpakMustar,yaitubarupulangsetelahjadisarjana.Aku
banggamengenang
kamimampumenyelesaikankuliahdiJawatanpapernahmendapat
kirimanselembarpun
wesel.Kamimenitipkanalamatrumahibukupadasekretariatpengurus
beasiswaagar
dapatmengirimkanhasilteskamikesana.

[Hamalan161dari168]

|
AndreaHirataSangPemimpi

[Hamalan162dari168]

|
AndreaHirataSangPemimpi
Mozaik18
Episiklus

AkudanAraimenyergapnyaketikaiasedangmemasukkananaknyake
dalamkeranjang
besiyangdibuatkhusuagardapatdicantolkanpadasetang
sepeda.Begitulahcaraorang
Melayumembawaanaknyanaiksepeda.KeranjangBesiitubiasadibuatkan
olehorang
bengkellasPNTimah.Setelahanaknyaberusialimatahun,karenasudah
berat,jika
bersepedaorantuaMelayumemasukkananaknyadalamkeranjang
pempang.Keranjang
pempangdibuatdarirotandandidudukkanmengangkangitempatduduk
dibelakang
sepeda.
Iaterkejutbukanmain.Danjikaterkejut,katakatanyatertelan,Ka...ka..ka..
ka..ka..!!

Tentusajaakutahumaksudnya.
Barukemarin,Bron!!
Na...na...na...na...na..
BINTANGLAUTSELATAN!!

Usianyabertambahtapiwajahnyatetapanakanak.Tubuhnyamakin
lebar.Akutakdapat
bernapaswaktuiamemelukku.
Su..su..su..su..su..su...su...
Maksudnyasudahselesaisekolah?lanngsungkusambut.
Sudah,cumlaude!!teriakkubanggamenunjukArai.

Mendengaritu,Jimbronsertamertameraihanaknyadarikeranjangbesi.Ia
mengangkat
anaklakilakiduatahunitutinggitinggisambilberteriakteriak
girang.Anaklakilakinya
yanggendutputih,memakaitopirajutandenganbandullucuberwarna
warni,tertawa
senangdiputarputarkanayahnyadiudara.Ibuanakitujugatersenyum
manis,senyum
manisLaksmimemangsudahterkenal.Kamiberkunjungkerumah
Jimbron,yaitulos
[Hamalan163dari168]

|
AndreaHirataSangPemimpi
kontrakankamiduluyangsedikitdiperluas.Iamasihbekerjadipeternakan
Capodantak
melepaskantigagambardidindingloskontrakanitu:Jim
Morrison,Laksmi,danKak
Rhoma.
Lewattengahmalamakuberjalansendirimenelusurijalanjalansempitdi
Pasar
Magai.menjumpaisahabatsahabatlama:episcialiardipinggirpinggir
paritdanairnya
yangmati,selempangsinarlampujalankuningyangmenyelinapnyelinap
dipunggung
pohonpohonbantan,dibibiratapatapsiraprumahmantricandu,dibahu
jalanyang
sepi,dandikeranjangsayuryangbertumpuktumpukdiberandaToko
SinarHarapan.
Betapaajaibtenagacintapertama,SenyumALingmasihsemerbakdi
relungrelung
dadakusamasepertiketikaakuberdirididepantokoitu,terpaku
melihatnyamengintipku
daribaliktiraiyangterbuatdarikeongkeongkecil,tujuhtahunyang
lalu.FragmenA
LingdandesacantikkhayalanEdensorrupanyataklaburdalam
pikiranku,setidaknya
sangwaktutakberdayamenyamarkannya.
Akuberanjakkedermaga.Cendawangelapberbentuksepertilembu
menghalangi
bulan,tapitaklama,lalusinarrembulanterjunketelukteluksempityang
dialirianak
anakSungaiManggar,berebutanmenjangkaujangkau
muara,menggabungkandiridengan
lengkungputihperakSemananjungAyah.Semenanjungyangtenang
memendamseribu
cerita.Takjauhdarisana,berbarisrumahrumahsementaraorangorang
berkerudung,karenarumahmerekasesungguhnyaadalah
perahu.Mereka,manusiayang
jatuhhatipadalaut,Wanitawanitanyakerastapicantik,pandaimelantun
ayatayat
suci,priaprianyasantun,selalumerayudengankatamanisku....
Rembulanbenderangdankundengarsatuteriakan:Magai...!!

Teriakannakhoda.Laluberbelokhalusbelasanbentukbentuk
ramping,lentikberseni
[Hamalan164dari168]

|
AndreaHirataSangPemimpi
seakanjemaripenari,denganlayaryanglayudikatupkan.Katirkatir
nelayanpulang
melaut.Tenangberduyunduyunseumpamakawanananaianai,merapatke
dermaga
disambuthirukpikukkulingambat.Kulikuliituberlarimenginjak
lumput,menerabaslaut
yangdangkal,mencokokujungkatir,menariknyakedarat,dan
mengosongkanisinya.
Akuseakanmelihatdirikusendiri,AraidanJimbron,sempoyongan
memikulpuluhankilo
ikandariperahumenujustanplat.Tigatahunpenuhkamimelakukan
pekerjaanpaling
kasardidermagaitu.Menahankantuk,lelahdandingindenganmeraupi
seluruhtubuh
kamidengankehangatanmimpimimpi.Betapakamiadalahpara
pemberani,parapatriot
nasib.Dengankakitenggelamdidalamlumpursampaikelututsampaike
lututkamiyak
surutmenggantungkancitacitadibulan:inginsekolahkePrancis,ingin
menginjakkan
kakikakimiskinkamidiatasaltarsuciAlmamaterSorbonne,ingin
menjelajahiEropa
sampaikeAfrika.
Akumasihseekorpunggukbutadanmimpimimpiitumasih
rembulan,namun
sebenderangrembulandinihariini,mimpimimpiitumasihbercahaya
dalamdadaku.Tak
pernahlekangsyairsyairPakBalia,jugaketikaiamengutippuisiBellede
Parisyang
ditulisratusantahunlampauolehEustacheDeschamps:
Takadasatupunkotalaindapatmenyamainya
TakadayangsebandingdenganParis
BerbulanbulanakudanAraiberdebardebarmenunggukeputusan
penguji
beasiswa.Limabelasorangdariribuanpelamaradalahpeluangyangamat
sempit.Kalaupunkamilulus,peluangakudanAraimendapatkansatu
universitasyang
samadiantararatusanuniversitasdiUniEropayangtersebarmulaidari
tepipalingbarat
Skotlandiasampaikepinggirpalingtimur,yaituuniversitasdinegara
negarabagiandi
Rusia,jugakecil.Disisilainkamimerasapengumumanbeasiswainisangat
[Hamalan165dari168]

|
AndreaHirataSangPemimpi
pentinguntuk
menentukanarahkamiselanjutnya.Setiapharikamiwaswasmenunggu
suratdariTuan
Pos.
Akhirnya,petangini...
TuanPos!kataibuku.
Ayahkuyangsedangmenyiangipekaranganmenghamburkepinggirjalan
mengambil
suratdariTuanPos.BeliaumenyerahkannyapadakudanArai.Kami
memutuskanuntuk
membukasuratsuratitusetelahsalahmagrib.Usaimagribayahdanibuku
langsung
dudukdikursidepanmejamakankami.Kutahuayahkyguguptapibeliau
berusaha
setenangmungkin.Ibukutakdapatmenyembunyikankegelisahannya.
Petangyangsunyidanmenegangkan.Araumengambilbingkaiplastikfoto
hitamayah
danibunya.Iamenyingkirkeruangtamu.Iadudukdikursimalasayahku.Di
bawah
bendanganlampuyangtemaram.Iataklangsungmembuka
suratnya.Dibekapnyasurat
danbingkaifotoayahibunya.
Akuberanjakmembawasuratkudandudukditanggarumahpanggung
kami.Ayahibuku
mengikutikulalududukdikirikananku.Akutaksanggupmembukasurat
itumaka
kuserahkanpadaibuku,Ayahkumenunggudengangugup.aku
memalingkanmuka.Ibuku
membukasuratitupelanpelandanmembacanya.Beliautercenunglalu
mengangkat
wajahnya,memandangjauh,matanyaberkacakaca.Detikituakulangsung
tahubahwaaku
lulus.Ayahkutersenyumbangga.Akuterbelalakketikamembacanama
universitasyang
menerimaku.Alhamdulillah,kataayahibukuberulangulang.Ayahku
merengkuh
pundakku.Tangankulinyayanghitam,tua,dankasarmelingkari
leherku.Sejakduluia
mendaftarkankumasukkelassatudiSDMuhammadiyah,senyumbangga
itutakpernah
terhapusdariwajahnya.Kiniakumengertisepenuhnyaartisenyum
ayahku:Bahwasejak
[Hamalan166dari168]

|
AndreaHirataSangPemimpi
dulu,sejakakumasihsekolahdiSDmiskinMuhammadiyah,iatelahyakin
suatuhariaku
akanmendapatkanbeasiswapendidikantinggi.Iatakpernahsekalipun
berhentimeyakini
anaknya.Namun,kamiterhenyakkarenadariruangtamu,kamimendengar
samarsamar
suaraisakan.
Kamibangkitmenujuruangtamu.Dariambangpintukamimelihatwajah
Araisembab
beruraiairmata.Iamembekaperatbingkaifotoayahibunyadansurat
keputusan
beasiswaitu.Iamenatapkamipenuhperasaanperihdan
kerinduan.KerinduanpadaAyah
ibunya.SeumurhidupkutakpernahmelihatAraimenangis,takpernah
melihatnya
demikiansedih.Airmatanyaberjatuhanmembasahibingkaiplastikfoto
hitamputihayah
ibunya,membasahikertastebalmengilatyangdipegangnyabergetar
getar.Kamimasih
berdirimematungdiambangpintuketikaiamengatakandenganlirih,Aku
lulus...
DadakusesakmenahankanrasamelihatwajahArai.jelassekali
keinginannyauntuk
memberitahukankelulusanitupadaayahibunya,padaseluruhkeluarga
dekatnya.Apalah
dayasangSimpaiKeramatini.Iasebatangkaradalamgaris
keluarganya.Hanyatinggalia
sendiri.Padasiapaakaniaberitahukan,akaniarayakandalamharidan
gembiraberkah
yangsangatbesarini.Isakantangisnyasemakinkeras.Akumemandangnya
denganpilu
dankembaliteringatpadaanakkecilyangmengapitkarung
kecampang,berbajuseperti
percadengankancingtaklengkap,berdirisendiriandidepangubuknya,di
tengahladang
tabuyangtakterurus,cemasmenungguharapanmenjemputnya.Ayahku
menghampiri
Arai.Araimenangissesenggukanmemelukayahku.
AkumengambilsuratkelulusanAraidanmembacakalimatdemikalimat
dalamsurat
keputusanyangdipegangnyadanjiwakuseakanterbang.Hariiniseluruh
ilmuumat
[Hamalan167dari168]

|
AndreaHirataSangPemimpi
manusiamenjadiseitikairdiatassamudrapengetahuanAllah.Hariini
NabiMusa
membelahLautMerahdengantongkatnya,danmiliaranbintanggemintang
yangberputar
denganeksentrikyangbersilangan,membentuklingkaranepisiklusyang
mengelilingi
miliaransiklusyanglebihbesar,berlapislapistakterhinggadiluar
jangkauanakal
manusia.Semuanyatertatarapidalamprotokoljagatrayayangdiatur
tangan
Allah.Sedikitsajasatudarimiliaranepisiklusitukeluardariorbitnya,maka
dalam
hitungandetiksemestaalamakanmeledakmenjadiremahremah.Hanya
itukalimatyang
dapatmenggambarkanbagaimanasempurnanyaTuhantelahmengatur
potonganpotonganMozaikhidupkudanArai,demikianindahnyaTuhan
bertahuntahuntelahmemelukmimpimimpikami,telahmenyimak
harapanharapansepidalamhatikami,karenadikertasitutertulisnama
universitasyangmenerimanya,samsdenganuniversitasyang
menerimaku,disanajelastertulis:UnivesitedeParis,Sorbonne,Prancis.

Tamat

[Hamalan168dari168]