Anda di halaman 1dari 43

SUMBERPENDIDIKAN.

COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
Minggu
MINGGU1
4/18/1/16

Tema/Tajuk
TEMA1:KELUARGA
HARMONI
UNIT1
TAJUK:HariKeluarga
EMK:
Nilaimurni,peraturan
sosiobudaya

HasilPembelajaran
(StandardKandungan)
1.2Mendengar,mengecam,dan
menyebutbunyibahasa,iaitu
abjad,sukukata,perkataan,frasa
danayatdenganbetul.
2.2Membacadanmemahami
perkataan,frasadanayatdaripada
pelbagaisumberdengansebutan
yangbetul.

PengisianKurikulum:
Nilai:Kasihsayang,tolong
menolong
Ilmu:PendidikanMoral
KBT:
KB(Mengumpulkandan
mengelaskan,
mengenalpasti,
menjanakanidea)
BCB(Bacaanintensif)
KP(Muzik).
Media:Bukuteks,
komputer,radio
SistemBahasa:
Tatabahasa:Katanama
Am
KosaKata:
Menjinjing,kusyen,straw
plastik,kereta,beg
pakaian

PENGGAL1
CadanganAktivitiPembelajaran
KodEvidens
(StandardPembelajaran)
Pentaksiran
1.2.6 Mendengar, memahami, dan menyebut
frasa, ayat tunggal dan ayat majmuk dengan
betuldantepat.
2.2.1Membacadanmemahamiperkataandalam
ayattunggalyangmengandungiduaatautiga
sukukata,diftong,vokalberganding,digrafdan
konsonanbergabungdengansebutanyang
betul.
2.2.2Membacadanmemahamifrasadalamayat
yangmengandungiperkataanduaatautigasuku
kata,diftong,vokalberganding,digrafdan
konsonanbergabungdengansebutanyang
betul.

2.3Membacakuatpelbagaibahan
bacaandenganlancar,sebutan
yangjelasdanintonasiyangbetul.

2.3.1Membacakuatayatpenyatadengan
lancar,sebutanyangjelas,intonasiyangbetul
danberjeda

3.2Menulissecaramekanis
berdasarkanbahanyangdiberi
denganbetuldankemas.

3.2.4Menulispelbagaiperkataandanfrasayang
mengandungiperkataanduaataulebihsuku
kata,diftong,vokalberganding,digrafdan
konsonanbergabungdengancarayangbetul
dantulisanyangkemas.

4.1Menyebutdanmemahami
unsursenidalamlagumelalui
nyanyiansecaradidikhibur.

4.1.1Menyebutsenikatalagudenganjelas
melaluinyanyiansecaradidikhibur.

B1DL1E2

5.1Memahamidanmenggunakan
golongankatadenganbetul
mengikutkonteks.

5.1.1Memahamidanmenggunakankatanama
amhidupmanusiadenganbetulmengikut
konteks.

B1DT1E1

MINGGU2

Catatan
Transisi
Tahun1:
2
11/1/2013

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
11/115/1/16

TEMA1:KELUARGA
HARMONI
UNIT1
TAJUK:HariKeluarga

1.2Mendengar,mengecam,dan
menyebutbunyibahasa,iaitu
abjad,sukukata,perkataan,frasa
danayatdenganbetul.

1.2.6 Mendengar, memahami, dan menyebut


frasa, ayat tunggal dan ayat majmuk dengan
betuldantepat.

EMK:
Nilaimurni,peraturan
sosiobudaya

2.2Membacadanmemahami
perkataan,frasadanayatdaripada
pelbagaisumberdengansebutan
yangbetul.

2.2.1Membacadanmemahamiperkataandalam
ayattunggalyangmengandungiduaatautiga
sukukata,diftong,vokalberganding,digrafdan
konsonanbergabungdengansebutanyang
betul.

PengisianKurikulum:
Nilai:Kasihsayang,tolong
menolong
Ilmu:PendidikanMoral
KBT:
KB(Mengumpulkandan
mengelaskan,
mengenalpasti,
menjanakanidea)
BCB(Bacaanintensif)
KP(Muzik).

2.3Membacakuatpelbagaibahan
bacaandenganlancar,sebutan
yangjelasdanintonasiyangbetul.

2.3.1Membacakuatayatpenyatadengan
lancar,sebutanyangjelas,intonasiyangbetul
danberjeda

3.2Menulissecaramekanis
berdasarkanbahanyangdiberi
denganbetuldankemas.

3.2.4Menulispelbagaiperkataandanfrasayang
mengandungiperkataanduaataulebihsuku
kata,diftong,vokalberganding,digrafdan
konsonanbergabungdengancarayangbetul
dantulisanyangkemas.

4.1Menyebutdanmemahami
unsursenidalamlagumelalui
nyanyiansecaradidikhibur.

4.1.1Menyebutsenikatalagudenganjelas
melaluinyanyiansecaradidikhibur.

5.1Memahamidanmenggunakan
golongankatadenganbetul
mengikutkonteks.

5.1.1Memahamidanmenggunakankatanama
amhidupmanusiadenganbetulmengikut
konteks.

TEMA1:KELUARGA
HARMONI
UNIT2
TAJUK:HobiMakUsu

1.2Mendengar,mengecam,dan
menyebutbunyibahasa,iaitu
abjad,sukukata,perkataan,frasa
danayatdenganbetul.

1.2.6 Mendengar, memahami, dan menyebut


frasa, ayat tunggal dan ayat majmuk dengan
betuldantepat.

EMK:
Ilmu,Nilaimurni,

1.3Mendengar,memahamidan
memberiresponsterhadapsesuatu

1.3.1Mendengar,memahamidanmemberikan
responsyangsesuaisecaralisanataugeraklaku

Media:Bukuteks,
komputer,radio
SistemBahasa:
Tatabahasa:Katanama
Am
KosaKata:
Menjinjing,kusyen,straw
plastik,kereta,beg
pakaian
MINGGU3
18/122/1/16

2.2.2Membacadanmemahamifrasadalamayat
yangmengandungiperkataanduaatautigasuku
kata,diftong,vokalberganding,digrafdan
konsonanbergabungdengansebutanyang
betul.

B1DL1E2

B1DT1E2
B1DB1E1

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
kemahiranbernilaitambah
PengisianKurikulum:
Nilai:Kasihsayang,tolong
menolong
Ilmu:KemahiranHidup

arahan,soalandanpesananyang
didengardenganbetul.

terhadaparahanberdasarkanayatperintahjenis
silaandanayatperintahjenislarangandengan
betul.

2.2Membacadanmemahami
perkataan,frasadanayatdaripada
pelbagaisumberdengansebutan
yangbetul.

2.2.2Membacadanmemahamifrasadalamayat
yangmengandungiperkataanduaatautigasuku
kata,diftong,vokalberganding,digrafdan
konsonanbergabungdengansebutanyang
betul.

KBT:
KB(Mengenalpasti,
menghubungkaitkan,
mengumpulkandan
2.3Membacakuatpelbagaibahan
mengelaskan)
bacaandenganlancar,sebutan
BCB(mendengardengan yangjelasdanintonasiyangbetul.
berkesan,bacaanintensif
)
KONTEKSTUAL
Mengaplikasikan.
Media:Bukuteks,buku
aktiviti
SistemBahasa:
Tatabahasa:Katanama
Am,KataNamaKhas
KosaKata:
MakUsu,Adam,SueAi
Ling,
Hasnita,Maria,Baju
Melayu

3.2Menulissecaramekanis
berdasarkanbahanyangdiberi
denganbetuldankemas.

2.2.3Membacadanmemahamiayatmajmuk
daripadapelbagaibahanbacaandengansebutan
yangbetul.
2.3.2Membacakuatpelbagaijenisayatdengan
lancar,sebutanyangjelasdanintonasiyang
betulmengikuttandabaca.
3.2.4Menulispelbagaiperkataandanfrasayang
mengandungiperkataanduaataulebihsuku
kata,diftong,vokalberganding,digrafdan
konsonanbergabungdengancarayangbetul
dantulisanyangkemas.

5.1Memahamidanmenggunakan
golongankatadenganbetul
mengikutkonteks.

5.1.2Memahamidanmenggunakankatanama
khashidupmanusiadenganbetulmengikut
konteks.

1.7Penggunajalanraya

1.7.1Mengenalpastijenisjenispenggunajalan
rayayangberbeza.

1.3Mendengar,memahamidan
memberiresponsterhadapsesuatu

1.3.2Mendengar,memahamidanmemberikan
responsdenganbetulsecaralisanterhadap

B1DT1E1

TEMAPKJR:UNIT1
PELBAGAIPENGGUNA
JALANRAYA

MINGGU4
25/129/1/16

TAJUK1
MENGGENALI
PENGGUNAJALAN
RAYA
TEMA1:KELUARGA
HARMONI

24Jan
Maulidur

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
UNIT3
TAJUK:SepupuAdam

arahan,soalandanpesananyang
didengardenganbetul.

KBT:
KB(Menjanakanidea,
mengenalpasti,
menyusunmengikut
urutan)
BCB(mendengardengan
berkesan)
KPInterpersonal,
Verballinguistik
KONSTRUKTIVISME
Menghubungkaitkan
Media:Bukuteks,buku
aktiviti,gambar
SistemBahasa:
Tatabahasa:KataGanti
NamaDiri
KosaKata:
Sangkar,haiwan
peliharaan,mereka,dia,
nya

Rasul

1.3.3Mendengar,memahamidanmemberikan
responssecaralisandangeraklakuberdasarkan
pesananmengikuturutandenganbetul.

EMK:
Ilmu,Nilaimurni,Kajian
MasaDepan
PengisianKurikulum:
Nilai:Kasihsayang,tolong
menolong,bertanggung
jawab
Ilmu:KemahiranHidup,
DuniaSains

pelbagaisoalanbercapah.

1.4Bertutur,berbualdan
menyatakanpermintaantentang
sesuatuperkaradaripadapelbagai
sumberdalamsituasiformaldan
tidakformalsecarabertatasusila.

1.4.3Berbualtentangsesuatuperkara
menggunakankatagantinamadiriketiga
denganbetuldalamsituasitidakformalsecara
bertatasusila.

2.3Membacakuatpelbagaibahan
bacaandenganlancar,sebutan
yangjelasdanintonasiyangbetul.

2.3.1Membacakuatayatpenyatadengan
lancar,sebutanyangjelas,intonasiyangbetul
danberjeda.
2.3.2Membacakuatpelbagaijenisayatdengan
lancar,sebutanyangjelasdanintonasiyang
betulmengikuttandabaca.

2.4Membacadanmemahami
maklumatyangtersuratdan
tersiratdaripadapelbagaibahan
untukmemberiresponsdengan
betul.

2.4.1Membacadanmemahamimaklumatuntuk
mengenalpastiideautamadanideasampingan
dalambahanmultimediadengantepat

3.2Menulissecaramekanis
berdasarkanbahanyang
diberidenganbetuldankemas.

3.2.6Menulisayatmajmukdenganbetuldan
kemas.

3.3Membinadanmenulis
perkataan,frasa,danayat
denganbetul.

3.3.3Membinadanmenulisjawapandalam
bentukayatmudahdenganbetulberdasarkan
soalan.

4.2Mengujarkanbahasayang
indahdanmenggunakanbahasa
badansecarakreatifsemasa
berceritasecaradidikhibur.

4.2.1Mengujarkanayatdengansebutanyang
betul,intonasiyangjelasdandiksiyangtepat
melaluipenceritaansecaradidikhibur.

5.1Memahamidanmenggunakan
golongankatadenganbetul

5.1.6Memahamidanmenggunakankatahubung
denganbetulmengikutkonteks.

B2DL1E1

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
mengikutkonteks.
1.7Penggunajalanraya

1.7.2Memahamibahawasemuapengguna
jalanrayaialahpejalankakipadasuatumasa
dalamsetiapperjalanan,dankemahiransebagai
pejalankakiadalahpenting.

1.2Mendengar,mengecam,dan
menyebutbunyibahasa,iaitu
abjad,sukukata,perkataan,frasa
danayatdenganbetul.

1.2.6 Mendengar, memahami, dan menyebut


frasa, ayat tunggal dan ayat majmuk dengan
betuldantepat.

1.4Bertutur,berbualdan
menyatakanpermintaantentang
sesuatuperkaradaripadapelbagai
sumberdalamsituasiformaldan
tidakformalsecarabertatasusila.

1.4.1Berbualtentangsesuatuperkaradengan
menggunakanayattunggaldanayatmajmuk
yangbetuldalamsituasitidakformalsecara
bertatasusila.

2.3Membacakuatpelbagaibahan
bacaandenganlancar,sebutan
yangjelasdanintonasiyangbetul.

2.3.1Membacakuatayatpenyatadengan
lancar,sebutanyangjelas,intonasiyangbetul
danberjeda.

2.5Membacadanmenaakuluntuk
memindahkanmaklumatyang
terdapatdalampelbagaibahan.

2.5.1Membacadanmemahamibahangrafik
yangmempunyaiperkataandenganbetul.

3.2Menulissecaramekanis
berdasarkanbahanyangdiberi
denganbetuldankemas.

3.2.4Menulispelbagaiperkataandanfrasayang
mengandungiperkataanduaataulebihsuku
kata,diftong,vokalberganding,digrafdan
konsonanbergabungdengancarayangbetul
dantulisanyangkemas.

TEMAPKJR:UNIT1
PELBAGAIPENGGUNA
JALANRAYA
TAJUK2MENJADI
PENGGUNAJALAN
RAYAYANGBERBEZA
MINGGU5
1/25/2/16

TEMA2:SIHATDAN
CERDAS
UNIT4
TAJUK:Jagalah
kebersihan
EMK:
Nilaimurni,Peraturan
Sosiobudaya
PengisianKurikulum:
Nilai:Bekerjasama,
pembersih,bertanggung
jawab
Ilmu:PendidikanMoral,
PendidikanKesihatan
KBT:
KB(Mentafsir,Mengenal
pasti,mensintesis,
menjanakanidea,
menghubungkaitkan)
BCB(Bacaanintensif)
KPInterpersonal,Muzik
KONTEKSTUAL
Menghubungkaitkan
Media:Bukuteks,buku
aktiviti,gambar,radio

3.2.6Menulisayatmajmukdenganbetuldan
kemas.
3.3Membinadanmenulis
perkataan,frasa,danayatbetul.

3.3.1Membinadanmenulisperkataandanfrasa
dengancarayangbetuldankemas.

2728Feb
Thaipusam

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
SistemBahasa:
Tatabahasa:KataKerja
Tunggal

4.1Menyebutdanmemahami
unsursenidalamlagumelalui
nyanyiansecaradidikhibur.

4.1.2Memahamidanmenyatakanmaksud
perkataandalamsenikatalagumelaluinyanyian
dangeraklakusecaradidikhibur.

KosaKata:
Telapaktangan,cuci,
gembira,ada,balik,
mandi,

5.1Memahamidanmenggunakan
golongankatadenganbetul
mengikutkonteks.

5.1.4Memahamidanmenggunakankatakerja
tunggaldenganbetulmengikutkonteks.

7.2Proseduryangselamatuntuk
melintas.

7.2.2Mengetahuilimalangkahuntuk
menyempurnakantugasmelintasdengan
selamat.

7.2.3Menggambarkanprosedurmelintasdengan
selamatdanmenerangkansetiaplangkah.

1.2Mendengar,mengecam,dan
menyebutbunyibahasa,iaitu
abjad,sukukata,perkataan,frasa
danayatdenganbetul.

1.2.6 Mendengar, memahami, dan menyebut


frasa, ayat tunggal dan ayat majmuk dengan
betuldantepat.

1.4Bertutur,berbualdan
menyatakanpermintaantentang
sesuatuperkaradaripadapelbagai
sumberdalamsituasiformaldan
tidakformalsecarabertatasusila.

1.4.1Berbualtentangsesuatuperkaradengan
menggunakanayattunggaldanayatmajmuk
yangbetuldalamsituasitidakformalsecara
bertatasusila.

2.3Membacakuatpelbagaibahan
bacaandenganlancar,sebutan
yangjelasdanintonasiyangbetul.

2.3.1Membacakuatayatpenyatadengan
lancar,sebutanyangjelas,intonasiyangbetul
danberjeda.

2.5Membacadanmenaakuluntuk
memindahkanmaklumatyang
terdapatdalampelbagaibahan.

2.5.1Membacadanmemahamibahangrafik
yangmempunyaiperkataandenganbetul.

3.2Menulissecaramekanis
berdasarkanbahanyangdiberi
denganbetuldankemas.

3.2.4Menulispelbagaiperkataandanfrasayang
mengandungiperkataanduaataulebihsuku
kata,diftong,vokalberganding,digrafdan
konsonanbergabungdengancarayangbetul
dantulisanyangkemas.

TEMAPKJR:UNIT1
PELBAGAIPENGGUNA
JALANRAYA
TAJUK3:SEMUA
ORANGPEJALANKAKI
MINGGU6
8/212/2/16

TEMA2:SIHATDAN
CERDAS
UNIT4
TAJUK:Jagalah
kebersihan
EMK:
Nilaimurni,Peraturan
Sosiobudaya
PengisianKurikulum:
Nilai:Bekerjasama,
pembersih,bertanggung
jawab
Ilmu:PendidikanMoral,
PendidikanKesihatan
KBT:
KB(Mentafsir,Mengenal
pasti,mensintesis,
menjanakanidea,
menghubungkaitkan)
BCB(Bacaanintensif)
KPInterpersonal,Muzik
KONTEKSTUAL
Menghubungkaitkan

3.2.6Menulisayatmajmukdenganbetuldan

B1DT1E1

B1DT1E3
B1DL1E1

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
kemas.
Media:Bukuteks,buku
aktiviti,gambar,radio

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.1Membinadanmenulisperkataandanfrasa
dengancarayangbetuldankemas.

4.1Menyebutdanmemahami
unsursenidalamlagumelalui
nyanyiansecaradidikhibur.

4.1.2Memahamidanmenyatakanmaksud
perkataandalamsenikatalagumelaluinyanyian
dangeraklakusecaradidikhibur.

5.1Memahamidanmenggunakan
golongankatadenganbetul
mengikutkonteks.

5.1.4Memahamidanmenggunakankatakerja
tunggaldenganbetulmengikutkonteks.

1.7Penggunajalanraya

1.7.2Memahamibahawasemuapenggunajalan
rayaialahpejalankakipadasuatumasadalam
setiapperjalanan,dankemahiransebagai
pejalankakiadalahpenting.

TEMA2:SIHATDAN
CERDAS
UNIT5
TAJUK:KantinSaya
Bersih

1.4Bertutur,berbualdan
menyatakanpermintaantentang
sesuatuperkaradaripadapelbagai
sumberdalamsituasiformaldan
tidakformalsecarabertatasusila.

1.4.2Berbualtentangsesuatuperkara
menggunakankatapanggilandengantepatbagi
keluargabukankalangankeluargaasasdalam
situasitidakformalsecarabertatasusila.

EMK:
Nilaimurni,Peraturan
Sosiobudaya

2.2Membacadanmemahami
perkataan,frasadanayatdaripada
pelbagaisumberdengansebutan
yangbetul.

2.2.2Membacadanmemahamifrasadalamayat
yangmengandungiperkataanduaatautigasuku
kata,diftong,vokalberganding,digrafdan
konsonanbergabungdengansebutanyang
betul.

2.3Membacakuatpelbagaibahan
bacaandenganlancar,sebutan
yangjelasdanintonasiyangbetul

2.3.2Membacakuatpelbagaijenisayatdengan
lancar,sebutanyangjelasdanintonasiyang
betulmengikuttandabaca.

3.2Menulissecaramekanis
berdasarkanbahanyangdiberi
denganbetuldankemas.

3.2.7Menulissecaramekanisabjaddan
perkataandalambentuktulisanberangkai
denganbetul.

SistemBahasa:
Tatabahasa:KataKerja
Tunggal
KosaKata:
Telapaktangan,cuci,
gembira,ada,balik,
mandi,
TEMAPKJR:UNIT1
PELBAGAIPENGGUNA
JALANRAYA
TAJUK4:BERJALAN
DENGANSELAMATDI
TEMPATLETAKKERETA
MINGGU7
15/219/2/16

PengisianKurikulum:
Nilai:Tolongmenolong,
bertanggungjawab
Ilmu:PendidikanMoral
KBT:
KB(menjanakanidea,
mengenalpasti,membuat
urutan)

1012Feb
Tahun
BaruCina

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
BCB(Perbincangan)
KPVerballinguistik,
Interpersonal,Kinestetik

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.1Membinadanmenulisperkataandanfrasa
dengancarayangbetuldankemas.

5.1Memahamidanmenggunakan
golongankatadenganbetul
mengikutkonteks.

5.1.1Memahamidanmenggunakankatanama
amhidupmanusiadenganbetulmengikut
konteks.

3.1Mengetahuitentangperaturan
danundangundangjalanraya
sertamenggunakannya.

3.1.1Menerangkanmengapaperaturandan
undangundangjalanrayaituperluuntuk
keselamatansemuapenggunajalanraya.

TEMA2:SIHATDAN
CERDAS
UNIT6
TAJUK:Makanan
BersihdanBerkhasiat

1.4Bertutur,berbualdan
menyatakanpermintaantentang
sesuatuperkaradaripadapelbagai
sumberdalamsituasiformaldan
tidakformalsecarabertatasusila.

1.4.3Berbualtentangsesuatuperkara
menggunakankatagantinamadiriketiga
denganbetuldalamsituasitidakformalsecara
bertatasusila.

EMK:
Nilaimurni,Peraturan
Sosiobudaya,Kecerdasan
Pelbagai

2.2Membacadanmemahami
perkataan,frasadanayatdaripada
pelbagaisumberdengansebutan
yangbetul.

2.2.3Membacadanmemahamiayatmajmuk
daripadapelbagaibahanbacaandengansebutan
yangbetul.

PengisianKurikulum:
Nilai:Tolonhmenolong,
rajin,hormat
menghormati
Ilmu:DuniaSains,
PendidikanKesihatan

3.2Menulissecaramekanis
berdasarkanbahanyangdiberi
denganbetuldankemas.

3.2.6Menulisayatmajmukdenganbetuldan
kemas.

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul

3.3.1Membinadanmenulisperkataandanfrasa
dengancarayangbetuldankemas.

Media:gambar,radio
SistemBahasa:
Tatabahasa:KataAdjektif
KosaKata:
Tampan,merdu,masam,
kelat,wangi
TEMAPKJR:UNIT2
PERATURANJALAN
RAYA
TAJUK1PATUHI
PERATURANJALAN
RAYA
MINGGU8
22/226/2/16

KBT:
KB(Mengkonsepsikan,
Mengenalpasti)

3.3.2Membinadanmenulisayatyang
mengandungiperkataanduaataulebihsuku
kata,diftong,vokalberganding,digrafdan

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
BCB(Bacaanintensif,)
KPVerballinguistik,
Interpersonal
KONTEKSTUAL
Menghubungkaitkan
Media:Bukuteks,buku
aktiviti,gambar
SistemBahasa:
Tatabahasa:KataAdjektif,
KataGantiNamaDiri
KosaKata:
Mereka,ulam,vitamin,
pedas,masam,manis,
pedas,
TEMAPKJR:UNIT2
PERATURANJALAN
RAYA

MINGGU9
29/24/3/16

TAJUK2:AMALKAN
PERATURANJALAN
RAYA
TEMA2:SIHATDAN
CERDAS
UNIT7
TAJUK:Bersenam
MenyihatkanBadan
EMK:
Nilaimurni,Peraturan
Sosiobudaya,Kecerdasan
Pelbagai
PengisianKurikulum:
Nilai:Hormat
menghormati,
mengamalkangayahidup
sihat,
Ilmu:PendidikanJasmani,

konsonanbergabungdenganbetul.
4.2Mengujarkanbahasayang
indahdanmenggunakanbahasa
badansecarakreatifsemasa
berceritasecaradidikhibur.

5.1Memahamidanmenggunakan
golongankatadenganbetul
mengikutkonteks.

4.2.2Mengujarkanayatdengansebutanyang
betul,intonasiyangjelasdandiksiyangtepat
sertamenggunakanmimikmukayangsesuai
melaluipenceritaansecaradidikhibur.
5.1.3Memahamidanmenggunakankataganti
namadiriketigadenganbetulmengikutkonteks.

B2DT1E1
B2DT1E2

5.1.5Memahamidanmenggunakankataadjektif
pancainderadenganbetulmengikutkonteks.

3.1Mengetahuitentangperaturan
danundangundangjalanraya
sertamenggunakannya.

3.1.3Menghuraikanbagaimanadanmengapa
peraturandanundangundangjalanraya
diaplikasikankepada:pejalankaki,penumpang,
penunggangbasikal,pemandu,penunggang.

1.4Bertutur,berbualdan
menyatakanpermintaantentang
sesuatuperkaradaripadapelbagai
sumberdalamsituasiformaldan
tidakformalsecarabertatasusila.

1.4.1Berbualtentangsesuatuperkaradengan
menggunakanayattunggaldanayatmajmuk
yangbetuldalamsituasitidakformalsecara
bertatasusila.
1.4.4Bertuturdanmenyatakanpermintaan
denganintonasiyangbetultentangsesuatu
perkaradalamsituasitidakformalsecara
bertatasusila.

1.5Berceritadanmenceritakan
sesuatuperkarasemuladengan
tepatmenggunakansebutanyang
jelasdanintonasiyangbetul.

1.5.1Berceritatentangsesuatuperkaradengan
tepat,sebutanyangjelasdanintonasiyangbetul
menggunakanayatmajmuk.

2.2Membacadanmemahami
perkataan,frasadanayatdaripada

2.2.1Membacadanmemahamiperkataandalam
ayattunggalyangmengandungiduaatautiga

25Feb
Cuti
Peristiwa1

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
PendidikanKesihatan
KBT:
KB(Menjanakanidea,
Mentafsir)
BCB(Bacaanintensif)
KPInterpersonal
KONSTRUKTIVISME
Menghubungkaitkan
KONTEKSTUAL
Menghubungkaitkan
Media:Bukuteks,buku
aktiviti,muzik,radio,
bangku,gelungrotan
SistemBahasa:
Tatabahasa:KataAdjektif

pelbagaisumberdengansebutan
yangbetul.

sukukata,,vokalberganding,digrafdan
konsonanbergabungdengansebutanyangbetul

2.4Membacadanmemahami
maklumatyangtersuratdan
tersiratdaripadapelbagaibahan
untukmemberiresponsdengan
betul.
2.5Membacadanmenaakuluntuk
memindahkanmaklumatyang
terdapatdalampelbagaibahan.

2.4.1Membacadanmemahamimaklumatuntuk
mengenalpastiideautamadanideasampingan
dalambahanmultimediadengantepat.

2.6Membacapelbagaibahan
sasteradanbukansasterayang
sesuaibagimemupukminat
membaca.

2.6.2Membacadanmemahamipelbagaibahan
bacaanberbentukdidikhiburuntuk
menambahkanilmudankosakata.

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.2Membinadanmenulisayatyang
mengandungiperkataanduaataulebihsuku
kata,diftong,vokalberganding,digrafdan
konsonanbergabungdenganbetul.

KosaKata:
Redup,meriah,garau,
tegap,rancak,gembira

2.5.2Membaca,memahamidanmenaakul
bahangrafikdanbukanbahangrafikdengan
betul.

3.3.1Membinadanmenulisperkataandanfrasa
dengancarayangbetuldankemas.
3.3.3Membinadanmenulisjawapan
dalambentukayatmudahdengan
betulberdasarkansoalan.

TEMAPKJR:UNIT2
PERATURANJALAN
RAYA

5.1Memahamidanmenggunakan
golongankatadenganbetul
mengikutkonteks.

5.1.5Memahamidanmenggunakan
kataadjektifpancainderadengan
betulmengikutkonteks.

3.1Mengetahuitentangperaturan
danundangundangjalanraya
sertamenggunakannya.

3.1.4Mengenalpastiperaturanjalanraya,
undangundangjalanrayadanlainlainprosedur
keselamatanyangrelevandipersekitaran
mereka.

TAJUK3:KENALPASTI
PERATURANJALAN
RAYADIKAWASAN
KAMU

10

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
MINGGU
10
7/311/3/16

TEMA3:SEMANGAT
PERPADUAN
UNIT8
TAJUK:JirankuMesra
EMK:
Nilaimurni,Peraturan
Sosiobudaya,
Kewarganegaraan
PengisianKurikulum:
Nilai:Hormat
menghormati,peramah,
tolongmenolong,
penyayang
Ilmu:PendidikanMoral
KBT:
KB(Menjanakanidea,
membuaturutan,
mengenalpasti,membuat
keputusan)
KPVerballinguistik,
Interpersonal
KONSTRUKTIVISME
Menghubungkaitkan

1.4Bertutur,berbualdan
menyatakanpermintaantentang
sesuatuperkaradaripadapelbagai
sumberdalamsituasiformaldan
tidakformalsecarabertatasusila.

1.4.1Berbualtentangsesuatuperkaradengan
menggunakanayattunggaldanayatmajmuk
yangbetuldalamsituasitidakformalsecara
bertatasusila.

1.5Berceritadanmenceritakan
sesuatuperkarasemuladengan
tepat
menggunakansebutanyangjelas
danintonasiyangbetul.

1.5.1Berceritatentangsesuatuperkaradengan
tepat,sebutanyangjelasdanintonasiyangbetul
menggunakanayatmajmuk.

2.2Membacadanmemahami
perkataan,frasadan
ayatdaripadapelbagaisumber
dengansebutanyangbetul.

2.2.3Membacadanmemahamiayatmajmuk
daripadapelbagaibahanbacaandengansebutan
yangbetul.

2.4Membacadanmemahami
maklumatyangtersuratdan
tersiratdaripadapelbagaibahan
untukmemberiresponsdengan
betul.

2.4.2Membacadanmemahamimaklumat
daripadabahanmultimediauntukmenyatakan
maklumatmengikuturutandenganbetul.

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.2Membinadanmenulisayatyang
mengandungiperkataanduaataulebihsuku
kata,diftong,vokalberganding,digrafdan
konsonanbergabungdenganbetul.

Media:Bukuteks,buku
aktiviti

3.3.3Membinadanmenulisjawapandalam
bentukayatmudahdenganbetulberdasarkan
soalan.

SistemBahasa:
Tatabahasa:KataHubung
KosaKata:
Bertegursapa,jiran,
tetapi,kerana,sambil,
atau,riadah

02Mac
Majlis
Makan
Malam
AmalPIBG
04Mac
Cuti
Peristiwa2

3.3.4Membinadanmenulisayattunggaldan
ayatmajmukberdasarkanbahangrafikdengan
betul.
4.3Mengujarkanbahasayang
indahdanmenggunakanbahasa
badandengankreatifmelalui
lakonansecaradidikhibur.

4.3.1Mengujarkandialogdengansebutanyang
betul,intonasiyangjelasdandiksiyangtepat
melaluilakonanspontansecaradidikhibur.

5.1Memahamidanmenggunakan

5.1.6Memahamidanmenggunakankatahubung

11

B2DB1E1
B3DL1E2

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)

TEMAPKJR:UNIT2
PERATURANJALAN
RAYA

golongankatadenganbetul
mengikutkonteks.

denganbetulmengikutkonteks.

3.1Mengetahuitentangperaturan
danundangundangjalanraya
sertamenggunakannya.

3.1.1Menerangkanmengapaperaturandan
undangundangjalanrayaituperluuntuk
keselamatansemuapenggunajalanraya.

1.4Bertutur,berbualdan
menyatakanpermintaantentang
sesuatuperkaradaripadapelbagai
sumberdalamsituasiformaldan
tidakformalsecarabertatasusila.

1.4.1Berbualtentangsesuatuperkaradengan
menggunakanayattunggaldanayatmajmuk
yangbetuldalamsituasitidakformalsecara
bertatasusila.

1.5Berceritadanmenceritakan
sesuatuperkarasemuladengan
tepatmenggunakansebutanyang
jelasdanintonasiyangbetul.

1.5.1Berceritatentangsesuatuperkaradengan
tepat,sebutanyangjelasdanintonasiyangbetul
menggunakanayatmajmuk.

2.2Membacadanmemahami
perkataan,frasadanayatdaripada
pelbagaisumberdengansebutan
yangbetul.

2.2.3Membacadanmemahamiayatmajmuk
daripadapelbagaibahanbacaandengansebutan
yangbetul.

2.4Membacadanmemahami
maklumatyangtersuratdan
tersiratdaripadapelbagaibahan
untukmemberiresponsdengan
betul.

2.4.2Membacadanmemahamimaklumat
daripadabahanmultimediauntukmenyatakan
maklumatmengikuturutandenganbetul.

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.2Membinadanmenulisayatyang
mengandungiperkataanduaataulebihsuku
kata,diftong,vokalberganding,digrafdan
konsonanbergabungdenganbetul.

TAJUK4:PATUHI
PERATURANJALAN
RAYA
MINGGU
12
21/325/3/16

TEMA3:SEMANGAT
PERPADUAN
UNIT8
TAJUK:JirankuMesra
EMK:
Nilaimurni,Peraturan
Sosiobudaya,
Kewarganegaraan
PengisianKurikulum:
Nilai:Hormat
menghormati,peramah,
tolongmenolong,
penyayang
Ilmu:PendidikanMoral
KBT:
KB(Menjanakanidea,
membuaturutan,
mengenalpasti,membuat
keputusan)
KPVerballinguistik,
Interpersonal
KONSTRUKTIVISME
Menghubungkaitkan

12

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
Media:Bukuteks,buku
aktiviti.
SistemBahasa:
Tatabahasa:KataHubung
KosaKata:
Bertegursapa,jiran,
tetapi,kerana,sambil,
atau,riadah

3.3.3Membinadanmenulisjawapandalam
bentukayatmudahdenganbetulberdasarkan
soalan.
3.3.4Membinadanmenulisayattunggaldan
ayatmajmukberdasarkanbahangrafikdengan
betul.
4.3Mengujarkanbahasayang
indahdanmenggunakanbahasa
badandengankreatifmelalui
lakonansecaradidikhibur.

4.3.1Mengujarkandialogdengansebutanyang
betul,intonasiyangjelasdandiksiyangtepat
melaluilakonanspontansecaradidikhibur.

5.1Memahamidanmenggunakan
golongankatadenganbetul
mengikutkonteks.

5.1.6Memahamidanmenggunakankatahubung
denganbetulmengikutkonteks.

1.4Isyaratjalanraya,tandajalan
danisyarattrafik

1.4.1Memahamibahawatandajalan,penenda
jalandnisyarattrafikdigunakanuntuk
mengawallalulintasdanmestidipatuhiuntuk
meningkatkankeselamatan.

TEMAPKJR:UNIT3
PAPANTANDA,
ISYARATDAN
PENANDAJALAN

1.4.8Membincangkanperaturandantingkah
lakupenggunajalanrayayangberkenaan
dengantandajalanasas.

TAJUK1:KENALI
PAPANTANDA,
ISYARATDAN
PENANDAJALAN
MINGGU
13
28/33/4/16

TEMA3:SEMANGAT
PERPADUAN
UNIT9
TAJUK:JiranSepakat

1.5Berceritadanmenceritakan
sesuatuperkarasemuladengan
tepatmenggunakansebutanyang
jelasdanintonasiyangbetul.

1.5.2Menceritakansesuatuperkarayang
didengardengantepat,sebutanyangjelasdan
intonasiyangbetulmenggunakanayat
majmuk.

EMK:
Nilaimurni,Peraturan
Sosiobudaya,
Kewarganegaraan

2.2Membacadanmemahami
perkataan,frasadanayatdaripada
pelbagaisumberdengansebutan
yangbetul.

PengisianKurikulum:
Nilai:Bekerjasama,Jujur,

2.2.2Membacadanmemahamifrasadalam
ayatyangmengandungiperkataanduaatau
tigasukukata,diftong,vokalberganding,
digrafdankonsonanbergabungdengan
sebutanyangbetul.

2.3Membacakuatpelbagaibahan

2.3.2Membacakuatpelbagaijenisayatdengan

13

B3DB1E1
B4DL1E1

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
Prihatin,Hormat
menghormati,Baikhati
Ilmu:PendidikanMoral

bacaandenganlancar,sebutan
yangjelasdanintonasiyangbetul.

lancar,sebutanyangjelasdanintonasiyang
betulmengikuttandabaca.

2.4Membacadanmemahami
maklumatyangtersuratdan
tersiratdaripadapelbagaibahan
untukmemberiresponsdengan
betul.

2.4.2Membacadanmemahamimaklumat
daripadabahanmultimediauntukmenyatakan
maklumatmengikuturutandenganbetul.

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.4Membinadanmenulisayattunggaldan
ayatmajmukberdasarkanbahangrafikdengan
betul.

SistemBahasa:
Tatabahasa:KataTanya

3.4Menulisimlakdengantepat.

3.4.1Menulisimlakperkataanyang
mengandungikatagandadengantepat.

KosaKata:
Kaunter,polis,kereta,
jiran,dapur

5.1Memahamidanmenggunakan
golongankatadenganbetul
mengikutkonteks

5.1.7Memahamidanmenggunakankatatanya
denganbetulmengikutkonteks

1.4Isyaratjalanraya,tandajalan
danisyarattrafik

1.4.1Memahamibahawatandajalan,penenda
jalandnisyarattrafikdigunakanuntuk
mengawallalulintasdanmestidipatuhiuntuk
meningkatkankeselamatan.

KBT:
KB(Membuaturutan,
Mengitlak,Membuat
keputusan,Mengenal
pasti)
BCBMendengardengan
berkesan,bacaanintensif
Media:Bukuteks,buku
aktiviti.

TEMAPKJR:UNIT3
PAPANTANDA,
ISYARATDAN
PENANDAJALAN

2.4.3Membacadanmemahamimaklumatyang
tersuratdengantepatdaripadabahan
multimediayangsesuai.

B3DL1E3

1.4.6Mengklasifikasikantandajalanmengikut
tujuanutamanya.

TAJUK2:KATEGORI
PAPANTANDAJALAN

1.4.8Membincangkanperaturandantingkah
lakupenggunajalanrayayangberkenaan
dengantandajalanasas.

MINGGU
14
4/410/4/16
MINGGU
15
11/417/4/16

CUTIPERTENGAHANPENGGAL1
TEMA3:SEMANGAT
PERPADUAN
UNIT9
TAJUK:JiranSepakat

1.5Berceritadanmenceritakan
sesuatuperkarasemuladengan
tepatmenggunakansebutanyang
jelasdanintonasiyangbetul.

1.5.2Menceritakansesuatuperkarayang
didengardengantepat,sebutanyangjelasdan
intonasiyangbetulmenggunakanayatmajmuk.

14

2331
Mac2013

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
EMK:
Nilaimurni,Peraturan
Sosiobudaya,
Kewarganegaraan
PengisianKurikulum:
Nilai:Bekerjasama,Jujur,
Prihatin,Hormat
menghormati,Baikhati
Ilmu:PendidikanMoral

KBT:
KB(Membuaturutan,
Mengitlak,Membuat
keputusan,Mengenal
pasti)
BCBMendengardengan
berkesan,bacaanintensif
Media:Bukuteks,buku
aktiviti.
SistemBahasa:
Tatabahasa:KataTanya
KosaKata:
Kaunter,apa,mengapa.
Bagaimana,mana,di
mana
TEMAPKJR:UNIT3
PAPANTANDA,
ISYARATDAN
PENANDAJALAN
TAJUK3:AMBIL
LANGKAHBIJAK

2.2Membacadanmemahami
perkataan,frasadanayatdaripada
pelbagaisumberdengansebutan
yangbetul

2.2.2Membacadanmemahamifrasadalamayat
yangmengandungiperkataanduaatautigasuku
kata,diftong,vokalberganding,digrafdan
konsonanbergabungdengansebutanyang
betul.

2.3Membacakuatpelbagaibahan
bacaandenganlancar,sebutan
yangjelasdanintonasiyangbetul.
2.4Membacadanmemahami
maklumatyangtersuratdantersirat
daripadapelbagaibahanuntuk
memberiresponsdenganbetul.

2.3.2Membacakuatpelbagaijenisayatdengan
lancar,sebutanyangjelasdanintonasiyang
betulmengikuttandabaca.
2.4.2Membacadanmemahamimaklumat
daripadabahanmultimediauntukmenyatakan
maklumatmengikuturutandenganbetul.
2.4.3Membacadanmemahamimaklumatyang
tersuratdengantepatdaripadabahan
multimediayangsesuai.

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.4Membinadanmenulisayattunggaldan
ayatmajmukberdasarkanbahangrafikdengan
betul.

3.4Menulisimlakdengantepat.

3.4.1Menulisimlakperkataanyang
mengandungikatagandadengantepat.

5.1Memahamidanmenggunakan
golongankatadenganbetul
mengikutkonteks.

5.1.7Memahamidanmenggunakankatatanya
denganbetulmengikutkonteks

1.4Isyaratjalanraya,tandajalan
danisyarattrafik

1.4.1Memahamibahawatandajalan,penenda
jalandnisyarattrafikdigunakanuntuk
mengawallalulintasdanmestidipatuhiuntuk
meningkatkankeselamatan.
1.4.6Mengklasifikasikantandajalanmengikut
tujuanutamanya.
1.4.8Membincangkanperaturandantingkah
lakupenggunajalanrayayangberkenaan
dengantandajalanasas.

15

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
MINGGU
16
18/424/4

TEMA3:SEMANGAT
PERPADUAN
UNIT10
TAJUK:Semangat
kerjasama

1.6Berbicarauntuk
menyampaikanmaklumattentang
sesuatuperkaradaripadapelbagai
sumberdengantepatsecara
bertatasusila.

1.6.1Berbicarauntukmendapatkanmaklumat
yangtepattentangsesuatuperkaradaripada
pelbagaisumbersecarabertatasusila.

EMK:
Nilaimurni,Peraturan
Sosiobudaya,
Kewarganegaraan

1.2Mendengar,mengecam,dan
menyebutbunyibahasa,iaitu
abjad,sukukata,perkataan,frasa
danayatdenganbetul.

1.2.6Mendengar,memahami,danmenyebut
frasa,ayattunggaldanayatmajmukdengan
betuldantepat.

PengisianKurikulum:
Nilai:Bekerjasama,Jujur,
penyayang,pemurah
Ilmu:PendidikanMuzik

2.2Membacadanmemahami
perkataan,frasadanayat
daripadapelbagaisumberdengan
sebutanyangbetul

2.2.1Membacadanmemahamiperkataandalam
ayattunggalyangmengandungiduaatautiga
sukukata,diftong,vokalberganding,digrafdan
konsonanbergabungdengansebutanyang
betul.

2.4Membacadanmemahami
maklumatyangtersuratdan
tersiratdaripadapelbagaibahan
untukmemberiresponsdengan
betul.

2.4.3Membacadanmemahamimaklumatyang
tersuratdengantepatdaripadabahan
multimediayangsesuai.

KBT:
KB(Menjanakanidea,
Mengenalpasti,Menilai)
BCBBacaanluncuran,
Mendengardengan
berkesan
KONSTRUKTIVISME
Menerangkandan
menjelaskan
KPMuzik.
Media:Bukuteks,buku
aktiviti.
SistemBahasa:
Tatabahasa:KataTanya
KosaKata:
Poster,carta,komputer,
kamus

TEMAPKJR:UNIT3
PAPANTANDA,

2.5Membacadanmenaakuluntuk 2.5.1 Membaca dan memahami bahan grafik


memindahkanmaklumatyang
yangmempunyaiperkataandenganbetul
terdapatdalampelbagaibahan.
3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.4Membinadanmenulisayattunggaldan
ayatmajmukberdasarkanbahangrafikdengan
betul.

3.4Menulisimlakdengantepat.

3.4.2Menulisimlakfrasadanayatyang
mengandungikatagandadenganejaandan
tandabacadengantepat.

4.1Menyebutdanmemahami
unsursenidalamlagumelalui
nyanyiansecaradidikhibur.

4.1.1Menyebutsenikatalagudenganjelas
melaluinyanyiansecaradidikhibur.

1.4Isyaratjalanraya,tandajalan
danisyarattrafik

1.4.1Memahamibahawatandajalan,penenda
jalandnisyarattrafikdigunakanuntuk
mengawallalulintasdanmestidipatuhiuntuk

16

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
ISYARATDAN
PENANDAJALAN

meningkatkankeselamatan.
1.4.8Membincangkanperaturandantingkah
lakupenggunajalanrayayangberkenaan
dengantandajalanasas.

TAJUK4:JOM,JALAN
JALAN
MINGGU
17
25/41/5/16

TEMA3:SEMANGAT
PERPADUAN
UNIT11
TAJUK:SambutanHari
Kanakkanak

1.4Bertutur,berbualdan
menyatakanpermintaantentang
sesuatuperkaradaripadapelbagai
sumberdalamsituasiformaldan
tidakformalsecarabertatasusila.

1.4.4Bertuturdanmenyatakanpermintaan
denganintonasiyangbetultentangsesuatu
perkaradalamsituasitidakformalsecara
bertatasusila.

EMK:
Nilaimurni,Peraturan
Sosiobudaya,
Kewarganegaraan

1.6Berbicarauntukmenyampaikan
maklumattentangsesuatuperkara
daripadapelbagaisumberdengan
tepatsecarabertatasusila.

1.6.2Berbicarauntukmenyampaikanmaklumat
tentangsesuatuperkaradaripadapelbagai
sumberdengantepatdanjelassecara
bertatasusila.

PengisianKurikulum:
Nilai:Bekerjasama,
Hormatmenghormati,
aktif
Ilmu:PendidikanJasmani,

2.4Membacadanmemahami
2.4.1Membacadanmemahamimaklumatuntuk
maklumatyangtersuratdantersirat mengenalpastiideautamadanideasampingan
daripadapelbagaibahanuntuk
dalambahanmultimediadengantepat.
memberiresponsdenganbetul.
2.4.2Membacadanmemahamimaklumat
daripadabahanmultimediauntukmenyatakan
maklumatmengikuturutandenganbetul.

KBT:
KB(Membuatrumusan,
Menganalisis,
Membandingkandan
membezakan,Mengitlak,
Mengenalpasti,Membuat
pilihan)
BCBMencatatnota,
Bacaanintensif
KONTEKSTUAL
Mengaplikasikan,
KONSTRUKTIVISME
Menerangkandan
menjelaskan
KPInterpersonal,
Verballinguistik
Media:Bukuteks,buku
aktiviti.

2.5Membacadanmenaakuluntuk
memindahkanmaklumatyang
terdapatdalampelbagaibahan.

2.5.2Membaca,memahamidanmenaakul
bahangrafikdanbukanbahangrafikdengan
betul.
2.5.3Membaca,memahamidanmenaakul
bahanbukangrafikuntukmemindahkan
maklumatkepadabentukgrafiksertaayat
denganbetul.

3.3Membinadanmenulis
3.3.1Membinadanmenulisperkataandanfrasa
perkataan,frasa,danayatdengan dengancarayangbetuldankemas.
betul.
3.5Mencatatmaklumatyangbetul
tentangsesuatuperkaradaripada
pelbagaisumber.

3.5.1Mencatatmaklumatpentingdenganbetul
daripadapelbagaisumber.

17

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
SistemBahasa:
Tatabahasa:Imbuhan
awalan

4.3Mengujarkanbahasayang
indahdanmenggunakanbahasa
badandengankreatifmelalui
lakonansecaradidikhibur.

4.3.2Mengujarkandialogdengansebutanyang
betul,intonasiyangjelas,diksiyangtepatdan
mimikmukayangsesuaimelaluilakonansecara
didikhibur.

5.2Memahamidanmenggunakan
pembentukankatayangsesuai
dalampelbagaisituasidengan
betul.

5.2.1Memahamidanmenggunakanimbuhan
awalan,akhirandanapitandenganbetuldalam
pelbagaikonteks.

2.1Jenisdanciricirikenderaan

2.1.5Menceritakanfaktoryangmenghalang
penglihatanpemandudijalanrayadanterhadap
pejalankaki.

4.3Darjahpenglihatan

4.3.2Menunjukkankefahamankeataskaitan
antaraberadadalamkeadaanselamatdan
bolehdilihat.

TEMA3:SEMANGAT
PERPADUAN
UNIT11
TAJUK:SambutanHari
Kanakkanak

1.4Bertutur,berbualdan
menyatakanpermintaantentang
sesuatuperkaradaripadapelbagai
sumberdalamsituasiformaldan
tidakformalsecarabertatasusila.

1.4.4Bertuturdanmenyatakanpermintaan
denganintonasiyangbetultentangsesuatu
perkaradalamsituasitidakformalsecara
bertatasusila.

EMK:
Nilaimurni,Peraturan
Sosiobudaya,
Kewarganegaraan

1.6Berbicarauntukmenyampaikan
maklumattentangsesuatuperkara
daripadapelbagaisumberdengan
tepatsecarabertatasusila.

1.6.2Berbicarauntukmenyampaikanmaklumat
tentangsesuatuperkaradaripadapelbagai
sumberdengantepatdanjelassecara
bertatasusila.

PengisianKurikulum:
Nilai:Bekerjasama,
Hormatmenghormati,
aktif
Ilmu:PendidikanJasmani,

2.4Membacadanmemahami
maklu9matyangtersuratdan
tersiratdaripadapelbagaibahan
untukmemberiresponsdengan
betul.

2.4.1Membacadanmemahamimaklumatuntuk
mengenalpastiideautamadanideasampingan
dalambahanmultimediadengantepat.

KBT:
KB(membuatrumusan,
Menganalisis,
Membandingkandan

2.5Membacadanmenaakuluntuk
memindahkanmaklumatyang

2.5.2Membaca,memahamidanmenaakul
bahangrafikdanbukanbahangrafikdengan

KosaKata:
Bolasepak,Oktober,
nenek,cerminmata

TEMAPKJR:UNIT4
KEBOLEHLIHATANDI
JALANRAYA
TAJUK1:BOLEH
DILIHATDANLEBIH
SELAMAT
MINGGU
18
2/58/5/16

2.4.2Membacadanmemahamimaklumat
daripadabahanmultimediauntukmenyatakan
maklumatmengikuturutandenganbetul.

18

B3DL1E1

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
membezakan,Mengitlak,
Mengenalpasti,Membuat
pilihan
BCBMencatatnota,
Bacaanintensif
KONTEKSTUAL
Mengaplikasikan,
KONSTRUKTIVISME
Menerangkandan
menjelaskan
KPInterpersonal,
Verballinguistik
Media:Bukuteks,buku
aktiviti.
SistemBahasa:
Tatabahasa:Imbuhan
awalan
KosaKata:
Bolasepak,Oktober,
nenek,cerminmata

TEMAPKJR:UNIT4
KEBOLEHLIHATANDI
JALANRAYA

terdapatdalampelbagaibahan.

betul.
2.5.3Membaca,memahamidanmenaakul
bahanbukangrafikuntukmemindahkan
maklumatkepadabentukgrafiksertaayat
denganbetul.

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.1Membinadanmenulisperkataandanfrasa
dengancarayangbetuldankemas.

3.5Mencatatmaklumatyangbetul
tentangsesuatuperkaradaripada
pelbagaisumber.

3.5.1Mencatatmaklumatpentingdenganbetul
daripadapelbagaisumber.

4.3Mengujarkanbahasayang
indahdanmenggunakanbahasa
badandengankreatifmelalui
lakonansecaradidikhibur.

4.3.2Mengujarkandialogdengansebutanyang
betul,intonasiyangjelas,diksiyangtepatdan
mimikmukayangsesuaimelaluilakonansecara
didikhibur.

5.2Memahamidanmenggunakan
pembentukankatayangsesuai
dalampelbagaisituasidengan
betul.

5.2.1Memahamidanmenggunakanimbuhan
awalan,akhirandanapitandenganbetuldalam
pelbagaikonteks.

2.1Jenisdanciricirikenderaan

2.1.5Menceritakanfaktoryangmenghalang
penglihatanpemandudijalanrayadanterhadap
pejalankaki.

4.3Darjahpenglihatan

4.3.2Menunjukkankefahamankeataskaitan
antaraberadadalamkeadaanselamatdan
bolehdilihat.

TAJUK2:CUACADAN
WAKTU

MINGGU
19
9/515/5/16

TEMA4:SENIDAN
BUDAYA
UNIT12
TAJUK:KrafTangan

1.3Mendengar,memahamidan
memberiresponsterhadapsesuatu
arahan,soalandanpesananyang
didengardenganbetul.

4.3.3Menerangkanbagaimanakeadaancuaca
tertentudanpencahayaanbolehmemberkesan
terhadapkeselamatanpejalankakidan
penunggangbasikal.
1.3.3Mendengar,memahamidanmemberikan
responssecaralisandangeraklakuberdasarkan
pesananmengikuturutandenganbetul.

19

B4DL1E2

01Mei
Cuti
Umum
Hari
Pekerja

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
EMK:
Nilaimurni,Peraturan
Sosiobudaya,kreativiti
daninovasi,kemahiran
teknologimaklumatdan
komunikasi
PengisianKurikulum:
Nilai:Kreatif,Tolong
menolong,Bekerjasama
Ilmu:DuniaSeniVisual
KBT:
KB(Menjanakanidea,
Menyusunmaklumat,
Menghubungkaitkan,
Mengenalpasti)
BCBMencatatnota
KONTEKSTUAL
Mengaplikasikan,
KONSTRUKTIVISME
Mengembangkanidea
KPInterpersonal
Media:Bukuteks,buku
aktiviti,cartagambar,
SistemBahasa:
Tatabahasa:Imbuhan
akhiran
KosaKata:
Manik,iklan,Labu
Sayong,tembikar,bunga,
garisan

1.6Berbicarauntukmenyampaikan
maklumattentangsesuatuperkara
daripadapelbagaisumberdengan
tepatsecarabertatasusila

1.6.1Berbicarauntukmendapatkanmaklumat
yangtepattentangsesuatuperkaradaripada
pelbagaisumbersecarabertatasusila.
1.6.2Berbicarauntukmenyampaikanmaklumat
tentangsesuatuperkaradaripadapelbagai
sumberdengantepatdanjelassecara
bertatasusila.

2.4Membacadanmemahami
2.4.2Membacadanmemahamimaklumat
maklumatyangtersuratdantersirat daripadabahanmultimediauntukmenyatakan
daripadapelbagaibahanuntuk
maklumatmengikuturutandenganbetul.
memberiresponsdenganbetul.
2.4.3Membacadanmemahamimaklumatyang
tersuratdengantepatdaripadabahan
multimediayangsesuai.
2.5Membacadanmenaakuluntuk
memindahkanmaklumatyang
terdapatdalampelbagaibahan.

2.5.3Membaca,memahamidanmenaakul
bahanbukangrafikuntukmemindahkan
maklumatkepadabentukgrafiksertaayat
denganbetul.

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.1Membinadanmenulisperkataandanfrasa
dengancarayangbetuldankemas

3.5Mencatatmaklumatyangbetul
tentangsesuatuperkaradaripada
pelbagaisumber.

3.5.2Mencatatmaklumatpentingyangbetul
untukmenghubungkaitkanfaktadaripada
pelbagaisumber.

3.6Menulisuntukmenyampaikan
maklumattentangsesuatuperkara
denganmenggunakanbahasa
yangsantun.

3.6.1Menulisuntukmenyampaikanmaklumat
yangbetulmenggunakanperkataan,diksi,frasa
danayatdenganmenegaskankesantunan
berbahasasecaraberpandu.

5.2Memahamidanmenggunakan
pembentukankatayangsesuai
dalampelbagaisituasidengan
betul.

5.2.1Memahamidanmenggunakanimbuhan
awalan,akhirandanapitandenganbetuldalam
pelbagaikonteks.

1.3Perabotjalanraya

1.3.1Mendefinisikanapayangdimaksudkan
demgamperabotjalanraya.

20

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
TEMAPKJR:UNIT4
KEBOLEHLIHATANDI
JALANRAYA
TAJUK3:PERABOT
JALAN

MINGGU
20
16/522/5/16

TEMA4:SENIDAN
BUDAYA
UNIT13
TAJUK:Permainan
Tradisional

1.3.2Mengenalpastiperabotjalanyang
berlainanjenisdanbagaimanaiamemberiimpak
ataskeselamatanmerekayangberjalankakidan
berbasikal.
2.1Jenisdanciricirikenderaan

2.1.5Menceritakanfaktoryangmenghalang
penglihatanpemandudijalanrayadanterhadap
pejalankaki.

4.3Darjahpenglihatan

4.3.2Menunjukkankefahamankeataskaitan
antaraberadadalamkeadaanselamatdan
bolehdilihat.

1.6Berbicarauntukmenyampaikan
maklumattentangsesuatuperkara
daripadapelbagaisumberdengan
tepatsecarabertatasusila.

1.6.2Berbicarauntukmenyampaikanmaklumat
tentangsesuatuperkaradaripadapelbagai
sumberdengantepatdanjelassecara
bertatasusila.
1.6.3Berbicarauntukmenyampaikanmaklumat
dengantepattentangsesuatuperkaradaripada
pelbagaisumberdenganmenggunakanayat
yangmengandungirangkaikatayangsesuai
secarabertatasusila.

EMK:
Nilaimurni,Peraturan
Sosiobudaya,Kecergasan
pelbagai
PengisianKurikulum:
Nilai:Bekerjasama,Jujur,
keselamatan
Ilmu:PendidikanJasmani
KBT:
KB(Menghubungkaitkan,
Menjanakanidea,
Membuatkeputusan)
BCBMencatatmaklumat
KPInterpersonal
Media:Bukuteks,buku
aktiviti,congkak
SistemBahasa:
Tatabahasa:Imbuhan

2.5Membacadanmenaakuluntuk
memindahkanmaklumatyang
terdapatdalampelbagaibahan.

2.5.1Membacadanmemahamibahangrafik
yangmempunyaiperkataandenganbetul.
2.5.2Membaca,memahamidanmenaakul
bahangrafikdanbukanbahangrafikdengan
betul.

2.6Membacapelbagaibahan
sasteradanbukansasterayang
sesuaibagimemupukminat
membaca.

2.6.1Membacapelbagaibahankreatifyang
sesuaiuntukmenambahkosakatadan
meningkatkankelancaranbacaan.

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.1Membinadanmenulisperkataandanfrasa
dengancarayangbetuldankemas

21

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
apitan
KosaKata:
Tradisional,BolaRaga,
Rampanau,timangan

3.6Menulisuntukmenyampaikan
maklumattentangsesuatuperkara
denganmenggunakanbahasa
yangsantun.

3.6.1Menulisuntukmenyampaikanmaklumat
yangbetulmenggunakanperkataan,diksi,frasa
danayatdenganmenegaskankesantunan
berbahasasecaraberpandu.

5.2Memahamidanmenggunakan
pembentukankatayangsesuai
dalampelbagaisituasidengan
betul.

5.2.1Memahamidanmenggunakanimbuhan
awalan,akhirandanapitandenganbetuldalam
pelbagaikonteks.

2.1Jenisdanciricirikenderaan

2.1.5Menceritakanfaktoryangmenghalang
penglihatanpemandudijalanrayadanterhadap
pejalankaki.

4.3Darjahpenglihatan

4.3.1Menunjukkankesedarankesansaizbadan
merekayangkecilkeataskeselamatanmereka.

TEMAPKJR:UNIT4
KEBOLEHLIHATANDI
JALANRAYA
TAJUK4:
KEBOLEHLIHATANDI
ANTARADUABUAH
KERETAYANG
DILETAKKAN
MINGGU
21
23/529/5
/16

TEMA4:SENIDAN
BUDAYA
UNIT14
TAJUK:Makanan
Tradisional
EMK:
Nilaimurni,Peraturan
Sosiobudaya,
Kewarganegaraan
PengisianKurikulum:
Nilai:Hormat
menghormati,bersikap
terbuka,rajin
Ilmu:PendidikanSains,
KemahiranHidup,
PendidikanSivik
KBT:

4.3.2Menunjukkankefahamankeataskaitan
antaraberadadalamkeadaanselamatdan
bolehdilihat.
1.5Berceritadanmenceritakan
sesuatuperkarasemuladengan
tepatmenggunakansebutanyang
jelasdanintonasiyangbetul.

1.5.1Berceritatentangsesuatuperkaradengan
tepat,sebutanyangjelasdanintonasiyangbetul
menggunakanayatmajmuk.

1.7Berbincangdanmengemukakan 1.7.2Berbincangdanmengemukakanpendapat
pendapattentangsesuatuperkara
tentangsesuatuperkaradaripadapelbagai
daripadapelbagaisumbersecara
sumbersecarabertatasusila.
bertatasusila.
2.3Membacakuatpelbagaibahan
bacaandenganlancar,sebutan
yangjelasdanintonasiyangbetul.

2.3.1Membacakuatayatpenyatadengan
lancar,sebutanyangjelas,intonasiyangbetul
danberjeda.
2.3.2Membacakuatpelbagaijenisayatdengan
lancar,sebutanyangjelasdanintonasiyang
betulmengikuttandabaca.

2.4Membacadanmemahami
2.4.3Membacadanmemahamimaklumatyang
maklumatyangtersuratdantersirat tersuratdengantepatdaripadabahan

22

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
KB(Mentafsir,
Membandingkandan
membezakan,
Menjanakanidea,
Mengenalpasti)
BCBBacaanintensif,
Menuliscepat,Mengingat
KONSTRUKTIVISME
Mengembangkanidea
KPInterpersonal

daripadapelbagaibahanuntuk
memberiresponsdenganbetul.

multimediayangsesuai.

3.4Menulisimlakdengantepat.

3.4.2Menulisimlakfrasadanayatyang
mengandungikatagandadenganejaandan
tandabacadengantepat.

3.5Mencatatmaklumatyangbetul
tentangsesuatuperkaradaripada
pelbagaisumber.

3.5.1Mencatatmaklumatpentingdenganbetul
daripadapelbagaisumber.

Media:Bukuteks,buku
aktiviti,gambar

3.7Menghasilkanpenulisankreatif
3.7.1Menghasilkanpenulisanberbentuknaratif
dalampelbagaigenredenganbetul. secaraseparaterkawaldenganbetul.

SistemBahasa:
Tatabahasa:Ayatmajmuk.
Ayattanya
KosaKata:
Ambuyat,Baulu,Kuih
Bakul,KuihBulan,acuan,
melekit,bijiteratai

1.1Jenisjenisjalanraya

1.1.1
Memahamibahawajalanrayaadalah
tempatyangkompleksdanberbahaya.

TEMAPKJR:UNIT5
MENGIMBASLALU
LINTAS

1.5Aliranlalulintasarahlalu
lintas

1.5.1Kenalpastiarahdatangnyalalulintas.

7.3Pemilihanruangdan
pengimbasan

7.1.3Mengenalpastitempatyangpalingselamat
untukmelintasjalan.

TAJUK1:JALANRAYA
ADALAHKOMPLEKS
DANBERBAHAYA
MINGGU
22
30/55/6/16

25Mei
09Jun
2013

CUTIPERTENGAHANTAHUN

MINGGU
23
6/612/6/16

Minggu

Tema/Tajuk

HasilPembelajaran
(StandardKandungan)

PENGGAL2
CadanganAktivitiPembelajaran
(StandardPembelajaran)

23

KodEvidens
Pentaksiran

Catatan

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
MINGGU
24
13/6
19/6/16

TEMA4:
SENIDANBUDAYA
UNIT15
TAJUK:WarisanKita

1.5Berceritadanmenceritakan
sesuatuperkarasemuladengan
tepatmenggunakansebutanyang
jelasdanintonasiyangbetul.

EMK:
Nilaimurni,Peraturan
Sosiobudaya,
Kewarganegaraan

1.7Berbincangdanmengemukakan 1.7.1Berbincangdanmengemukakan
pendapattentangsesuatuperkara
pandangantentangsesuatuperkaradaripada
daripadapelbagaisumbersecara
pelbagaisumbersecarabertatasusila.
bertatasusila.

PengisianKurikulum:
Nilai:Bekerjasama,
Bertanggungjawab,
bersemangat,berani
Ilmu:PendidikanSivik,
PendidikanMuzik

2.5Membacadanmenaakuluntuk
memindahkanmaklumatyang
terdapatdalampelbagaibahan.

2.5.1Membacadanmemahamibahangrafik
yangmempunyaiperkataandenganbetul.

2.6Membacapelbagaibahan
sasteradanbukansasterayang
sesuaibagimemupukminat
membaca.

2.6.1Membacapelbagaibahankreatifyang
sesuaiuntukmenambahkosakatadan
meningkatkankelancaranbacaan.

KBT:
KB(Menaakul,
Menghubungkaitkan,
Mengenalpasti,Menjanakan
idea)
BCBBacaanintensif
KONTEKSTUAL
Menghubungkaitkan
KPInterpersonal
Media:Bukuteks,buku
aktiviti,gambar,

SistemBahasa:
Tatabahasa:Kataganda,
Ayatmajmuk
KosaKata:
Kompang,nyayian,perigi,
telefon,Samfu,Ceongsam,
setem

1.5.1Berceritatentangsesuatuperkaradengan
tepat,sebutanyangjelasdanintonasiyangbetul
menggunakanayatmajmuk.

2.6.2Membacadanmemahamipelbagaibahan
bacaanberbentukdidikhiburuntuk
menambahkanilmudankosakata.
3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.1Membinadanmenulisperkataandanfrasa
dengancarayangbetuldankemas.
3.3.3Membinadanmenulisjawapandalam
bentukayatmudahdenganbetulberdasarkan
soalan.

3.6Menulisuntukmenyampaikan
maklumattentangsesuatuperkara
denganmenggunakanbahasa
yangsantun.

3.6.2Menulisuntukmenyampaikanmaklumat
berbentukpuisidenganmenegaskankesantunan
berbahasasecaraberpandu.

4.2Mengujarkanbahasayang
indahdanmenggunakanbahasa
badansecarakreatifsemasa
berceritasecaradidikhibur.
5.2Memahamidanmenggunakan
pembentukankatayangsesuai
dalampelbagaisituasidengan
betul.

4.2.1Mengujarkanayatdengansebutanyang
betul,intonasiyangjelasdandiksiyangtepat
melaluipenceritaansecaradidikhibur.
5.2.2Memahamidanmenggunakankataganda
penuhdenganbetuldalampelbagaikonteks.

24

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
TEMAPKJR:UNIT5
MENGIMBASLALU
LINTAS

7.3Pemilihanruangdan
pengimbasan

7.3.1Memahamiapayangdimaksudkandengan
mengimbalalulintasuntukmengenalpastirisiko
danbahaya.

TEMA4:SENIDAN
BUDAYA
UNIT15
TAJUK:WarisanKita

1.5Berceritadanmenceritakan
sesuatuperkarasemuladengan
tepatmenggunakansebutanyang
jelasdanintonasiyangbetul.

1.5.1Berceritatentangsesuatuperkaradengan
tepat,sebutanyangjelasdanintonasiyangbetul
menggunakanayatmajmuk.

EMK:
Nilaimurni,Peraturan
Sosiobudaya,
Kewarganegaraan

1.7Berbincangdanmengemukakan 1.7.1Berbincangdanmengemukakan
pendapattentangsesuatuperkara
pandangantentangsesuatuperkaradaripada
daripadapelbagaisumbersecara
pelbagaisumbersecarabertatasusila.
bertatasusila.

PengisianKurikulum:
Nilai:Bekerjasama,
Bertanggungjawab,
bersemangat,berani
Ilmu:PendidikanSivik,
PendidikanMuzik

2.5Membacadanmenaakuluntuk
memindahkanmaklumatyang
terdapatdalampelbagaibahan.

2.5.1Membacadanmemahamibahangrafik
yangmempunyaiperkataandenganbetul.

2.6Membacapelbagaibahan
sasteradanbukansasterayang
sesuaibagimemupukminat
membaca.

2.6.1Membacapelbagaibahankreatifyang
sesuaiuntukmenambahkosakatadan
meningkatkankelancaranbacaan.

TAJUK2:
MENGIMBASLALU
LINTAS
MINGGU
25
20/6
26/6/16

KBT:
KB(Menaakul,
Menghubungkaitkan,
Mengenalpasti,Menjanakan
idea)
BCBBacaanintensif
KONTEKSTUAL
Menghubungkaitkan
KPInterpersonal
Media:Bukuteks,buku
aktiviti,barangmaujud

2.6.2Membacadanmemahamipelbagaibahan
bacaanberbentukdidikhiburuntuk
menambahkanilmudankosakata.
3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.1Membinadanmenulisperkataandanfrasa
dengancarayangbetuldankemas.
3.3.3Membinadanmenulisjawapandalam
bentukayatmudahdenganbetulberdasarkan
soalan.

3.6Menulisuntukmenyampaikan
maklumattentangsesuatuperkara
denganmenggunakanbahasayang

3.6.2Menulisuntukmenyampaikanmaklumat
berbentukpuisidenganmenegaskankesantunan
berbahasasecaraberpandu.

25

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
SistemBahasa:
Tatabahasa:Kataganda,
Ayatmajmuk
KosaKata:
Kompang,nyayian,perigi,
telefon,Samfu,Ceongsam,
setem

TEMAPKJR:UNIT5
MENGIMBASLALU
LINTAS

santun.
4.2Mengujarkanbahasayang
indahdanmenggunakanbahasa
badansecarakreatifsemasa
berceritasecaradidikhibur.

4.2.1Mengujarkanayatdengansebutanyang
betul,intonasiyangjelasdandiksiyangtepat
melaluipenceritaansecaradidikhibur.

5.2Memahamidanmenggunakan
pembentukankatayangsesuai
dalampelbagaisituasidengan
betul.

5.2.2Memahamidanmenggunakankataganda
penuhdenganbetuldalampelbagaikonteks.

7.2Proseduryangselamatuntuk
melintas.

7.2.6Menggunakanpelbagaikemahirandan
pancainderamerekauntukmengumpul
maklumatmengenailalulintas.

1.3Mendengar,memahamidan
memberiresponsterhadapsesuatu
arahan,soalandanpesananyang
didengardenganbetul.

1.3.1Mendengar,memahamidanmemberikan
responsyangsesuaisecaralisanataugeraklaku
terhadaparahanberdasarkanayatperintahjenis
silaandanayatperintahjenislarangandengan
betul.

2.3Membacakuatpelbagaibahan
bacaandenganlancar,sebutan
yangjelasdanintonasiyangbetul.

2.3.1Membacakuatayatpenyatadengan
lancar,sebutanyangjelas,intonasiyangbetul
danberjeda.

TAJUK3:MENCARI
PETUNJUK
MINGGU
26
27/6
3/7/16

TEMA5:PETANIMODEN
UNIT16
TAJUK:KebunSekolahku
EMK:
Nilaimurni,Peraturan
Sosiobudaya,Kecerdasan
pelbagai,
PengisianKurikulum:
Nilai:Rajin,gigihberusaha,
pemurah
Ilmu:KemahiranHidup,
PendidikanSains
KBT:
KB(Membuaturutan,
Mengenalpasti)
BCBMendengardengan
berkesan,Mencatatnota,
Bacaanintensif
KONTEKSTUAL
Menghubungkaitkan

2.3.2Membacakuatpelbagaijenisayatdengan
lancar,sebutanyangjelasdanintonasiyang
betulmengikuttandabaca.
2.4Membacadanmemahami
maklumatyangtersuratdantersirat
daripadapelbagaibahanuntuk
memberiresponsdenganbetul.
2.6Membacapelbagaibahan
sasteradanbukansasterayang
sesuaibagimemupukminat
membaca.

2.4.2Membacadanmemahamimaklumat
daripadabahanmultimediauntukmenyatakan
maklumatmengikuturutandenganbetul.
2.6.1Membacapelbagaibahankreatifyang
sesuaiuntukmenambahkosakatadan
meningkatkankelancaranbacaan.

26

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
KPVerballinguistik
Media:Bukuteks,buku
aktiviti.

3.4Menulisimlakdengantepat.

3.4.1Menulisimlakperkataanyang
mengandungikatagandadengantepat.

SistemBahasa:
Tatabahasa:AyatPenyata

3.7Menghasilkanpenulisankreatif
3.7.2Menghasilkanpenulisanberbentuknaratif
dalampelbagaigenredenganbetul. danbukannaratifsecaraseparaterkawal
denganbetul.

KosaKata:
Jagung,keledek,kangkung,
bayam,lobak,bajaorganik,
motivasi

4.2Mengujarkanbahasayang
indahdanmenggunakanbahasa
badansecarakreatifsemasa
berceritasecaradidikhibur.

4.2.2Mengujarkanayatdengansebutanyang
betul,intonasiyangjelasdandiksiyangtepat
sertamenggunakanmimikmukayangsesuai
melaluipenceritaansecaradidikhibur.

5.3Memahamidanmembinaayat
yangbetuldalampelbagaisituasi

5.3.1Memahamidanmembinaayat
dasarmenggunakanpolaayatFN+FN,FN+
FK,FN+FAdanFN+FSNdenganbetuldalam
pelbagaikonteks.

7.2Proseduryangselamatuntuk
melintas.

7.2.6Menggunakanpelbagaikemahirandan
pancainderamerekauntukmengumpul
maklumatmengenailalulintas.

1.3Mendengar,memahamidan
memberiresponsterhadapsesuatu
arahan,soalandanpesananyang
didengardenganbetul.

1.3.2Mendengar,memahamidanmemberikan
responsdenganbetulsecaralisanterhadap
pelbagaisoalanbercapah.

2.3Membacakuatpelbagaibahan
bacaandenganlancar,sebutan
yangjelasdanintonasiyangbetul.

2.3.1Membacakuatayatpenyatadengan
lancar,sebutanyangjelas,intonasiyangbetul
danberjeda.

2.4Membacadanmemahami
maklumatyangtersuratdantersirat
daripadapelbagaibahanuntuk
memberiresponsdenganbetul.

2.4.1Membacadanmemahamimaklumatuntuk
mengenalpastiideautamadanideasampingan
dalambahanmultimediadengantepat.
2.4.2Membacadanmemahamimaklumat
daripadabahanmultimediauntukmenyatakan
maklumatmengikuturutandenganbetul.

TEMAPKJR:UNIT5
MENGIMBASLALU
LINTAS

B4DB1E1

B2DT1E3

TAJUK4:PEMERHATIAN
LALULINTAS
MINGGU
27
4/7
10/7/16

TEMA5:PETANIMODEN
UNIT17
TAJUK:DusunPakLong
EMK:
Nilaimurni,Peraturan
Sosiobudaya,
Kewarganegaraan
PengisianKurikulum:
Nilai:Bekerjasama,Jujur,
penyayang,pemurah
Ilmu:PendidikanMuzik,
KBT:
KB(Menjanakanidea,
Mengenalpasti)

2.4.3Membacadanmemahamimaklumatyang

27

30Jun
Sukan
Tahunan
01Julai
Cuti
Peristiwa3

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
BCBMendengardengan
berkesan,Bacaanintensif
KONTEKSTUAL
Menghubungkaitkan
Media:Bukuteks,buku
aktiviti,poster
SistemBahasa:
Tatabahasa:Tandabaca,
AyatPenyata,KataKerja

tersuratdengantepatdaripadabahan
multimediayangsesuai.
3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.3Membinadanmenulisjawapandalam
bentukayatmudahdenganbetulberdasarkan
soalan

3.8Mengeditdanmemurnikanhasil
penulisan.

3.8.1Mengeditperkataandalamayatdaripada
aspekejaandantandabaca

5.3Memahamidanmembinaayat
yangbetuldalampelbagaisituasi.

5.3.1Memahamidanmembinaayatdasar
menggunakanpolaayatFN+FN,FN+FK,FN+
FAdanFN+FSNdenganbetuldalampelbagai
konteks.

6.1Tingkahlakuyangselamatdan
bertanggungjawabseseorang
penumpang.

6.1.1Menerangkankepentinganuntukmenjadi
penumpangyangselamatdan
bertanggungjawab.

6.2.4Membincangkantanggungjawabdarisegi
undangundanguntukpenumpangsupaya
memakaitalipinggangkeledardenganbetul.

KosaKata:
Dusun,harum,akartunjang,
bakul,cangkul,baja
TEMAPKJR:UNIT6
MENJADIPENUMPANG
YANGSELAMATDAN
BERTANGGUNGJAWAB

6.2Penggunaanalatpenahan

TAJUK1:
TALIPINGGANG
KELEDAR

MINGGU
28
11/7
17/7/16

TEMA5:PETANIMODEN
UNIT18
TAJUK:Ternakan

6.2.6Menerangkanakibatkepadapenumpang
danobjekdidalamkenderaanapabilakenderaan
tersebutmembelokdselekohtajamatau
melanggarobjek.
10.1Kesandaripadatingkahlaku
yangberisiko.

10.1.3Mengenalpastitingkahlakupengguna
jalanrayayangbertanggungjawab.

1.3Mendengar,memahamidan
memberiresponsterhadapsesuatu
arahan,soalandanpesananyang
didengardenganbetul.

1.3.2Mendengar,memahamidanmemberikan
responsdenganbetulsecaralisanterhadap
pelbagaisoalanbercapah.

EMK:
Nilaimurni,Peraturan
Sosiobudaya,TMK
PengisianKurikulum:
Nilai:Rajinberusaha,

1.3.3Mendengar,memahamidanmemberikan
responssecaralisandangeraklakuberdasarkan
pesananmengikuturutandenganbetul.
2.3Membacakuatpelbagaibahan
bacaandenganlancar,sebutan

2.3.1Membacakuatayatpenyatadengan
lancar,sebutanyangjelas,intonasiyangbetul

28

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
pemurah,bersyukur,jujur
Ilmu:DuniaSainsdan
Teknologi,KemahiranHidup

yangjelasdanintonasiyangbetul.

2.3.2Membacakuatpelbagaijenisayatdengan
lancar,sebutanyangjelasdanintonasiyang
betulmengikuttandabaca.

KBT:
KB(Menjanakanidea,
Membuaturutan,
Menganalisis,Mengenal
pasti)
BCBBacaanintensif
KONTEKSTUAL
Menghubungkaitkan
KPInterpersonal

2.4Membacadanmemahami
2.4.2Membacadanmemahamimaklumat
maklumatyangtersuratdantersirat daripadabahanmultimediauntukmenyatakan
daripadapelbagaibahanuntuk
maklumatmengikuturutandenganbetul.
memberiresponsdenganbetul.
2.4.3Membacadanmemahamimaklumatyang
tersuratdengantepatdaripadabahan
multimediayangsesuai.

Media:Bukuteks,buku
aktiviti,cartagambar

3.8Mengeditdanmemurnikanhasil
penulisan.

3.8.2Mengeditdanmemurnikanperkataan
dalamayatdaripadaaspekejaandantanda
baca.

SistemBahasa:
Tatabahasa:Tandabaca,
AyatPenyata,KataAdjektif

5.3Memahamidanmembinaayat
yangbetuldalampelbagaisituasi.

5.3.1Memahamidanmembinaayatdasar
menggunakanpolaayatFN+FN,FN+FK,FN+
FAdanFN+FSNdenganbetuldalampelbagai
konteks.

6.1Tingkahlakuyangselamatdan
bertanggungjawabseseorang
penumpang.

6.1.1Menerangkankepentinganuntukmenjadi
penumpangyangselamatdan
bertanggungjawab.

6.2.4Membincangkantanggungjawabdarisegi
undangundanguntukpenumpangsupaya
memakaitalipinggangkeledardenganbetul.
6.2.6Menerangkanakibatkepadapenumpang
danobjekdidalamkenderaanapabilakenderaan
tersebutmembelokdselekohtajamatau
melanggarobjek.

KosaKata:
Pejal,lembut,risalah,urutan,
rimbun
TEMAPKJR:UNIT6
MENJADIPENUMPANG
YANGSELAMATDAN
BERTANGGUNGJAWAB

6.2Penggunaanalatpenahan

TAJUK2:MENJADI
PENUMPANGYANG
BERTANGGUNGJAWAB

MINGGU
29

danberjeda.

TEMA5:
PETANIMODEN

10.1Kesandaripadatingkahlaku
yangberisiko.

10.1.3Mengenalpastitingkahlakupengguna
jalanrayayangbertanggungjawab.

1.4Bertutur,berbualdan
menyatakanpermintaantentang

1.4.1Berbualtentangsesuatuperkaradengan
menggunakanayattunggaldanayatmajmuk

29

B3DT1E1

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
18/7
24/7/16

UNIT19
TAJUK:HasilLaut
EMK:
Ilmu,peraturansosiobudaya,
kreatifdaninovatif
PengisianKurikulum:
Nilai:kebersihan,kegigihan,
kreatif
Ilmu:DST,KemahiranHidup
KBT:
KB(Menjanakanidea,
Mensistesis,Mengenalpasti,
Membandingkandan
membezakan,Menganalisis,)
BCBBacaanintensif,
Mencatatmaklumat
KONTEKSTUAL
Menghubungkaitkan
KPInterpersonal,Naturalis
Media:Bukuteks,buku
aktiviti.
SistemBahasa:
Tatabahasa:AyatMajmuk,
AyatPenyata,KataSendi
Nama
KosaKata:
Ikanbilis,produk,protein,
vitamin,sagu,keropoklekor,
enak,sate

sesuatuperkaradaripadapelbagai
sumberdalamsituasiformaldan
tidakformalsecarabertatasusila.

yangbetuldalamsituasitidakformalsecara
bertatasusila.

2.2Membacadanmemahami
perkataan,frasadanayatdaripada
pelbagaisumberdengansebutan
yangbetul.

2.2.3Membacadanmemahamiayatmajmuk
daripadapelbagaibahanbacaandengansebutan
yangbetul.

2.3Membacakuatpelbagaibahan
bacaandenganlancar,sebutan
yangjelasdanintonasiyangbetul.

2.3.1Membacakuatayatpenyatadengan
lancar,sebutanyangjelas,intonasiyangbetul
danberjeda.

2.4Membacadanmemahami
2.4.3Membacadanmemahamimaklumatyang
maklumatyangtersuratdantersirat tersuratdengantepatdaripadabahan
daripadapelbagaibahanuntuk
multimediayangsesuai.
memberiresponsdenganbetul.
2.6Membacapelbagaibahan
sasteradanbukansasterayang
sesuaibagimemupukminat
membaca.

2.6.2Membacadanmemahamipelbagaibahan
bacaanberbentukdidikhiburuntuk
menambahkanilmudankosakata.

3.2Menulissecaramekanis
berdasarkanbahanyangdiberi
denganbetuldankemas.

3.2.6Menulisayatmajmukdenganbetuldan
kemas.

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.4Membinadanmenulisayattunggaldan
ayatmajmukberdasarkanbahangrafikdengan
betul.

3.4Menulisimlakdengantepat.

3.4.2Menulisimlakfrasadanayatyang
mengandungikatagandadenganejaandan
tandabacadengantepat.

3.5Mencatatmaklumatyangbetul
tentangsesuatuperkaradaripada
pelbagaisumber.

3.5.1Mencatatmaklumatpentingdenganbetul
daripadapelbagaisumber.

4.4Melafazdanmemahamipuisi
denganintonasiyangbetul
menggunakanbahasayangindah

4.4.2Membinapantunempatkeratsecara
berpandudanmelafazkannyadengansebutan
yangbetuldanintonasiyangjelassecaradidik

30

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)

TEMAPKJR:UNIT7
MENJADIPENGGUNA
JALANRAYAYANG
BERHEMAH

secaradidikhibur.

hibur.

5.3Memahamidanmembinaayat
yangbetuldalampelbagaisituasi.

5.3.1Memahamidanmembinaayatdasar
menggunakanpolaayatFN+FN,FN+FK,FN+
FAdanFN+FSNdenganbetuldalampelbagai
konteks.

1.6Laluankakidanlaluankongsi
untukpejalankakidanpenunggang
basikal.

1.6.3Mengenalpastipenggunajalanrayayang
manamungkinberkongsilaluansecarasahatau
tidaksah,sertakemungkinanbahayanyakepada
pejalankakidanpenunggangbasikal.

TAJUK1:PENGGUNA
JALANRAYAYANG
BERHEMAH

MINGGU
30
25/7
31/7/16

TEMA7
SAYAANAKMALAYSIA
UNIT24
TAJUK:JalurGemilang

EMK:
Ilmu,kajianmasadepan,
kreatifdaninovatif,
PengisianKurikulum:
Nilai:Prihatin,Cintakan
negara,Hormat
menghormati,bersemangat
Ilmu:DSV,PendidikanMuzik
KBT:
KBMenjanakanidea,
Menaakul,Mengenalpasti,
Menyusunmaklumat,
Mengitlak

B4DT1E1

1.6.4Membandingkanpenggunaanyang
bertanggungjawabdanbertimbangrasadi
laluan/lorongpejalankakidan/ataulaluan
kongsidengankemungkinanberlakunyaaktiviti
berbahawadanberisiko.
1.4Bertutur,berbualdan
menyatakanpermintaantentang
sesuatuperkaradaripadapelbagai
sumberdalamsituasiformaldan
tidakformalsecarabertatasusila.

1.4.3Berbualtentangsesuatuperkara
menggunakankatagantinamadiriketiga
denganbetuldalamsituasitidakformalsecara
bertatasusila.

1.5Berceritadanmenceritakan
sesuatuperkarasemuladengan
tepatmenggunakansebutanyang
jelasdanintonasiyangbetul.

1.5.1Berceritatentangsesuatuperkaradengan
tepat,sebutanyangjelasdanintonasiyangbetul
menggunakanayatmajmuk.

2.2Membacadanmemahami
perkataan,frasadanayatdaripada
pelbagaisumberdengansebutan
yangbetul.

2.2.3Membacadanmemahamiayatmajmuk
daripadapelbagaibahanbacaandengansebutan
yangbetul.

2.5Membacadanmenaakuluntuk
memindahkanmaklumatyang
terdapatdalampelbagaibahan.

2.5.1Membacadanmemahamibahangrafik
yangmempunyaiperkataandenganbetul.
2.5.2Membaca,memahamidanmenaakul
bahangrafikdanbukanbahangrafikdengan
betul.

31

25Julai
Cuti
Umum
NuzulAl
Quran

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
BCBMenulismaklumat
KONTEKSTUAL
Menghubungkaitkan
KPVerballinguistik,Muzik

2.6Membacapelbagaibahan
sasteradanbukansasterayang
sesuaibagimemupukminat
membaca.

2.6.2Membacadanmemahamipelbagaibahan
bacaanberbentukdidikhiburuntuk
menambahkanilmudankosakata.

Media:Bukuteks,buku
aktiviti,bendera

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.1Membinadanmenulisperkataandanfrasa
dengancarayangbetuldankemas.

3.7Menghasilkanpenulisankreatif
dalampelbagai
genredenganbetul.

3.7.1Menghasilkanpenulisanberbentuknaratif
secaraseparaterkawaldenganbetul.

4.1Menyebutdanmemahami
unsursenidalamlagumelalui
nyanyiansecaradidikhibur.
5.2Memahamidanmenggunakan
pembentukankatayangsesuai
dalampelbagaisituasidengan
betul.

4.1.2Memahamidanmenyatakanmaksud
perkataandalamsenikatalagumelaluinyanyian
dangeraklakusecaradidikhibur.
5.2.1Memahamidanmenggunakanimbuhan
awalan,akhirandanapitandenganbetuldalam
pelbagaikonteks.

1.6Laluankakidanlaluankongsi
untukpejalankakidanpenunggang
basikal.

1.6.3Mengenalpastipenggunajalanrayayang
manamungkinberkongsilaluansecarasahatau
tidaksah,sertakemungkinanbahayanyakepada
pejalankakidanpenunggangbasikal.

SistemBahasa:
Tatabahasa:Imbuhan
Awalan
KosaKata:
JalurGemilang,perarakan,
merdeka,tentera

TEMAPKJR:UNIT7
MENJADIPENGGUNA
JALANRAYAYANG
BERHEMAH

1.6.4Membandingkanpenggunaanyang
bertanggungjawabdanbertimbangrasadi
laluan/lorongpejalankakidan/ataulaluan
kongsidengankemungkinanberlakunyaaktiviti
berbahawadanberisiko.

TAJUK2:BERHEMAHDI
JALANRAYA

MINGGU
31
1/87/8/16

TEMA7
SAYAANAKMALAYSIA
UNIT25
TAJUK:BahasaKita
EMK:
Ilmu,Pembelajaran
Konstruktivisme,Kreatifdan
inovatif,

1.4Bertutur,berbualdan
menyatakanpermintaantentang
sesuatuperkaradaripadapelbagai
sumberdalamsituasiformaldan
tidakformalsecarabertatasusila.

1.4.4Bertuturdanmenyatakanpermintaan
denganintonasiyangbetultentangsesuatu
perkaradalamsituasitidakformalsecara
bertatasusila.

2.2Membacadanmemahami
perkataan,frasadanayatdaripada
pelbagaisumberdengansebutan

2.2.3Membacadanmemahamiayatmajmuk
daripadapelbagaibahanbacaandengansebutan
yangbetul.

32

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
PengisianKurikulum:
Nilai:Prihatin,Cintakan
negara,Hormat
menghormati,bersemangat
Ilmu:DSV
KBT:
KBMengenalpasti
BCBBacaanintensif
KONTEKSTUAL
Menghubungkaitkan,
mengaplikasikan

yangbetul.
2.3Membacakuatpelbagaibahan
bacaandenganlancar,sebutan
yangjelasdanintonasiyangbetul.

2.3.1Membacakuatayatpenyatadengan
lancar,sebutanyangjelas,intonasiyangbetul
danberjeda.

2.4.3Membacadanmemahamimaklumatyang
2.4Membacadanmemahami
maklumatyangtersuratdantersirat tersuratdengantepatdaripadabahan
multimediayangsesuai.
daripadapelbagaibahanuntuk
memberiresponsdenganbetul.
2.6Membacapelbagaibahan
sasteradanbukansasterayang
sesuaibagimemupukminat
membaca.

2.6.1Membacapelbagaibahankreatifyang
sesuaiuntukmenambahkosakatadan
meningkatkankelancaranbacaan.

3.2Menulissecaramekanis
berdasarkanbahanyangdiberi
denganbetuldankemas.

3.2.7Menulissecaramekanisabjaddan
perkataandalambentuktulisanberangkai
denganbetul.

3.8Mengeditdanmemurnikanhasil
penulisan.

3.8.2Mengeditdanmemurnikanperkataan
dalamayatdaripadaaspekejaandantanda
baca.

5.2Memahamidanmenggunakan
pembentukankatayangsesuai
dalampelbagaisituasidengan
betul.

5.2.2Memahamidanmenggunakankataganda
penuhdenganbetuldalampelbagaikonteks.

TEMAPKJR:UNIT8
MELINTASDENGAN
SELAMAT

4.2Arahyangpalingselamatuntuk
pejalankaki

TAJUK1:MELINTAS
DENGANSELAMAT

7.1Memilihtempatyangselamat
untukmelintas

4.2.1Menerangkankenapaberjalan
menghadaplalulintasadalahlebihselamat
daripadaberjalanmengikutarahyangsama
dengankenderaan.
7.1.1Memahamibahawajalanrayaadalah
tempatyangberbahaya,melintasjalanraya
adalahkompleksdanorangdewasaboleh
membantukanakkanakuntukmelintasdengan
selamat.
7.1.2Mengenalpastidanmenerangkan
bahagianbahagianpersekitaranjalanrayayang
dapatmeningkatkankeselamatansewaktu
melintas.

Media:Bukuteks,buku
aktiviti,logosekolah
SistemBahasa:
Tatabahasa:KataGanda
Penuh
KosaKata:
Logo,Warna,cipta,obor,
syabas,restoran

33

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
7.1.3Mengenalpastitempatyangpalingselamat
untukmelintasjalan.
7.1.5Membincangkankelebihandankeburukan
dariaspekkeselamatanjikamenggunakanatau
tidakmenggunakantempatmelintasyang
ditentukan.
MINGGU
32
8/8
14/8/16

TEMA7
SAYAANAKMALAYSIA
UNIT26
TAJUK:NegaraKita

1.5Berceritadanmenceritakan
sesuatuperkarasemuladengan
tepatmenggunakansebutanyang
jelasdanintonasiyangbetul.

EMK:
Ilmu,Pembelajaran
Konstruktivisme,Kreatifdan
inovatif,

1.7Berbincangdanmengemukakan 1.7.2Berbincangdanmengemukakanpendapat
pendapattentangsesuatuperkara
tentangsesuatuperkaradaripadapelbagai
daripadapelbagaisumbersecara
sumbersecarabertatasusila.
bertatasusila.

PengisianKurikulum:
Nilai:Prihatin,Cintakan
negara,Hormat
menghormati,bersemangat
Ilmu:DSV,PendidikanMuzik

2.3Membacakuatpelbagaibahan
bacaandengan
lancar,sebutanyangjelasdan
intonasiyangbetul

2.3.2Membacakuatpelbagaijenisayatdengan
lancar,sebutanyangjelasdanintonasiyang
betulmengikuttandabaca.

3.2Menulissecaramekanis
berdasarkanbahanyangdiberi
denganbetuldankemas.

3.2.6Menulisayatmajmukdenganbetuldan
kemas.

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.2Membinadanmenulisayatyang
mengandungiperkataanduaataulebihsuku
kata,diftong,vokalberganding,digrafdan
konsonanbergabungdenganbetul.

3.7Menghasilkanpenulisankreatif
dalampelbagaigenredenganbetul.

3.7.2Menghasilkanpenulisanberbentuknaratif
danbukannaratifsecaraseparaterkawal
denganbetul.

4.3Mengujarkanbahasayang
indahdanenggunakanbahasa
badandengankreatifmelalui
lakonansecaradidikhibur.

4.3.2Mengujarkandialogdengansebutanyang
betul,intonasiyangjelas,diksiyangtepatdan
mimikmukayangsesuaimelaluilakonansecara
didikhibur.

5.1Memahamidanmenggunakan
golongankatadenganbetul

5.1.4Memahamidanmenggunakankatakerja
tunggaldenganbetulmengikutkonteks.

KBT:
KBMengenalpasti,
Menjanakanidea,
Menganalisis
BCBPerbincangan
KONTEKSTUAL
Mengaplikasikan
KPVerballinguistik
Media:Bukuteks,buku
aktiviti,liriklagunegaraku,
gambar
SistemBahasa:
Tatabahasa:KataKerja
KosaKata:
Lawatan,muzium,rukun,
takhta,negeri,bebas

1.5.2Menceritakansesuatuperkarayang
didengardengantepat,sebutanyangjelasdan
intonasiyangbetulmenggunakanayatmajmuk.

34

B5DL1E2
B5DB1E1

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
mengikutkonteks.
TEMAPKJR:UNIT8
MELINTASDENGAN
SELAMAT

7.2Proseduryangselamatuntuk
melintas

TAJUK2:LANGKAH
CERMATJIWASELAMAT

7.2.1Memahamibahawamelintasjalanadalah
lebihselamatapabilalangkahtertentudiambil
untukmenyempurnakantugastersebut.
7.2.2Mengetahuilimalangkahuntuk
menyempurnakantugasmelintasjalandengan
selamat.
7.2.3Menggambarkanprosedurmelintasdengan
selamatdanmenerangkansetiaplangkah.
7.2.4Menunjukkanpengetahuandankemahiran
limalangkahmelintasdenganselamatdalam
situasiyangdikawaldandiselia.

MINGGU
33
15/8
21/8/16

TEMA7
SAYAANAKMALAYSIA
UNIT27
TAJUK:LambangNegara

1.5Berceritadanmenceritakan
sesuatuperkarasemuladengan
tepatmenggunakansebutanyang
jelasdanintonasiyangbetul.

1.5.2Menceritakansesuatuperkarayang
didengardengantepat,sebutanyangjelasdan
intonasiyangbetulmenggunakanayatmajmuk.

EMK:
Ilmu,Pembelajaran
Konstruktivisme,Kreatifdan
inovatif,

1.6Berbicarauntukmenyampaikan
maklumattentangsesuatuperkara
daripadapelbagaisumberdengan
tepatsecarabertatasusila.

1.6.3Berbicarauntukmenyampaikanmaklumat
dengantepattentangsesuatuperkaradaripada
pelbagaisumberdenganmenggunakanayat
yangmengandungirangkaikatayangsesuai
secarabertatasusila.

PengisianKurikulum:
Nilai:Prihatin,Cintakan
negara,Hormat
menghormati,bersemangat
Ilmu:DSV,KemahiranHidup

1.7Berbincangdanmengemukakan 1.7.1Berbincangdanmengemukakan
pendapattentangsesuatuperkara
pandangantentangsesuatuperkaradaripada
daripadapelbagaisumbersecara
pelbagaisumbersecarabertatasusila.
bertatasusila.

KBT:
KBMenjanakanidea,
Menganalisis
BCBBacaanintensif,
Perbincangan
KONTEKSTUAL
Menghubungkaitkan
KPVerballinguistik

2.3Membacakuatpelbagaibahan
bacaandengan
lancar,sebutanyangjelasdan
intonasiyangbetul.

2.3.2Membacakuatpelbagaijenisayatdengan
lancar,sebutanyangjelasdanintonasiyang
betulmengikuttandabaca.

2.4Membacadanmemahami
2.4.1Membacadanmemahamimaklumatuntuk
maklumatyangtersuratdantersirat mengenalpastiideautamadanideasampingan
daripadapelbagaibahanuntuk
dalambahanmultimediadengantepat.
memberiresponsdenganbetul.

35

31Ogos
Hari
Kemerdek
aan

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
Media:Bukuteks,buku
aktiviti,gambarlambang
negara

2.5Membacadanmenaakuluntuk
memindahkanmaklumatyang
terdapatdalampelbagaibahan.

2.5.2Membaca,memahamidanmenaakul
bahangrafikdanbukanbahangrafikdengan
betul.

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.4Membinadanmenulisayattunggaldan
ayatmajmukberdasarkanbahangrafikdengan
betul.

3.5Mencatatmaklumatyangbetul
tentangsesuatuperkaradaripada
pelbagaisumber.

3.5.2Mencatatmaklumatpentingyangbetul
untukmenghubungkaitkanfaktadaripada
pelbagaisumber.

3.6Menulisuntukmenyampaikan
maklumattentangsesuatuperkara
denganmenggunakanbahasayang
santun.
3.8Mengeditdanmemurnikanhasil
penulisan.

3.6.2Menulisuntukmenyampaikanmaklumat
berbentukpuisidenganmenegaskankesantunan
berbahasasecaraberpandu.

4.4Melafazdanmemahamipuisi
denganintonasiyangbetul
menggunakanbahasayangindah
secaradidikhibur.

4.4.1Melafazkandanmemahamipantunempat
keratdengansebutanyangbetuldanintonasi
yangjelassecaradidikhibur.

5.3Memahamidanmembinaayat
yangbetuldalampelbagaisituasi.

5.3.2Memahamidanmembinaayatpenyata
denganmenggunakantandabacayangbetul
dalampelbagaikonteks.

1.5Berceritadanmenceritakan
sesuatuperkarasemuladengan
tepatmenggunakansebutanyang
jelasdanintonasiyangbetul.

1.5.1Berceritatentangsesuatuperkaradengan
tepat,sebutanyangjelasdanintonasiyangbetul
menggunakanayatmajmuk.

EMK:
Ilmu,peraturansosiobudaya,
kreatifdaninovatif,

1.6Berbicarauntukmenyampaikan
maklumattentangsesuatuperkara
daripadapelbagaisumberdengan
tepatsecarabertatasusila.

1.6.1Berbicarauntukmendapatkanmaklumat
yangtepattentangsesuatuperkaradaripada
pelbagaisumbersecarabertatasusila.

PengisianKurikulum:
Nilai:kebersihan,kegigihan,

2.2Membacadanmemahami
perkataan,frasadanayatdaripada

2.2.2Membacadanmemahamifrasadalamayat
yangmengandungiperkataanduaatautigasuku

SistemBahasa:
Tatabahasa:AyatPenyata

KosaKata:
Lambang,tengkolok,keris,
risalah,masjid,jingga

MINGGU
34
22/8
28/8/16

TEMA6
MARIBERNIAGA
UNIT20
TAJUK:HariJualan
Sekolahku

3.8.1Mengeditperkataandalamayatdaripada
aspekejaandantandabaca.

36

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
kreatif,bekerjasama
Ilmu:DSV,KemahiranHidup
KBT:
KBMenjanakanidea,
Menaakul,Mengenalpasti
BCBBacaanintensif,
Mencatatmaklumat,Bacaan
imbasan
KONTEKSTUAL
Menghubungkaitkan
KPVerballinguistik
Media:Bukuteks,buku
aktiviti.

SistemBahasa:
Tatabahasa:KataGanda
Penuh

MINGGU
35
29/8
4/9/16

KosaKata:
Berniaga,jualan,poster,
tugas,treler,traktor,
bendera
TEMA6
MARIBERNIAGA
UNIT21
TAJUK:KedaiCenderamata
EMK:
Ilmu,peraturansosiobudaya,
kreatifdaninovatif,TMK
PengisianKurikulum:
Nilai:Tolongmenolong,
kegigihan,kreatif,rajin
Ilmu:DSV,KemahiranHidup
KBT:
KBMenghubungkaitkan,

pelbagaisumberdengansebutan
yangbetul.

kata,diftong,vokalberganding,digrafdan
konsonanbergabungdengansebutanyang
betul.

2.5Membacadanmenaakuluntuk
memindahkanmaklumatyang
terdapatdalampelbagaibahan.

2.5.1Membacadanmemahamibahangrafik
yangmempunyaiperkataandenganbetul.

3.2Menulissecaramekanis
berdasarkanbahanyangdiberi
denganbetuldankemas.

3.2.5Menulisayatyangmengandungiperkataan
duaataulebihsukukata,diftong,vokal
berganding,digrafdankonsonanbergabung
dengancarayangbetuldantulisanyangkemas.

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.1Membinadanmenulisperkataandanfrasa
dengancarayangbetuldankemas.

3.5Mencatatmaklumatyangbetul
tentangsesuatuperkaradaripada
pelbagaisumber.

3.5.2Mencatatmaklumatpentingyangbetul
untukmenghubungkaitkanfaktadaripada
pelbagaisumber.

5.2Memahamidanmenggunakan
pembentukankatayangsesuai
dalampelbagaisituasidengan
betul.

5.2.2Memahamidanmenggunakankataganda
penuhdenganbetuldalampelbagaikonteks.

1.4Bertutur,berbualdan
menyatakanpermintaantentang
sesuatuperkaradaripadapelbagai
sumberdalamsituasiformaldan
tidakformalsecarabertatasusila.

1.4.4Bertuturdanmenyatakanpermintaan
denganintonasiyangbetultentangsesuatu
perkaradalamsituasitidakformalsecara
bertatasusila.

2.3Membacakuatpelbagaibahan
bacaandenganlancar,sebutan
yangjelasdanintonasiyangbetul.

2.3.2Membacakuatpelbagaijenisayatdengan
lancar,sebutanyangjelasdanintonasiyang
betulmengikuttandabaca.

2.5Membacadanmenaakuluntuk
memindahkanmaklumatyang
terdapatdalampelbagaibahan.

2.5.1Membacadanmemahamibahangrafik
yangmempunyaiperkataandenganbetul.
2.5.2Membaca,memahamidanmenaakul
bahangrafikdanbukanbahangrafikdengan
betul.

37

1012Sept
UPSR

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
Membandingkandan
membezakan,Menaakul,
BCBMencatatnota,Bacaan
intensif
KONTEKSTUAL
Menghubungkaitkan
KPInterpersonal
Media:Bukuteks,buku
aktiviti,gambar

3.5Mencatatmaklumatyangbetul
tentangsesuatuperkaradaripada
pelbagaisumber.

3.5.1Mencatatmaklumatpentingdenganbetul
daripadapelbagaisumber.

3.6Menulisuntukmenyampaikan
maklumattentangsesuatuperkara
denganmenggunakanbahasayang
santun.

3.6.1Menulisuntukmenyampaikanmaklumat
yangbetulmenggunakanperkataan,diksi,frasa
danayatdenganmenegaskankesantunan
berbahasasecaraberpandu.

5.3Memahamidanmembinaayat
yangbetuldalampelbagaisituasi.

5.3.2Memahamidanmembinaayatpenyata
denganmenggunakantandabacayangbetul
dalampelbagaikonteks.

SistemBahasa:
Tatabahasa:Ayatpenyata

MINGGU
36
5/9
11/9/16

KosaKata:
Cenderamata,rantai,corak,
wau,Kristal,promosi

TEMA6
1.6Berbicarauntukmenyampaikan
MARIBERNIAGA
maklumattentangsesuatuperkara
UNIT22
daripadapelbagaisumberdengan
TAJUK:NasihatPakLong
tepatsecarabertatasusila.

1.6.1Berbicarauntukmendapatkanmaklumat
yangtepattentangsesuatuperkaradaripada
pelbagaisumbersecarabertatasusila.

EMK:
Nilaimurni,Ilmu,kreatifdan
inovatif,TMK

2.3Membacakuatpelbagaibahan
bacaandenganlancar,sebutan
yangjelasdanintonasiyangbetul.

2.3.2Membacakuatpelbagaijenisayatdengan
lancar,sebutanyangjelasdanintonasiyang
betulmengikuttandabaca.

PengisianKurikulum:
Nilai:Inovatif,Tolong
menolong,kegigihan,kreatif,
rajin
Ilmu:DSV,KemahiranHidup

2.6Membacapelbagaibahan
sasteradanbukansasterayang
sesuaibagimemupukminat
membaca.

2.6.1Membacapelbagaibahankreatifyang
sesuaiuntukmenambahkosakatadan
meningkatkankelancaranbacaan.

KBT:
KBMenghubungkaitkan,
Menjanakanidea,Mengenal
pasti
BCBMencatatnota,Bacaan
luncuran
KPVerballinguistik,bacaan
intensif

3.5Mencatatmaklumatyangbetul
tentangsesuatuperkaradaripada
pelbagaisumber.

3.5.2Mencatatmaklumatpentingyangbetul
untukmenghubungkaitkanfaktadaripada
pelbagaisumber.

3.6Menulisuntukmenyampaikan
maklumattentangsesuatuperkara
denganmenggunakanbahasayang
santun.

3.6.2Menulisuntukmenyampaikanmaklumat
berbentukpuisidenganmenegaskan
kesantunanberbahasasecaraberpandu.

4.4Melafazdanmemahamipuisi

4.4.1Melafazkandanmemahamipantunempat

38

B5DT1E2

16Sept
Cuti
Umum
Hari
Malaysia

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
Media:Bukuteks,buku
aktiviti,postergambar
SistemBahasa:
Tatabahasa:KataTanya
KosaKata:
Peniaga,internet,usahawan,
untung,faedah,letih,
gembira
MINGGU
37
12/9
18/9/16
MINGGU
38
19/9
25/9/16

denganintonasiyangbetul
menggunakanbahasayangindah
secaradidikhibur.

keratdengansebutanyangbetuldanintonasi
yangjelassecaradidikhibur.

5.1Memahamidanmenggunakan
golongankatadenganbetul
mengikutkonteks.

5.1.6Memahamidanmenggunakankatahubung
denganbetulmengikutkonteks.
5.1.7Memahamidanmenggunakankatatanya
denganbetulmengikutkonteks.

CutiPertengahanPenggal2
TEMA6
MARIBERNIAGA
UNIT23
TAJUK:DuniaPerniagaan

1.6Berbicarauntukmenyampaikan
maklumattentangsesuatuperkara
daripadapelbagaisumberdengan
tepatsecarabertatasusila.

EMK:
Nilaimurni,Ilmu,kreatifdan
inovatif,TMK

2.4Membacadanmemahami
2.4.3Membacadanmemahamimaklumatyang
maklumatyangtersuratdantersirat tersuratdengantepatdaripadabahan
daripadapelbagaibahanuntuk
multimediayangsesuai.
memberiresponsdenganbetul.

PengisianKurikulum:
Nilai:Inovatif,Tolong
menolong,kegigihan,kreatif,
rajin
Ilmu:TMK

1.6.2Berbicarauntukmenyampaikanmaklumat
tentangsesuatuperkaradaripadapelbagai
sumberdengantepatdanjelassecara
bertatasusila.

2.5Membacadanmenaakuluntuk
memindahkanmaklumatyang
terdapatdalampelbagaibahan.

2.5.3Membaca,memahamidanmenaakul
bahanbukangrafikuntukmemindahkan
maklumatkepadabentukgrafiksertaayat
denganbetul.

KBT:
KBMembandingkandan
membezakan,Menyusun
maklumat,Mengenalpasti
BCBBacaanintensif
KONSTRUKTIVISME
Menghubungkaitkan,
mengembangkanidea

2.6Membacapelbagaibahan
sasteradanbukansasterayang
sesuaibagimemupukminat
membaca.

2.6.2Membacadanmemahamipelbagaibahan
bacaanberbentukdidikhiburuntuk
menambahkanilmudankosakata.

3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.3Membinadanmenulisjawapandalam
bentukayatmudahdenganbetulberdasarkan
soalan.

Media:Bukuteks,buku
aktiviti.

3.5Mencatatmaklumatyangbetul
tentangsesuatuperkaradaripada
pelbagaisumber.

3.5.1Mencatatmaklumatpentingdenganbetul
daripadapelbagaisumber.

39

B5DL1E1
B5DT1E1

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
SistemBahasa:
Tatabahasa:KataTanya

MINGGU
39
26/9
2/10/16

KosaKata:
Rotan,kayu,kilang,eksport
Celik,positif,bank
TEMA8
REKACIPTA
UNIT28
TAJUK:KelabRekaCipta
EMK:
Nilaimurni,Ilmu,kreatifdan
inovatif,TMK
PengisianKurikulum:
Nilai:Inovatif,Tolong
menolong,kegigihan,kreatif,
rajin
Ilmu:DST,TMK,Pendidikan
Muzik

3.6Menulisuntukmenyampaikan
maklumattentangsesuatuperkara
denganmenggunakanbahasayang
santun.

3.6.1Menulisuntukmenyampaikanmaklumat
yangbetulmenggunakanperkataan,diksi,frasa
danayatdenganmenegaskankesantunan
berbahasasecaraberpandu.

1.3Mendengar,memahamidan
memberiresponsterhadapsesuatu
arahan,soalandanpesananyang
didengardenganbetul.

1.3.1Mendengar,memahamidanmemberikan
responsyangsesuaisecaralisanataugeraklaku
terhadaparahanberdasarkanayatperintahjenis
silaandanayatperintahjenislarangandengan
betul.

1.6Berbicarauntukmenyampaikan
maklumattentangsesuatuperkara
daripadapelbagaisumberdengan
tepatsecarabertatasusila.

1.6.3Berbicarauntukmenyampaikanmaklumat
dengantepattentangsesuatuperkaradaripada
pelbagaisumberdenganmenggunakanayat
yangmengandungirangkaikatayangsesuai
secarabertatasusila.

2.3Membacakuatpelbagaibahan
bacaandengan
lancar,sebutanyangjelasdan
intonasiyangbetul.

2.3.1Membacakuatayatpenyatadengan
lancar,sebutanyangjelas,intonasiyangbetul
danberjeda.

KBT:
KBMenganalisis,
Menjanakanidea,
Menghubungkaitkan,
Mengenalpasti
BCBBacaanintensif,
Mencatatnota
KPInterpersonal

2.4Membacadanmemahami
2.4.3Membacadanmemahamimaklumatyang
maklumatyangtersuratdantersirat tersuratdengantepatdaripadabahan
daripadapelbagaibahanuntuk
multimediayangsesuai.
memberiresponsdenganbetul.
3.5Mencatatmaklumatyangbetul
tentangsesuatu
perkaradaripadapelbagaisumber.

3.5.2Mencatatmaklumatpentingyangbetul
untukmenghubungkaitkanfaktadaripada
pelbagaisumber.

Media:Bukuteks,buku
aktiviti,kadimbasan

3.6Menulisuntukmenyampaikan
maklumattentangsesuatuperkara
denganmenggunakanbahasayang
santun.

3.6.1Menulisuntukmenyampaikanmaklumat
yangbetulmenggunakanperkataan,diksi,frasa
danayatdenganmenegaskankesantunan
berbahasasecaraberpandu.

SistemBahasa:
Tatabahasa:AyatPenyata
KosaKata:
Udara,teknologi,solar,
kelab,notis,automatik

3.7Menghasilkanpenulisankreatif
3.7.1Menghasilkanpenulisanberbentuknaratif
dalampelbagaigenredenganbetul. secaraseparaterkawaldenganbetul.
5.1Memahamidanmenggunakan
golongankatadenganbetul

5.1.7Memahamidanmenggunakankatatanya
denganbetulmengikutkonteks.

40

B5DB1E1

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
mengikutkonteks.

MINGGU
40
3/10
9/10/16

TEMA8
REKACIPTA
UNIT29
TAJUK:SainsdanReka
Cipta
EMK:
Nilaimurni,Ilmu,kreatifdan
inovatif,TMK
PengisianKurikulum:
Nilai:Inovatif,Tolong
menolong,kegigihan,kreatif,
rajin
Ilmu:DST,TMK,DSV
KBT:
KBMenjanakanidea,
Menyatakanrasional,
Menyusunmengikuturutan
Menghubungkaitkan,
Menaakul
KONTEKSTUAL
Menghubungkaitkan
KONSTRUKTIVISME
Menghubungkaitkan,
Mengembangkanidea
KPVerballinguistik
KMDMeramal
Media:Bukuteks,buku
aktiviti,kadimbasan
SistemBahasa:
Tatabahasa:PolaAyat

5.3Memahamidanmembinaayat
yangbetuldalampelbagaisituasi.

5.3.2Memahamidanmembinaayatpenyata
denganmenggunakantandabacayangbetul
dalampelbagaikonteks.

1.5Berceritadanmenceritakan
sesuatuperkarasemuladengan
tepatmenggunakansebutanyang
jelasdanintonasiyangbetul.

1.5.1Berceritatentangsesuatuperkaradengan
tepat,sebutanyangjelasdanintonasiyangbetul
menggunakanayatmajmuk.

1.7Berbincangdanmengemukakan 1.7.1Berbincangdanmengemukakan
pendapattentangsesuatuperkara
pandangantentangsesuatuperkaradaripada
daripadapelbagaisumbersecara
pelbagaisumbersecarabertatasusila.
bertatasusila.
2.4Membacadanmemahami
2.4.2Membacadanmemahamimaklumat
maklumatyangtersuratdantersirat daripadabahanmultimediauntukmenyatakan
daripadapelbagaibahanuntuk
maklumatmengikuturutandenganbetul.
memberiresponsdenganbetul.
2.4.3Membacadanmemahamimaklumatyang
tersuratdengantepatdaripadabahan
multimediayangsesuai.
2.5Membacadanmenaakuluntuk
2.5.1Membacadanmemahamibahangrafik
memindahkanmaklumatyang
yangmempunyaiperkataandenganbetul.
terdapatdalampelbagaibahan.
3.3Membinadanmenulis
perkataan,frasa,danayatdengan
betul.

3.3.4Membinadanmenulisayattunggaldan
ayatmajmukberdasarkanbahangrafikdengan
betul.

3.6Menulisuntukmenyampaikan
maklumattentangsesuatuperkara
denganmenggunakanbahasayang
santun.

3.6.2Menulisuntukmenyampaikanmaklumat
berbentukpuisidenganmenegaskankesantunan
berbahasasecaraberpandu.

3.7Menghasilkanpenulisankreatif
3.7.1Menghasilkanpenulisanberbentuknaratif
dalampelbagaigenredenganbetul. secaraseparaterkawaldenganbetul.
3.7.2Menghasilkanpenulisanberbentuknaratif
danbukannaratifsecaraseparaterkawal
denganbetul.

41

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
KosaKata:
Pengacara,herba,roti,
mengacau,dodol,mesin,
halia,muara

MINGGU
41
10/10
16/10/16

TEMA8
REKACIPTA
UNIT30
TAJUK:Pertandingan
RekaCipta
EMK:
Nilaimurni,Ilmu,kreatifdan
inovatif,TMK
PengisianKurikulum:
Nilai:Inovatif,Tolong
menolong,kegigihan,kreatif,
rajin
Ilmu:DST,TMK,DSV
KBT:
KBMembandingkandan
membezakan,Mengenalpasti
Menjanakanidea,
Menghubungkaitkan
BCBBacaanintensif
KONTEKSTUAL
Menghubungkaitkan
KONSTRUKTIVISME
Menerangkandan
menjelaskan
KPVerballinguistik
Media:Bukuteks,buku
aktiviti,powerpoint

4.4Melafazdanmemahamipuisi
denganintonasiyangbetul
menggunakanbahasayangindah
secaradidikhibur.

4.4.2Membinapantunempatkeratsecara
berpandudanmelafazkannyadengansebutan
yangbetuldanintonasiyangjelassecaradidik
hibur.

5.3Memahamidanmembinaayat
yangbetuldalampelbagaisituasi.

5.3.1Memahamidanmembinaayatdasar
menggunakanpolaayatFN+FN,FN+FK,FN+
FAdanFN+FSNdenganbetuldalampelbagai
konteks.

1.5Berceritadanmenceritakan
sesuatuperkarasemuladengan
tepatmenggunakansebutanyang
jelasdanintonasiyangbetul.

1.5.1Berceritatentangsesuatuperkaradengan
tepat,sebutanyangjelasdanintonasiyangbetul
menggunakanayatmajmuk.

1.6Berbicarauntukmenyampaikan
maklumattentangsesuatuperkara
daripadapelbagaisumberdengan
tepatsecarabertatasusila.

1.6.2Berbicarauntukmenyampaikanmaklumat
tentangsesuatuperkaradaripadapelbagai
sumberdengantepatdanjelassecara
bertatasusila.

2.4Membacadanmemahami
2.4.3Membacadanmemahamimaklumatyang
maklumatyangtersuratdantersirat tersuratdengantepatdaripadabahan
daripadapelbagaibahanuntuk
multimediayangsesuai.
memberiresponsdenganbetul.
2.5Membacadanmenaakuluntuk
memindahkanmaklumatyang
terdapatdalampelbagaibahan.

2.5.2Membaca,memahamidanmenaakul
bahangrafikdanbukanbahangrafikdengan
betul.

2.6Membacapelbagaibahan
sasteradanbukansasterayang
sesuaibagimemupukminat
membaca.

2.6.1Membacapelbagaibahankreatifyang
sesuaiuntukmenambahkosakatadan
meningkatkankelancaranbacaan.

3.5Mencatatmaklumatyangbetul
tentangsesuatuperkaradaripada
pelbagaisumber.

3.5.1Mencatatmaklumatpentingdenganbetul
daripadapelbagaisumber.

3.6Menulisuntukmenyampaikan
maklumattentangsesuatuperkara
denganmenggunakanbahasayang

3.6.1Menulisuntukmenyampaikanmaklumat
yangbetulmenggunakanperkataan,diksi,frasa
danayatdenganmenegaskankesantunan

42

B4DB1E1
B6DL2E1

1516Okt
Cuti
Umum
CutiHari
RayaHaji

SUMBERPENDIDIKAN.COM
RancanganPelajaranTahunan(RPT)2016
Tahun2Subjek:BAHASAMALAYSIA(BM)
SistemBahasa:
Tatabahasa:ImbuhanApitan
KosaKata:
Pemenang,sketsa,interaktif,
elektrik,pencemaran

MINGGU
42
17/10
23/10/16
MINGGU
43
24/10
30/10/16
MINGGU
44
31/10
6/11/16
MINGGU
45
7/11
13/11/16

santun.

berbahasasecaraberpandu.

3.7Menghasilkanpenulisankreatif
3.7.2Menghasilkanpenulisanberbentuknaratif
dalampelbagaigenredenganbetul. danbukannaratifsecaraseparaterkawal
denganbetul.
5.2Memahamidanmenggunakan
pembentukankatayangsesuai
dalampelbagaisituasidenganbetul

5.2.1Memahamidanmenggunakanimbuhan
awalan,akhirandanapitandenganbetuldalam
pelbagaikonteks.

B6DL1E1
B6DL1E2
B6DB1E2

PentaksiranSumatif2

Prosespemulanganbukuteks

PembahagianKelasdanPenerimaanbukutekssesipersekolahan2014

0304NovHariDeepavali

PersediaandanMajlisAnugerahCemerlang2013

15NovMajlisHari
AnugerahCemerlang

CutiAkhirTahun

16Nov201201Jan2014

Nota:PerubahanRPTinibolehdibuatmengikutkesesuaianP&Pdanmatapelajaran.
Disediakanoleh,Disemakoleh,

Disahkanoleh,

.....................................................................................
(__________________________)()
Tarikh:KetuaPanitiaBahasaMalaysia
Tarikh:

.........................................................
()
Tarikh:

43