Anda di halaman 1dari 93

)bjective,

function,andApplicalion
EasicTheory
& 0peralion,

BAB II
ELECTRICGENERATOR
TUJUAN

parapesertaakandapat:
Diharapkan
1. Menyebutkan
fungsidarisistimelectricgenerator
prinsipdarielectrical
generation
2. Menjelaskan
ilustrasidan mengidentifikasi
3. Memberikan
secara
benarmasing-masing
komponen
darigenerator
4. Menjelaskanfungsi dari komponen utama
generator
5. Menjelaskan
secarasrngkatfungsi dari voltage
regulator
6 . Menjelaskan
denganur utanyang benar ,oper as i
darigenerator
selamastart.

PRINSIP
DASAR
PEMBANGKITAN
LISTRIK

Sebuah AC generator mengkonversikanenergi


mekanis ke energi listrik dengan memanfaatkan
prinsipINDUKSIELEKTROMAGNFIK.
Apabilasebuah
konduktorberadadi dalamsuatumedanmagnit,baik
itu fieldnya atau konduktornya
bergerak,sebuah
(EMF,
FORCE
Gaya
Gerak Listrik)
ELECTROMOTIVE
atau voltage(tegangan),akan terinduksidi dalam
konduktor.
A da tiga ( 3) elem en yang diper lukanuntuk
sebuahtegangan
denganmenggunak an
menghasilkan
prinsipinduksielektromagnetik
yakni:
field( medanmagnet)
1. M agnetic
2. Konduktor
relatifantaramedanmagnetdan
3. Pergerakan
konduktor.

TrainingConductedby PT. Pakafti Handayani-hy

9/7/2006

function,andApplication
)bjeclive,
Basic
Theory
& )peration,

FUNGSI

kadangGeneratorarus bolakbalik (AC Generator),


kadangdisebutsebagaialternatortetapi afti yang
palingpentingadalahpembangkittenaga listrik
dijalankan
oleh tenagamekanik
Generatorberoperasi,
hal
biasanya
disebutsebagaimesinpenggerak.,D,a]am
ini mesinpenngeraknya
adalahmesinturbin.
Fungsi dari (turbine) generator adalah untuk
energimekaniske energilistrik.
mengkonversi
,/-l'-\
/i \

o^,* r,uou*

v EC H AN T c AL

i
+D >1

EN R GY

/
GN R AIOR

,r'

FPM

Gam bar1 - 1.
OPEMSIDASAR

Apabilarotor dari sebuah generatordiputar pada


kecepatanputaransinkrondiantarasebuahmedan
magnit,teganganac (alternating
current)terinduksi
padaexciterarmature.Medanmagnityangterbentuk
oleh eksitasidi supply/catuke medan magnit dari
melalui
exciteryang tidak memilikibrush(brushless)
voltageregulator.
rangkaian
Pada saat engine mulai berakselerasi,
mencapai
keadaan
Setelah
dalam
terbuka.
exciter
o/o,
rangkaian
akantertutupdan medan
66
kecepatan
exciter (exciterfield) akan mengalami"flash" dari
control batteriesuntuk memastikanbahwa medan
magnitakanterbentuk.
Setelahenginespeednaikmenujuspeedyangnormal
(rated), tegangangeneratorakan naik menuju ke
teganganyang normal(rated)sambildikontrololeh
voltageregulator.
Sensing dari Transformerakan memberikanbus
voltage signal ke regulator.Output utama dari
generator dikontrol oleh generatorfield current.
Generatorfield current sebaliknyadikontrol oleh
exciter.
daribrushless
rangkaian

TrainingConductedby PT. Pakarti Handayani-hy

9/7/2006

andApplication
Theory
Funclion,
0bjective,
Basic
& )peralion,

Sebuahpower transformer,melaluiregulatorakan
memberikan
eksitasike kumparanexciter.Perubahan
dengan
dariteganganbusakandipantaudandikoreksi
ini.
rangkaian
akan
transformer
Sebuahcrosscurrentcompensating
yang
untuk
ke
regulator
sesuai
memberikansignal
mengaktifkansistim load sharing (mengakomodir
unityangdihubungkan
bebanreaktif)antarabeberapa
secaraparalel.

TYPEDANAPLIKASI

M enur ut ar us atau tegangan yang dihasil k an,


generatordapat dibagi menjadigeneratorDC dan
menurutmetodapembangkitan
GenatorACsedangkan
yangumumnyadipakaisaat
ada dua jenisgener ator
i ni :
1 . Generatordengankumparanutama berputar

(Revolving
ArmatureGenerator).
2. Generator
denganmedanmagnetyangdiputar
(Revolving
FieldGenerator),
REVOLVINGARMATUREAC GENERATOR
GeneratorAC dengan kumparanutama berputar,
medan
kumparanstatornyaakan membangkitkan
berfungsi
rotornya
elektromagnetik. Sementara
sebagaikumparanutamayangberputardalammedan
tegangan
magnet,memotongfluksidan menghasilkan
jenis
ini output
k eluar anyang diinginkan.Pada
g ener ator disalur kanm elalui cincin putar d an
sebagaiarus
tetap dipertahankan
karakteristiknya
b olakbalik.

TrainingConductedby PT. Pakarti Handayanihy

9/7/2005

andApplication
Funclion,
& )peralion,
Basic
Theory
abjective,

Generatorjenis ini tidak umum digunakankarena


tenaga outputnyadisalurkan
dalam kenyataannya
melalui kontak yang berputar (cincin putar dan
sikat arang). Kontak tersebut pasti menimbulkan
gesekkan dan bunga api, terutama pada generator
lidahapi '
tinggiakanm enimbulkan
d engantegangan
Karenaitu generatordengankumparanutamayang
berputar pemakaiannyahanya terbatas untuk
kebutuhantenaga dan tegangan yang rendah,
REVOLVINGFIELDAC GENERATOR
Generatordengan medan magnet yang berputar
ini,
sejauhini yangpalingluasdipakai.Padagenerator
(brushless
yang
berbeda
(DC)
darisumber
arussearah
exciter)disalurkanke kumparanrotor. Rotortersebut
yang
sebuahmedanelektromagnetik
membangkitkan
magnet
yang
meclan
polaritas
tetap,
berputardengan
tersebut menonjol keluar sehingga memotong
tegangan(EMF)ke
kumparanstator,menginduksikan
DC umumnyat25
dalamkumparanstator. Tegangan
VDC atau 250 VDC. Tegangankumparanutama
tergantungpernbeli,mulai dari 120 Volt sampai
dengan20.000Volt. Demikiandemikiankebutuhan
akan tegangantinggi dapat dipenuhi,tidak seperti
generator jenis yang pertama tersebut dimana
cincingeser.
memerlukan
Brushlessexciter armature menggunakansebuah
armatureyang berputarterletakpadarotor generator
exciterfield'(Konfigurasi
utamadan sebuahstationary
generator utama berlawanan dengan armature
itasionerdan rotatingfield).Voltageregulatorakan
memonitoroutputdari generatordan akan mengatur
jumlaharusyangdi dikirimke exciterfield'
ke diodaAC outputdariexciterarmaturediumpankan
rotor
ujung
di
pada
sinks
heat
diodayang terpasang
yang
shaft. AC currentakan di-rectifiedke arus DC
akan dialirkanmelalui winding pada rotor poles'
Setelahrotor berputar,ac voltageakanmenginduksi
field.
magnetic
armaturewindingsebagai
TrainingConductedby PT, Pakafti Handayani-hy

e/7/2006

l
funclion,andApplrcation
lheory& )peration,
)bjeclive,
Basic

stasioner,
Karenaoutputpowerdiambildari kumparan
langsungke
maka outputnyabisa disambungkan
externalload melaluiterminalyang tetap.Tidakada
contactyang bergeserpadaterminalyang tetap dan
seluruhrangkaianoutput secaraterus menerusdi
bahayadari bungaapi
isolasi,sehinggamengurangi
potential.
ground
(arcing)antarakonduktor
ke
RATING
nilaibebanyang
AC generatormendekati
Kemampuan
dapatdisuplai.Bebannormaladalahbebanyangdapat
ditanggungsecaraterus menerus. Mampu untuk
menahan kelebihanbeban dalam waktu tertentu.
generatormenanggung
bebanditentukan
Kemampuan
panas
yang
Dim anapanas
timbul di dalamnya.
oleh
yang timbuldisebabkan
oleh arus listrik.Kemampuan
generatordapat juga ditunjukkandengan kapasitas
aruslistrik.
Ar us maksim umyang dapat disuplaioleh seb uah
pada:
generator
ACtergantung
m aksim um
kar enapanas( I2R)yangda pat
1. Rugi- r ugi
utam a,
ditahan
olehkumpar an
2. Rugi-rugimaksimumkarena panas yang dapat
dalammedanm agnet.
ditahan
Kemampuan generator tergantung juga
penguatnya.
darigenerator
kemampuan

pada

Kemampuangeneratorbiasanyadicantumkandalam
nameplateyang ditempelkanpada bagian luar dari
kerangkamesin.Informasiyangada umumnyasebagai
berikut:
serialandtypenumbers.
1. Manufacturer'

2 . Num berof phases


3. Speed(RPM)
4. Num berof poles
q

Voltageratings(output)
of output
6. Frequency
KW
rating
7. KVAand
TralningConductedby PT. Pakarti Handayanrhy

e/7/2005

function,andApplication
[heory& 0peration,
Easic
)bjective,

8. Armaturecurrent(in Ampsper phase)


9. Ambientand risetemperature
10. Fieldcurrent(in DCamps)
11. PowerFactor
Class
12. Insulation
Informasitambahanmungkinjuga diberikan,sepefti
secaraterus menerus
apabilageneratordioperasikan
(Continuous
duty),
APLIKASI
Generatorset dapat dipakaisebagaiibase load I
maupunsebagaibackup
continuousduty application
powerdalamindustridan fasilitasproses,perumahan,
gedung,dan juga dapat sebagaidistributedpower
yangterhubung
denganPLNGrid.
set
lebihditujukanpadagenerator
Disinipembahasan
yangbanyakdipakaipadaindustriterutamadi industri
minyak dan gas dan jenis generatoryang biasa
dipakai pada Industry/ProcessFacilities adalah
Centaur generator package, Synchronous- type
dengan
dilengkapi
dengansleevebearing.Enclosures
melaluilouvers.
fan untukself-ventilation
Fackageadalahsebuahtipe
PACKAGE SolarCentaurGenerator
GENERATOR
"rotatingfield", 3-phase,brushless,self ventilating
unit. Generator memiliki beban norriral untuk
pemakaian
2500kW padapowerfactor
terus-menerus
0.8 (2800kW pada0.8 powerfactoruntukpemakaian
standby)
sebagai
voltageyang umum dan
Tabel berikutmenunjukkan
yangtersedia pada0.8 PF,
frequency

*------fpquency
--=------Voltage

50 l1z
480
600

3,300

2,400

11,000

5,500

13,800
4,L60
TypicalCentaurGeneratorPackagedan Generator
padaGam bar1.2 dan Gam bar1 .3
Type ditunjukkan
di bawahini.
TrainingConductedby PT. Pakarti Handayani-hy

9/7/2006

Function,
andApplication
Theory
& )peration,
)bjective,
Basic

EXH ^U ST
T U F BIN E
EN G IN E
I
I

i
I

GE AR
U N IT \

GENERATOR

y-

7;:.:,,>*)
\

ENGINE
GAGE
PANEL

I N TE RCONNE CT
SH AT T

PACXAG E
SK ID

Package
Gambar- 1.2 TypicalCentaurGenerator

TurbineSync.Generator
Gambar- 1.3 TypicalCentaur
TrainingConductedby PT. PakartiHandayanrhy

9/7/2006

nts
GeneralorMajor Conpone

BAB II. 2
GENERATORMAIOR COMPONENTS
MACHINERY
CONSTRUCNON

Konstruksi AC generator dapat dibagi menjadi


kategori:
beberapa
o Framework
u Statoratauarmature
a Rotor
System
tr Excitation
Gambar 2-1. menunjukkanpotongan melintang
generator
dengansleevebearing.
sebuahbrushless

F IELO Lf,ADS
RCTIFIERASSLI.tBLY
XCITERARM ATUR\\' INDINC
EXCtIER FIELOlllNolNC
EXCITERFRAIIE W II{ DINC
SLEEVg BEARI]' iG
sTAt0R AR:.lArtr REwlNollvc
cElgelr on
BRACINCRll,JG

9
l0
II
l2
Il
t4
15
1b

IIAIN LtAD S
T EU IR AL LEAD 5
Sl Al 0R LAr J l tr AIl 0Bs
s T Al 0{ r R At.t
R oT 0R s pt0tR
F r EL0 pot LAr ,l l hAT l oN s
F IELO \.'l N D l r {0
Ar ,r 0R T tSStuR | !| tuOIN C

I7 R 0 I0R F Al r
r 8 atR 0ET LEc T O R
l 9 SIIAFI
0r L s r r c A!Gf
3l 0r L R l tGS
SC R Etr r
?l tr {D 5x l tL0
?4 c EN R Al oR T ER U IN ALBl r

Exciter
Brushless
GeneratorSleeveBearing,
Gambar2 - L Konstruksi

Training Conducted by PT. Pakarfi Handayani-hy

9/7/2006

Generator
MajorConponents

STATOR

Statordibuatlembaran
besiyangdilaminasi
oleh"high
gradesiliconsteel",diberi lobangsecarapresisi,dan
diisolasi secara individual. Kumparan (winding)
berteganganrendah berupa "random-woundcoil"
yang lurus, memiliki slots yang "semi-close".
Kumparanbertegangan
tinggi berupa"form-wound"
dalamslotsyang lurus.Gambar2-2. memperlihatkan
typicalstator dan Gambar2-3 menunjukkan
ada 6
buahslotdalamstator.

Typ i ca 1 Genera tor

S tator

Gambar2-2. TypicalGenerator
Stator

SI NGLE.PI ECE
LAMINATION

Gambar2-3.StatorLaminations
TrainingConductedby PT. Pakafti Handayani-hy

9/7/2006

MajorCom7onenls
Generator

Inti kumparan diisi secara berulang dengan


"thermosettingsynthetic varnish, dan dipanaskan
maksimum,
tahanankelembaban
untuk memperoleh
yang
pengikat
tinggi,dan kualitas
kekuatandielektrik
tinggi.
Untuk menghindarikerusakankumparanterhadap
pendek
sepertihubungan
adanyabebanyangtiba-tiba,
penting
untuk
atau motor starting, sangatlah
memasang penguat untuk menahan beban
akibatdari beban
tersebut. Gambar2-4 menunjukkan
tersebut dan Gambar 2-5 menunjukkanpenahan
di antaraujunggulungandan sebuahtali
dimasukkan
penahan
denganpemasangan
serat kaca.Bersamaan
ujungkumparanke kerangkastator(Gambar2-5),cara
yangkakudan kekar.
gulungan
ini akanmenghasilkan

on CoilEndTurns
Gambar2-4.Forces

TrainlngConductedby PT. Pakafti Handayani-hy

9/7/2006

MajorComponenls
Generator

UjungCoil
2- 4.TaliPenahan
Gambar

LeadConnections
Gambar2-5.Insulating
Spaceheaterterletakdi bagiandalamdari generator
akan mencegahpembentukankondensatdi dalam
kumparangeneratorsetelahshutdownpada periode
yanglama.Spaceheaterakandihidup-matikansecara
otomatisoleh sistim turbine control selama urutan
startupdan shutdownjika tidak saklarpemilihdari
TrainingConductedby PT, PakartrHandayani-hy

9/7/2006

MajorConponents
Genentor

pada posisiOFF.Tindakan
sistimakan ditempatkan
bahwa
untukmemastikan
operatorhanya diperlukan
generator
mati.
selama
heatertetapberoperasi
TemperatureDetector)
SensorOpsi RTD (Resistance
windings.
temperatre
untukmemonitor
bisadipasang

ROTOR

Ada dua tipe dasar dari rotor yang dipakaidalam


generator
AC:
- SalientPole
D Synchronous
- Cylindrical
o Synchronous
sinkronadalah
Typerotoryangdipakaipadagenerator
SalientPole.Dinamakandemikiankarenakutub-kutub
darirotornya.
menonjolataumemanjang
medannya
sehingga
balanced"
Rotorjenisini adalah"dynamically
pada
minimal
dinamis
tingkatimbalance
menyebabkan
getaran
semua bidang koreksiuntuk mendapatkan
yang minimum. Rotor fan yang berguna untuk
mengalirkanudara ke generatordan pendinginan
rotor.
(layer-wound
Rotormemilikikumparanyangberlapis
yang
denganresin'rekuatan
di-cement
fieldwindings)
(baked).
tinggi(highstrengthresin)dandipanaskan
ini terdapatslot-slotuntuk
Padalembaran-lembaran
amortisseuryang berguna dalam proses operasi.
paralelgenerator.
I

dan elektrikal
secaramekanikal
Rotortelah dibalance
pada semua speed sampai L25o/odari speed
normalnya.
digunakandalamgenerator
Rotorjenis Cylindricalbiasa
fungsi
dan carakerjanyasama
rpm
tetapi
dengan3600
denganrotorjenisSalient-Pole.

TrainingConductedby PT. Pakafti Handayani-hy

9/7/2006

MajorConponents
Generator

T y p ic a l G e n e r a lo rRo t o r v r i th
Ro L ait n g E x ci t e r
Rotorwith Rotating
Gambar2-6. TypicalGenerator
Exciter

Kacauntuk melihat(sidegage)yangterletakdibawah
bearing digunakanuntuk memeriksaoil level di
reseruoir.
Sensor-sensorOpsi RTD (ResistanceTemperature
Defector) biasanyadipasangpada kumparanstator
bearingdarigenerator.
temperatur
untukmemonitor

EXCiTATIONSYSTEM

Exciterterdiridari sebuahgeneratorAC 3 fasa tipe


armature berputar (3-phaserotating armature ac
penuh3
gelombang
generator)
dan sebuahpenyearah
fasa (3-phasefull wave rectifier).Eksitasiakanterjadi
150 persenarusnormal
ketikageneratormengalirkan
selamasatumenit.
Armatureyang berputardan rectifieryang berputar
terpasangpada generator rotor shaft dan secara
elektristersambungsatu sama lainnyadan dengan
fieldwindings)'(lihat
kumparangenerator(generator
gambar9-4)
StatoruntukExciterterdiridari inti yangdilapisililitan
yang terpasangpada flange ring yang membentuk

TrainingConductedby PT. PakartiHandayani-hy

9/7/2006

nts
Generalor
MaiorComDone

frontbearing
suatubagianyangintegraldarigenerator
bracket.Exciteryang lengkapditutup dan cJiproteksi
denganpenutupyangbisadibuka.

Gambar2-7. Typicalexciterarmature-rotating
rectifierassemblv.

GE N E R A TORFIE LD
S U R GES U P P R E S sOR
EXC ITER
FIELD

E X CITE R
AR,"^ATURE
R OTA TIN G R E C TIFIE R

V OLTA GE
R E GU LATO R

ke brushless
Connection
Gambar2-8. Electrical
rotatingexciterdenganrotating
rectifierunit.

BEARING

Bearing yang digunakanpada rotating machine


bearingdan sleeve
umumnyadari jenis "antifriction
bear ing". Pemilihanjenis bear ing yang ak an
analisa
dipergunakansangat tergantung pada
dan besarnya
kebutuhanoperasi,sikluspemeliharaan
mesin

TralningConductedby PT. Pakaftl Handayani-hy

9/7/2006

MaiorConPonents
Generator

Antifriction(roller) bearingumumnyadapat dipakai


sampaidengan
dengankapasitas
untuk mesin-mesin
ukurandan beratnya.
tergantung
5000HP,
cocokuntuk unit yang
bearingkhususnya
Antifriction
atau untuk
tidak ada beban ikutan (non-attended)
perpanjangan
idle.
waktu
dari
masateftentu
bearingumumnyasudahdiberikanpelumas
Antifriction
(grease)sewaktu masih fabrikasi,untuk menjamin
bearingaman.
bahwapermukaan
Sementara bila diperlukan pelumasan kembali
(regreasing),
umumnyahanyacocokuntukmotordan
generatorkecildan untukstandbyunit. Gambar9-16
potongan
dariballbearing.
melintang
memperlihatkan

EN O SH IELD
ER U SH XO LOER
SALL BEAR IN G
O U T EF BEAR IN G C AP
BEAR IN G LOC '( N U T
AN D W ASH ER

IN N ER BEAR IN G C AP

CrossSection
Bearing
Gambar2-9.Antifriction

l
Jika sleevebearingyanEdipakai,udarapendinginan
untuk generator juga akan secara efektif
oil yangmengalirmelaluibearingke oil
mendinginkan
reservoir.

TrainingConductedby PT. PakartiHandayani-hy

9/7/2006

Gene
ratorMajorConponents

OUIER BEAFINGC^P
IN N EB BEAR IN G C AP

SXAFT EXTENSIOT{

ST EEVE BEAR IN G

BEAR IN G F AC E

CrossSectiori
Gambar2-10.SleeveBearing
Sum bermasalahum um yang timbul dalam mes i nmesirr rotasi adalah adanya arus yang mengalir d,
antara permukaan poros dengan bearing. Hal ini
terjadinyabearingpit (lubang-lubang
mengakibatkan
kecil),membakarpelumasmenjadihitam,dan dalam
scorethe shaft.
kasusmenyebabkan
beberapa
Arus tersebut dapat ditimbulkankarena adanya
hubungan pendek dalam kumparan penguat.
Penyebabumum ini adalahsalahsatu dari inherent
designdari pelapisanstator dan pengaturankutubkutub medan penguat.Dalamprakteknyahal yang
isolasiterhadap
dapat dilakukanadalahmemberikan
pegaruhdari arus poros,
bearinguntuk mengurangi
atau bahkan memutuskanhubugannyake tanah
(gr ound) .
Hallainyangjuga tidakkalahpentinguntukgenerator
System),Sistem
set adalahSistemIsolasi(Insulation
Pengetesan
dan
(Ventilation
System)
Ventilasi
(Testing).
SYSTEM
ISOLATION
SistemIsolasimenurutNEMAstandardterbagiatas
jenisini
padagenerator
KelasA, B, F dan H. Umumnya
memilikiKelasIsolasiF.
TralnrrtgConductedby PT. PakarttHandayani-hy

9/7/2006

Generator
MaiorComponents

Batasuntuk isolasikelasF adalah1550C. Kenaikkan


juga sangat sensitif
temperaturyang diperbolehkan
bagus untuk
tersebut
ketinggian.
Nilai
terhadap
ketinggiansampaidengan3300 ft (1000 M). Untuk
yang
melebihi3300ft kenaikkan
temperatur
ketinggian
o/o
untuk setiap
dikurangisebesarL
diperbolehkan
330ft.
kenaikkan
SYSTEM
VENNLAT]ON
Sistem Ventilasimerupakansustu keharusandan
konstruksidrip proof
sebagaistandarmenggunakan
padaGambar2-11.
ventilation
sepeftiditunjukkan

Gam bar
9- 21.Ventilasi
yang ada
Banyak konstruksi ventilasi/enclosure
pemilihannya
Kriteria
menurut NEMA standard.
didasarkanpada kondisi lingkungan di mana unit
tercebut beroperasi, kondisi opt-?si, ruangan
yang tersedia, dan biaya, Pemilihanpelindungyang
denganhati-hati.
sesuaiharusdilakukan
"open dripSebagianbesar aplikasimenggunakan
pelindung
pemakaian
khusus
proofenclosure".
Hindari
yangmemerlukan
biayatinggi.

TrainingConductedby PT. Pakarti Handayani-hy

10

t--

9/7/2006

Generator
MajorConponenls

TESTING
Pengetesan
terhadaprotatingequipmentbervariasi
sesuaipabrikantetapi menurutNEMAstandarddan
IEEEstandard,
meliputi:
o
o
a
D
o
o
o
o
tr
o

Temperature
rise/heatrun.
Waveform characteristic
Efficiencies
Shortcircuitcapability
Saturation
Overspeed
Vibration
Highpotential
and megger
Noise
Reactance
measurements

TrainingConductedby PT. PakartiHandayani-hy

11

9/7/2006

BAB II.3
SPEEDCONTROLSYSTEM
OBJECTIVE

parapesertaakandapat:
Diharapkan
fungsidarisistimspeedcontrol
1. Menyebutkan
operasidari speedcontrolsystemsaat
2. Menjelaskan
beroPerasi
unitpackage
secara
3. Memberikanilustrasi , mengidentifikasi
control
speed
dari
komponen
masing-masing
benar
sYstem
4. Menjelaskankarakteristikoperasi komponenutamadarispeedcontrolsystem
komponen

SISTIMDAN FUNGSI

Fungsi dari speed control system adalah untuk


menjaga frekuensi generator dengan mengatur
kecepatan mesin turbine dan distribusi beban
pararel.
padasaatunitdioperasikan
generator

URAIANOPERASI

mesinTurbinedibacaolehmagneticpickup.
Kecepatan
Dipasangpada gear yang berputar pada suatu
mesin
yang proposional
dengankecepatan
kecepatan
signal
AC
pickup
membangkitkan
magnetic
turbine,
kecepatan
proposional
dengan
yang frequensinya
mesin turbine. Sirkuit yang presisi mengubahAC
Voltage menjadi DC voltage dan sebaliknya
mesinturbine.
proporsional
dengankecepatan
Kecepatanmesln turbine di set dengan kecepatan
pada control.Tambahan
rated normalpotentiometer
potentiometerkecepatantrim eksternaldapat juga
settingVoltagelaludi
Kecepatan
mengaturkecepatan.
bandingkandenganspeedVoltageyang sebenarnya
pada controlamplifierdan apabilaada perbedaan,
voltageyangsesuaike
mengirim
Controlservoamplifier
lebihtinggi
actuator.Sebagaicontoh, jika kecepatan
mengurangi
akan
amplifier
control
dari speedsetting,
bahanbakar
outputnyadan actuatorakanmengurangi
ke mesinturbine.

TrainingConductedby PT. Pakarti Handayant

9/7/2006

Controltfqllfft
Speed

Pembagianbeban antara dua atau lebih Mesin


Pengatur
Setakandi atur melaluiRangkaian
Generator
Beban(loadsensingcircuitry).Setiapbebangenerator
diukursecaraelectronisterus menerusoleh masingmasingload/speed
controlgovernordan dibandingkan
dengan unit-unit yang lain pada BUS y_a!gsama
lines'.Koreksiyangterus menerus
melalui'paralleling
pembagian
beban/
terhadapcontrolloopmemberikan
loadsharing.
Sensing kecepatanFail-Safeakan men"shutdown"'
MesinTurbinejika magneticpickupsignqlFails.Fail
akan Clear'bila mesin
safe circuitdengansendirinya
Turbinedi cranks.SebuahsignalAC 1.0 Volt 100 Hz
indikasike ControlGovernor
bahwasignal
memberikan
pickup
dan
Fail
safe secara
magnetic
adalahbenar
otomatisakanclear.
LOKASI
KOMPONEN
DANPENJELASAN

Komponenutama dari speedcontrolsystemadalah


WoodwardModel 2301 Load sharing dan Speed
lain meliputi
ControlGovernor.Komponen-komponen
Operatorcontrol devices,speed dan load sensing
seruoactuator.
devices,dan electrohydraulic

ELECTRO
HYDRAULIC
ACTUATOR

Di dalamspeedcontrolsystem,electrohydraulicservo
actuatormenerimasignallistrikdari governor.Pada
tekananservohydraulic
langkahini akan memberikan
terhadapperubahansecaramekanik,baik itu throttle
valve atau liquidfuel controlvalvetergantungpada
fuelsystemyangdigunakan.

OPEMTORCONTROL
DEViCES

Speed control yang tersedia untuk Operatoryakni


Saklar yang mengendalikanpotensiometeryang
digerakkanmotor dan beradapada control console.
Pada dasarnyamerupakansaklar tiga posisi yang
memilikispringreturnke posisitengah(OFF). Apabila
saklar ini diaktifkan,baik pada posisi MISE atau
berputarpadaarahyang tepat
LOWER,potensiometer
signalreferensi
untuk menaikkanatau menurunkan
ke Governor.
kecepatan

TrainlngConductedby PT. Pakafti Handayani

SpeedContrctlSystem

2301WOODWARD
GOVERNOR

Governorberada dibagianbelakangdalam Control


yang
yangterdiri4 (empat)moduleindividual
Console
gambar).
(lihat
pada
'single
board'
sebuah
terpasang
Setiapmoduleadalahperangkatelektroniksolid state
yangmelaksanakan
fungsitertentudi dalamsystem.
untukmemilih
SensorBeban(Loadsensor)digunakan
mode operasi(ISOCHatau DROOP)dan memonitor
Speedsensormenerimainputsignal
bebangenerator.
pickup
sebandingdengan kecepatan
dari magnetic
mesinturbine.
Speed sensor mengirim signal ke amplifieryang
menunjukan kecepatan mesin. Ramp Generator
module mengurus speed control yang berkurang
sewaktu compressor cleaning dan mengontrol
percepatan
mesin.
dan perlambatan
masukandari
Moduleamplifiermenerimasignal-signal
ramp
speedsensor,load sensordan module-module
Signalgenerator,dan memperkuat
signaltersebut.
dan akan
signal tersebutlaludikirimke seruoactuator
mengontrolengine speed dengan mengaturaliran
bahanbakar.

System
Governor
Gambar4-1. 2301Woodward

TrainingConductedby PT. Pakafti Handayani

9/7/2006

SpeedControlSvstem

Governormenerimamasukandari magneticpickup
(lihatgambar)dan daritrafo arusdan trafotegangan.
Keluaran dari Governor disambungkan ke
yang dikirim
Electrohydraulic
actuator.Signal-signal
dari governor ke actuator untuk mendapatkan
hubungan antara kecepatan dan beban yang
diinginkan,sesuaidenganyang dimintaoleh signal
governor
masukan
S P E ES
DE N S IN G

Salah satu kegunaandari Governoradalah untuk


mengaturkecepatanTurbinedan dengandemikian
berartifrekuensikeluarangenerator.Untukmengatur
kecepatanTurbine,governorharus memilikisebuah
masukan yang menunjukkankecepatan turbine.
Magneticpickup mengukurturbine speed dengan
menghitungjumlah gigi roda I gear pada-r:eduction
driveassembly.
Padasaat gigi roda melewatimedanfluks magnetik
dari pickup,sebuahimpulslistrikdibentukdan dikirim
ke speed sensormoduledari governor(lihat gbr).
Impuls listrik ini akan diterjemahkapmenjadi
AC
kecepatanengineoleh speedsensor. Frequensi
yang dihasilkan
oleh magneticpickupakansebanding
dengankecepatan
mesin

F L U XF I E L D

GEARTEETH

speedPickup.
Gambar4-2. Magnetic

TralningConductedby PT. Pakarti Handayant

9/7/2006

I
SpeedControlSvstenr

S E R V OA C TU A TOR

Diagram
Gambar4-3. SpeedSensing
ApabilagovernormenerimasignalAC, Signaltersebut
akan dikonversike suatu teganganDC dan akan
ke Sum m ingJunction.SignalDC i ni
mengir imnya
turbineyangdimiliki (HAVE)
mewakilikecepatan
sekar anghar usdibe r i k an
Sebuahsignalpembanding
ke Generatoruntuk menunjukankecepatanengine
yangdiinginkan (WANT).Operatorharusmelakukan
pengaturan
terhadapsaklarSpeedcontrolpadaturbine
panel
yang menunjukankecepatanyang
control
diinginkan ( W ANT) . SebuahsignalDC lalu dik i r i m
ke summingjunction yang menunjukankecepatan
(WANT).
yangdiinginkan
Padasum m ingjunction,2 ( dua) signals,yang k i ta
miliki/HAVE dan yang kita inginkan/WANT,
Apabilaberbeda,sebuahsignalerror
dibandingkan.
dihasilkandan dikirim ke amplifier.Lalu amplifier
actuator
untuk menggerakkan
mengaturkeluarannya
padaar ahyangm eniadakan
signaler r or '
LOADSENSING

TrainingConductedby PT. Pakarti Handayani

Governoratau Sensor ElektronisKecepatan/Beban


melakukan lebih dari hanya mengindera dan
mengontrolspeeddari mesin,Modulesensorbeban
beban kilowatt antara dua
akan menyeimbangkan
generatoryang beroperasipararelsecaraotomatis.
9/7/2006

StteedControlSustent

Bagiansensorbebandari governorselaludigunakan
bila duaataulebihgenerator
di pararel.
S ensorbebanmembuatper ubahan
dar ijum lahbahan
bakar pada setiap mesin yang diterima sehingga
dengandemikianbebandapatdiseimbangkan
di antara
mesin-mesintersebut. Bagaimanapun,kecepatan
mesintidak akan berubaholeh sensorbeban.Lebih
baik, beban yang dirubah dari satu generatorke
generatoryang lain dengankecepatanyang dijaga
konstan. Perubahan kecepatan akan merubah
frekuensikeluaranlistrikdari tujuan 60 atau 50 cycles
yangdibutuhkan.
Sensorbeban akan menerimasignal masukandari
keluarangenerator.Signal-signal
arus dan tegangan
dari Generatorini akan digunakan
oleh sensorbeban
untukmenghitung
kilowatts.
SebuahteganganDC lalu
dihasilkanyang proposional
denganbeban kilowatt.
Tingkattegangandc ini dianggapsebagaipenguatan
beban(LOADGAIN).
Signalpenguatanbebanjuga dikirimsistimgovernor
dari generator-generator
lain yang berjalanparallel
untuk dipakai sebagai perbandingan. Selama
paralelisasi,
bagiansensorbebangovernordari setiap
mesin sebenarnyadiinterkoneksi. Bila generatorgeneratordiparalelpadamodeISOCH,baqiansensor
bebandarisetiapgenerator
membandingkah
bebannya
yanglain
denganbebanpadagenerator
BagianDC dari load sensorpada 2 dua governor
pada(lihatgbr), Leveltegangan
systemdigambarkan
DC (load gain) yang melewatirangkaianjembatan
sensorbebanakan sebanding
denganbebankilowatt
generator.

TrainingConductedby PT. Pakarti Handayani

9/7/2006

rcedControlS

SETA
ENERATOR

SETB
ENERATOR

S U MMIN GJU N C TION

Gambar4-4. Loadsensingdiagram

LOADSENSOR
MULTIPLEUNIT

Sensor beban memberkanpembagianbeban yang


bila dua atau lebih unit
proporsional/sebanding
generatordiparalel. Dalammode ini, setiapsensor
bebandariunit pembangkitnya
bebanmembandingkan
tenaga,
denganunit-unityang lainyangmenghasilkan
jum
lah
ba han
m
enur
unkan
maupun
baikmeningkatkan
proporsionalnya
bakarke mesinuntukmenjagabagian
dar ibeban.
Bila saklar-saklarmode ini diset untuk operasi
isochronousuntuk suatu kombinasimesin yang
jembatansensor
terpasangsecaraparallel,rangkaian
bebannyatersambungbersamamelalui garis-garis
paralel(parallelinglines). Pada mode operasiini,
jembatandiseimbangkan
dengan
rangkaian-rangkaian
(common
bersama
acuan
titik
terminal 11 sebuah
point).
reference
Bila dua atau lebih unit dipar alel,setiap m es i n
dari beban dengan
menerimabagian proporsional
bebannyamelalui
tegangan-tegangan
menyamakan
jaringanjembatan(bridgenetwork).

TrainingConductedby PT. Pakarti Handayant

9/7/2006

CotttrolSVstenr

il3

Unit.
Gambar4-5. BasicLoadSensor,Parallel

LOADSENSOR,
SIN GL U
E N IT

Selama operasi synchronousunit tunggal, (lihat


sehingga
jembatandiseimbangkan
gambar)rangkaian
ini,
kondisi
Dalam
nol'
keluaransensorbebanmenjadi
kontrolkecepatan
mempertahankan
sensorkecepatan
mesin.
eksternal dengan
Putarlah saklar mode
Rl1 ke DC com m on. Ini ak an
menghubungkan
jaringanjembatan
ketidakseimbangan
menyebabkan
perbedaan
tegangandi antara
suatu
dan menghasilkan
bebangener ator
ter minal11 danter minal12. Kar ena
jembatan
rangkaian
meningkat, tegangan beban
(naiksecaranegatlve).
(terminal12) berkurang
Tegangannegativeini diterapkanke potensiometer
yang mengaturbesarnyatahananseri. Pada
DROOP
mode ini, teganganbeban negativemengakibatkan
signalpengaturkecepatanbergeraktu,runpada saat
I
bebanbertambah.

TrainingConductedby PT, Pakarti Handayani

9/7/2006

( irrr/rtr/Sr/slt'ltl
.S/rt't'r/

0t . DR00e
C 0Na0r
l

\ PlRntt
L tttiEs

rl

l, t
lli

-t r-r' ! --^

r r

L ----l+

/ ur hLn

'\

I i

r7 ' ^ 1 \u ,

I L0l0
/ SENSOI

i i f'o ' t,::i :',;J i i '^ II


1

ll-' i

- a . . L ''t , /

c rr

' i---' t '

-fi,'f*;*i,'-n'" r/
.
5,,,
ry
Y

|
I

\^

,-

r r
*c:'
Y
^" ' l

li-i;.-l-i,
u:

-I 75(
:i ' \\

'

I
/.'

ii h t\
\,i

i;.;, rn I
,/

I
D^^^"
i ooP I

ri

C R OOP
CONTROI

I
Is0c

I
TCSUMMIIiG
Tr0N
JUr'/C

u )i

SingleUnit
Gambar4-6. BasicLoadSensorSchematic

TrainingConductedby PT. Pakafti Handayani

Coyyglpyl!311_
Sp':ed

tl
(rOCr0

la

I
l-l
-l )r tl

rl
rl
rgtt
(firr

i
{

rstt
cnrr
rrya

I
I
I

rutc
c#.r
rlEqa

I
I
I

rl

r-L
9r
rl

,,1
l!

I
I
I

I
I
qt0

I
I
I

-11:
Oi i ,ft.r dx
ti

----l
,I
vrro l_fiL
{,
I

EJ.{?iE'A-6.7

LJ

r,Lli

rr*
I
I
I

I
I
Irh

r {{tl
Hl0

-.!

ilca(l.rrc

I
L__

'rct3

cl0t

Elimimiil.i5
rh

i.

-"lrFtu

fl

f-.7 0

L __r

lgla

|
-T-|-=u
rI

-T

_l

----l

Diagram
Gambar4-7. SpeedControlSystemSchematic

TrainingConductedby PT. Pakarti Handayani

10

9/7/2006

Regulator
Vollage

BAB II.4
VOLTAGEREGULATOR
VOLTAGEREGULATOR

statis,
Voltageregulatoradalahalat yang benar-benar
dari tipe silicon-controledrectifier (SCR) dengan
dan dipasanguntuk
sebuahzenersebagaireference,
phase
sensing.
Semuarectifieradalahdarisilicon
single
PadaRegulator
dan di sealsecarahermetical.
terdapat
(CCC) untuk operasi
cross-current-compensation
parallel.
Regulatormempunyairentang pengaturanvoltage
sampai5 persenmelaluirheostatyang bisadiletakkan
Sebuah
sampai30.4 meter(100 feet) dari generator.
(sekitar
1.5 kVa)
trafo tegangan fasa tunggal
memberikanpower ke voltage regulatorpada sistim
tegangan
tinggi(di atas600volts).
di
Outputdari generatorke regulatorakan disensing
tiga lokasipada regulator: "sensingcircuit","power
compensation"
stage"dan "cross-current

Ganrbar- 6. TypicalVoltageregulator

Truining Condrcted by I'I'. Pukarti Ilandal'sn;-lty

91712006

Voltage
Regulator

EXCITER

GENERATOR

S E N S IN G(A C )

VOTTAGE
REGUTATOR

Gambar- 7. Skematikdaristaticvoltageregulator

Sensing
Circuit

Ketikaarus mengalirmelaluidiode voltagereference


dan resistor,sebuahconstantreference
signal6.8 volts
tetap dijaga. Jika generatoroutputnya naik diatas
angkaset voltage,signalerror (perbedaan)terjadi
yang berartisignaluntuk mengurangi
outputvoltage.
Apabilageneratorvoltageturun dibawahset voltage,
signal errornyaakan menghasilkan
kenaikandalam
voltageoutput.

Preamplifier.

Amplifierakanmenerima
signalerrordari unit sensing
dan meng-aplify
dan menstabilkan
signalnya,
sehingga
mengurangi
voltageswingketikageneratormerespon
kenaikan
ataupenurunan
signal.
gating
Input
circuitadalahsignalyangdiperkuatdan
distabilkan(amplifiedsignal) melalui pre-amplifier.
Signal ini akan mengisikapasitorrangkaian.Pada
sekitar70 persendari signalvoltage,kapasitorakandi
"discharge".
Hasildari lonjakanvoltasepadagerbang
(gates) dari dioda rangkaianakan menyebabkan
"powerstage"menjadibefungsi(operational).

Gatingcircuit

I'raining Conducted by P'l'. Pakarti llatdayani-h1t

91712006

Voltage
Begulator

A- C G ENERATO R

CURRENT
8RU5HLE55
EXCI TER
GA TIN G
C IR CU IT

SENSING
CIRCUIT

EXCI TER
FI ELD

TA B ILIZ
I T SUSTAI NE
SHO RT- CI RCU
ANDEUI LD. UPCI RCUI T

D .CBA T T ERS
YO U R C E

Gambar- 8. Blockdiagramdarisuatuvoltageregulator

Powerstage

Rangkaianini menerimapower input signal dari


generatordan mengubahnya
ke voltaseyang lebih
jembatan
rendah.Rangkaian
dari rectifier menerima
outputdari "gatingcircuit",Arus signalyang telah di
rectify diperbolehkanuntuk melewati rangkaianke
"exciterfield". Arus signalini akan menaikkanatau
menurunkan
exciteroutput,sehinggaakanmenaikkan
generator
ataumenurunkan
outputvoltage.

Stabilizing
Circuit

Rangkaian
ini bertugassebagairangkaian
umpanbalik
dimanaakan memungkinkan
koreksiawalyang cukup
besar dari signal yang mana akan memungkinkan
kembalinya dengan cepat dari sebuah variasi
perubahanoutput voltage.Ini akan diikuti dengan
koreksiseperlunyaapabilavoltase gene5atorsudah
mendekati
hargayangsudahditentukan.

Shortcircuitsustainerand Ketika engine speed mencapai66 percent, battery


build-upcircuit.
powerke exciterfield,menyebabkan
akanmemberikan
kenaikan
cepatdari medanmagnitpadarotor.Output
voltageakan naik secaracepatpadasetiappercobaan
start dari generator.Padasekitar75 percentvoltage
generatoryang normal,aliran batteryke exciterfield
akandiputus.
SeriesBoost

Sistim ini juga didapatisebuah"seriesboost", atau


sistimpenunjangdari eksiitasi.Padasaat bebanyang
besar(overload),hubunganpendek(shortcircuit)atau

'l'raining Conducted bt PT. l'akarti Ilundayani-hy

917l20M

Voltage
Regulator

motor mulai dijalankan (motor start), tegangan


keluarangeneratorakanturun. Sistimseriesboostdan
transformer supply yang bersangkutan akan
memberikanteganganyang relatif konstan selama
keadaanoverloads
dan shortcircuits.

Crosscurrent
Compensation
Droopmode.

Sebuah "current transformer"dalam rangkaianini


memungkinkan
signal dari generatordi aplikasikan
melalui sebuah potensiometeryang bisa di-adjust.
Bagiandari signal ini akan diberikanke rangkaian
sensingdan akanmenyebabkan
sebuahkondisivoltage
droop.
Ketika sebuah single generatordipakai,hubungan
pendek switch unit parallelbisa digunakanuntuk
mengabaikan
signal.Padaoperasiparallel,KVARload
sharingbisa dicapaidenganmemberikan
signalyang
samamelaluipotensiometer
ke rangkaian
sensingdari
regulator.

L_3y!2_-i

,i
I

D R OOP C OMP E N S A TION

Crosscurrent
compensation
NoDroopmode.

Sebuah metoda alternatif dari KVAR load sharing


adalahmetodano-droop.Dalammodeini, signaldari
semuaparallelgenerator
akanmelewatisemuacurrent
transformer,potensiometer
dalamsebuahloop secara
series.

'l'ruining (-ondtrcteJ br' [' ] . l'akurtt I Iondayuni-hv

91712006

Regulalor
Voltage

r - - - - - -1

a'l )

l"t
uJ

I u'
t

l
i
t

In a

+
I
*

+aR

BUS

ap

T-"
O L O AD

TOMPENSATION
C R O SC
S U R R E NC
B A L A N C EK
DV A RL O A O I N G

Crosscurrent
Compensation

bisa digunakanhanyabila
compensation
Crosscurrent
regulator dari semua generator yang sedang
beioperasi berada pada common bus saling
dihubungkankedalam crosscurrentloop. Generator
dengan
yang berbedakW ratingnyabisa dioperasikan
yang
transformer
apabila
crosscurrentcompensation
dipilih akan memberikan kira-kira sama arus
padamasingmasingbebangenerator'
secondarynya
yang
compensation
Padaaplikasiparallelcrosscurrent
"Unitgenerator,
switch
terdiri dari lebih dari dua
paralel"harus ditempatkanpada posisi"UNIT" pada
setiapsistim generatoryang tidak beradapada load
bus atau "voltage droop" akan diikutkan kedalam
yang
darigenerator
transformer
sistim.Sebuahparallel
compensation
tidak terbebanitidak akan memberikan
signal,tetapi akan menjadikansebuahvoltage drop
Voltagedropinijugamenyebabkan
terjadidiantaranya.
uoltug. dari "incominggenerator"untuk ber fluktuasi
sebelumdi Parallel.
denganmemanfaatkan
Fluktuasiini bisa dihilangkan
sebuahauxiliarycontactpada main generatorcircuit
pada
breaker.Auxilarycontactini harusdihubungkan
ketika
dan di closed
dari paralleltransformer
secondary
generatordibuka'
main
dari
ketika circuit breaker
contactini akan terbukaketikamain generatorcircuit

7,t*f ,*.rrnt

ni'hy
rrt ht !'1' l' ukurt i I lunclu.t'a

917120c6

Voltage
Regulator
I
l------.-.-_-

breaker
di close.Ketikaauxiriary
contactini digunakan,
UNIT-PAMLEL
switchdaramparailering
modureharus
dibiarkan
padaposisiPAMLEL.

R E GU LA TORN O. 1

U NIT
P A R A LLE L
sw tTcH

G ENERATO R
No. I
(

REGULATOR NO. 2

UNIT
P A R AL L E L

GE NE RA TOR
NO . 2
./'
!

s wrT c H

REGULATOR NO. 3

U N IT
PA RALLE L
sw l rc H

G ENERATO R
NO . 3

Gambar- 11. Crosscurrent


conditions
MOTORIZED
VOLTAGE
ADJUST
(Opsi)
SYSTEM

KW CONTROLLER
(Option)

Sistim motorizedvoltage adjust menggantinormal


voltage adjust dengan rheostat (terdapat pada
generator metering panel) dengan sebuah
MISE/LOWER switch yang akan menggerakkan
motorizedpotensiometer
untukmengontrol
voltage.Ini
memungkinkansebuah tambahan RAISE/LOWER
switch diperkenalkanke dalam sistim untuk
menghasilkan
voltagecontroldari lokal(localcontrol)
ataujarakjauh (remotecontrol).
kW controllermenjagadan mempertahankan
beban
(kW) keluaranagar tetap konstan,yang di set oleh
dial, pada generatorset pada saat unit di paralel

7 t'cthing Concluctetl by, P I'. lrakurti ] ktndat'ani-hv

91712006

Regulator
Voltage

dengansumberyangbesar(utility).Padasaatoperasi,
unitini haruspadaoperasispeeddroop.
kW controller mengatur Motorized speed adjust
potentiometeragar beban nyata (real load) konstan
padaunitbilafrekuensi
dariBUSberfluktuasi.
System ini terdiri dari Rheostatyang berada pada
generatormeteringpaneluntukmengaturjumlahdari
real load (kW) dimanaUnit d'rjaga,dan sebuahswitch
ONdanOFF.
memutarcontroller
XW
IBTA
Ii
CAL
{R7
3)
GTIi E R A IOR
V OtIA Gt
RAIORCURRiiII

XW
st iis0R

Tc)
AtL
AUPLI; II RS
AVIRA(;T
I(II INPUT
FRO$
|(W("O}IIR OILTR IS )
OTH TR

c.ITHT,R
RtFtRilrct
AUPttFrtn
GAllt
A)JUS]
(R 23)

IIIPUIFROIISCP
QUTNCY

To load

FRi.QUi,NCY
COI{IROtLER

POWI
R
A IIP tFIi .R

r@
552196

12.
Gam bar
Controller.
KVAR/PFController
(Option)

FungsionalBlock diagram, kW

KVAR/PFcontrollermenjagaBeban Keluaian-Reactif
(KVAR)konstanatau Constant PF, di set oleh dial,
pada generatorset pada saat unit di paraleldengan
bebanyangcukupbesar(Utility).
KVAR/PFControllermengatur MOTORIZEDvoltage
Reactive
untuk menjagaContilrnt
adjustpotentiometer

'l'r'aining Con<lucled hy l' l'. I'akarti

ltandas'ani-lty

91712006

Voltage
Begulator

pada BUS
Load atau PF pada unit apabilaVOLTAGE
bedluktuasi.
System ini terdiri dari Rheostatyang berada pada
jumlahdari
generatormeteringpaneluntukmengaturl
reactiveload (KVAR)atau pf, dimanaunit ini dijaga,
dansebuahswitchmemutarcontroller
ONdanOFFdan
untukrnemilih
modeyangdiinginkan,
KVARatauPF.

xvAn

[0 0 nA I0 A 0JUs t

1R 7l )
cA LtE FrTE
v0tTA 6t
r tR A l 0R
C U R R E ti I
:NtR .A I0R

TOA LL
RS
A I/P tIFIE
DITHI.R

A0Jusl
OIIH [R
05ctLu I0R

NIK E
REFT
A U P L It R

S S ?I97

Gambar- 13.TypicalFunctionBlockDiagram,KVAR
Controller.

7 raining, (-'trulttt'ted ht' l)'1. Pakqrti I londayani-lty'

91712006

Voltage
Regulator

TO LOAD

V OLTAG E
A D JUST
P OTENTI O
ME TER

VOLTAGE
REGULATOR

R OTA TIN G P OR TION -

--l

SURGE
SUPPRESSOR

GE N E R A T O R
A F M AT U R E
(ST A T IO N AR Y)

IG.E N E R A TOR
:FIE LD

R E C TIFIE R
A S S E MB LY

E X C ITE R

I
I
EXCI T
I FI
ELD
I ( STAT

AnMATURE I ARY)
_ ___J

generator/
exciterdan regulator
system.
dariTypical
Gambar- 14. Skematik

I'raining Con<lucted by l''1. l'akurti llarula;,ani-hy

91712006

Contrcls sfld lndicators

BABII.5
CONTROLS AND INDICATORS
OB]ECTIVE

1.

Dengansebuahilustrasi,diharapkanpesefta
akan
mampu
mengidentifikasi dan
menyebutkanfungsi control dan indicator
pada:
a. EngineControlPanel
b. Generator
Metering
Panel
c, CircuitBreakerPanel
d. Engine
GagePanel

Catatan
:

UMUM

Kontrol dan indikator pada Centaur


GeneratorSet sangat bergantungpada
packagenya
susunan

Kontrol dan indikator, ditempatkanpada konsul


kontrol lokal, diperlukan untuk memeriksa,
generator
mengoperasikan
dan memantau
set secara
prinsip.
Kontroldan indikatorlain yang ada di panelgage
ditempatkanpada base frame pada remote control
jika disediakan.
console,

LOCALCONTROL
CONSOLE

Konsulcontrol local (LocalControlConsole)seperti


pada Gambar5.1 meliputisebuahengine control
panel yang dipasangpada sisi kanan dari pintu
konsuldan sebuahgeneratormeteringpanel pada
sisi kiri. Suatu panel pemutus tenaga dengan
yang terpasang di dalam
instrument-instrumen
konsulnya.
Jika tersedia (termasukdalam package),vibration
monitoratau generatorwindingtemperaturemonitor)
dipasangpadapintukonsuldi bawahgqgepaneldan
I
controlpanel.

TrainingConductedBy PT. PakarttHandayani

Controls and Indicators

otialIor
ITIIiIK

tuaaaf
ffiIlot
tltfl

'ANII
...-1_.
),ooooo
I OOoOO
I oooqo
i ooooo
i eoooo

aagoo'l
OOOoo i
ooooo i
ooo90 |
oooool

f-_ltiilt--i

t il | { t

I
lN I I
It--lt i l | | a rl-l:l

;;:1ii;ii

,.li"i

::
OO

OO

l - t' I

- r 'l

I tr l l

;5
;;
tl\.,

I
i
i

l-l:

::

cooo
-fro 0 0

- j - - 't:-

I 'i

tl

-G..()'
-=

-G6

ir'

a.-

C)

-iN-

t.'l
ldl

t !:__:Jl

(roc^r)

(typical)
Gambar5-1. LocalControlConsole

TrainingConductedBy PT. Pakafti Handayani

9t7t20(\6

Con t ro I s an d lndicators

ENGINECONTROL
PANEL

yang mungkindisediakan
pada
Instrumen-instrumen
enginecontrolpanelmeliputi(lihatGambar5-2).
METER
.

Pengukur Suhu Turbin (Turbine Temperature


Meter)
Slim-line style, dipasang secara vertical,
mempunyai skala dari nol sampai dengan
815.6oC(1500oF),mengindikasikan
turbineinlet
temp dari 3'o stage(T5) yang dibaca oleh
thermocouple yang terpasang pada turbine
assembly.
Pengukur KecepatanTurbin ffurbine Speed
Meter)
Slim-linestyle, dipasangvertical, mempunyai
skala dari nol sampai dengan I20 persen,
mengindikasikan
kecepatanrotor turbin (Npt)
yangdibacaolehpickuppadaturbineassembly.

SWITCH& LIGHTS
SaklarHornSilence
(Optional)
jenis
Suatusaklar
tomboltekankontakyangmenshutoff-audiblealarmhorn.
SystemControl
Saklar putar 3 posisi (OFF, LOCAL,AUTOyang mengontrolTenaga24 volt dc ke
REMOTE)
sistimkontrol.
.

Reset
Saklarjenis tomboltekan kontakyang me-reset
relay malfunction
dan mengeteslampu-indikator
malfunction.
Staft
Saklar jenis tombol tekan kontak cepat yang
menginisiasi
urutanstart

TrainingConductedBy PT. Pakarti Handayani

Controls and lndicators

C) oooo
ooooo
ooooo
oc) ooo
ooooo

(i (ri l t F(rL

ooooo
ooo( ) o
ooooo
ooooo
ooooo

('"lz\irr
fi/'.

\>J

lrl

C) o"s*s
li:iN;":r.
LOC AL EN G IN E T I.'R BIN f
'C OH T R OL
PAN EL

Gambar5-2. LocalEngineTurbineControlPanel

TrainlngConducted8y PT. Pakafti Handayani

9t7t2006

Controls and lndicators

. stop
Saklarjenis tombol tekan kontakyang mendeenergizerelay controlstart untuk menshutdown
suatulampu
engine. Saklarini menghubungkan
merahyangakanmenyalabilasaklarditekan.
EngineSpeed- Isoch/Droop
Saklar2 posisi(ISOCH,DROOP)yang memilih
operasicontrolkecepatanuntuk modekecepatan
droop.
ataukecepatan
konstan(isochronous)
SpeedAdjust
Saklar3 posisi(OFF,INCR,DECR),spring-loaded
ke posisi OFF, yang mengontrol governor
pengaturkecepatan
motor.
EngineWaterWash(Option)
Saklarputar 3 posisi(OFF,ON) yang mengontrol
sistim penjernihan air untuk pembersihan
Kompresor.
EngineCrank(Option)
Saklar putar 2 posisi yang digunakanuntuk
(crank)enginetanpapembakaran
menghidupkan
yang dilakukanpada
/penyalaan(Combustion)
pemeliharaan
prosedur-prosedur
teftentu.
FireSystemLockout(Option)
Saklar2 posisi(OFF,ON) yang membantuatau
men-disable'dischargevalve' dari fire system
enclosure.
AlarmIndicatorLights
Malfunction
Lampu (merah) malfunctiondan lampu alarm
padasebuahpaneldi atas
(kuning)digabungkan
meter-meter.Plat-plat identifikasi,Yang diberi
kode terhadaplampu-lampu,terletakdi bawah
tersebut.
di sisimeter-meter
lampu-lampu

GENEMTOR
METERINGPANEL

Instrumentasi yang biasanya terpasang pada


generator metering panel (Gambar5-3) meliputi
berikutini, :

TrainingConducted8y PT. Pakarti Handayani

Controls and Indicators

METER
Ammeter
Slim-linestyle,alat ukur yang dipasangveftical,
mengindikasikan
arus output generatordalam
satuanAmpere,untuk setiap generator3 fasa
yangdipiliholehsaklarpemilihammeter.
Voltmeter
Slim-linestyle,alat ukur yang dipasangvertical,
diskala sesuai dengan kapabilitas output
generator,mengindikasikan
teganganline-to-line
pada sisi generator atau bus dari rangkaian
pemutustenaga.
FrequenryMeter
Slim-linestyle,alat ukur yang dipasangvertical,
diskaladari 55 sampaidengan65 Hz (Sistim
generator60 Hz) atau dari 45 sampaidengan55
Hz (Sistim generator50 Hz), mengindikasikan
frekuensigeneratordalamsatuan1-171(cycle
per
detik).
KWKVARMeter
Slim-linestyle,alat ukur yang dipasangvertical,
diskaladari 0 sampai dengan 3000 kWkVAR
(atau dari 0 sampaidengan3 MWMVARpada
pemasangan),
beberapa
mengindikasikan
output
generatoractual dalam satuan kilowatt (atau
megawatt)atau daya reaktifdalamkilovar(atau
megavar).
SWITCHESDAN LIGHTS
SaklarAmmeter
pemilihan
Saklarputar3 posisiyang memberikan
arusfasageneratorke ammeter.
SaklarVoltmeter
pemilihan
SaklarputarB posisiyangmemberikan
indikasi tegangan line-to-linedari bus atau
generator,ke voltmeter.
SaklarKW/KVAR

Training Conducted By PT. Pakafti Handayani

I
Cont rols and I ndi cators

pemilihan
Saklarputar2 posisiyang memberikan
indikasikilowattatau kilovarke voltmeter.
Synchronizing
Saklardan lampu-lampu
Saklarputar2 posisiyangmembantusinkronisasi
rangkaian
dan lampu-lampu.
VoltageAdjustRheostat
Sebuah tombol putar yang memberikan
pengaturan
tegangan
outputgenerator.
Circuitbreaker
Saklardan lampu-lampu
posisi
yang mengontrol
Saklar kontak 3
pemutustenaga.
rangkaian
Lampuindicatorhijau akan menyalabila circuit
breaker terbuka, lampu merah menyala bila
circuitbreakerdi tutup.
Saklar dan Lampu-lampu
Synchronizer

Single Unit

Bila suatu sistim pesinkronotomatisdari unit


sebuahsaklartomboltekan
tunggal digunakan,
mengactivekanauto/synch dengan lampu
synch.
rangkaian
untukmengenergize
digunakan
Lampu merah yang menandakankegagalan
operasi akan menyalajika auto synch dari
generator
gagal.
oncoming

TrainingConducted8y PT, Pakafti Handayani

Contro ls and lndieators

TrainingConduded By PT. Pakafti Handayani

9nn006

Controls and lndicators

Auto Staft to Dead Bus


Saklar/Lampu
Bila sisitimini yang dipilih,saklardin lampulampu berikut ini terpasang di panel
pengukurannya,
,/ LampuStandby
./
LampuPowerFailure
'/
LampuReadyto Restore
./ SaklarPowerRestore
Saklardan lampuoptionallainmungkintermasuk
pada panel generatorsesuaidengankebutuhan
pelanggan.
Optionalini meliputi,
./ SaklarKWControl
./ SaklarKWLoadAdjust
./ SaklarKVARControl
./ SaklarkVARLoadAdjust

GENERATOR
WINDING Generator
WindingTemperature
Monitor (Gambar5TEMPERATURE
4) bila digunakan,terpasangpada pintu Local
ControlConsole.
Monitor modular dari unit juga menghubungkan
sebuahpengukursuhu,relaypembatasdenganset
point yang dapat diatur, tombol tekan untuk
menampilkansetiap setpoint pada meter, lampu
indicatoralarmdan lampuindicatorshutdown,serta
pushbutton
switchesuntukTESTdan RESET.
Dalamoperasi,jika suhu kumparangeneratorpada
tempat yang dipantau melebihi alarm setpoint,
biasanya150oC(302oF),lampuindicatoralarmakan
menyalatapi enginetidakshutdown.
Jikasuhuterus
bertambah dan mencapai shutdown setpoint,
biasanya160oC(320oF),lampu indicatorshutdown
akanmenyaladan engineshutdown.Setelahkondisi
overtemperaturedikoreksi,kedua relay dapat di
resetdenganmenekantombolRESET.

TrainingConductedBy PT. Pakarti Handayani

Controls and lndicatots

f-LlMlr
2
lr

lO

.)

'

ADJUSI---_-l
|
?
2l
r ^J

,- |

1_r..rroc
12't21

( I nesn

TESTi:)

t::I_l:l
Gambar 5-4. Typical GeneratorWinding Temperatur
Monitor
ViBRATION
ENGINE
PANEL
MONITOR

Panel pemantau getaran (Gambar 5-5), bila


disediakan,terpasang pada pintu Local Control
panel3-drawerpanel
Dalampemakaiannya,
Console.
meliputi:power supply,indicatordrawer,dan blank
drawer.
.
.
'
.

Yang termasukdi dalam Powersupplydrawer


yang berwarnahijauyang
adalahlampuPOWER
akanmenyalabilalistrikdihidupkan,
saklarpemilihbagianA,
dan
saklarpemilihbagianB (tidakdigunakan)
untuk setpoint-setpointtanda
suatu table
bahayadanshutdown.

pemilihan
SaklarpemilihbagianA memungkinkan
tingkat vibrasi channell atau channel 2 untuk
pada meter yang terletak pada
menampilkannya
TrainingConductedBy PT' Pakafti Handayani

10

9nn006

Controls and Indicators

indicator. Saklar-saklaryang berupa spring-load


kembalike posisitengahHIGHRED,Kanaldengan
hasil bacaanygng lebih tinggi ditampilkansecara
terusmenerus.
Indicatordrawermenghubungkan
sebuahpengukur
getaran yang diskaladari 0 sampaidengan3 mils
(atau0 sampaidengan6 milspadabeberapa
model)
yang mengindikasikan
nilai tertinggiatau tingkat
getaranmasing-masing
kanal, dalam mils peak-topeak.
Lampuhijau OK untuk channel1 dan 2 menyala
powersupplyberadadalambatas-batas
menandakan
dan terus berada diantara pickup getaran atau
transducer
dan monitor.
Tombol shutdownmenampilkansetpoint level trip
untuk channel tertentu. Tombol tanda bahaya
menampilkansetpoint tanda bahaya. Mengatur
kontrol untuk pengaturansetpointtingkat getaran
terdapatdi dalammonitor,
Lampushutdownmenyalamerahmenandakan
preset
tingkat getaran channel yang telah terlampaui.
Lamputanda bahayamenyalakuningmenandakan
presettingkatgetaranterlampaui.
Output Jacks untuk tiap channel memungkinkan
untuk penampilanjarak jauh atau pencatatan
getara
tingkat*tingkat
n.

TrainingConductedBy PT. Pakafti Handayant

11

Controls and lndicators

sEcnox A tltrDrca'IoR

PC'WER SUPPLY
D R AW ER

0R AW ER

ELAXK O AAW R

CO

r'

:S;

oc

oc)
CO
'a) a)
\J

MonitorPanel
Gambar5-5. EngineVibration
CIRCUITBREAKER
PANEL

Circuitbreakerpanels(lihatgambar5-6) diletakkan
dalam Konsul Kontrol Lokal. Panel ini meliputi
berikut:
nstrumen dan kontrol-kontrol
instrument-i
CIRCUITBREAKER
Semuarangkaianpemutustenaga untuk berbagai
rangkaiandalam sistim controlDC di tempatkandi
dalampanelini.
SWITCHES
Voltage Isoch/Droop
RotarySwitch2 posisiyaituOFFatau ISOCHdan
DROOP.Sakalar ini diposisikanke OFF atau
ISOCHselamaoperasigeneratortunggal.
Reduced Speed
RotarySwitch 2 posisiyang mengontrolmode
pelambatan
(deceleration
mode)padarangkaian
rampgenerator.

TrainingConduded By PT. PakartrHandayani

12

Controls and Indicators

v 0 tI A [ t
t5ul11
0R00P
s\|ilcI

,H0tlRMtTtR
/ {i l l c l i l t r {O u R 5 )/ 5 T A I t t R
I
/ ltt'tttL
5Ptt0
I
t'
|
MrTrR
/
5]AR It,R
i ft(,il,ii
l Ir .1l 'l i ,i ], ^ l
,,t[ Ii i]

5Y5TFl,l
0c c0r'iril0L
it R c i , , i il R t A r t l {
/ j IrL,\c[\)

'Rtouct0iliGtr',t 's IiRTLR


Lrrbrtit
SPti.0
SrtrliCH i.,A!irlllCll

'i .\6i l i L
5i A i i i i ,.r.f i I

Gambar5-6.TypicalCircuitBreakerpanelControlsand
Indicators
METERS

GAGEPANEL

Hourmeter
Hourmeter
aktif padasaat660lokecepatan
engine,
mencatatkumulatifjam operasidalamskala0.1
dar i1 jam sam paidengan9999.9jam.

Staft Counter
Counter ini juga aktif pada 660/o kecepatan
engine/mencatatbanyaknya
operasistarteryang
berhasil,
sampaidengan99,999start.

Panelgage(lihatgambar5-7) dipasangpadasisikiri
dari baseframe pada bagianbelakandari package.
Gage-gagedan saklar-saklartersebut mungkin
padasuatupane!yangmencakup:
dipasang
SWITCHES
Emegency Stop
Sebuahsaklartombol tekan kontak cepat yang
mende-energize
relay-relaystart control untuk
membuatengineshutdown.Lampuinkatormerah
padasaklarstopdi KonsulKontrolLokalmenyala.

TrainingConduded By PT. Pakafti Handayani

13

Contro Is and Tndicators

EngineCrank
Sebuah saklar 2 posisi (OFF, ON) yang
dengansaklarcrank
secaraparallel
didihubungkan
pada KonsulKontrolLokal.Saklarini digunakan
untuk menghidupkan(cranking)engine tanpa
penyalaan (combustion) selama prosedurteftentu'
prosedurPerawatan

GAGES
.

Gageuntuk tekananmasukandan keluarandari


Lube Oil Filter(LubeOil FilterInlet and Output
Gages)
Pressure
Keduagage diskaladari 0 sampaidengangage
downstream
160 psig. Inlet Gage menampilkan
dari oil filters, sedangkan outlet gage
menampilkan upstream dari oil fitter yang
I
lubeoil engineinlet.
merupakan
menunjukan
antarakeduapembacaan,
Perbedaan
yang
biasanya
pressuredrop pada oil filters,
bervariasidari 2 sampaidengan20 psid. Jika
30 psid,elemen
perbedaan
tekananini mencapai
filter harusdiganti.

Gage
Pressure
Discharge
Compressor
Gageini diskaladari 0 sampaidengan160 psid
dan menampilkan tekanan kompresor, Pcd'
Tekananoperasinormai pada 1000/okecepatan
adalah sekitar 110 sampai dengan 125 Psi9,
tergantungpada temperaturmasuk udara dan
altitude.
Gage
GasFuelPressure
Diskaladari 0 sampaidengan300 psig),gageini
tekanansuplaigas yang di 'tap'
menunjukkan
padaflangemasukantarastrainerdan main fuel
valve,Tekanannominal185Psig.
TrainingConductedBy PT. Pakarti Handayani

L4

l
Controls and lndicators

triclilt LUBt0tL i K Ii II LU B OIL


COMPRIS SON ,t16Dl[tlQUr0
FI L I T IRi I LII
HAlfi0tL MAiltF0[0 0tsfl ut6f
/[utL mt5Stj,tt
PR5t 5 U R
\f
;tl P fLYt,ktssti R t P R t!S ufi t,
tf,r tRclilct!r 0 t,
r Rill
SWlT Cli
-.

''', , 1 - l

'\, ,;

i N{]int.iiA ,
- t rtf ,)l l i.,,1t
t
Hl

. :./
\-,
rN:

L 0 A0SWIiC' l' itF )

C Atl i j 5i i { l ii L
VAtVt Al ':/ f i' i

ccf{rt cI r0fi

( 5 Pl .r * s )

S Y S TtU
0C
E0x
Jtrfi cl l 0rt
(R U)

Gambar 5-7.

REMOTEENGINE
CONTROLPANEL

(oPrroN)

Typical gage Panel Controlsand


Indicators

jauh (remote)
Sebuahpanelcontrolyang diletakkan
(Gambar5-B), ditempatkan
di dalamsuatu Control
Area/Room yang dipilih oleh customer, dapat
digunakan
dalarnhubungannya
dengancontrolpanel
pada controlconsole. Instrumentasi
yang tersedia
padapanelini meliputi,
METERS
Sebuahpengukursuhu turbineenginedan sebuah
pengukurkecepatan
turbineengineyang
dipasangkan
pada panelremotedan identikdenganmeter-meter
sejenispadapanelcontrolpadakonsulcontrol.

TrainingConduded By PT. Pakafti Handayani

15

Controls and lndicators

SWITCHES
pada panel remote: staft, stop, reset/
Saklar-saklar
dan speedadjustadalahsamadengansaklar-saklar
sejenisdi controlpanelpadacontrolconsole.
LAMPU.LAMPU
INDIKATOR
Readyto Loadand Readyto Run
Lampu-lampuindicatorstatus ini dalah sama
lampu-lampusejenispada panel control local
padaenginekonsul.
RemoteStatusatau LocalStatus
Lampu-lampu
indicator
ini akanmenyalahijaybila
saklarcontrolpadapanelkosullocalditempatkan
padaposisiAUTO/REMOTE
atauLOKAL.
Malfunction
danAlarm
Lampu-lampu
indikatorini akan menyalamerah
atau amber,jika dipakai,jika setiaplampualarm
atau malfunctionpada panel konsul local
menyala.
l
Gas Fuel System Activated atau Liquid Fuel
System Activated (Hanya untuk Dual Fuel
System)
Lampu-lampu
indicatorini akan menyalahrlau
atau biru jika sistimbahanbakaryang dipakai
diaktifkan.
Jikadisediakan,
lampu-lampu
dansaklar-saklar
ini
padabagianbawahpanel.
ditempatkan

TrainingConduded By PT. Pakarti Handayani

16

Controls and Indicators

o
fr

.)

/-]\
\^/

,'\
\z/

/\
('9t,,

/\

\--l

\-/

(-\
\J

''d-lf\**
\]-/

PA{fl
co tr R o t
{e Eto r Et

Gambar5-8. TypicalRemoteControlPanel

TrainingConductedBy PT. Pakarti Handayani

L7

Contro Is and I ndicators

[;.,",,,
t ""-11 _

t.-"ir

(-.li

(._r)

(-,

i rl ' l--r':
.',
\t //
l--i'
l'

t:

-^
r ir:-

!r':ltlirrrl

uJ,'

Gambar5-9. Startto LiveBusControlPanel

TrainingConductedBy PT. Pakarti Handayani

1B

StartSequence
for Cenerator

BAB II. 6
FORGENERATOTR
srART SEQUENCES

OB]ECTIVE

parapesertadapat:
Diharapkan
1.

Menerangkan
tentang hubungan dari sistim(supportsystems)
sistimpendukung

2.

Menerangkan
suatu package
urutan operasional
bahanbakargas,dimulai
dengan menggunakan
saat start
Note : pada bagian akhir ada sebuah blok
diagramsebagaireference

SYSTEM
SUPPORT
INTERFACE

HubunganSupport System (Lihat Gambar) untuk


padaoperasiyang
enginedan generatorbergantung
satu
dengan lainnya. Sebagai
benar/tepatantara
dengan
contoh,jika sistimudara(Pcd)tidakberoggrasi
benarmakasistimbahanbakartidakdapatmengatur
bahanbakardenganbenarke engine. Sistimkontrol
yangmunculmenjadi
sistim-sistim
dapatmenyebabkan
denganbenar.
tidak berfungsibila tidak beroperasi
Pemahamanyang benar tentang Support system
merupakanhal yang sangatpentinguntuk menjaga
agar packagebekerjadenganbenar/ sebagaimana
mestinya.

Training Conducted by PT. Pakarti Handayani-hy

e/7/2006

SlAg

sd9
S TA IU S
c0i l TR 0L

t*,..t
FUEL
FLOW
Y

ri
ri

GEiIEM T OR

RE0UC
Tt0rl
ORIVE
ASSEMStY

SlART ER
c MilK rNG

Gambar7-1. SupportSystimInteface
STARTPROCEDURE
LOCALSTARTDENGAN
BAHAN
BAKAR
GAS

Suatu prosedurstart lokal dilakukandari Konsul


KontrolLokal(lihatGambarSSDgasFuel).
Cek apakah event-eventyang tepat/sesuaiterjadi
setelahsetiap langkahuntuk memastikanlangkah
start, berjalandenganbenar.
Langkah1.
Systemkontrolswitchdipindahkan
ke LOKAL:
1. Rangkaian-rangkaian
pengontrol engine dienergize.

TrainingConductedby PT.PakartiHandayani-hy

9/7/2006

Start Sequence
for Generator

2. Padapanelpengukuran
generator,
lampuCIRCUIT
yang
BREAKEROPEN
berwarna hijau akan
menyala.

3 . Pada Pemantau Getaran (Vibration monitor),


lampu POWERyang berwarnakuning, lampulampuCH1 dan CH2yang benruarna
hijau,akan
menyala.
4. Pada panel kontrol engine, lampu J;aKarSTOP
yangberwarnamerahakanmenyala.
5. Horn alarm optionalakan berbunyidan dapat
dimatikan
denganmenekan
saklarHORNSILENCE.
Langkah2.
SaklarRESET
ditekan:
1. Rangkaian rangkaian start
'diperleng
kapi'(armed)

ringkasan

2. Semualampu malfunctionyang benruarna


merah
dan lampu alarm yang berwarna kekuningkuningan(amber),(kecualiIMP HIGHENGTEMP)
akanmenyala.
3. LampuREADY
TO RUNdari engineyangbenrrarna
amberakanmenyala.
4. LampusaklarSTOPyang berwarnamerahakaf
padam.

Langkah3.
SaklarRESET
dilepas:
1. Semualampumalfunction
danalarmpadam
2. LampuREADY
TO RUNtetapmenyala
Trainury Conducted by PT. Pakarti Handayani-hy

3. Jika alarm sebelumnyaaktif, selanjutnyahorn


alarmakandiam.
Langkah4.
STARTswitch ditekandandilepas:
1. Rangkaian-rangkaian
start dienergize
dan urutan
startdimulai.
i,-. LampuRUNyangbenruarna
hijauakanmenyala.

3 . AuxiliaryOil pump mulai masukke sikluspralubrikasi


4. Turbine stafter dienergizedan mempercepat
kecepatan
operasi.
.

15 detiksetelahsaklarstaftditekan:
1. Startermulaimenghidupkan
Lngine

Enginemencapai
kecepatan
15o/o

10 detiksetelahkecepatan
L1o/o
:

1.

Sistimbahanbakardiaktifkan

2.

Lightoff tery'adidalam beberapadetik


(combustion)
dan penyalaan
dimulai.

3.

Suhuenginemulaibergerak
naik

20 detiksetelahkecepatan
l5o/o:
(shutoff)
1. Ignitiondimatikan

Tekanan pompa oil (digerakkanengine)


mencapai
35 psig:
1. Auxiliary
Oilpumpakanberhenti

Training Conducted by PT. Pakartr Handayani-hy

StartSettuence
for Generator

Kecepatan
660/o:
enginemencapai
1.

Slstimstaft berhenti

2.

Startmetermencatatstartengine

3.

Hourmeter mulai menghitung jam


operasiengine

4.

SistimVane variabel,bergerakkearah
bukamaksimum

5.

Suhu engine mencapaipuncak dan


kemudian
sedikitturundi bawahnya.

6.

Medangeneratorflasheddan generator
yangdikontrolmulaieksitasi.

. Kecepatan
enginemencapai
90 o/o:
governor
pengindera
Sistim
beban/kecepatan
dari engine,menerima
kontrolaliranbahanbakaryangdicapai
dan memantaukecepatanoperasiyang
d ip ilih .

1.

Kecepatanengine mencapaitingkat operasi


sesuaidenganyangdi preset:
1.

TO LOADyang berwama
LampuREADY
hijauakanmenyala.

2.

beban.
setsiapmenerima
Generator

Catatan

TrainingConductedby PT.PakaftiHandayani-hy

:Merujuk kepada Pengoperasian


padabagianini.
Generator

9/7/2006

-l

I
I

;glr

I
I

c:5
"i ;

I
I

a:i
" E t :l
:l

_l

"= 3
s 8338
Hgr
Ei'
s-t

- 2 EN

l Ei E

d3H

rS

i 3 ; d3lr l
t'

-l

ca

E5F
HBsg

YZg

133

r*s
rd:
o-u

AE
EEE

[+lsEl

rct
siE

l----g
gu
I

i
l-

/-\
--

3tt
P0:3
;;?

igE

r-

!r ra
i- i5

=a

rg;=
ig re :iExH
l i g:
--;
i

I
\T

Generator Per{onnance ArtaI vsis

BAB TI.7
GENERATORPERFORMANCE
ANALYSIS
Ti n i a u a n ;
yang mempengaruhi
Tiga parameter
padaunjukkerjadari sebuahgas turbine
generator
seu
-

Temperatur
udaramasukpadaenginedangenerator
Tekanan
sekitardariudaramasuk(altitude)
Rugitekananpadasisimasukdan keluarturbin.

Performance Conditions;
UnjukkerjaEnginedidasarkan
ataspersyaratan
standar(ISO)sebagai
berikut;
operasipada ketinggianpermukaanlaut (d =1.0), dengantemperatur
masukengine(T1)adalah59 deg F
Zeroinletand exhaustductsystempressurelosses
Zerocompressor
air bleedoutput(Bleedairvalveclosed)
Noauxiliary
powertakeoff(Standard
auxiliary
equipment
only)
100percentratedenginespeed,
t4,944rpm (50 Hzgenerator)
t4,95Lrpm (60 Hzgenerator)
-

Outputgearreduction,
gearGB=96 perce.rt
efisiensi
generator;
Efisiensi
95,5percentpadabebanpenuh
95.0percentpadas/abeban
93.8percentpada7z beban

Faktor koreksi ketinggian (correction Factor for Attitude) (see fig.#1) .


Faktor koreksi ketinggianharus dipakai sebagai data unjuk kerla jika
pemasangan
lebih dari 500 m di atas permukaanalaut. Ketinggiantidak
berpengaruh
terhadapkonsumsibahanbakar,tetapimengurangi
tenagayang
dihasilkan
oleh(sebab)faktorkoreksiketinggian.

Training Ccn(lucGd by PT. Pakarti Handayani-hy

9/9/2006

Generatu Perforntt t<e Ai ta lysis

Rugi tekanan (Tekananbalik) pada system


saluran masuk dan keiuar
mempunyai
suatuefek yang besardarampencapaian
unlut<kerjaenginedan
dapatmengakibatkan
pengurangan
dayakeruaran
yangtlrsedia.(rihatFig.#4)

Correction Factor, 6 =

Ambient pressure(psia)
14.7 psia

PenqqunaanKurva;
Tenagayangdihasilkan,
aliranudaradan suhu keluar,
- -'' dan aliranbahanbarar
vs.suhuudaramasuk(LihatFigure# t and
# 2).
Kurvaini bisadigunakan
untukmenghitung
tenagamaksimum
yang dihasirkan
dalamkilowattpadasuatukondisisuniu
lamiiuntl ,ourn masukengine.
Figure# 3 digunakan
untukoperasidenganbahanbakargas,
Figure# 4 digunakan
untukoperasidenganbahanbakercair.
Sebagai
tambahan,ariranbahanbakardaramBTUper jam,
ariranudara(gas)
keluardalamkirogram
per detik(poundsper hour),iun sun,
udara(gas)keruar
dalamderajatcelsius(Fahrenheii;
niru diperoleh'untuk
tenaga
yangdihasitkan
padasuaturangeyangbesar
Exhaust
heatavailable
dapatditentukan
denganmenggunakan
formulaberikut:

wex

a
=

Cp (Tus - Tro)

66
dimana
n
Y

Wex

Heatavailable
in kW (Btu/hr)
Exhaustmassflow in kglsec(thousandslb/hr)

TrainingConducted
by pI. pakartiHandayani_hy
9/9/2006

Genera
tor Perfiin, ur ru nna lys,S

pressure
Ambient
kPa(psia)
101.4kPa( 14.7psia)
(Tug- Tru) = Temperature
dropin heatrecoveryequipment
Cp
Tse
Teg

= Averagspecificheatoverthe (T.n - Tr.) range.


Assumsi= 1,05
= StackExhaust
Temperature
= Exhaust
Temperature

TrainingConclucted
by PT.PakartiHanday;ni-h1,

9/9/2006

Generator Perfotnt ance Analysi.;

ot

o
c
!

lqD

*)

4 r tr !.r
A!l l U o e .
M tr l AS

ligur e

l .l .l .

Pt'r for nr onc c

wllll

tfl

tl tl

l tr ) a m vt

C or r tc l i on

|sth

PN U *

[t

sl l

L tvtt

l ac tor

xw

for Al l i l r r dc

ti gurc 1.|-2. l nl tt and [r har r s t Pow c r Ior r

Traininq Conductedby PT. Pakarti liandayi rti-hv

ru

Generator Perfcrmance,4nalysis

r ,l N I a l r r r ,t d t ta | ( ,1 5 L I
. ( i ( ) N r r N t( ) tl S
l ) U fY
! N C , AU XItIAR Y
H l A( t
KAt
OI f
. ZL ,IO fXIEFN AI
{{r C l
,tl L SSU n t
! r l ^ | U l l A! GAS I tr f t

Itl r a tr sl

tto w .

w l r /6 ,

xG/stc

tl r t( ) u sa h tr s

tOsl l tS

t u /r r ^ )

:u

'gi5^'"'y':'-

ll
rl

\l ---L
tt'

({r

,-,

t xctxt

lig r r r c 1 3 -3. Typi cal Oul pul

Training Conductedby PT. Pakarti Handayani-hy

P ow r:r A vai l al '1r., Gas Fuel

Generator Performance Analysis

kk,,

lig u r e l3 - i l . Iypi cal Oul pul P ow rr A vai l abl e, l i qui d S ucl

TrainingConducted
by PT.PakartiHandayani-hy

Gerrcrator Performance Analysis

EXAMPLE
Tentukanbesarnyakonsumsibahanbakar(gas)padabebanpenuh,s/cbeban
penuh,setengahbeban penuh dan AvailableExhaustHeat dari suatu gas
generator
setdengankondisisebagai
berikut;
Ambienttemperature
Elevation
Inlet ductloss
Exhaustduct loss
(Tse)
StackExhaustTemperature

150C(5eoF)
460m (1500feet)
500Pa(2 in. l't2O
100Pa(4 in. H2O
149oC(300oF)

DariFig.#3 pada15oC(59oF)diperoleh;
2800kWS
Darri
Fig.#1 pada460m(1000feet)diperoleh;
6 = 0.95
DariFig #2 pada2800kW6 diperoleh:
Inlet Loss = 0.056kWPa x 500 Pa = 28kW
= 27kW
ExhaustLoss= 0.027kPax 1000Pa
= 55kW
Total Loss = 28 kW + 27 kW

MininrumPower Available= (2800x 0.95) = 2605kW


Daril--ig.
#3 pada15oC(59oF)dan
.
'
.

PadaBebanpenuh(2800kW6) diperoleh
Wf / 6 = t1.4 MW(38.8mill.btu/hr)
PadaBeban% bebanpenuh(2100kWS)diperoleh
Wf / 6 = 9.4 MW(32 mill.btu/hr)
PadaBeban1/2 bebanpenuh(1400kWS)diperoleh
Wf / 6 = 7.5 MW(25.5mill.btu/hr)

Fuel Consumption:Wf = (Wt | 6) x 5


.
'
.

PadaBebanpenuh(2505kW) diperoleh,
Wf = 11.4x 0.95 = 10.8M\/V(38.8mill.btu/hr)
3/+
PadaBeban bebanpenuh(1954kW)diperoleh,
= 8.93MW(30.4mill.btu/hr)
Wf = 9.4 x 0.95
3/+
PadaBeban bebanpenuh(1303kW)diperoleh,
Wf = 7 .5x 0.95 = 7.1 MW( 24.2mill.btu/hr )

frainingConducted
by PT.PakartiHandayani-hy

9/9/2000

Gerrcrator Perfonrn nceAtn iysis

Exhaust Flow (Wex/ S) dan ExhaustTemperature (Teg)


DariFig.#3 pada15oC(59oF)dan
.

PadaBebanpenuh(2800kW6) diperoleh,
lb/hr)danTeg = 429oC(805oF)
Wex/6 = 17.65kg/sec((139,6thousand

Pada3r'+
Bebanpenuh(2100kWa) diperoleh,
lb/hr)danTeg = 360oC(6B0oF)
Wex/6 = 17.7Lkg/sec((140.1thousand

Pada7z Bebanpenuh(1400kWS) diperoleh,


Wex/6 = 17.73kg/sec((140.2thousand
lb/hr)danTeg = 299oC(570oF)

Ava i l a b l eE xh a u stH e a t: Q = 6 x( W ex/6) xCPx( Teg- Tse)


.

PadaBebanpenuh(2605kW) diperoleh,
Q = 0.95x 17.65x 1.05(429- 149)= 4930kW (16.8mill.Btu/hr)

PadaBeban3/abebanpenuh(1954kW)diperoleh,
Q = 0 .9 5x I7 .7 Lx 1.05( 360* 149)= 3727kW ( i2.7 mill.Btu/hr )

PadaBeban94 bebanpenuh(1303[rW)diperoleh,
Q = 0 .9 5x1 7 .7 3x 1 .05( 299- 149)= 2653kW ( 9.1mill,Btu/hr )

TrainingConducted
by PT.PakartiHandayani-hy

9i9i2006

O perstiorrmtd Mshrtenance

BAB II.8
OPERATIONAND MAINTENANCE
8.1.

OPERATION

CHECKOUT
8.1.1 PRESTART
setiaphariataukalaubisasebelum
Pemeriksaan
berikutharusdilakukan
Kombinasi
dari PemeriKaanPrestaft,ProsedurOperasi
mesindijalankan.
kemungkinan
besar akan menemukan
Operasional,
dan Pemeriksaan
yang
terhadap performance'
berpengaruh
kondisi
abnormal
setiap
ini meliputibatterychaper & rack
(performa-unjuk
kerja. Pemeriksaan
package,
engineair filter,lubeoil cooler,dan konsul
turbine
assembly,
kontrol.
.

DieselStafter Engine
Oil harusdijagapadalevel
leveloil padaenginecrankcase.
1. Periksa
*FULL"
and"ADD"padadipstick(oillevelgage).
antara
dan mendinginkan
2. Periksa
enginecoolantleveldenganmematikan
mesin.laga padaposisi1/zin.(13 mm)daridasarpipa.

BatttT Chargerdan Rack Assembly


dalamposisiON.
1. Periksa
apakahchargercircuitbreakers
denganbenar.Jikaarus
2. Periksaapakahbatterychargerberoperasi
keluaran battery charger terlalu tinggi, kemungkinanterjadi
hubungsingkatpadasalahsatusystemDC.Hubungsingkatdapat
semuabreakerpadaposisiOFF,yang
diisolasidenganmeletakkan
arus muatan menjadi stabil dan kemudian
nremungkinkan
posisikankembalimasing-masing
breakerke posisiON sambil
dc ammeter.
mengamati

NOTE
Jika batteryberadadalamkeadaandischargedketika charger
keluaran
akanmenghasilkan
secaraotomatis
charger
dihidupkan,
dengandc
mode.Untuknameplate
maksimum
dalamcurrent-limit
melebihi
55A.
initidakakan
rating50A,current-limit
Training Conducted by PT: Pakartt Handayant-hy

9/7/2006

Operntiottand Mnhrtenance

Turbine Package
1. Periksaapakahsemuagage isolationhand valvesdalam posisi
terbuka(fullycounterclockwise).
2. periksaindikatorlube oil level. Reseruoirharus diisi sampai
hanyabisa dilakukan
indicatorlevel menunjukpenuh.(pekerjaan
unit)'
denganmen-shutdown
3. Periksaapakahlubeoil filter bleeddan drainvalvesdalamposisi
teftutuP.
apakahsemuakatupfuelsupplydalamposisiterbuka'
4. Periksa
5. Cektekananbahanbakarpadapanelgage'
6. Cekgeneratordan yakinkanSemuacoverdan guardsditempatkan
secara aman. Periksasemua louvers dan ventilationscreens
yang
terhadap benda asing atau material penghambatlain
ventilasi'
mungkinmencegahaliranudaradan menghambat
terjadinya
untuk mencegah
7. Cek semuasalurandan kencangkan
jika terjadikebocoran'
Perbaiki
kebocoran.
EngineAir Filter
udara pada jalan masukmesinaPakahada
Cek sistem PenYaring
ataukontaminasi.
clogging

LubeOil Cooler
Pada heat exchangerYang
1. Cek apakahterjadi kontaminasi
Prosesheat
alirancoolantatau mereduksi
mungkinmembatasi
transfer.
setiaP'terjadinYa
oil. Perbaiki
2. Cek apakahterjadi kebocoran
kebocoran..

. ControlConsole
(S118)switchke posisiOFF'
OFF/RUN
1. Letakkan

TrainingConrluctedby PT.PakartiHandayani-hy

9/7/2006

Oper ntiott mrd Mnin tenance

2. Bukapintu depanKonsuldan periksaVOLTAGE


ISocH/DRoop
switch(s260),pada dindingbelakang,
dan kecepatan
mesin
ISocH/DRooP
switch(s191),padabagianclepan
konsul,
apakah
padaposisiyangdipersyaratkan
ditempatkan
padamodeoperasi
yangdiinginkan.
Mode-mode
operasi
danposisi
switchdapatdilihat
padatabel9.1.1.
3. Padapanelcircuitbreaker
yangterletakdi dalamkonsul,periksa
semuacontrolsystemcircuitBreakers
(c8200throughcBzoT)
apakahtertutup (oN). Periksaapakahpermanentmagnet
generator
(Plvlc)circuitBreaker(cBz60-1)dalamposisitertutup
(oN):
4. Tutupdan amankancontrolconsolefrontaccessdoors.
5. PosisiOFF/RUNKey switch (s118) ke RUN,dan tekan LocAL
Switch(s1011).Periksaapakahpemilihanmenu displayscreen
munculpadaoperatorinterface
displaydan LocALLight(DS101L).
padaturbinecontrolpanelmenyala.
i
6. cek te{adinya indikasi-indikasi
malfunction.perbaiki setiap
malfunction.
7. PeriksaBREAKER
coNTRoL Switch (s106) apakahpada posisi
TRIP(open)danCIRCUIT
BREAKER
OPENLight(DS164)menyata.
B . Periksaoperasigeneratorspaceheater.
Tabel 9.1.1 Isocly'DroopSwitch Positions

Mode of
Operation
a.

Single generator operation starting to a clead bus

b.

Single generatorin parallel with infinite bus

Engine Speed
IsocLy'Droop
Switch

Voltage
Isocly'Droop
Switch
ISOCH
Closed
DROOP

Commercial

c.

Paralleloperationof generatorswith identical

control svstern
d.

Paralleloperationof generatorswith dissimilar


Control svstems

Training Conducted by PT. Pakarti Handayani-hy

DROOP
Open

DROOP

9/7/2006

Operationand Maintenance

8.1.2 ENGINEOPERATION
.

Time Between Stafts


Suaturestartbiasanyadapat diinisiasisatu menit setelahkecepatan
jika
turbineengineturun/jatuhsampai15 persen.Namundemikian,
jangan
lakukanrestaft lagi
suatu usaha restart gagal dilakukan,
mati. Dalam hal terjadi malfunction
sebelumengine benar-benar
diketahuidan
shutdown,janganlakukanstart sampaipenyebabnya
staft gagal
tiga
kali
usaha
Setelah
diperbaiki.
kondisi tersebut
harusdilakukan.
troubleshooting
dilakukan,

ExhaustSystem Purging Procedure


materiallain masukke turbine
Jika unburnedfuel atau combustible
exhaustsystem,fuel ataumaterialtersebutdapatmenyala(ignite)jika
sumber
limitsdan terdapat/terjadi
fuel/airratio mencapaicombustible
penyalaan
(ignitionsources).
Fueldapatmenumpuk
di dalamexhaust
startatausetelahengineflameoutatauignitiongagal.
systemsebelum
1.

warningberikut.
Perhatikan

WARNING
-

Penumpukan combustible materials pada exhaust system


yang
combustion
teriadinya
dapat menyebabkan
membahayakan,
Pelajari Metoda perawatannya sesuai dengan yang
dipersyaratkanPabrikan
Jika hal ini tidak dilakukan dapat berakibat pada
rusaknya exhaust system dan menyebabkan kecelakaan
dan kerusakanhafta milik.

fl:meout
initialstaft atau restartsetelahSebelummelakukan
sebagai
ataugagalignition,exhaustsystemharusdibersihkan
berikut:

TrainingConductedby PT.PakartiHandayani-hy

9/7/2006

O1teratiortand Mnbtenance

a. Tentukan volume internal jalur exhaust yang akan


(Ini merupakanvolumeof the exhaustsystem
dibersihkan.
darienginedimanaexhaustakanlolos')
downstream
b. Tentukanpurgecycletime.Minimumpurgerycletime adalah
30 detik, atau internalfree volumeof the exhaustsystem,
dalam cubic feet, dikalikan0.08, atau lebih besar.untuk
exhaust systemsyang lebih kompleks,engine dilengkapi
volume
dengansilencerdan ductingdan yang mengandung
yanglebihbesardari350cubicfeet,kalikandengan0.135.
c. Tentukansettingof enginepurgetimer yang ada dengan
Software
merujukpadaKvalof purgetimer on Turbotronics
( 14974t).
Documentation
d. Jika purge time lebih besardari calculatedsetting,setting
cukupdantidakperludirubah.
dianggap
e. Jika existingsettinglebih kecil dari calculatedsetting,atur
settingatau lakukanmanual
timer sesuaidengancalculated
crankpadaengini crankswitchtanpa start initiation,untuk
time. lika tidak crankswitchtidak terpasangpada
calculated
unit, lakukanlangkah3 dan contactSolarTurbineCustomer
Services.
nilai
atauutilitycJpacity,.
2 . Jikapurgetimedibatasiolehequipment

lower eiplosivelevel (LEL)pada exhaustsystemdapat diukur


bahwanilaitersebuttidak lebihbesardari 20
untukmemastikan
harus
Pengukuran
persensebelumSuatuenginestartdilakukan.
Semua kantung dari exhaust system dimana
dilakukanpada
yangdapatmenumpuk'
yangsignifikan
terdapatkonsentrasi

3 . lika engineflameoutatau ignitionfailureterjadi pada setiap


sebelumrestat.
maintenance
waktu,tipukancorrective

berikutdirekomendasikan
Sebagaitambahan,tindakan-tindakan
basis:
on a continuing
a. Lakukanperawatandan pengaturansemua gas turbine,
controls dan exhaust systems sesuai dengan yang
kan.
Pabri
direkomendasikan
b. Pastikanbahwa setiap exhaustgas valves atau dampers
normal.Adalahhal
terpasangdenganbenardan beroperasi
y angs an g a t p e n t in g b a h wa ja | u r e x h a u s t g a s k e a t m o sp h e r e

TrainingConductedby PT.PakartiHandayani-hy

e/7/2006

Operationand Maintenance

selaludijagadalamkeadaanbebashambatan
selamaengine
staft-updan operasi.
Pastikkan
bahwa,exhaustcollectordan exhaustsystemliquid
drainsdarigasturbineberfungsi
denganbaik.
d . Jagakualitasbahanbakaragar tetap padabatas-batas
yang

ditentukan oleh Pabrikan. Deviasi dari spesikasiyang


ditentukan Pabrikan dapat berakibat tidak berfungsinya
SistemKontrolBahanBakar(fuelcontrolsystem).

. Start Procedure
NOTE
Instruksi-instruksiberikut yang ditunjukkan dalam
tanda [ ] dapat dilihat pada displayscreen.
1. Periksa
apakahOFF/RUN
padaposisiRUN.
Keyswitch(S1BB)
7 . Pressand releaseLOCAL
Switch(51011).
3 . Pressand releaseACKNOWLEDGE
Switch (5117) dan RESET

Switch(5114).READYLight (DS117)harus menyala.lika ada


yangditampilkan,
shutdownmalfunction
REDYLight(DS177)tidak
akan menyala.Malfunction
harusdiperbaikidan ACKNOWLEDGE
Switch(S117)dan RESETSwitch(S114)ditekankembaliuntuk
me-resetmalfunction
circuit.
4 . READYLight (DS177)akan menyalajika semua malfunction

dihilangkan.
5. TekanSTARTSwitch(S110)sekejap.
a. STARTING
Light(DS114)mulaimenyala.Pre/postlube pump
pre-lubrication.
mulaistaftsdan melakukan
Enclosure
fan dan
dieselstafterdi-energize.
b. Setelah
mulaiterjadipre-lube
30-detik,
cycleenginecranking.
c. Setelaheniginedi-crankoleh stafter sampaikecepatan15
persen,purgetimer akan memberikan
suatuperiodapurging
(yang telah dipilihsebelumnya)
dari exhaustsystemmelalui
engineairflow"
TrainingConductedby PT.PakartiHandayani-hy

e/7/2006

Operatiottand Mahtenance

d. setelahpurgecycleselesai,
liquidfuel dapatditerimaigniter
torchdanfuel injectors.
Bahanbakar,yangdipisahkan
oingan
bantuan
tekananudaradancampurannya,
dinyalakan
denlan
adanyaudarapembakaran
(combustion
air).Fenyalaan
akan
terjadibeberapa
detikkemudian
danmulaiterjadipembakaran.
STARTING
Light(DS144)akanberhentiberk-edip
tetapitetap
menyala.
e. Engineterusberakselerasi
dan enginetemperature
akannaik
sampai400oF(2+oo c). lrcNrrIoN] ditampitkan
pada
operationsummaryDisplay
screen,fueliamp diaKifkan,
fuel
torchdanignition
ditutup(shutoff).
f . Engine
speed.akan
naiksampai66 percent.
Tekanan
Enginedrivenlubeoil pumpakannaikdanpre-lube
pumpmati.staft
systemdimatikan
dan startemasukke cooldowncycle,dan
starter clutch menutup(overruns).Voltagereguiatordienergize.
Vibrationmonitordipindahkan
dari posisioffsetke
normalsetting.NUMBER
oF NORMAL
STARTS
Meter(M110)
registers
a successful
startand ENGINE
HOURS
Meter(M100)
mulaimenghitung
engineoperatinghours.srARnNG'Lighi
(DSl14)padamdan[RUNNTNGJ
ditampilkan
padaoperattn
Summary
Display
Screen.
g. Enginespeednaiksampai90 persen.Rangkaian
p.ngino.ru
kecepatan
(speed-sensing
circuit)mulai bekerjamengontrol
bahanbakardenganbatuansignars
yangdikirimke mainfuel
actuator.
6 . Kira-kira
10 detiksetelahkecepatan
90 persentercaplai,
variable

guidevanesmembuka,
danenginespeednaiksampai100persen
dan READY
To LOADLight(DS1B6)
menyara.
Generator
set siap
menerima
beban.

7. Ketika
bebanditerapkan,
padaoperation
[oN LOADIditampilkan

summary Displayscreen. Main fuel actuator/throtfle


valve
ditempatkan
sedemkian
rupa untukmenjagaagar enginetetap
padaspeedsettingyangterahdipilih.UntukInstruksi
beroperasi
Pembebanan
(Loading
/Prosedur
Instructions)
pada
akandibahas
GENEMTOR
OPEMTION.

B . Amatisemuametersand gagespadasaatenginespeednaik
menujuoperating
speedsetting.
9. Lakukan
operational
checkout
berikut
ini.
Training Conducted by PT. Pakafti Handayani-hy

9/7/2006

Op erati ott and Maint enance

OperationalCheckout
Pemeriksaan
(Checkout)
harusdilakukansetiaphari setelahgenerator
set dijalankanuntuk memeriksa
apakahberoperasi
dengannormal.
catat speeds,pressures,
temperatures,
vortage,current,dan output
power sebagaibahan perbandingan
dengan besaran-besaran
yang
telahditetapkan.Periksakebocoran
padasaluranudara,oil ataufuei.
Pastikanbahwa generatorset dioperasikandengan aman setiap
waktu.
CONTROLCONSULE- OPERATOR
INTERFACEDISPI.AY
. Enginespeed
. Enginetemperature
ENGINEGAGEPANEL
. Lubeoil filterdifferential
pressure
. Enginelubeoil temperature
. Enginelubeoil pressure
. Enginecompressor
pressure(pcd)
discharge
. Pcdlairassistreservoirpressure
. Dieselfuel pressure

,. STOPPROCEDURE
NORMALSTOP
Untukmenginisiasikan
suatunormalstop,tekansrop switch(sl11)
sekejap.
Kejadian-kejadian
berikutakanterjadi:
1. CIRCUITBREAKER
CLOSELight(DS165)padamdan CooLDoWN
Light(DS113)
menyala.
2. Setelahpendinginanselama 3 menit, the coolDowN Light
(DS113)padamdanSTOPPING
Light(DS111)
menyata.
3. Liquidfuel valvemenutup,combustion
berhenti,dan enginemulai
pelambatan
melakukan
(decelerate).
Lliquidpurgevalvemembuka
untuk memulaimelakukanpurgingterhadapanozzlesdan jalur
bahanbakarl.Purgingakanberrangsung
terussampaiunit engine
speedturunsampai15 persenketikakatupmenutup.

Training Conducted by PT. Pakafti Handayanj-hy

e/7/2006

Oneratiortand Maintenance

FASTSTOP

WARNING

PosisiOFF/RUN
Keyswitch(S118)ke OFFhanyajika diperlukan
Untukmenginisiasi
suatufast stop, tekan FASTSTOPSwitch(S112)
sekejap.Kejadian-kejadian
berikutakanterjadi:
1. Generator
akanunloaddengancepat.
2. Engineakanshutdown
segeratanpamelaluiperiodapendinginan.
3. Postlubrication
akandinisiasikan
samasepertipadanormalstop.
MALFUNCTION
STOP
Jikasuatumultifunction
terjadiyang membutuhkan
unit di-shutdown
dengan segera, control system akan menginisiasikansuatu
multifunction
shutdown.Unit akan di-unloaddan engineharusdiyangsamapadafast stop.lika kondisiini
shutdowndenganprosedur
merupakansuatu self-correcting,
engine dapat di-restartsetelah
kondisikembalinormal.lika kondisiini membutuhkan
perbaikan,
lakukancorrective
nraintenance.
.

REMOTEOPERATION
Pengoperasian
unitdarisuatutempatyangjauh (remotelo<ration)
dapatdilakukan
olehcustomer,dengantersedianya
remote'switches.
Prosedur
berikutuntukmempersiapkan
unit localcontrolconsolebagi
pengoperasian
dari remotelocation.
1. Ikuti prosedurRESTART
CHECKOUT
di atas.
2. Padalocalcontrolconsole:
Keyswitch(S118)padaposisiRUN.
a. Periksa
apakahOFF/RUN
b. Tekan dan lepas RESETSwitch (S114). Perbaikisemua
yangada.
Malfunction

Training Conducted by PT. Pakarti Handayani-hy

9/7/2006

Operatittrtmul M aintenance

c. TekanREMOTE
switch (s101R).LocAL Light(DS101L)akan
padamdan REMOTE
Light(DS101R)
menyala.

'

8.1.3

Unit sekarangsiap untuk operasidari REMOTElocation.contror


selamaoperasidapatdikembalikan
ke localturbinecontrolconsole
denganmenekanLOCALSwitch(51011).Pada localturbinecontrol
console,REMOTELight (DS101R)padam,LocAL Light (DS101L)
menyala,dan semua remote control berhenti berop.-erasi
sampai
dikembalikan
ke remotecontrol.

GENERATOR
OPERATION
Generator
outputdipantaudan dikontroldari generatormeteringpanel
yangyangberadadi sebelahkanan,pintudepancontrolconsole.I]ustrasi
tentang generatormeters,system'scontrolsdan indicators
dibahaspada
BabII.6 di atas.
.

GeneratorOperation Starting to a Dead Bus


1. Pastikanbahwa generatorpower circuit breaker terbuka dan
generator
tidakterhubungdengangeneratorbus. Bukaindividual
switchgear
feedercircuitsbreakers.cIRcuIT BREAKER
opENLight
(DS164)
akanmenyala.
2. PeriksaapakahenginespeedISocH/DRoopswitch (s191),pada

turbine
paner,
controt
danVOLTAGE
ISocH/DRoop
switchtbiool,

yang beradadi dalam control console,diletakkanpada posisi


sesuaidenganinstruksi-instruksi
yang diberikanpada PRESTART
CHECKOUT
di atas.
3. Jalankan(start)enginesesuaidenganapplicable
staft proeedure
padaENGINE
opEMTIoN di atas.Lakukanpengaturan
icecepatan
denganenginespeed INCREASE
Switch(s154) dan DECdEASE
switch(s155)untukmendapatkan
frekuensi
yangdiinginkan.
4. cek tegangantanpa beban dari generator(generatorno-load
voltage).Atur GENEMTOR
VOLTAGE
ADJUSTSwitch1i,tsz; ;it<a
diperlukan
untukmendapatkan
normalgenerator
no-loadvoltjgb.
5. PeriksaapakahIREADYro LOAD]ditampilkanpada operation
summaryDisplayscreen.pindahkanBREAKER
coNTRoLSwitch
(5106)Ke posisiCLOSE.
CIRCUITBREAKER
CLOSELight(DS165)
menyaladan cIRCUITBREAKER
opEN Light(DS164)padampada
saatcircuitbreakermenutup.

Training Conducted by PT. Pakafti Handayani-hy

10

9/7/2006

A1teratiorrand Msin tenance

feedercircuitbreakers.
Bebanjangansampai
6. Tutupswitchgear
generator
setrating.
melampaui
secara
7. LakukanOperationaf
Checkout,
dan fakukanpengamatan
engine dan generatoruntuk
berkalasemua instrumentasi
setberoperasi
normal.
memastikan
bahwagenerator
Manual Generator Parallel Operation

generator
Asumsi-asumsi
berikutpada bus dimanaoncoming
akan
dfparafeftefah siap untuk di-energizedan memungkinkan
untuk.
mengirimkan
beban.
l

1. Perhatikan
cautionberikut.

CAUTTON

Never attempt to parallel generators with different phase


rotation.
Periksaapakahpower circuit breakerdari oncomlnggenerator
dalam posisiterbuka dan generatortidak terhubungdengan
generatorbus. CIRCUITBREAKER
OPEN Light (DS164)akan
menyala.
2. Tergantungpada systemdimanageneratorakan diparalel,periksa
Switch(5191),padaturbine
apakahenginespeedISOCH/DROOP
panel,
VOLTAGE
ISOCH/DROOP
Switch (5260), di
control
dan
dalam controlconsofe,ditempatkanpada posisi sesuaidengan
yang diberikanpada PRESTART
di
instruksi-instruksi
CHECKOUT
atas.

3 . Jalankan(start) enginesesuaidenganapplicablestaft procedure


padaENGINE
kecepatan
OPEMTIONdi atas.Lakukanpengaturan
Switch (5154) dan DECREASE
dengan engine speed INCREASE
(5155)
frekuensigeneratoryangsama
untukmendapatkan
Switch
bus.
denganfrekuensi

4. Cek tegangantanpa bebandari generator(generatorno-foad


voltage)pada ketiga fasanya.Tegangantanpa beban harus
normal.
Training Concluctedby PT. Pakarti Handayani-hy

11

e/7/2006

Operationand Maintenance

Switch (5104) handledan pindahkan


5. SisipkanSYNCHROSCOPE
posisi
lights akan menyaladan
switch ke
ON. Synchroscope
mulaiberotasi.
Synchroscope
6. Amaticautionberikut.

CAUTION

Synchroscope light must illuminate and extinguish


simultaneously. If
lights
not
do
fluctuate
simultaneously, phase rotation is incorrect.

Atur oncominggeneratorspeedsesuaiyang dibutuhkansampai


lightsberfluktuasi
Syncroscope
dari terangke gelappadakelajuan
kuranglebih4 detiktiap rycle atau Synchroscope
berputarsangat
lambatpada arah FAST. Hal ini mengindikasikan
bahwasystem
yang akandiparalelberoperasi
sangatdekatdengansynchronous
speed.
7 . Ketikasynchroscope
lightberadadi tengahperiodagelap,ataubila

synchroscope
beradapada posisijam 12, pindahkanBREAKER
CONTROL
Switch(5106) ke posisiCLOSEuntuk menutuppower
circuit breaker.CIRCUITBREAKER
CLOSELight (DS165)akan
BREAKER
menyaladan CIRCUIT
OPENLight(DS164)padam.
Switch(5104)ke posisiOFFdan cabut
B . Pindahkan
SYNCHROSCOPE
handle.

padaKWI(/ARMeter(M102)dan atur engine


9. Amatipembacaan
speedINCREASE
Switch(5154)and DECREASE
Switch(5155)
power
untuk oncominggeneratorset untuk mendapatkan
gen*'atorset
yang diinginkan.
Janganmelampaui
distribution
ratings.
NOTE
A small amount of load is required to mair.ltain a
stable parallel condition.

Training Conducted by PT. Pakafti Handayani-hy

t2

9/7/2005

Operutiortand Mrintenance

10. Lakukan Operation Checkout, dan amati secara berkala


instrumentasiengine dan generatoruntuk memastikanbahwa
generatorset beroperasi
dengannormal.
.

Automatic Generator ParallelOperation


dari
operasiparalleldan sinkronisasi
Prosedurberikutmenginisiasikan
suatu generator set ke bus beban. Automatic synchronizeinitiate
switch dan syltchronize sequence fail light tergabung di dalam
generatormodepanel.
1. Periksaapakah power circuit breaker dari oncominggenerator
dalam posisi terbuka dan generatortidak terhubung dengan
OPEN Light (DS164)akan
generatorbus. cIRcuIT BREAKER
menyala.
2. Tergantungpadasystemdimanageneratorakandiparalel,periksa
Switch(5191),l'tadaturbine
apakahenginespeedISOCH/DROOP
Switch (5260), di
panel,
ISOCH/DROOP
dan VOLTAGE
control
dalam control console,ditempatkanpada posisi sesuaidengan
di
CHECKOUT
yang diberikanpada PRESTART
instruksi-instruksi
atas.
staft procedure
3. Jalankan(start) enginesesuaidenganappficable
di atas.
padaENGINE
OPERATION
4. 10 detik setelahgeneratorset mencapaikecepatan 90 persen,
IREADYTO LOAD]ditampilkanpadaoperationSummaryDisplay
Screen.
5. Cek tegangantanpa beban dari generator(generatorno-load
voltage) pada ketiga fasanya.Tegangantanpa beban harus
normal.
INmATE Switch (s107).
6. Tekan AUTOMATICSYNCHRONIZE
INflATE Light(DS107)akan
SYNCHRONIZE
IntegralAUTOMATIC
staft dari suatusiklussinkronisasi
menyalauntuk mengindikasikan
cycle).
synchronization
30 detik(the 30-second
generator
paralelisasi
melakukan
7. Individualautomaticsynchronizer
set dengan bus beban, power circuit breaker contactsakan
INffiATE Light (DS107)
SYNCHRONIZE
transfer,dan AUTOMATIC
"on-load."
padampadasaatgeneratormenujupadakeadaan

TrainingConductedby PT.PakartiHandayani-hy

13

9/7/2006

Operation and Maintenance

B. Lakukan operation checkout, dan amati secara berkara


instrumentasi
enginedan generatoruntuk memastikan
bahwa
generator
setberoperasi
dengannormal.
Dalamhal generatorset gagalkoneksike utilitybus,AUToMATIC
SYNCHRONIZE
INffiATE Light (Ds10z)padam,dan SyNCHRONIZE
SEQUENCE
FAIL Light (DS107-1)menyata. untuk mengurangi
sekuensini, tekan kembaliAUTOMATIC
SYNCHRONIZE
INHATE
Switch(5107).
. KVAR/PFController
!(/AR/PF
(2259)mengukur
Controller
komponen
realdanreaktifdari
generator line current. KVAR/PFcontroller membandingkan
komponen-komponen
ini dengan suatu lever teganganacuan
(reference
voltagelevel)dan memproduksi
suatuerrorsignalyang
akan digunakan
oleh VoltageRegulator
(vR260)untuk merubah
tegangangeneratorsampai diperolehreactiveload currentatau
powerfactordipilihsebelumnya.
KVARCONTROL
1. Jalankan
turbinesepertiyangdiuraikan
padastart procedure
di
atas.
2 . Aturenginesampai
diperoleh
ratedvoltage,
danposisikan
KVAR/pF
posisi
coNTRoLswitch (s161) ke AUTO.
Generator
operating
ModeSwitch(5108)ke UTILITY.
3 . Untuk menaikkanatau menurunkan
reactiveload dari suatu
generator,
posisikan
KVAR/PF
CONTROL
Switch(5161)ke MAN.
PosisiKVAR/PF
SELECT
switch(5153) ke KVAR.Atur KVAR/pF
(R159)untukmenaikkan
ADJUST
Potentiometer
ataumenurunkan
outputkilovar.
Reposisi
KVAR/PF
(5161)
Control
Switch
keAUTO.
PFCONTROL
l. Jalankan
turbinesepertiyangdiuraikan
padastart proceour.oi
atas.
4. 2. Atur enginesampaidiperolehratedvoltage,dan posisikan
KVAR/PF
CONTROL
Switch(5161) ke AUTO.posisiGenerator
i
Operating
ModeSwitch(5108)ke UTILITY.

TrainingConductedby PT.PakaftiHandayani-hy

t4

Oneratiort and M aintenance

3. Untuk menaikkanatau menurunkanpower factor dari suatu


generator,posisikanKVAR/PF
CONTROL
Switch(5161) ke MAN.
Posisi KVAR/PFSELECTSwitch (5153) ke PF. Atur lryAR/PF
(R159)untukmenaikkan
ADJUSTPotentiometer
atau menurunkan
powerfactor.ReposisiI(/AR/PFControlSwitch(5161)ke AUTO.

8.1.4 GENERATOR
ELECTRICAL
CHECK
WARNING
Some high voltage devicescan store and maintain-a residualvoltagefor severalhoursafter the unit has been
stopped. A lethal electrical shock can result. Before
workingon or aroundthe equipment,dischargeall high
voltage circuitsby using a heavy insulatedcable and
shoftingeachphaseto ground.

l
8 .1 .4 . 1StaftupCheck
Lakukanpre-operation
staftupcheckpadageneratordenganmemutuskan
powercircuitbreakersataumemutuskan
mainbusdarithe circuitbreaker.
generator,
Hal ini akan mengisolasi
voltageregulator,dan meter-meter
untuk electrical check. setelah startup check selesai dilaksanakan,
shutdownunitdansambungkan
kembalibusdancircuitbreakers.

CAUTION
Ensurethat all loose items such as nuts,
washers, and spare wiring are removed
from the generatorset beforestafting
Jalankan(Stat) engine dengan mengikutiNormal Staft procedure.
harusstabilpada100persen.
Kecepatan
Rated voltage harus disalurkanpada kira-kirakecepatan80 persen.
ADJUSTcontrol.Jika tegangan
Aturtegangan
teftentudenganVOLTAGE
bahwageneratordan voltage
dapatdiaturdan dikontrol,ini menandakan
regulatorbekerjadenganbaik. lika tegangantidak dapat diatur atau
dan cek rangkaianterbuka(opencircuits)ke
dikontrol,unti di-shutdown

TrainingConductedby PT.PakartiHandayani-hy

15

9/7/2006

Operationand Maintenance

voltage regulator. Jika generator gagal membangkitkantegangan,


lakukanpengecekan
berikut:
1.

Teganganeksitasike generator,
termasukrangkaian
PMG.

2.

Lakukan penginderaanterhadap voltage relay dan speed


switch.

3.

Balik polaritaspada ujung-ujungkabel excitervoltageatau


rangkaian
PMG.

4.

Kerusakan
voltageregulator

Padasaat turbinegeneratorset beroperasipada kecepatanengine100


' persen, frequencymeter harus menunjukkanfrekuensiseperti yang
teftera pada generatornameplate.Jika frequenrymeter menunjukkan
frekuensiyangtidaksesuai,ceksambungan-sambungannya.
Note
Frequencymeters are not adjustable.
Sincethe generatoris operatingat a no-loadcondition,a
kW/kVARmeter or an ammeterwill not indicate.If used,
a power factor meter may rotate freely. These meters
can only be checkedor readduring a loadtest
8.1.4.2LoadTest

Dalambanyak
kasus,
diperlukan
untukmencabut
semuabebandandaya
bus sebelummenerapkan
bebanawal generator.
Cek manualnya
dan
electrical
phase
trip circuitsdari semuacircuitbreakernya.
rotation
Cek
generator
sebelum
mengoperasikan
dalamparallel
mode.

WARNING

Never open the circuit to current transformers,


ammeters, or kW/KVAR meter current coils with the
generator in operation. Possible personal injury and
transformer damage could result. If the generator to be
operated with open current circuits, jumper the
secondary terminals of the current transformer.
I
TrainingConductedby PT.PakaftiHandayani-hy

16

Operation and Maintenance

Pada saat dihubungkanke resistiveload banks atau buildingloads


power),sejumlahkecilbebanharusditerapkan
(terisollasi
daricommercial
meterdan ammeter.Powerfactormeterakan
watts-vars
mengecek
untuk
1.0 karenatidakada inductivecurrent.Padabebanrendah,
menunjukkan
meter tidak menunjukkan apa-apa atau penunjukkannyaakan
(sluggish).
lemah/ngaco

rumuswatts-varsdapatdiperiksadenganmenggunakan
Pengukuran
rumusberikut:
1.

kW = Volts x Amps x PowerFactorx 1.73


1000

2.

k V A =V o lt s x A m o s x 1 . 7 3
1000

polaritasdari
cek sambungan
Jika watts-varsmetergagalmenunjukkan,
(potential
(current
trafo
tegangan
transformer)
dan
trafo arus
transformer).

Rotation
8.1.4.3Phase
phase
paralel,
secara
duaataulebihgenerator
mengoperasikan
Sebelum
phaserotation
rotationpadasetiapunitharussama.Metodapengecekan
(Gambar
9-1).
untukdilakukan
berikutinidirekomendasikan

TrainingConductedby PT.PpkartiHandayani-hy

L7

9/7/2006

Operation and Maintenance

ClRCUIT
BREAI(ERA

A
GEI{ERATOR

GambarB-1. PhaseCheckDiagram
1

2.

BukacircuitbreakerA, B, dan C untukmengisolasi


generatorgeneratortersebutdan busgunaphasecheck.
Hubungkanphase meter ke bus, baik secara langsung
maupun melalui potential transformer,tergantung pada
phasemeterselamaphase
tegangan.Janganmemindahkan
checkberlangsung.

3.

Tutup circuit breakerC dan amati phase meter indicationBukacircuitbreakerC.

4.

lalankanenginemengikuti
NormalStartProcedure.

5.

yang beroperasipada rated


Dengan generator-generator
speednya,atur frekuensidan tegangantanpa bebanyang
ditentukan(specifiedno-loadfrequencyand voltage)pada
unit-unityangdicek.

o.

Tutup CircuitbreakerA dan amati phasemeter indication.


Buka circuit breakerA. Tutup circuitbreakerB dan amati
phasemeter indication.BukacircuitbeakerB. Semuaphase
meterindication
harussama.Jikaada indikasi
yangberbeda,
cek danperbaiki
wiringnya.
Ulangiphasecheck.

7.

Jika pengecekan
telah selesai,shutdownunit-unittersebut
denganmengikutiNormalShutdownProcedures.

TrainingCondudedby PT.PakartiHandayani-hy

OperationandMaintenance

8.2

MAINTENANCE
SCHEDULE
pada generatordibutuhkanpada
Inspeksidan scheduledmaintenance
yang
interval-interval
telah ditetapkan. Banyaknya Scheduled
padajam operasiperalatanper tahundan dibagi
maintenance
didasarkan
ke dafamtiga (3) kategori:Operational,
Intermediate,
dan Major.Untuk
operationalmaintenance,
equipmenttidak perludi-shutdownsedangkan
untuk intermediatedan major maintenance,equipment harus dishutdown.
Operational maintenance berupa walkaround inspection untuk
memastikanbahwa equipmentberfungsisebagaimanamestinyadan
mendeteksi
tanda-tanda
awalpenurunan
unjukkerja.
protective
Intermediatemaintenance
lebihditekankanpada pengecekan
enginegenerator
systems,
cleaning,
dan memastikan
optimumequipment
peformance.
Major maintenancemeliputi pembongkaran
(disassembly)
komponenkomponensubsystem
teftentuuntukdiperiksa,
dan visualinspection
dari
jalur
komponen-komponen gaspadaenginedenganperalatanborescope.

8.2.1 OperationalMaintenance
yangtanpapengawasan,
Padapemasangan
continuous
operation,
atau
jarak
jauh,
procedures
,yangdioperasikan
secara
operational
inspection
trdakperludilakukan
setiaphari.Akantetapi,direkomendasikan
untuk
praktis.
dilakukan
secara
8.2.2 IntermediateMaintenance
pada
Intermediate
maintenance
memerlukan
equipment
di-shutdown
jam operasiper
Dengantanpa
sebagian
besarinspeksi.
memperhatikan
tahun,direkomendasikan
bahwaintermediate
maintenancedilakukan
setiap6 bulanoperasi.
Maintenance
interuals
untuksubsequent
operation
padapengallaman
harusdibuatyangberdasarkan
selama
tahunpertama,
berkenaan
dengankemungkinan
operating
conditions
menghasilkan
lain
praktir
lebih
danintervalnya

{raining Conductedby PT.PakartiHandayani-hy

19

9/7/2006

Operation and Maintenance

8.2.3 MajorMaintenance
Majormaintenance
harusdilakukandenganinterval 8000jam operasi.
Akan tetapi, operatingconditionsakan menghasilakan
interval untuk
melakukan
inspeKidanpemeliharaan
secaralebihpraktis.
Elemen-elemen
yangsudahtidak berfungsiatau rusakpada masalalut,
dan semua penyimpangan
lain yang telah diketahuipada inspeksi
sebelumnya
perhatianyang lebihbaikdengantanpa
harusmendapatkan
memperhitungkan
apakahsudah termasukdalam daftar tugas-tugas
pemeliharaan
(listof maintenance
tasks)ataubelum.
Penimpanan
catatanrinci merupakanhal yang sangat pentingdan
bermanfaat
sebagaisuatuperangkatpendeteksian
kerusakan
komponen,
pinpointing
malfunctions
untuksuatukomponen
tertentu,dan mendetekst
zuatu malfunctionsebelumhal tersebutberkembangpada tahap yang
padaunjukkerja.
berdampak
8.2.4

Scheduled
Performance
Tasks
Table 9.1 di bawah ini memuat scheduredperformancetasks yang
diperlukan.
Tabeltersebutditabulasi
sebagaiberikut:
Column

Peralatan(Equipment)

Kolom ini berisi assembly-assembly


yang membutuhkanpemeliharaan
(periodic
berkala
maintenance)

Column 2

Interuals

Kolomini berisisemuatindakan/kegiatan
yang
scheduled
maintenance
padaequipment
terdapat
manual.
Simbol-simbol
berikut
harusdigunakac:
Interual

Svmbol

Operational
Intermediate
Major
Column

O
I
M

Tindakan(Action)

Kolomini memuattindakanpemeliharaan
yangharusdilakukan.

Traiflng Conduct& by PT.PakartiHandayani-hy

20

e/7/2006

Operatiortand Maintenance

TABLE8.1.

SCHEDULED
PERFORMANCE
TASKS
interuals

Equipment

Action

O IM
GENERATOR
SET

BeforeShutdown

AfterShutdown

Check entire installation for abnormal


operating
conditions

Checkfor discoloration,
cracks,chafingof
wires and lines, oil leaks, air leaks, and
unusualnoisesandvibrations.

Checkfor any loosemechanical


fasteners.

Recordenginesystemspeformance.

Checkpipingarrangement
and vei.ifythat all
pipingand ductingsupports,fasteners,and
hardwareare secure.

Maintain highest possible standardsof


cleanlinessj

Record engine and system performance


figures and compareresultswith previous
analysis.

Performengine,accessorydrive, and driven


equipment
vibration
analysis.

Performborescope
inspection.

Checkentirepackageexternally

TrainingConductedby PT.PakaftiHandayani-hy

2I

9/7/2006

OperationandMaintenance

TABLE8.1. SCHEDULED
PERFORMANCE
TASKS
Equipment

Intervals
O IM

TURBINE

Action

Check exterior of engine air intake and


exhaust duct, and transition pieces for
damage.

Checkair inlet filters for obstructionsand


signsof contamination.

Checkenginecompressor
as required

Cleanor replaceair filtersas necessary.

Inspectthermocouple
harnessfor breakage
and generalcondition.

Inspectengineintakeand exhaustducting,
engine intake screen and all transition
pieces.

At startup, record engine and system


performance.
Disassembleand check engine-to-driven
equipmentinterconnect
shaftsand splines.
Xlnspectand clean engineXombustorbleed
valve.
Check engine combustor bleed valve
operation.
Checkoperationand conditionof variable
vanes mechanicallinkage and actuator
assemblies.

X Check conditionof vibration protection


system, monitor, probes, and velocity
transducer

Training&nducted by PT.PakartiHandayani-hy

22

9/7/2C06

OperationarrdMahttenance

TABLE8,1. SCHEDULED
PERFORMANCE
TASKS
Equipment

Interuals
OIM

TURBINE,
CONT.
X
STARTSYSTEM

FUELSYSTEM

LUBEOILSYSTEM

Action

Cfeanand inspectmagneticspeedpickup.

Inspectall pressuregagesfor leaks.

Clean strainers in supply lines to start


system.

Checksstart systemand associatedwiring


and controls.

Checkfuel supplypressure.

Cleanstrainersin supplylinesto fue-[system.

Removeand inspectfuel injectors.

Inspectfuel systemcomponents
for proper
operation.
I
Removeand inspecttorch assemblyand
ignitorplug.

Removeand inspectgas fuel controlvalve


screenfilter.

Checkthrottlevalvelinkagerigging.

Check all pressuresgaugeson skid gage


panel.

Checklubeoil flow glassto ensurelubeoil is


flowing.

Checkoil filter operation.Replaceelements


as required.

If
Checkslube oil for possibledegradation.
possible,
a lube oil sampleshouldbe taken
oncea monthfor laboratory
analysis.

TrainingConductMby pT. PakartiHandayani-hy

23

e/7/2006

Operation andMaintenance

PERFORMANCE
TASKS
TIBLF 8.1. SCHEDULED

Eqqippent

Intervals
O IM

CONSOLE X
0ONTROL

Action

Checkcontrol consoleelectricalconnections
for securify.

Test and calibratealarm, malfunction,and


shutdownsystems.
Inspect junction boxes for good material
conditionand signsof condensation.
Perform a check of malfunction and
protectionsystemto ensuresignalcontinuity
(andsignalloss)at selectedset points.

BATTERIES

Checkelectrolytelevel of batteriesusedas
dc controlpowersource.
Performcontrolpower and ancillarypower
batterysystemloadtest. Checkbatteriesand
chargersfor operation.

TrainingConductedby PT.PakaftiHandayani-hy

24

9/7/2006