Anda di halaman 1dari 25

Jawab dengan singkat dan jelas dari soal-soal berikut :

1. Apa perbedaan secara klinis antara Plasenta Praevia dengan Solustio Plasenta.
2. Seorang wanita umur 24 tahun, Primigravida hamil 37 minggu, dikirim dari PKM dengan keterangan
riwayat kejang-kejang di rumah 2x. Hasil pemeriksaan di RS ; BB 74 Kg, TB 155 Cm, T 160/110 mmHg,
N 100 x/menit, R 40 /menit, Temp 38C, kesadaran koma, odem anasarka. DJJ + 160 x/menit regular, His -,
TBJ 2700 gr dan hasil VT belum ada pembukaan, kepala belum masuk panggul.
a. Apa diagnose saudara?
b. Bagaimana planningnya?
c. Kapan harus diakhiri kehamilannya?
3. Hemoragik Post Partum (HPP).
a. Apa definisi HPP?
b. Factor resiko HPP antepartum?
c. Penaganan HPP karena Atonia Uteri?
1.
2.
3.
4.

Keriteria Diagnosis dan Derajad PID?


Etiologi KPD dan tatalaksana KPD pada kehamilan premature?
Penatalaksanaan gangguan haid pada wanita post pemasangan implant?
Pengobatan DUB yang rasional?

1.

a. Jelaskan gejala klinis (keluhan dan pemeriksaan obstetric) dan pemeriksaan penunjang antara Solutio
Placenta dan Placenta Praevia?
b. Bagaimana penatalaksanaan APB (Ante Partum Bleeding) dan bagaimana sikap terhadap
kehamilannya?
a. Jelaskan definisi oligomenore, menorrhagia, polimenore, metrorhagia dan amenore sekunder?
b. Bagaimana penatalaksanaan DUB (Disfungsi Uteri Bleeding)

2.

Soal 1
Saudara sebagai dokter Puskesmas di pulau terpencil, 30 jam dengan kapal laut untuk mencapai rumah
sakit rujukan. Ny. S, usia 24 tahun dengan tinggi badan 140 cm, hamil kedua, umur kehamilan 3 bulan.
Tahun 2000, kehamilan pertama usia 19 tahun mengalami persalinan macet, bayi lahir mati intra natal, dan
dilakukan embriotomi oleh dokter Puskesmas.
Tahun 2006, hamil yang kedua ini dengan bayi yang sangat didambakan dan memiliki nilai sosial yang sangat
tinggi bagi ibu hamil dan keluarga.
Tensi 110/70, nadi 96 x/m, Hb 8 gr%.
Pertanyaan :
1. Sebutkan faktor risiko (FR) dan jumlah skor serta kelompok risiko pada kehamilan pertama!
2. Sebutkan faktor risiko dan jumlah skor dan kelompok risiko pada kehamilan kedua!
3. Apa yang saudara lakukan selama kehamilan?
4. Apa yang saudara lakukan menjelang persalinan, dalam upaya menyelamatkan ibu dan bayi baru lahir?
5. Isilah kartu skor berdasar data penderita waktu hamil kedua!
Soal 3
A. Sebutkan definisi abortus!
B. Sebutkan macam-macam abortus spontan menurut gejala klinisnya dan beri keterangan!
- .....................................
- .....................................
- ....................................
- ....................................
C. Mana diantara yang tersebut diatas (B) yang masih dapat dipertahankan?
D. Bagaimana penatalaksanaan masing-masing macam abortus diatas?
Soal 4
1. Alat kontrasepsi / KB apa yang tampak dalam gambar?

2. Bagaimana mekanisme kerjanya?


3.

Apabila kontrasepsi tersebut diberikan pada tanggal 29 juni


2006, kapan akseptor diminta datang kembali untuk melanjutkan KBnya? Apa alasannya?

4.

Sebutkan efek samping alat kontarsepsi tersebut!

Soal 5
Seorang wanita usia 17 tahun, datang ke praktek saudara dengan keluhan perdarahan haid selama 3
minggu. Perdarahan kadang banyak kadang sedikit, dan keadaan ini telah berlangsung sejak 3 bulan yang lalu
(3 siklus haid), sehingga badan terasa lemah. Riwayat haid sebelumnya teratur, siklus 30 hari, lama haid 6 hari,
nyeri haid (-)
Pemeriksaan fisik :
TD : 100/ 70 N: 100x/m, konjungtive: anemis (+), C/P : dbn, Abd : supel, mass (-)
RT : v/v : fluksus (+), hymen utuh
P : licin, kenyal
CU : AF ~ ukuran normal
AP : D et S : mass (-), nyeri (-)
Pertanyaan:
1. Apa diagnosis / diagnosis banding saudara?
-.Perdarahan Obstetrik d.........................................................................................................
-.........................................................................................................
2. Data penunjang apa lagi yang dibutuhkan? Sebutkan mengapa diperlukan?
-.....PP test...................................................................................................
-........................................................................................................
3. Apa tindakan yang segera saudara lakukan?
- .........................................................................................................
- .........................................................................................................
4. Apa rencana terapi selanjutnya?
Soal 6
A. Sebutkan 3 jenis letak sungsang berdasar VT dan berikan penjelasan!
a. ................................artinya.........................
b. ................................artinya........................
c. ................................artinya........................
B. Sebutkan 3 teknik pertolongan persalinan sungsang pervaginam dan beri penjelasan!
a. ................................artinya...........................
b. ................................artinya..........................
c. ................................artinya..........................
C. Dari jenis letak sungsang pada nomer A, manakah yang prognosisnya palaing buruk untik persalinan
pervaginam? Berikan satu alasan!
D. Dari jenis teknik persalinan letak sungsang pervaginam pada nomer B, manakah yang prognosisnya
paling buruk? Berikan satu alasan!
E. Dari jenis letak sungsang nomer A, manakah yang harus dilakukan seksio sesaria bila pembukaan masih
4 cm?
Soal 7
Seorang ibu umur 40 tahun, P6-6 kiriman bidan paska persalinan 3 jam yang lalu.
Bayi aterm lahir spontan dan hidup. Ibu ini mengalami perdarahan pervaginam yang tidak berhenti, sehingga
dirujuk ke kamar bersalin rumah sakit kelas A dimana saudara bekerja. Keadaan umum lemah, tensi 90/60, nadi
128 x/m, respirasi 28 x/m, Hb 5 gr%.
Pertanyaan :
A. Sebutkan diagnosis klinik saudara!

B. Apa kemungkinan faktor penyebab keadaan tersebut?


a. ....................................
b. ...................................
c. ...................................
C. Dari data-data diatas dalam eksplorasi, faktor penyebab yang terutama dipikirkan adalah?
D. Sebagai terapi, apa saja yang dilakukan di kamar bersalin?
a. ............................................
b. ...........................................
c. ..........................................
d. ..........................................
E. Bila ternyata perdarahan tidak berhenti dngan terapi di atas, maka dilakukan tindakan?
a. ................................(dilakukan di kamar bersalin sebagai terapi sementara)
b. ................................(dilakukan di kamar operasi sebagai terapi definitif)

1. Anda seorang dokter yang bertugas di Puskesmas. Seorang wanita, 20 tahun, belum menikah, mengeluh
nyeri perut mendadak disertai perdarahan flek-flek pervaginam, HPHT : 24-8-2014, Riwayat keputihan
lama, Riwayat coitus multipartner.
Pada pemeriksaan fisik didapatkan :
KU lemah, T: 80/50 mmHg, N : 120x/mnt, R : 32x/mnt, anemis,
Abdomen : nyeri tekan(+), cairan bebas (+) ;
Inspekulo : fluxus (+) dari OUI, Portio livide, tampak Cavum Douglas menonjol
VT : Portio tidak ada pembukaan, nyeri goyang portio (+), Ukuran uterus normal, nyeri tekan adneksa
kanan.
a. Diagnosa? KET + Syok hipovolemik
b. Apakah ada pemeriksaan lainnya yang bisa dikerjakan pada pasien ini di puskesmas? Kuldosintesis
c. Tatalaksana?
Posisi tredelenburg
2. a. Sebutkan 3 indikasi absolut SC ! Panggul sempit absolut, Tumor Jalan lahir,
b.Bila anda tugas di puskesmas dan menemukan salah satu kasus dengan indikasi absolute SC
dimakondisi pasien baik, pada umur kehamilan berapa sebaiknya dilakukan SC? Mengapa?
38 minggu, bayi sudah aterm, sebelum terjadi inpartu (kontraksi)
Jawab dengan singkat dan jelas dari soal berikut :
1. a. Terangkan tentang penyebab HPP?
b. Jelaskan penanganan HPP karena Atonia Uteri?
2. a. Jelaskan apa yang di maksud dengan AKI & AKP?
b. Penyebab kematian ibu & bayi?
c. Berapa target AKI & AKP pada MDGs 2015?
3. KASUS
Wanita 37 thn, G1P0A0, Hamil aterm, lama kawin sdh 10 thn, Janin tunggal Pres Kep, dengan kepala sudah
masuk panggul. TBJ 3000 gr, DJJ normal, HIS belum ada, VS : T 180/120 mmHg, N 90 x/mnt, R 20 x/mnt,
Temp 36,8 c, TB 150 cm, BB 79 Kg. Odem tungkai ++,
a. Apa penyebabnya?
b. Bagaimana prinsip penanganan pada kasus ini?
1.
2.
3.
4.
5.

Bagaimana Pengobatan kondidiasis Vulva Vagina?


Kontrasepsi darurat yang sering digunakan, apa saja?
Bagaimana penatalaksanaan Hyperemisis Gravidarum?
Bagaimana penatalaksanaan DUB?
Bagaimana penatalaksanaan Mola Hidatidosa?

Jawab dengan singkat dan jelas dari soal berikut :

4. a. Terangkan tentang penyebab HPP?


b. Jelaskan penanganan HPP karena Atonia Uteri?
5. a. Jelaskan apa yang di maksud dengan AKI & AKP?
b. Penyebab kematian ibu & bayi?
c. Berapa target AKI & AKP pada MDGs 2015?
6. KASUS
Wanita 37 thn, G1P0A0, Hamil aterm, lama kawin sdh 10 thn, Janin tunggal Pres Kep, dengan kepala sudah
masuk panggul. TBJ 3000 gr, DJJ normal, HIS belum ada, VS : T 180/120 mmHg, N 90 x/mnt, R 20 x/mnt,
Temp 36,8 c, TB 150 cm, BB 79 Kg. Odem tungkai ++,
c. Apa penyebabnya?
d. Bagaimana prinsip penanganan pada kasus ini?
6.
7.
8.
9.

Terapi apa saja yang digunakan pada disfungsional uteri bleeding? Jelaskan dan terangkan kegunaanya!
Mengapa pada kasus anovulatory perdarahan banyak?
Minimal ada 6 langkah yang harus dijawab pada kehamilan dengan kelainan atau penyakit pada ibu, apa itu?
Kriteria Diagnosis dan Derajad PID ?

Jawab dengan singkat dan jelas!


1. a. Apa prinsip dasar gawat-darurat Osbtetri?
b. Sebutkan 4 penyebab utama kematian ibu, janin dan bayi baru lahir ?
c. Bagaimana penanganan Atonia Uteri?
2. a. Apa syarat dan indikasi induksi?
b. Bagaimana prosedur induksi ?
c. Apa efek samping dan komplikasinya dan bagaimana penanganannya?
1. Terapi apa yang digunakan pada dysfungsional uterin bleeding? Jelaskan dan terangkan kegunaannya!
2. Mengapa pada kasus anovulatory perdarahan banyak?
3. Minimal ada 6 langkah yang harus dijawab pada kehamilan dengan kelainan atau penyakit pada ibu, apa
itu?
4. Kriteria diagnosis dan derajad PID?
Jawabdengansingkatdanjelasdarisoal-soalberikut :
1. ApaperbedaansecaraklinisantaraPlasenta Praevia denganSolutioPlasenta?
2. Seorangwanitaumur 24 thn, primagravidahamil 37 mgg, di kirimoleh PKM denganketeranganriwayatkejankejang di rumah 4 kali. Hasilpemeriksaan di RS : BB 74 Kg, TB 155 Cm, T 160/110 mmHg, N 100 x/mnt, R
40 /mnt. Temp 38 c,kesadarankoma, odemanasarka. DJJ + 160 x/mnt regular, HIS - , TBJ 2700 gr danhasil
VT belumadapembukaan, kepalabelummasukpanggul.
a. Apa diagnose sodara?
b. Bagaimanaplanningnya?
c. Kapan harusdiakhirikehamilannya?
3. HemoragikPost Partum (HPP).
a. Apadefinisi HPP?
b. Faktorrisiko HPP antepartum?
c. Penanganan HPP karenaatonia uteri?
1.
2.
3.
4.
5.

KlasifikasiChorio CA prognosis baikdan prognosis jelek?


PenatalaksanaanMolaHidatidosa?
KriteriaMolaHidatidosaberubahkeganas / Chorio CA?
Penatalaksanaan AUB?
PembagianAdnexitis?

1. Seorangwanita GIV P5-5 usiakehamilan 8 mggmengeluhkeluardarahdannyeriperut.


a. Jelaskankemungkinan diagnose penderitadanpemeriksaanklinis/penunjang yang mwndukung diagnose?
b. Seandainyadidapatkantinggi
fundus
uteri
lebihbesardariusiakehamilandanmerasamengeluarkanjaringansepertigelembung,
bagaimanapenatalaksanaandan follow up pasien?

2. a.
b.

Jelaskandefinisioligominore,
polimenore,
menorhagea,
metrorhagea,
danamenoresekunder?
Bagaimanapenatalaksanaanpenderitadengan Abnormal Uteri Bleeding?

amenore

primer

Soal Ujian OSCE dr. Endang Maruf R., tanggal 06 Juni 2014
Jawab dengan singkat dan jelas dari soal berikut :
7. a. Terangkan tentang penyebab HPP?
b. Jelaskan penanganan HPP karena Atonia Uteri?
8. a. Jelaskan apa yang di maksud dengan AKI & AKP?
b. Penyebab kematian ibu & bayi?
c. Berapa target AKI & AKP pada MDGs 2015?
9. KASUS
Wanita 37 thn, G1P0A0, Hamil aterm, lama kawin sdh 10 thn, Janin tunggal Pres Kep, dengan kepala sudah
masuk panggul. TBJ 3000 gr, DJJ normal, HIS belum ada, VS : T 180/120 mmHg, N 90 x/mnt, R 20 x/mnt,
Temp 36,8 c, TB 150 cm, BB 79 Kg. Odem tungkai ++,
e. Apa penyebabnya?
f. Bagaimana prinsip penanganan pada kasus ini?
Soal Ujian OSCE dr. Gogot S., tanggal 06 Juni 2014
10.
11.
12.
itu?
13.

Terapi apa saja yang digunakan pada disfungsional uteri bleeding? Jelaskan dan terangkan kegunaanya!
Mengapa pada kasus anovulatory perdarahan banyak?
Minimal ada 6 langkah yang harus dijawab pada kehamilan dengan kelainan atau penyakit pada ibu, apa
Kriteria Diagnosis dan Derajad PID ?

Soal Ujian OSCE dr. Dita Diana Parti, tanggal 06 Juni 2014
1. a. Jelaskan diagnosis Abortus, Kehamilan Ektopik dan Mola Hidatidosa (dari anamnesa, pemeriksaan dan
pemeriksaan penunjang)
b. Jelaskan penatalaksaan Abortus, Kehamilan Ektopik dan Mola Hidatidosa?
2. a. Jelaskan penyebab HPP?
b. Jelaskan langkah-langkah penatalaksaan HPP (Pendarahan Pasca Persalinan)
Soal Ujian OSCE dr. Endang Maruf R., tanggal 06 Juni 2014
Jawab dengan singkat dan jelas dari soal berikut :
1. a. Terangkan tentang penyebab HPP?
b. Jelaskan penanganan HPP karena Atonia Uteri?
2. a. Jelaskan apa yang di maksud dengan AKI & AKP?
b. Penyebab kematian ibu & bayi?
c. Berapa target AKI & AKP pada MDGs 2015?
3. KASUS
Wanita 37 thn, G1P0A0, Hamil aterm, lama kawin sdh 10 thn, Janin tunggal Pres Kep, dengan kepala sudah
masuk panggul. TBJ 3000 gr, DJJ normal, HIS belum ada, VS : T 180/120 mmHg, N 90 x/mnt, R 20 x/mnt,
Temp 36,8 c, TB 150 cm, BB 79 Kg. Odem tungkai ++,
a. Apa penyebabnya?
b. Bagaimana prinsip penanganan pada kasus ini?
Soal Ujian OSCE dr. Gogot S., tanggal 06 Juni 2014
1.
2.
3.
4.

Terapi apa saja yang digunakan pada disfungsional uteri bleeding? Jelaskan dan terangkan kegunaanya!
Mengapa pada kasus anovulatory perdarahan banyak?
Minimal ada 6 langkah yang harus dijawab pada kehamilan dengan kelainan atau penyakit pada ibu, apa itu?
Kriteria Diagnosis dan Derajad PID ?

Soal Ujian OSCE dr. Dita Diana Parti, tanggal 06 Juni 2014
1. a. Jelaskan diagnosis Abortus, Kehamilan Ektopik dan Mola Hidatidosa (dari anamnesa, pemeriksaan dan
pemeriksaan penunjang)
b..Jelaskan penatalaksaan Abortus, Kehamilan Ektopik dan Mola Hidatidosa?
2. a. Jelaskan penyebab HPP?
c. Jelaskan langkah-langkah penatalaksaan HPP (Pendarahan Pasca Persalinan)
Soal Ujian OSCE dr. Endang Maruf R., tanggal 22 Agustus 2014
Jawab dengan singkat dan jelas dari soal berikut :
10.
a. Terangkan tentang penyebab HPP?
b. Jelaskan penanganan HPP karena Atonia Uteri?
11.
a. Jelaskan apa yang di maksud dengan AKI & AKP?
b. Penyebab kematian ibu & bayi?
c. Berapa target AKI & AKP pada MDGs 2015?
12.
KASUS
Wanita 37 thn, G1P0A0, Hamil aterm, lama kawin sdh 10 thn, Janin tunggal Pres Kep, dengan kepala sudah
masuk panggul. TBJ 3000 gr, DJJ normal, HIS belum ada, VS : T 180/120 mmHg, N 90 x/mnt, R 20 x/mnt,
Temp 36,8 c, TB 150 cm, BB 79 Kg. Odem tungkai ++,
g. Apa penyebabnya?
h. Bagaimana prinsip penanganan pada kasus ini?
Soal Ujian OSCE dr. Gogot S., tanggal 22 Agustus 2014
14.
Bagaimana Pengobatan kondidiasis Vulva Vagina?
15.
Kontrasepsi darurat yang sering digunakan, apa saja?
16.
Bagaimana penatalaksanaan Hyperemisis Gravidarum?
17.
Bagaimana penatalaksanaan DUB?
18.
Bagaimana penatalaksanaan Mola Hidatidosa?
Soal Ujian OSCE dr. Dita Diana Parti, tanggal 22 Agustus 2014
3. Seorang wanita usia 30 th G2P1A0 hamil 35 36 minggu datang dengan keluhan partus tak maju sudah
sehari. Saat dilakukan pemeriksaan fisik didapatkan TFU 37 cm, punggung janin di sebelah kanan ibu,
bagian terbawah janin kepala, kepala sudah masuk panggung, bagian perlimaan 2/5, kepala turun hodge III ,
pembukaan 10 cm, DJJ 140 x/menit, his 3 4 kali dalam 10 menit 35 40 detik, panggul tidak sempit, kulit
ketuban masih utuh.
a. Diagnosa yang tepat untuk pasien?
c. Apakah tindakan yang tepat untuk pasien?
4. Seorang wanita 25 tahun berparas cantik datang dengan keluhan nyeri perut selama berbulan-bulan. pada
pemeriksaan fisik didapatkan massa pada adneksa kanan. Hasil USG didapatkan massa ovarium 9 cm dan
tampak berisi seperti rambut.
a. Apa diagnose pasien ini?
b. Apakah tindakan yang tepat (jelaskan alasannya dan resiko akibat tindakan)

Soal Ujian OSCE dr. Endang Maruf R., tanggal 22 Agustus 2014
Jawab dengan singkat dan jelas dari soal berikut :
13.
a. Terangkan tentang penyebab HPP?
b. Jelaskan penanganan HPP karena Atonia Uteri?
14.
a. Jelaskan apa yang di maksud dengan AKI & AKP?
b. Penyebab kematian ibu & bayi?
c. Berapa target AKI & AKP pada MDGs 2015?
15.
KASUS

Wanita 37 thn, G1P0A0, Hamil aterm, lama kawin sdh 10 thn, Janin tunggal Pres Kep, dengan kepala sudah
masuk panggul. TBJ 3000 gr, DJJ normal, HIS belum ada, VS : T 180/120 mmHg, N 90 x/mnt, R 20 x/mnt,
Temp 36,8 c, TB 150 cm, BB 79 Kg. Odem tungkai ++,
i. Apa penyebabnya?
j. Bagaimana prinsip penanganan pada kasus ini?
Soal Ujian OSCE dr. Gogot S., tanggal 22 Agustus 2014
19.
Bagaimana Pengobatan kondidiasis Vulva Vagina?
20.
Kontrasepsi darurat yang sering digunakan, apa saja?
21.
Bagaimana penatalaksanaan Hyperemisis Gravidarum?
22.
Bagaimana penatalaksanaan DUB?
23.
Bagaimana penatalaksanaan Mola Hidatidosa?
Soal Ujian OSCE dr. Dita Diana Parti, tanggal 22 Agustus 2014
5. Seorang wanita usia 30 th G2P1A0 hamil 35 36 minggu datang dengan keluhan partus tak maju sudah
sehari. Saat dilakukan pemeriksaan fisik didapatkan TFU 37 cm, punggung janin di sebelah kanan ibu,
bagian terbawah janin kepala, kepala sudah masuk panggung, bagian perlimaan 2/5, kepala turun hodge III ,
pembukaan 10 cm, DJJ 140 x/menit, his 3 4 kali dalam 10 menit 35 40 detik, panggul tidak sempit, kulit
ketuban masih utuh.
a. Diagnosa yang tepat untuk pasien?
d. Apakah tindakan yang tepat untuk pasien?
6. Seorang wanita 25 tahun berparas cantik datang dengan keluhan nyeri perut selama berbulan-bulan. pada
pemeriksaan fisik didapatkan massa pada adneksa kanan. Hasil USG didapatkan massa ovarium 9 cm dan
tampak berisi seperti rambut.
a. Apa diagnose pasien ini?
b. Apakah tindakan yang tepat (jelaskan alasannya dan resiko akibat tindakan)

SOAL dr. Endang ,Sp.OG


2. a. Jelaskan apa yang dimaksud AKI an AKP?
KEMATIAN IBU : Menurut ICD 10 didefinisikan sebagai Kematian seorang wanita yangterjadi saat hamil
atau dalam 42 hari setelah akhir kehamilannya, tanpa melihat usia dan letak kehamilannya, yang diakibatkan
oleh sebab apapun yang terkait dengan atau diperburuk oleh kehamilannya atau penanganannya, tetapi bukan
disebabkan oleh insiden dan kecelakaan
Angka Kematian Ibu (AKI) adalah banyaknya kematian perempuan pada saat hamil atau selama 42 hari sejak
terminasi kehamilan tanpa memandang lama dan tempat persalinan, yang disebabkan karena kehamilannya atau
pengelolaannya, dan bukan karena sebab-sebab lain, per 100.000 kelahiran hidup.
Kematian perinatal adalah kematian dalam masa kehamilan 28 minggu sampai bayi lahir dan berusia 7
hari. Kematian perinatal ditentukan dengan menghitung jumlah kematian masa perinatal tersebut di bagi
dengan jumlah bayi lahir hidup dan lahir mati.
Angka Kematian Perinatal (AKP) adalah jumlah kematian perinatal dikalikan 1000 dan kemudian
dibagi dengan jumlah bayi lahir hidup dan lahir mati pada tahun yang sama

Wiknjosastro (2005) menyatakan bahwa untuk dapat memahami kematian perinatal maka ada definisi-definisi
yang lazim dipakai seperti kelahiran hidup, kematian janin, kelahiran mati, kematian perinatal
dini dan kematian perinatal.

Kelahiran hidup (live birth) adalah keluarnya hasil konsepsi secara sempurna dari ibunya tanpa
memandang lamanya kehamilan dan sesudah terpisah dari ibunya bernafas atau menunjukkan tandatanda kehidupan seperti denyutan tali pusat atau pergerakan otot, tidak peduli apakah tali pusat telah
dipotong atau belum.

Kematian janin (foetal death) adalah kematian hasil konsepsi sebelum dikeluarkan dengan sempurna
dari ibunya tanpa memandang tuanya kehamilan. Kematian dinilai dengan fakta bahwa sesudah
dipisahkan dari ibunya janin tidak bernafas atau menunjukkan tanda-tanda kehidupan seperti denyut
jantung, atau palsasi tali pusat atau kontraksi otot.

Kelahiran mati (stillbirth) ialah kelahiran hasil konsepsi dalam keadaan mati yang telah mencapai
umur kehamilan 28 minggu (atau berat badan lahir lebih atau sama dengan 1000 gram).

Kematian perinatal dini (early neonatal death) ialah kematian bayi dalam 7 hari pertama
kehidupannya. Sedangkan kematian perinatal (perinatal mortality) ialah bayi lahir mati dan kematian
bayi dalam 7 hari pertama sesudah lahir.

Angka Kematian Perinatal (AKP) adalah jumlah kematian perinatal dikalikan 1000 dan kemudian
dibagi dengan jumlah bayi lahir hidup dan lahir mati pada tahun yang sama AKP = jumlah kematian
perinatal x 1000 Jumlah lahir mati + jumlah lahir hidup

b. Penyebab kematian ibu dan bayi ?


IBU
Penyebab langsung kematian ibu
Secara global, lima penyebab utama kematian ibu adalah perdarahan, hipertensi dalam kehamilan (HDK),
infeksi, partus lama/macet dan abortus. Kematian ibu di Indonesia tetap didominasi oleh tiga penyebab utama
kematian yaitu perdarahan, hipertensi dalam kehamilan (HDK) dan infeksi. Proporsi ketiga penyebab
kematian ini telah berubah, dimana perdarahan dan infeksi semakin menurun sedangkan HDK dalam kehamilan
proporsinya semakin meningkat, hampir 30 % kematian ibu di Indonesia pada tahun 2011 disebabkan oleh
HDK .
Penyebab tidak langsung (indirek) kematian ibu
Definisi kematian ibu mengindikasikan bahwa kematian ibu tidak hanya mencakup kematian yang disebabkan
oleh persalinan tetapi mencakup kematian yang disebabkan oleh penyebab non-obstetri. Sebagai contoh adalah
ibu hamil yang meninggal akibat penyakit Tuberkulosis, Anemia, Malaria, Penyakit Jantung, dll. Penyakitpenyakit tersebut dianggap dapat memperberat kehamilan meningkatkan resiko terjadinya kesakitan dan
kematian.

BAYI
BBLR, Prematuritas, kelainan kingenital, dan asfiksia, infeksi neonatal
c. Berapa target AKI dan AKP pada MDGs 2015?
Target Millenium Development Goals (MDGs) 2015, yakni menurunkan angka kematian ibu (AKI) menjadi
102 per 100.000 kelahiran hidup, dan angka kematian bayi (AKB) menjadi 23 per 100.000 kelahiran hidup
yang harus dicapai.

SOAL dr. Kadek, Sp.OG


1. Sebutkan definisi Abortus?
Abortus adalah berakhirnya kehamilan melalui cara apapun sebelum janin mampu bertahan hidup pada usia
kehamilan sebelum 20 minggu didasarkan pada tanggal hari pertama haid normal terakhir atau berat janin
kurang dari 500 gram ( Obstetri Williams, 2006).
2. Ada berapa macam abortus menurut cara terjadinya?
Menurut terjadinya dibedakan atas:
1. Abortus spontan yaitu abortus yang terjadi dengan sendirinya tanpa disengaja atau dengan tidak didahului
faktor-faktor mekanis atau medisinalis, semata mata disebabkan oleh faktor-faktor alamiah.
2. Abortus provokatus (induksi abortus) adalah abortus yang disengaja tanpa indikasi medis, baik dengan
memakai obat-obatan maupun dengan alat-alat.
Abortus ini terbagi lagi menjadi:
1) Abortus medisinalis (abortus therapeutica) yaitu abortus karena tindakan kita sendiri, dengan alasan bila
kehamilan dilanjutkan, dapat membahayakan jiwa ibu (berdasarkan indikasi medis). Biasanya perlu
mendapat persetujuan 2 sampai 3 tim dokter ahli.
2) Abortus kriminalis yaitu abortus yang terjadi oleh karena tindakan-tindakanyang tidak legal atau tidak
berdasarkan indikasi medis dan biasanya dilakukan secara sembunyi-sembunyi oleh tenaga tradisional.
3. Sebutkan macam macam abortus spontan menurut gejala klinis keterangan
Pembagian abortus secara klinis adalah sebagai berikut :
1. Abortus Iminens merupakan tingkat permulaan dan ancaman terjadinya abortus, ditandai perdarahan
pervaginam, ostium uteri masih tertutup dan hasil konsepsi masih baik dalam kandungan.
2. Abortus Insipiens adalah abortus yang sedang mengancam ditandai dengan serviks telah mendatar dan
ostium uteri telah membuka, akan tetapi hasil konsepsi masih dalam kavum uteri dan dalam proses
pengeluaran.

3. Abortus Inkompletus adalah sebagian hasil konsepsi telah keluar dari kavum uteri dan masih ada yang
tertinggal.
4. Abortus Kompletus adalah seluruh hasil konsepsi telah keluar dari kavum uteri pada kehamilan kurang
dari 20 minggu atau berat janin kurang dari 500 gram.
5. Missed Abortion adalah abortus yang ditandai dengan embrio atau fetus telah meninggal dalam
kehamilan sebelum kehamilan 20 minggu dan hasil konsepsi seluruhnya masih tertahan dalam kandungan.
6. Abortus Habitualis ialah abortus spontan yang terjadi 3 kali atau lebih berturutturut.
7. Abortus Infeksious ialah abortus yang disertai infeksi pada alat genitalia.
8. Abortus Terapeutik adalah abortus dengan induksi medis (Prawirohardjo, 2009).

3. Arik
SOAL DR. GOGOT
2. Perbedaan adenomiosis & endometriosis
ADENOMYOSIS

ENDOMETRIOSIS

Jaringan endometrium yang masih berfungsi Jaringan endometrium yang masih berfungsi
dan terdapat di dalam miometrium. Sering pada terdapat di luar cavum uteri dan di luar
multipara dan premenopause

miometrium

-multipara
-premenopause
-pembesaran difus,simetris,padat,lunak
-dismenore sekunder
-dispareuni
-menometroragi
-perubahan terjadi sesuai siklus haid
-terapi hormonal umumnya resisten

-dewasa muda
-dismenore
-dyspareuni
-defekasi nyeri
-infertilitas
-terapi umumnya hormonal,pembedahan dan
radiasi

-Histerektomi untuk mengatasi nyerinya


3. Tatalaksana PID
C D C m e m p e r b a h a r u i p a n d u a n u n t u k d i a g n o s i s d a n m a n a j e m e n P I D . Panduan CDC terbaru
membagi criteria diagnostic menjadi 3 grup :
1. Grup 1 : minimum kriteria dimana terapi empiris diindikasikan bilatidak ada etiologi yang
dapat dijelaskan. Kriterianya yaitu adanya nyeri tekan uterin atau adnexa dan nyeri saat pergerakan
serviks.
2. Grup 2 : kriteria tambahan mengembangkan spesifisitas diagnostic t e r m a s u k k r i t e r i a
b e r i k u t : s u h u o r a l > 3 8 , 3 C , a d a n y a s e c r e t mukopurulen dari servical atau vaginal,
peningkatan

erythrocyte s e d i m e n t a t i o n

rate,

peningkatan

c-reactif

protein,

a d a n ya

b u k t i l a b o r a t o r i u m i n f e k s i s e r v i k a l i s o l e h N . g o n o r r h e a Atau C.trachomatis.
3.Grup 3 : kriteria spesifik untuk PID didasarkan pada prosedur yang t e p a t u n t u k b e b e r a p a
p a s i e n y a i t u k o n f i r m a s i l a p a r o s k o p i k , ultrasonografi transvaginal yang memperlihatkan
penebalan, tubayang terisi cairan dengan atau tanpa cairan bebas pada pelvis, atauk o m p l e k s
ovarian,

dan

endometrial

biopsy

tuba-

y a n g memperlihatkan

endometritis.Kebanyakan pasien diterapi dengan rawatan jalan, namun terdapat indikasiuntuk dilakukan
hospitalisasi yaitu :
Diagnosis yang tidak jelas
Abses pelvis pada ultrasonografi
Kehamilan
Gagal merespon dengan perawatan jalan
Ketidakmampuan untuk bertoleransi terhadap regimen oral
Sakit berat atau mual muntah
Imunodefisiensi
Gagal untuk membaik secara klinis setelah 72 jam terapi rawat jalanTer a p i d i m u l a i d e n g a n t e r a p i
a n t i b i o t i k e m p i r i s s p e c t r u m l u a s . J i k a t e r d a p a t AKDR, harus segera dilepas setelah pemberian
antibiotic empiris pertama. Terapiterbagi menjadi 2 yaitu terapi untuk pasien rawat inap dan rawat jalan.
Terapi pasien rawatan inap
Regimen A : berikan cefoxitin 2 gram iv atau cefotetan 2 gr iv per 12
j a m ditambah doxisiklin 100 mg per oral atau iv per 12 jam. Lanjutkan regimen ini selama 24 jam
setelah pasien pasien membaik secara klinis, lalu mulai doxisiklin1 0 0 m g p e r o r a l 2 k a l i s e h a r i

s e l a m a 1 4 h a r i . J i k a t e r d a p a t a b s e s t u b a o v a r i a n , gunakan metronoidazole atau klindamisin untuk


menutupi bakteri anaerob.
Regimen B : berikan clindamisin 900 mg iv per 8 jam tambah gentamisin 2 mg/kgBB dosis awal iv diikuti
dengan dosis lanjutan 1,5 mg/kg BB per 8 jam. Terapi ivdihentikan 24 jam setelah pasien membaik
secara klinis, dan terapi per oral 100mg doxisiklin dilanjutkan hingga 14 hari.
Terapi pasien rawatan jalan
Regimen A : berikan ceftriaxone 250 mg im dosis tunggal tambah doxisiklin 100mg oral 2 kali sehari
selama 14 hari, dengan atau tanpa metronidazole 500 mg 2 kali sehari selama 14 hari.
Regimen B : berikan cefoxitin 2 gr im dosis tunggal dan proibenecid 1 gr per oraldosis tunggal atau dosis
tunggal cephalosporin generasi ketiga tambah dozisiklin100 mg oral 2 kali sehari selama 14 hari dengan atau
tanpa metronidazole 500 mgoral 2 kali sehari selama 14 hari.P a s i e n d e n g a n t e r a p i i n t r a v e n a d a p a t
d i g a n t i k a d e n g a n t e r a p i p e r o r a l setelah 24 jam perbaikan klinis. Dan dilanjutkan hingga total 14 hari.
Penanganan juga termasuk penanganan simptomatik seperti antiemetic, analgesia, antipiretik,dan terapi cairan.
Terapi Pembedahan
Pasien yang tidak mengalami perbaikan klinis setelah 72 jam terapi harusdievaluasi ulang bila mungkin
dengan laparoskopi dan intervensi pembedahan.Laparotomi digunakan untuk kegawatdaruratan
sepeti rupture abses, abses yangtidak respon terhadap pengobatan, drainase laparoskopi.
Penanganan

dapat

pula b e r u p a

salpingoooforektomi,

histerektomi,

dan

bilateral

s a l p i n g o o f o r e k t o m i . Idealnya, pembedahan dilakukan bila infeksi dan inflamasi telah membaik.


Panduan CDC untuk penatalaksanaan PID
4. Deteksi dini dgn PAP smear & IVA (klasifikasi)
Pap smear: tindakan medis mengambil sampel sel dari serviks (leher rahim) wanita, kemudian dioleskan pada
slide lalu sel diperiksa dengan mikroskop untuk mencari lesi prakanker atau perubahan keganasan

IVA: pemeriksaan visual eksocervix, SCJ (Squamocolumnar junction), dan kanal endocervix dengan mata
telanjang (tanpa pembesaran) dengan asam asetat

SOAL DR. DITA


Diagnosa
AUB
Data penunjang
Anamnesis : penggunaan obat KB atau terapi hormonal lalu apakah ada penyakit sistemik lain serta apakah
dalam keadaan stress emosional.

Cek lab DL untuk mengetahui keadaan umum HB apakah perlu tranfusi atau tidak
PTT/APTT melihat adanya kelainan pembekuan darah atau tidak
USG abdomen (ginekologi) untuk evaluasi adanya kelainan organik

Tindakan segera

MRS
Perbaiki keadaan umum jika HB < 8 transfusi sampai HB >= 10 g/dl
Cari sumber perdarahan
Hentikan perdarahan dengan medika mentosa

Pengobatan selanjutnya

asam traneksamat 3 x 1
estradiol konyugasi 4x 2,5 mg
promestatin 4 x 25 mg
setelah perdarahan akut berhenti diberikan
pil KB kombinasi 4 x 1 tab (4 hari) 3 x 1 tab (3 hari) 2 x 1 tab (2 hari) 1 x 1 tab (3 minggu) dan 1
minggu bebas obat. Ulangi selama 3 bulan

SOAL DR. KADEK


1. MIA
2. MIA
3. MIA
4. ARIK
5. ARIK
SOAL DR. YONAS

1.
A. KET
B. Pungsi cavum douglas
C. persiapan untuk tindakan operatif gawat darurat
-stabilisai restorasi cairan tubuh dengan NS/RL 500ml dalam 15 menit pertama/2 liter per 2 jam
-transfusi
-tindakan operasi pada tuba:
a.parsial salpingektomi:eksisi bagian tuba yang ada hasil konsepsiinya
b.salpingostomi: mengeluarkan hasil konsepsi pada satu segmen tuba+reparasi bagian tersebut
-Antibiotik
-terapi post op: ketoprofen 100mg supp,tramadol 200mg IV,pethidin 50mg
2. a. Indikasi absolut SC:
Panggul sempit;
Bayi besar;
Tumor jalan lahir;
b.
c. Akibat anemia pada kehamilan
Anemia pada kehamilan adalah :
a. Hamil muda (trimester pertama): abortus, missed abortion, dan kelainan kongenital
b. Trimester kedua : persalinan prematur, perdarahan antepartum, gangguan pertumbuhan janin dalam
rahim, asphyxia intrauterine sampai kematian, berat badan lahir rendah (BBLR), gestosis dan mudah
terkena infeksi, IQ rendah, dekompensatio kordis kematian ibu.
c. Saat inpartu : gangguan his primer dan sekunder, janin lahir dengan anemia, persalinan dengan tindakan
tinggi, ibu cepat lelah, gangguan perjalanan persalinan perlu tindakan operatif.
pengaruh anemia dalam kehamilan :
a. Pengaruh pada ibu hamil baik dalam masa kehamilan, persalinan dan pasca persalinan : abortus, partus
premature, partus lama, perdarahan post partus, infeksi, anemia, dll.
b. Pengaruh terhadap janin : kematian janin, kematian perinatal, prematur, cacat bawaan, cadangan Fe bayi
kurang
Dr. Endang
Jawabdengansingkatdanjelasdarisoal-soalberikut :
1. ApaperbedaansecaraklinisantaraPlasenta Praevia denganSolutioPlasenta?
2. Seorangwanitaumur 24 thn, primagravidahamil 37 mgg, di kirimoleh PKM denganketeranganriwayatkejankejang di rumah 4 kali. Hasilpemeriksaan di RS : BB 74 Kg, TB 155 Cm, T 160/110 mmHg, N 100 x/mnt, R
40 /mnt. Temp 38 c,kesadarankoma, odemanasarka. DJJ + 160 x/mnt regular, HIS - , TBJ 2700 gr danhasil
VT belumadapembukaan, kepalabelummasukpanggul.
a. Apa diagnose sodara?
b. Bagaimanaplanningnya?
c. Kapan harusdiakhirikehamilannya?
3. HemoragikPost Partum (HPP).
a. Apadefinisi HPP?
b. Faktorrisiko HPP antepartum?
c. Penanganan HPP karenaatonia uteri?
Dr. Gogot
KomplikasidanefeksampingIUD ?
6. KriteriaChorio CA Prognosis Jelekdan Prognosis baik?
7. ApaituKistaOvaridisgerminova?
8. Apa yang dimaksuddenganHellpSyndrom?
Dr. Dita

1. a. Jelaskan gejala klinis dan penatalaksaan Fluor Albus karena Trichomoniasis dan Candidiasis Bacterial
Vaginasis?
b. Jelaskan definisi dan klasifikasi derajat PID (Pelvic Imflamatory Disease)?
2. a. Jelaskan langkah-langkah penatalaksanaan HPP (Perdarahan Pasca Persalinan)?
b. Jelaskan faktor-faktor yang menyebabkan HPP?
a. Apadampakkehamilanterhadapterjadinya anemia?
b. Bagaimanapencegahanterjadinyaanemia terhadapkehamilan?
Dr. Yonas
2. Sebutkanpencegahan Ca. Cervix?
3. Andaseorangdokter yang bertugas di Puskesmas. Seorangwanita, 20 tahun, belummenikah,
mengeluhnyeriperutmendadakdisertaiperdarahanflek-flekpervaginam, HPHT : 24-8-2014, Riwayatkeputihan
lama, Riwayat coitus multipartner.
Padapemeriksaanfisikdidapatkan : KU lemah, T: 80/50 mmHg, N : 120x/mnt, R : 32x/mnt, anemis,
Abdomen : nyeritekan(+), cairanbebas (+) ; Inspekulo : fluxus (+) dari OUI, Portiolivide, tampakCavum
Douglas menonjol VT : Portiotidakadapembukaan, nyerigoyangportio (+), Ukuran uterus normal,
nyeritekanadneksakanan.
a. Diagnosa?
b. Apakahadapemeriksaanlainnya yang bisadikerjakanpadapasienini di puskesmas? Sebutkan !
c. Tatalaksana?
Soal OSCE dr. Endang Maruf R, Sp.OG tanggal 04 Oktober 2013
Jawab dengan singkat dan Jelas
1. a. Jelaskan secara klinis perbedaan antara Solusio Plasenta & Plasenta Previa?
b. Sebutkan berapa macam plasenta previa dan bagaimana penanganannya?
c. Bagaimana penanganan Atonia Uteri?
2. a. Apa syarat dan indikasi Induksi ?
b. Bagaimana prosedurnya Induksi?
c. Apa efek samping dan komplikasinya dan bagaimana penangannannya?

Soal OSCE dr.Gogot S, Sp.OG tanggal 04 Oktober 2013


1.
2.
3.
4.
5.

Penatalaksanaan DVB?
Penatalaksanaan Mola Hydatidosa?
Penatalaksanaan HPP?
Penatalaksanaan Post Datism?
Penatalaksanaan Premature?

Soal Ujian OSCE dr. Dita Diana P., Sp.OG


1. a. Jelaskan gejala klinis dan pemeriksaan ginekologis mola hidatidosa?
b. Bagaimana penatalaksanaan dan follow up mola hidatidosa (klinis dan laboratories)
2. a. Jelaskan definisi persalinan premature?
b. Bagaimana penatalaksanaan persalinan premature?

Soal OSCE dr. Endang Maruf R, Sp.OG tanggal 04 Oktober 2013

Jawab dengan singkat dan Jelas


1. a. Jelaskan secara klinis perbedaan antara Solusio Plasenta & Plasenta Previa?
b. Sebutkan berapa macam plasenta previa dan bagaimana penanganannya?
c. Bagaimana penanganan Atonia Uteri?
2. a. Apa syarat dan indikasi Induksi ?
b. Bagaimana prosedurnya Induksi?
c. Apa efek samping dan komplikasinya dan bagaimana penangannannya?

Soal OSCE dr.Gogot S, Sp.OG tanggal 04 Oktober 2013


1.
2.
3.
4.
5.

Penatalaksanaan DVB?
Penatalaksanaan Mola Hydatidosa?
Penatalaksanaan HPP?
Penatalaksanaan Post Datism?
Penatalaksanaan Premature?

Soal Ujian OSCE dr. Dita Diana P., Sp.OG


1. a. Jelaskan gejala klinis dan pemeriksaan ginekologis mola hidatidosa?
b. Bagaimana penatalaksanaan dan follow up mola hidatidosa (klinis dan laboratories)
2. a. Jelaskan definisi persalinan premature?
b. Bagaimana penatalaksanaan persalinan premature?

Soal OSCE dr. Endang Maruf R, Sp.OG tanggal 04 Oktober 2013


Jawab dengan singkat dan Jelas
1. a. Jelaskan secara klinis perbedaan antara Solusio Plasenta & Plasenta Previa?
b. Sebutkan berapa macam plasenta previa dan bagaimana penanganannya?
c. Bagaimana penanganan Atonia Uteri?
2. a. Apa syarat dan indikasi Induksi ?
b. Bagaimana prosedurnya Induksi?
c. Apa efek samping dan komplikasinya dan bagaimana penangannannya?

Soal OSCE dr.Gogot S, Sp.OG tanggal 04 Oktober 2013


1.
2.
3.
4.
5.

Penatalaksanaan DVB?
Penatalaksanaan Mola Hydatidosa?
Penatalaksanaan HPP?
Penatalaksanaan Post Datism?
Penatalaksanaan Premature?

Soal Ujian OSCE dr. Dita Diana P., Sp.OG

1. a. Jelaskan gejala klinis dan pemeriksaan ginekologis mola hidatidosa?


b. Bagaimana penatalaksanaan dan follow up mola hidatidosa (klinis dan laboratories)
2. a. Jelaskan definisi persalinan premature?
c. Bagaimana penatalaksanaan persalinan premature?
Soal osce dr endang 22 Agustus 2014
1. a. Terangkan tentang penyebab HPP
b. Jelaskan penanganan HPP karena atonia uteri
Penyebab HPP:
dibagi berdasarkan: waktu dan kausa
BERDASARKAN WAKTU
Penyebab dini : bila perdarahan terjadi dalam 24 jam pertama
a.
b.
c.
d.

Atonia uteri
Laserasi jalan lahir: perlukaan servik, vagina, dan perineum
Hematom: biasanya di daerah yang mengaami laserasi
Lain2: sisa plasenta/ selaput janin, rupture uteri, inversion uteri

Penyebab Lambat: bila perdarahan terjadi setelah 24 jam pertama


a. Tertinggalnya sebagian plasenta
b. Subinvolusi di daerah insersi plasenta
c. Bekas luka sc
BERDASARKAN KAUSA
1. Perdarahan dari tempat implantasi plasenta:
a. Hipoteni/atoni uteri
akibat anastesi
distensi berlebihan (gemeli, anak besar, hidramnion)
partus lama, partus kasep
partus presipitatus
persalinan karena induksi oksitosin
multiparitas
korioamnionitis
riwayat atoni sebelumnya
b. Sisa plasenta
Kotiledon tersisa
Plasenta susenturia
Plasenta akreta, inkreta, perkreta
2. Perdarahan karena robekan:
a. Episiotomy melebar
b. Robekan perineum, vagina, dan serviks
c. Rupture uteri

3. Gangguan koagulasi:
Jarang terjadi biasanya pada trombofilia, HELLP Syndrom, Preeklampsi, solution plasenta,
kematian IUFD, emboli ketuban

Uterus berkontraksi YA: Pertahankan KBI 1-2 menit (maks)


Keluarkan tangan hati2
Pengawasan kala IV

Ajarkan Keluarga KBE


Keluarkan tangan, KBI dengan hati
Inj Metil Ergometrin 0,2 mg im
Inf RL + Oxytosin 20 iu guyur
Lakukan KBI lagi

2. a. Jelaskan apa yang dimaksud dengan AKI dan AKP


b. penyebab kematian ibu dan bayi?
c. berapa target AKI dan AKP pada MDGs 2015?
Jawab;
a. AKI= angka kematian ibu adalah Banyaknya kematian perempuan pada saat hamil atau selama 42 hari
sejak terminasi kehamilan tanpa memandang lama dan tempat persalinan, yang disebabkan karena
kehamilannya atau pengelolaannya, dan bukan karena sebab-sebab lain, per 100.000 kelahiran hidup.
AKP : angka kematian prenatal
Angka Kematian Perinatal (AKP) adalah jumlah kematian perinatal dikalikan 1000 dan kemudian
dibagi dengan jumlah bayi lahir hidup dan lahir mati pada tahun yang sama
Wiknjosastro (2005) menyatakan bahwa untuk dapat memahami kematian perinatal maka ada definisidefinisi yang lazim dipakai seperti kelahiran hidup, kematian janin, kelahiran mati, kematian
perinatal dini dan kematian perinatal.
Kelahiran hidup (live birth) adalah keluarnya hasil konsepsi secara sempurna dari ibunya tanpa
memandang lamanya kehamilan dan sesudah terpisah dari ibunya bernafas atau menunjukkan tandatanda kehidupan seperti denyutan tali pusat atau pergerakan otot, tidak peduli apakah tali pusat telah
dipotong atau belum.
Kematian janin (foetal death) adalah kematian hasil konsepsi sebelum dikeluarkan dengan sempurna
dari ibunya tanpa memandang tuanya kehamilan. Kematian dinilai dengan fakta bahwa sesudah
dipisahkan dari ibunya janin tidak bernafas atau menunjukkan tanda-tanda kehidupan seperti denyut
jantung, atau palsasi tali pusat atau kontraksi otot.
Kelahiran mati (stillbirth) ialah kelahiran hasil konsepsi dalam keadaan mati yang telah mencapai
umur kehamilan 28 minggu (atau berat badan lahir lebih atau sama dengan 1000 gram).
Kematian perinatal dini (early neonatal death) ialah kematian bayi dalam 7 hari pertama
kehidupannya. Sedangkan kematian perinatal (perinatal mortality) ialah bayi lahir mati dan kematian
bayi dalam 7 hari pertama sesudah lahir.
Angka Kematian Perinatal (AKP) adalah jumlah kematian perinatal dikalikan 1000 dan kemudian dibagi
dengan jumlah bayi lahir hidup dan lahir mati pada tahun yang sama AKP = jumlah kematian perinatal x
1000 Jumlah lahir mati + jumlah lahir hidup AKP perlu diketahui karena dapat merefleksikan tingkat
kesehatan ibu hamil dan bayinya serta standar pelayanan yang diberikan. Angka ini juga merupakan salah
satu indikator terbaik dari status sosial ekonomi masyarakat, daerah dan negara.

b. Penyebab kematian ibu:


- langsung: akibat kompilkasi kehamilan, persalinan, maupun masa nifas dan segala intervensi dan
penanganan yang tidak tepat dari komplikasi tersebut. Antara lain: perdarahan, terutama perdarahan
pasca persalinan; infeksi sampai sepsis; hipertensi dalam kehamilan (PEB, eklamsia);partus macet;
-

komplikasi abortus tidak aman, dan sebab2 lain.


tidak langsung: akibat dari penyakit yang sudah ada atau penyakit yang timbul selama kehamilan
yang berpengaruh terhadap kehamilan, msalnya : malaria, anemia,HIV AODS,penyakit
kardiovaskular, hepatitis, TB

Penyebab kematian bayi: BBLR, Prematuritas, kelaianan congenital, dan asfiksia, infeksi neonatal
c. Target Nasional menurut MDGs yaitu penurunan AKI menjadi 102 per 100.000 pada tahun 2015

3. kasus; wanita 37 tahun G1P0A0 hamil aterm lama kawin sdah 10 tahun, janin tunggal pres kep dengan
kepala sudah masuk panggul, TBJ 3000 gram DJJ normal HIS belum ada VS; TD 180/120 mmHg, N 90x/menit
RR 20x/menit Temp 36,8 C, TB 150 cm BB 79 kg. oedem tungkai ++,
a. apa penyebabnya?
b. Bagaimana prinsip penanganan pada kasus ini?
Jawab;
Penyebabnya:
Pasien ini memiliki faktor risiko nulipara dan primitua. Nulipara meningkatkan 3x lipat risiko preeklamsi.
Penyebab:
Teori Hormonal
Teori Toxin
Teori Metabolisme / Diet
Teori Infeksi (sehubungan dengan racun)
Teori Neurotik (sehubungan dengan emosional)
Teori Cerebral
Teori Ischaemia (paling banyak dianut)
Peran angiogenesis
Peran genetik faktor : 26 28% riwayat PEB
Peran disfungsi endothel
Peran nutrisi
Peran metabolik insulin, thyroid dan prolaktin
Peran inflamasi radikal bebas : ada 2 fenomena :
a. deefektive / impaired throphoblastic invation
b. generalized endothelial cell dysfunction
Pada pasien ini dilakukan management aktif atas indikasi kehamilan aterm

Penderita di rawat di ruang yang tenang, tidur miring ke kiri

Diet cukup protein, 100 gram/hari dan kurang garam yakni sampai 0,5 gram/hari
Infus dektose 5% yang tiap liternya diselingi infuse ringer laktat 160-125 ml/jam sebanyak
500ml
Jumlah cairan kurang lebih satu liter ditambah jumlah urine yang keluar. Bila terjadi kegagalan
ginjal, jumlah cairan maksimum 500 ml/hari. Kalau tekanan osmotis plasma menurun, diberikan
larutan
koloid
Pemberian oksigen 4 6 liter/menit
Magnesium sulfat :
a. Dosis awal : 4 gram larutan 20% intravena dengan kecepatan maksimal 1 gram/menit, yang
segera diikuti 8 gram larutan 40% 20ml masing-masing 10 ml di pantat kiri dan kanan
b. Dosisi pemeliharaan : 4 gram setiap 6 jam kemudian
Catatan :
Syarat pemberian magnesium sulfat adalah :
a). Refleks patela (+)
b). Respirasi 16 permenit
c). Produksi urin paling tidak 100 ml/4 jam terakhir
d). Tersedia antidotum, yakni kalsium glukonat
c. Pemberian magnesium sulfat dihentikan setelah 6 jam pasca persalinan 24 jam post partum
Anti-Hipertensi
Diberikan bila tekanan sistolik 180 mmHg atau diastolic 110 mmHg
a. Hidralazin
- 10 mg 4-6 jam sesuai respons
- Atau 5 mg intravena, tunggu 5 menit, bila tidak ada respons diulang 5 mg intravena sampai
dosis total 25 mg
b. Klonidin
- Satu ampul (0,15mg) dilarutkan dalam 9cc Nacl fisiologi disuntikkan intravena sebanyak 5 ml
tunggu 5 menit
- bila tekanan darah belum turun diulang sampai 4 kali dalam waktu 30 menit
- Bila tekanan darah sudah turun klonidin diberikan secara intra muscular 3-4 jam sebanyak 0,15
mg
GESTOSIS INDEK
Edema
Protein uria Esbach
Sistole
Diastole

Cara terminasi kehamilan:


1. Belum dalam persalinan
* Induksi (protokol)
* Seksio Sesarea
@ Terdapat kontra indikasi thd oksitosin
@ Setelah 12 jam dalam induksi tdk masuk fase aktif
@ Primigravida lebih cenderung kearah seksio sesarea
2. Sudah dalam persalinan
* Kala I fase laten 6 jam tdk masuk fase aktif induksi/SC
* Kala I fase Aktif Amniotomi 6 jam belum lengkap seksio sesarea / pacu
* Kala II : - Ekstraksi Vacum
- Ekstraksi Forsipal

Soal dr. Dita Diana Parti, Sp. OG


1. Seorang wanita usia 30 tahun G2P1A0 hamil 35-36 minggu datang dengan keluhan partus tak maju
sudah sehari. Saat dilakukan pemeriksaan fisik didapatkan TFU 37 cm, punggung janin di sebelah kanan
ibu, bagian terbawah janin kepala, kepala sudah masuk punggung, bagian perlimaan 2/5 kepala turun
hodge III pembukaan 10 cm DJJ 140x/menit His 3-4 kali dalam sepuluh menit 35-40 detik, panggul
tidak sempit, kulit ketuban masih utuh.
A. Diagnosa yang tepat untuk pasien?
B. Apakah tindakan yang tepat untuk pasien?
Jawab;
a. G2P1A0 UK 35-36 minggu janin T/H inpartu Kala II memanjang suspect bayi besar
b. Pro persalinan abdominal (SC) oleh dr.spesialis Obgyn
2. Seorang wanita 25 tahun berparas cantik, datang dengan keluhan nyeri perut selama berbulan-bulan.
Pada pemeriksaan fisik didapatkan massa pada adnexa kanan. Hasil USG didapatkan massa ovarium 9
cm dan tampak berisi seperti rambut
a. Apa diagnose pasien ini?
b. Apakah tindakan yang tepat (jelaskan alasannya dan resiko akibat tindakan)
Jawab;;
a. Kista dermoid ovarium
b. Pengangkatan kista dermoid dengan seluruh ovarium
Alasan;
- karena resiko rekurensi tinggi,
- komplikasi menajdi torsi tangkai
- kista dermoid menjai tumor yang khas seperti struma ovarium, kistdenoma ovarii
musinosum, kistadenoma ovarii serosum dan koriokarsinoma
- mengalami perubahan menajdi keganasan sebanyak 1,5%
Resiko; infertilitas

Kasus 1.
Ibu Mia, seorang ibu berusia 29 tahun, baru memperoleh satu anak, tak dapat lagi menggunakan metode
kontrasepsi Laktasi Amenore karena bayinya yang telah berusia 7 bulan dan mulai mendapat makanan
tambahan karena asupan ASI sudah tidak mencukupi dan ia mulai mendapat haid. Setelah mendapat konseling
kontrasepsi, ibu Mia memilih KB kombinasi karena dianggap paling sesuai untuknya, termasuk juga ingin
menghentikan produksi ASI karena ia akan mulai bekerja kembali dan meninggalkan tugas kantor (untuk
menyusui) adalah tidak memungkinkan.
Mungkin akibat tidak mendengarkan dengan baik petunjuk petugas KB tentang cara penggunaan dan ingin
cepat-cepat saja memperoleh pil KB maka ibu Mia menggunakan pil KB hanya jika suaminya sedang di rumah.
Suaminya bekerja sebagai pelaut dan hanya pulang seminggu sekali. Selama menggunakan pil KB, siklus
haidnya jadi tidak teratur dan haid tidak dimulai pada tanggal yang sama di bulan berikutnya, seperti yang
dialaminya sebelum kehamilan yang lalu.
Setelah 2 bulan menggunakan pil KB, pada bulan berikutnya, ibu Mia tidak mendapat haid. Seteleh 7 hari
terlambat haid, ia periksa ke dokter dan menurut hasil pemeriksaan urine, ia dinyatakan hamil. Ibu Mia tidak
terima bahwa ia hamil karena ia memakai pil KB dan hanya melakukan senggama seminggu sekali. Ia
mengajukan alasan mungkin hormon dalam pil KB tidak efektif atau konsentrasinya kurang karena ia membaca

di brosur Microgynon kandungan etinil estradiol hanya 30 mikrogram, tidak 50 mikrogram seperti pil KB milik
temannya. Karena dokter menganjurkan pemeriksaan lanjutan untuk memastikan kehamilan, ibu Mia merasa
kurang puas dan pulang dalam keadaan gusar.
Pertanyaan
1. Mengapa metode Laktasi Amenore untuk ibu Mia tidak dapat dilanjutkan dan apa risikonya bila tetap
dilanjutkan ?
2. Bagaimana penggunaan pil KB secara benar? Apakah ibu Mia menggunakan pil KB ini secara benar ?
3. Mengapa penggunaan pil KB seperti yang dilakukan oleh ibu Mia mempunyai risiko tinggi untuk
terjadinya kehamilan, sedangkan ia melakukan senggama hanya jika suaminya pulang ke rumah?
4. Mengapa siklus haidnya menjadi tidak teratur?
5. Apakah hasil pemeriksaan dokter yang menyatakan dirinya hamil mempunyai tingkat kemungkinan
yang sangat tinggi?
6. Apakah pengamatan ibu Mia tentang kandungan EE Mycrogynon 30mikrogram adalah benar ? Apakah
dapat diterima alasan terjadinya kehamilan karena adanya perbedaan kandungan etinil estradiol?
Apakah ada hormon lain dalam pil KB ini?
7. Mengapa komponen estrogen dalam pil KB mempunyai peran yang cukup penting dalam mencegah
proses fertilisasi?
Kasus 2.
Ibu Santi telah berusia 35 tahun dan memiliki 3 anak. Anak terkecil berusia 3 bulan dan masih menyusui. Untuk
sementara, ibu Santi tidak ingin menambah anak lagi dan ingin menggunakan kontrasepsi jangka menengah
yang cara penggunaannya tidak merepotkan dan juga tidak harus dikonsumsi atau diingat setiap hari. Setelah
mendapat konseling dari petugas kesehatan di poliklinik KB Puskesmas kota Cirebon, ibu Santi memilih
suntikan Depo Provera sebagai metode kontrasepsi yang paling sesuai untuknya.
Setelah menggunakan suntikan hingga 2 kali, ibu Santi merasa cocok dengan kontrasepsi pilihannya karena
selain praktis, juga hanya diberikan setiap 3 bulan sekali. Tetapi pada awal penggunaan, kadang-kadang terjadi
perdarahan bercak. Dalam 2 bulan terakhir, ibu Santi tidak lagi mendapat haid seperti biasanya. Hal ini selalu
menjadi beban pikiran menjelang tanggal perkiraan haid, walaupun telah diberitahukan oleh petugas di klinik
KB bahwa hal tersebut adalah salah satu efek samping kontrasepsi suntikan ini. Ibu Santi masih belum mengerti
mengapa haidnya menghilang dan kemana perginya darah haid yang biasanya keluar selama 5 hari menstruasi.
Apakah hal ini akan menyebabkan gangguan kesehatan bagi dirinya? Walaupun banyak pengguna suntikan KB,
juga tidak mendapat haid dan tidak menimbulkan gangguan kesehatan bagi mereka tetapi ibu Santi tetap merasa
cemas tentang kemungkinan darah haid yang seharusnya keluar setiap bulan akan menumpuk dan
menyebabkan akibat serius bagi dirinya.
Pertanyaan
1. Apakah pilihan ibu Santi untuk menggunakan kontrasepsi suntikan telah sesuai dengan keinginannya
untuk tidak menambah anak lagi dan bayinya yang masih menyusui?
2. Apa jenis hormon yang terkandung dalam suntikan KB dan apa pengaruh hormon tersebut terhadap
produksi ASI? Apakah suntikan Depo Provera juga mengandung hormon jenis lainnya?
3. Apakah tersedia suntikan KB lain yang mengandung hormon serupa dengan yang ada di dalam suntikan
Depo Provera? Berapa lama waktu penggunaan suntikan KB jenis ini?
4. Bila ibu Santi ingin metode kontrasepsi dengan hormon yang sama tetapai dalam bentuk pil, maka pil
KB manakah yang anda sarankan?
5. Beri satu contoh suntikan KB hormon kombinasi dan sebutkan jenis hormon dalam bahan suntikan
tersebut?
6. Mengapa terjadi perdarahan bercak pada 3 bulan pertama penggunaan suntikan KB Depo Provera?
7. Mengapa haid ibu Santi menghilang setelah 2 kali penggunaan suntikan KB? Kemana darah haid yang
seharusnya datang setiap bulan?
Apakah keadaan ini akan mengganggu kesehatan ibu Santi?

Anda mungkin juga menyukai