Anda di halaman 1dari 18

Kearifan Lokal dalam Pemberdayaan Masyarakat

Dosen: Pramono Giri


Mata Kuliah: Pemberdayaan Masyarakat

1. Devi Sulistyarini
P17420713002
2. Evan Agung W
P17420713006
3. Galih Adi Y
P17420713007
4. Karisma Supriliyanti
P17420713009
5. Kartika Nurmalia
P17420713010
6. Ratna Ferawati W
P17420713017
7. Shinta Ayu P
P17420713020
8. Titia Kusuma W
P17420713021
9. Vika Rahmawati
P17420713022
10. Zulaikah Nur I
P17420713023
11. Zulinda Risma D
P17420713024

PRODI DIV KEPERAWATAN MAGELANG


POLTEKKES KEMENKES SEMARANG
2016

BAB I
PENDAHULUAN
A. Latar Belakang
Kondisi lingkungan Indonesia menghasilkan keanekaragaman ekosistem beserta sumber
daya alam, melahirkan manusia Indonesia yang berkaitan erat dengan kondisi alam dalam
melakukan berbagai aktivitas untuk menunjung kelangsungan hidupnya. Manusia Indonesia
menaggapi alam sebagai guru pemberi petunjuk gaya hidup masyarakat, yang terlahir dalam
bentuk kebiasaan alami yang dituangkan menjadi adat kehidupan yang berorientasi pada
sikap alam terkembang menjadi guru (Salim, 2006).
Kearifan lokal merupakan warisan nenek moyang kita dalam tata nilai kehidupan yang
menyatu dalam bentuk religi, budaya dan adat istiadat. Dalam perkembangannya masyarakat
melakukan adaptasi terhadap lingkungannya dengan mengembangkan suatu kearifan yang
berwujud pengetahuan atau ide, peralatan, dipadu dengan norma adat, nilai budaya, aktivitas
mengelola lingkungan guna mencukupi kebutuhan hidupnya (Suhartini, 2009).
Kearifan tradisional yang bersifat lokal sesuai dengan daerahnya masing - masing
merupakan salah satu warisan budaya yang ada di masyarakat dan secara turun-temurun
dilaksanakan oleh kelompok masyarakat bersangkutan.
Lampe (2009), menjelaskan bahwa dari sisi lingkungan hidup keberadaan kearifan lokal
tradisional sangat menguntungkan karena secara langsung ataupun tidak langsung dalam
memelihara lingkungan serta mencegah terjadinya kerusakan lingkungan. Santosa (2011)
menjelaskan bahwa salah satu isu yang diperhatikan pada masa sekarang dan masa akan
datang menyangkut mutu pengelolaan lingkungan hidup melalui reaktualisasi kearifan lokal
dalam pemberdayaan masyarakat. Kearifan lokal sebagai produk kolektif masyarakat,
difungsikan guna mencegah keangkuhan dan keserakahan manusia dalam mengeksploitasi
sumberdaya alam tanpa merusak kelestarian hidup. Peningkatan mutu pengelolaan
lingkungan hidup memerlukan komitmen etika masyarakat lokal bersama stakeholder dalam
berperilaku adaptif memanfaatkan sumberdaya alam didukung kebijakan pembangunan yang
prolingkunganhidup.

B. Rumusan Masalah
1. Mengetahui Konsep Kearifan Lokal
2. Mengetahui Tujuan dan Strategi Pemberdayaan Masyarakat
3. Mengetahui Pengaruh Kearifan Lokal dalam Pemberdayaan Masyarakat
4. Mmengetahui Fungsi Kearifan Lokal dalam pemberdayaan Masyarakat
5. Mengetahu Pemberdayaan Masyarakat Berbasis Kearifan Lokal di Era Globalisasi

BAB II
PEMBAHASAN
1. Konsep Kearifan Lokal
A. Pengertian Kearifan Lokal
Secara etimologis, kearifan (wisdom) berarti kemampuan seseorang dalam menggunakan
akal pikirannya untuk menyikapi sesuatu kejadian, obyek atau situasi. Sedangkan lokal,
menunjukkan ruang interaksi di mana peristiwa atau situasi tersebut terjadi. Dengan
demikian, kearifan lokal secara substansial merupakan nilai dan norma yang berlaku dalam
suatu masyarakat yang diyakini kebenarannya dan menjadi acuan dalam bertindak dan
berperilaku sehari-hari.
Dengan kata lain kearifan lokal adalah kemampuan menyikapi dan memberdayakan
potensi nilai-nilai luhur budaya setempat. Oleh karena itu, kearifan lokal merupakan entitas
yang sangat menentukan harkat dan martabat manusia dalam komunitasnya (Geertz, 2007).
Perilaku yang bersifat umum dan berlaku di masyarakat secara meluas, turun temurun, akan
berkembang menjadi nilai-nilai yang dipegang teguh, yang selanjutnya disebut sebagai
budaya. Kearifan lokal didefinisikan sebagai kebenaran yang telah mentradisi atau ajeg dalam
suatu daerah (Gobyah, 2003). Kearifan lokal (local wisdom) dapat dipahami sebagai usaha
manusia dengan menggunakan akal budinya (kognisi) untuk bertindak dan bersikap terhadap
sesuatu, objek, atau peristiwa yang terjadi dalam ruang tertentu (Ridwan, 2007).
Kearifan adalah seperangkat pengetahuan yang dikembangkan oleh suatu kelompok
masyarakat setempat (komunitas) yang terhimpun dari pengalaman panjang menggeluti alam
dalam ikatan hubungan yang saling menguntungkan kedua belah pihak (manusia dan
lingkungan) secara berkelanjutan dan dengan ritme yang harmonis. Kearifan (wisdom)dapat
disepadankan pula maknanya dengan pengetahuan, kecerdikan,kepandaian, keberilmuan, dan
kebijaksanaan dalam pengambilan Keputusan yang berkenaan dengan penyelesaian atau
penanggulangan suat masalah atau serangkaian masalah yang relatif pelik dan rumit.
Kearifan lokal (localwisdom) terdiri dari dua kata: kearifan (wisdom)dan lokal
(local). Localberarti setempat, sedangkan wisdomdapat berarti kebijaksanaan. Secara umum
maka localwisdom(kearifan/kebijaksanaansetempat) dapat dipahami sebagai gagasan-gagasan
setempat (local) yang bersifat bijaksana, penuh kearifan, bernilai baik, yang tertanam dan
diikuti oleh anggota masyarakatnya. Kearifan lokal merupakan suat gagasan konseptual yang
hidup dalam masyarakat, tumbuh dan berkembang secara terus-menerus dalam kesadaran
masyarakat serta berfungsi dalam mengatur kehidupan masyarakat. Kearifan lokal yang
tumbuh di masyarakat memiliki ciri yang spesifik, terkait dengan pengelolaan lingkungan
sebagai kearifan lingkungan.
Kearifan lingkungan (ecologicalwisdom) merupakan pengetahuan yang diperoleh dari
abstraksi pengalaman adaptasi aktif terhadap lingkungannya yang khas. Pengetahuan tersebut
diwujudkan dalam bentuk ide, aktivitas dan peralatan. Kearifan lingkungan yang diwujudkan

ke dalam tiga bentuk tersebut dipahami, dikembangkan, dipedomani dan diwariskan secara
turun-temurun oleh komunitas pendukungnya. Kearifan lingkungan dimaksudkan sebagai
aktivitas dan proses berpikir, bertindak dan bersikap secara arif dan bijaksana dalam
mengamati, memanfaatkan dan mengolah alam sebagai suatu lingkungan hidup dan
kehidupan umat manusia secara timbal balik. Pengetahuan rakyat yang memiliki kearifan
ekologis itu dikembangkan, dipahami dan secara turun-temurun diterapkan sebagai pedoman
dalam mengelola lingkungan terutama dalam mengolah sumberdaya alam. Pengelolaan
lingkungan secara arif dan berkesinambungan itu dikembangkan mengingat pentingnya
fungsi sosial lingkungan untuk menjamin kelangsungan hidup masyarakat. Manfaat yang
diperoleh manusia dari lingkungan mereka, lebih-lebih kalau merekaberada pada taraf
ekonomi sub-sistensi, mengakibatkan orang merasa menyatu atau banyak tergantung kepada
lingkungan mereka.

B. Klasifikasi Kearifan Lokal


Klasifikasi kearifan lokal meliputi tata kelola, nilai-nilai adat, serta tata cara dan
prosedur, termasuk dalam pemanfaatan ruang (tanah ulayat).

1. Tata Kelola
Di setiap daerah pada umumnya terdapat suatu sistem kemasyarakatan
yang mengatur tentang struktur sosial dan keterkaitan antara kelompok komunitas
yang ada, seperti Dalian Natolu di Sumatera Utara, Nagari di Sumatera Barat,
Kesultanan dan Kasunanan di Jawa dan Banjar di Bali. Sebagai contoh, masyarakat
Toraja memiliki lembaga dan organisasi sosial yang mengelola kehidupan di
lingkungan perdesaan. Pada setiap daerah yang memiliki adat besar pada umumnya
terdiri dari beberapa kelompok adat yang dikuasai satu badan musyawarah adat yang
disebut Kombongan Ada. Setiap Kombongan memiliki beberapa penguasa adat kecil
yang disebut Lembang. Di daerah lembang juga masih terdapat penguasa adat wilayah
yang disebut Bua (Buletin Tata Ruang, 2009).
Selain itu, terdapat pula pembagian tugas dan fungsi dalam suatu
kelompok masyarakat adat misalnya Kepatihan (patih), Kauman (santri) di
perkampungan sekitar Keraton di Jawa. Kewenangan dalam struktur hirarki sosial
juga menjadi bagian dari tata kelola, seperti kewenangan ketua adat dalam
pengambilan keputusan, dan aturan sanksi serta denda sosial bagi pelanggar peraturan
dan hukum adat tertentu.
2. Sistem Nilai
Sistem nilai merupakan tata nilai yang dikembangkan oleh suatu
komunitas masyarakat tradisional yang mengatur tentang etika penilaian baik-buruk
serta benar atau salah. Sebagai contoh, di Bali, terdapat sistem nilai Tri Hita Karana
yang mengaitkan dengan nilai-nilai kehidupan masyarakat dalam hubungannya
dengan Tuhan, alamsemesta, dan manusia. Ketentuan tersebut mengatur hal-hal adat
yang harus ditaati, mengenai mana yang baik atau buruk, mana yang boleh dilakukan

dan yang tidak boleh dilakukan, yang jika hal tersebut dilanggar, maka akan ada
sanksi adat yang mengaturnya.
3. Tata Cara atau Prosedur
Beberapa aturan adat di daerah memiliki ketentuan mengenai waktu yang
tepat untuk bercocok tanam serta sistem penanggalan tradisional yang
dapat memperkirakan kesesuaian musim untuk berbagai kegiatan pertanian, seperti:
Pranoto Mongso (jadwal dan ketentuan waktu bercocok tanam berdasarkan kalender
tradisional Jawa) di masyarakat Jawa atau sistem Subak di Bali.
Selain
itu,
di
beberapa
daerah,
seperti
Sumatera,
Jawa,
Bali,Kalimantan, Sulawesi, dan Papua umumnya memiliki aturan mengenai
penggunaan ruang adat termasuk batas teritori wilayah, penempatan hunian,
penyimpanan logistik, aturan pemanfaatan air untuk persawahan atau pertanian
hingga bentuk-bentuk rumah tinggal tradisional. Di Tasikmalaya Jawa Barat misalnya,
terdapat sebuah kampung budaya yaitu Kampung Naga, yang masyarakatnya sangat
teguh memegang tradisi serta falsafah hidupnya, mencakup tata wilayah (pengaturan
pemanfaatan lahan), tata wayah (pengaturan waktu pemanfaatan), dan tata lampah
(pengaturan perilaku/perbuatan).

C. Ciri-ciri Kearifan Lokal


Secara umum budaya diartikan sebagai hal-hal yang berkaitan dengan budi
dan akal manusia. Jadi budaya daerah adalah suatu sistem atau cara hidup yang
berkembang dan dimiliki bersama oleh sebuah daerah dan diwariskan dari generasi ke
generasi.

Budaya

daerah

terbentuk

dari

berbagai

unsur,

termasuk sistem agama dan politik,adat,istiadat, bahasa, perkakas, pakaian, bangunan,


dan karya seniserta bahasa.
Kearifan Lokal secara umum diartikan sebagai gagasan-gagasan, nilai-nilainilai, pandangan-pandangan setempat (lokal) yang bersifat bijaksana, penuh kearifan,
bernilai baik, yang tertanam dan diikuti oleh anggota masyarakatnya.
Ciri-cirinya adalah:
1. Mampu bertahan terhadap budaya luar
2. Memiliki kemampuan mengakomodasi unsur-unsur budaya luar
3. Mempunyai kemampuan mengintegrasikan unsur budaya luar ke dalam budaya
asli
4. Mempunyai kemampuan mengendalikan
5. Mampu memberi arah pada perkembangan budaya
Dengan demikian budaya dan kearifan lokal adalah hal yang saling berkaitan satu
sama lain.
D. Bagaimana Menggali Kearifan Lokal

Kesadaran untuk mengangkat dan menggali kembali pengetahuan lokal atau


kearifan budaya masyarakat etnik muncul karena kemajuan ekonomi dan sosial
masyarakat dunia sekarang telah diiringi oleh pelbagai kerusakan lingkungan.
Kedepan, masyarakat dunia dihantui akan krisis multidimensi dan berhadapan dengan
semakin meningkatnya degradasi sumberdaya alam dan lingkungan serta pencemaran
yang meluas baik di daratan, laut maupun udara. Pengetahuan lokal yang sudah
menyatu dengan sistem kepercayaan, norma dan budaya, dan diekspresikan di dalam
tradisi dan mitos, yang dianut dalam jangka waktu cukup lama inilah yang disebut
kearifan budaya lokal. Pada makna yang sama berlaku diberbagai bidang yang
berkembang di masyarakat, seperti bidang pertanian, pengelolaan hutan secara adat,
pelestarian sumber air,secara umum dinyatakan sebagai kearifan lokal. Pada
penggalian kearifan lokal perlu dipahami beberapa hal agar kearifan tersebut dapat
diterima dan ditaati yaitu :
1. Kearifan tersebut masih ada.
2. Kearifan tersebut sesuai dengan perkembangan masyarakat.
3. Kearifan tersebut sesuai dengan prinsip Negara Kesatuan Republik Indonesia.
4. Kearifan tersebut diatur dengan Undang-undang.
Salah satu contoh kearifan lingkungan yang digali dari kearifan lokal pada upaya
pelestarian sumber air adalah kepercayaan pada sumber air yang terdapat pohon
rindang dan besar atau gua yang seramada penghuni gaib. Konseppamali atau (bhs.
Jawa oraelok) kencing dibawah pohonbesar di bawahnya terdapatsumber air
merupakan perilaku masyarakat tradisional memagari perbuatan anak-cucu agar tidak
merusak alam sehingga debit dan kualitas airnya dapat terjaga.Kearifan local tersebut
sulit dijelaskan secara ilmiah, namun dapat direnungi dalam jangka waktu panjang.
Bila kita melihat pada satu sisi rasional yang semuanya harus dapat dipahami secara
logika, maka hal tersebut sering dipahami takhayul secara bulat dampaknya banyak
pohon dirusak tanpa ada perasaan salah. Kearifan lokal sebagai kearifan lingkungan
saat ini sangat penting demi keharmonisan lingkungan untuk kelangsungan hidup
berkelanjutan tanpa harus mengkorbankan rasionalitas ilmu pengetahuan melebur
dalam keyakinan tradisional secara mutlak, melainkan mengutamakan azas manfaat
dan kewajaran.

E. Fungsi Kearifan Lokal

Sirtha (2003) sebagaimana dikutip oleh Sartini (2004), menjelaskan bahwa


bentuk-bentuk kearifan lokal yang ada dalam masyarakat dapat berupa: nilai, norma,
kepercayaan, dan aturan-aturan khusus. Bentuk yang bermacam-macam ini
mengakibatkan fungsi kearifan lokal menjadi bermacam-macam pula. Fungsi tersebut
antara lain adalah:
1. Kearifan lokal berfungsi untuk konservasi dan pelestarian sumberdaya alam.
2. Kearifan lokal berfungsi untuk mengembangkan sumber daya manusia.
3. Berfungsi sebagai pengembangan kebudayaan dan ilmu pengetahuan.
4. Berfungsi sebagai petuah, kepercayaan, sastra dan pantangan.
Menurut Prof. Nyoman Sirtha dalam Menggali Kearifan Lokal untuk Ajeg
Bali menyatakan bentuk-bentuk kearifan lokal dalam masyarakat dapat berupa: nilai,
norma, etika, kepercayaan, adat-istiadat, hukum adat, dan aturan-aturan khusus. Oleh
karena bentuknya yang bermacam-macam dan ia hidup dalam aneka budaya
masyarakat maka fungsinya menjadi bermacam-macam.
Dalam tulisan Pola Perilaku Orang Bali Merujuk Unsur Tradisi, antara lain
memberikan informasi tentang beberapa fungsi dan makna kearifan lokal, yaitu:
1. Berfungsi untuk konservasi dan pelestarian sumber daya alam.
2. Berfungsi untuk pengembangan sumber daya manusia, misalnya berkaitan dengan
upacara daur hidup, konsep kanda pat rate.
3. Berfungsi untuk pengembangan kebudayaan dan ilmu pengetahuan, misalnya
4.
5.
6.
7.

pada upacara saraswati, kepercayaan dan pemujaan pada pura Panji.


Berfungsi sebagai petuah, kepercayaan, sastra dan pantangan.
Bermakna sosial misalnya upacara integrasi komunal/kerabat.
Bermakna sosial, misalnya pada upacara daur pertanian.
Bermakna etika dan moral, yang terwujud dalam upacara Ngaben dan penyucian

roh leluhur.
8. Bermakna politik, misalnya upacara ngangkuk merana dan kekuasaan patron
client
9. (Balipos terbitan 4 September 2003)
Dari penjelasan fungsi-fungsi tersebut tampak betapa luas ranah keraifan lokal,
mulai dari yang sifatnya sangat teologis sampai yang sangat pragmatis dan teknis
F. Wujud Kearifan Lokal
Jim Ife (2002) menyatakan bahwa kearifan lokal terdiri dari enam dimensi yaitu,
1. Pengetahuan Lokal.
Setiap masyarakat dimanapun berada baik di pedesaan maupun pedalaman
selalu memiliki pengetahuan lokal yang terkait dengan lingkungan hidupnya.

Pengetahuan lokal terkait dengan perubahan dan siklus iklim kemarau dan penghujan,
jenis-jenis fauna dan flora, dan kondisi geografi, demografi, dan sosiografi. Hal ini
terjadi karena masyarakat mendiami suatu daerah itu cukup lama dan telah mengalami
perubahan sosial yang bervariasi menyebabkan mereka mampu beradaptasi dengan
lingkungannnya. Kemampuan adaptasi ini menjadi bagian dari pengetahuan lokal
mereka dalam menaklukkan alam.
2. Nilai Lokal.
Untuk mengatur kehidupan bersama antara warga masyarakat, maka setiap
masyarakat memiliki aturan atau nilai-nilai lokal yang ditaati dan disepakati bersama
oleh seluruh anggotannya. Nilai-nilai ini biasanya mengatur hubungan antara manusia
dengan manusia, manusia dengan alam dan manusia dengan Tuhannnya. Nilai-nilai
ini memiliki dimensi waktu, nilai masa lalu, masa kini dan masa datang, dan nilai ini
akan mengalami perubahan sesuai dengan kemajuan masyarakatnya.
3. Keterampilan Lokal
Kemampuan bertahan hidup (survival) dari setiap masyarakat dapat dipenuhi
apabila masyarakat itu memiliki keterampilan lokal. Keterampilan lokal dari yang
paling sederhana seperti berburu, meramu, bercocok tanam sampai membuat industri
rumah tangga. Keterampilan lokal ini biasanya hanya cukup dan mampu memenuhi
kebutuhan keluargannya masing-masing atau disebut dengan ekonomi subsisten.
Keterampilan lokal ini juga bersifat keterampilan hidup (life skill), sehingga
keterampilan ini sangat tergantung kepada kondisi geografi tempat dimana
masyarakat itu bertempat tinggal.
4. Sumber daya Lokal.
Sumber daya lokal ini pada umumnya adalah sumber daya alam yaitu sumber
daya yang tak terbarui dan yang dapat diperbarui. Masyarakat akan menggunakan
sumber daya lokal sesuai dengan kebutuhannya dan tidak akan mengekpoitasi secara
besar-besar atau dikomersilkan. Sumber daya lokal ini sudah dibagi peruntukannnya
seperti hutan, kebun, sumber air, lahan pertanian, dan permukiman, Kepemilikan
sumber daya lokal ini biasanya bersifat kolektif atau communitarian.
5. Mekanisme Pengambilan Keputusan Lokal.
Menurut ahli adat dan budaya sebenarnya setiap masyarakat itu memiliki
pemerintahan lokal sendiri atau disebut pemerintahan kesukuan. Suku merupakan
kesatuan hukum yang memerintah warganya untuk bertindak sebagai warga
masyarakat. Masing masing masyarakat mempunyai mekanisme pengambilan
keputusan yang berbeda beda. Ada masyarakat yang melakukan secara demokratis

atau duduk sama rendah berdiri sama tinggi. Ada juga masyarakat yang melakukan
secara bertingkat atau berjenjang naik dan bertangga turun.
Pendapat lain menyatakan bahwa bentuk kearifan lokal dapat dikategorikan ke dalam
dua aspek, yaitu kearifan lokal yang berwujud nyata (tangible) dan yang tidak berwujud
(intangible).
a. Berwujud Nyata (Tangible)
Bentuk kearifan lokal yang berwujud nyata meliputi beberapa aspek berikut:
1) Tekstual
Beberapa jenis kearifan lokal seperti sistem nilai, tata cara, ketentuan khusus yang
dituangkan ke dalam bentuk catatan tertulis seperti yang ditemui dalam kitab
tradisional primbon, kalender dan prasi (budaya tulis di atas lembaran daun
lontar). Sebagai contoh, prasi, secara fisik, terdiri atas bagian tulisan (naskah
cerita) dan gambar (gambar ilustrasi).
2) Bangunan/Arsitektural
Banyak bangunan-bangunan tradisional yang merupakan cerminan dari bentuk
kearifan lokal, seperti bangunan rumah rakyat di Bengkulu. Bangunan rumah
rakyat ini merupakan bangunan rumah tinggal yang dibangun dan digunakan oleh
sebagian besar masyarakat dengan mengacu pada rumah ketua adat. Bangunan
vernakular ini mempunyai keunikan karena proses pembangunan yang mengikuti
para leluhur, baik dari segi pengetahuan maupun metodenya (Triyadi dkk., 2010).
Bangunan vernacular ini terlihat tidak sepenuhnya didukung oleh prinsip dan teori
bangunan yang memadai, namun secara teori terbukti mempunyai potensi-potensi
lokal karena dibangun melalui proses trial & error, termasuk dalam menyikapi
kondisi lingkungannya.
3) Benda Cagar Budaya/Tradisional (Karya Seni)
Banyak benda-benda cagar budaya yang merupakan salah satu bentuk kearifan
lokal, contohnya, keris. Keris merupakan salah satu bentuk warisan budaya yang
sangat penting. Meskipun pada saat ini keris sedang menghadapi berbagai
dilemma dalam pengembangan serta dalam menyumbangkan kebaikan-kebaikan
yang terkandung di dalamnya kepada nilai-nilai kemanusiaan di muka Bumi ini,
organisasi bidang pendidikan dan kebudayaan atau UNESCO Badan Perserikatan
Bangsa Bangsa, mengukuhkan keris Indonesia sebagai karya agung warisan
kebudayaan milik seluruh bangsa di dunia. Setidaknya sejak abad ke-9, sebagai
sebuah dimensi budaya, Keris tidak hanya berfungsi sebagai alat beladiri, namun
sering kali merupakan media ekspresi berkesenian dalam hal konsep, bentuk,

dekorasi hingga makna yang terkandung dalam aspek seni dan tradisi teknologi
arkeometalurgi. Keris memiliki fungsi sebagai seni simbol jika dilihat dari aspek
seni dan merupakan perlambang dari pesan sang empu penciptanya.
Ilustrasi lainnya adalah batik, sebagai salah satu kerajinan yang memiliki nilai
seni tinggi dan telah menjadi bagian dari budaya Indonesia (khususnya Jawa)
sejak lama. Terdapat berbagai macam motif batik yang setiap motif tersebut
mempunyai makna tersendiri. Sentuhan seni budaya yang terlukiskan pada batik
tersebut bukan hanya lukisan gambar semata, namun memiliki makna dari leluhur
terdahulu, seperti pencerminan agama (Hindu atau Budha), nilai-nilai sosial dan
budaya yang melekat pada kehidupan masyarakat.
b. Tidak Berwujud (Intangible)
Selain bentuk kearifan lokal yang berwujud, ada juga bentuk kearifan lokal yang tidak
berwujud seperti petuah yang disampaikan secara verbal dan turun temurun yang
dapat berupa nyanyian dan kidung yang mengandung nilai-nilai ajaran tradisional.
Melalui petuah atau bentuk kearifan lokal yang tidak berwujud lainnya, nilai sosial
disampaikan secara oral/verbal dari generasi ke generasi.
Contoh kearifan lokal masyarakat :
Elly Burhainy Faizal mencontohkan beberapa kekayaan budaya, kearifan lokal di
Nusantara yang terkait dengan pemanfaatan alam yang pantas digali lebih lanjut
makna dan fungsinya serta kondisinya sekarang dan yang akan datang. Kearifan lokal
terdapat di beberapa daerah:
1) Papua, terdapat kepercayaan te aro neweak lako (alam adalah aku). Gunung
Erstberg dan Grasberg dipercaya sebagai kepala mama, tanah dianggap sebagai
bagian dari hidup manusia. Dengan demikian maka pemanfaatan sumber daya
alam secara hati-hati.
2) Serawai, Bengkulu, terdapat keyakinan celako kumali. Kelestarian lingkungan
terwujud dari kuatnya keyakinan ini yaitu tata nilai tabu dalam berladang dan
tradisi tanam tanjak.
3) Dayak Kenyah, Kalimantan Timur, terdapat tradisi tana ulen. Kawasan hutan
dikuasai dan menjadi milik masyarakat adat. Pengelolaan tanah diatur dan
dilindungi oleh aturan adat.
4) Masyarakat Undau Mau, Kalimantan Barat. Masyarakat ini mengembangkan
kearifan

lingkungan

dalam

pola

penataan

ruang

pemukiman,

dengan

mengklasifikasi hutan dan memanfaatkannya. Perladangan dilakukan dengan

rotasi dengan menetapkan masa bera, dan mereka mengenal tabu sehingga
penggunaan teknologi dibatasi pada teknologi pertanian sederhana dan ramah
lingkungan.
5) Masyarakat Kasepuhan Pancer Pangawinan, Kampung Dukuh Jawa Barat. Mereka
mengenal upacara tradisional, mitos, tabu, sehingga pemanfaatan hutan hati-hati.
Tidak diperbolehkan eksploitasi kecuali atas ijin sesepuh adat.
6) Bali dan Lombok, masyarakat mempunyai awig-awig.
Kearifan lokal merupakan suatu gagasan konseptual yang hidup dalam masyarakat,
tumbuh dan berkembang secara terus-menerus dalam kesadaran masyarakat, berfungsi dalam
mengatur kehidupan masyarakat dari yang sifatnya berkaitan dengan kehidupan yang sakral
sampai yang profan.

2. Konsep Pemberdayaan Masyarakat


Pemberdayaan
sebagai
proses

mengembangkan,

memandirikan,

menswadayakan,memperkuat posisi tawar menawar masyarakat lapisan bawah terhadap


kekuatan-kekuatanpenekan di segala bidang dan sektor kehidupan (Sutoro Eko, 2002).
Konsep pemberdayaan(masyarakat desa) dapat dipahami juga dengan dua cara pandang.
Pertama, pemberdayaandimaknai dalam konteks menempatkan posisi berdiri masyarakat.
Posisi masyarakat bukanlah obyek penerima manfaat (beneficiaries) yang tergantung pada
pemberian daripihak luar seperti pemerintah, melainkan dalam posisi sebagai subyek
(agen ataupartisipan yang bertindak) yang berbuat secara mandiri. Berbuat secara mandiri
bukanberarti lepas dari tanggungjawab negara. Pemberian layanan publik (kesehatan,
pendidikan, perumahan, transportasi dan seterusnya) kepada masyarakat tentu
merupakantugas (kewajiban) negara secara given. Masyarakat yang mandiri sebagai
partisipan berartiterbukanya ruang dan kapasitas mengembangkan potensi-kreasi,
mengontrol lingkungandan sumberdayanya sendiri, menyelesaikan masalah secara
mandiri, dan ikut menentukanproses politik di ranah negara. Masyarakat ikut
berpartisipasi dalam proses pembangunandan pemerintahan (Sutoro Eko, 2002).
Permendagri RI Nomor 7 Tahhun 2007 tentang Kader Pemberdayaan
Masyarakat,dinyatakan bahwa pemberdayaan masyarakat adalah suatu strategi yang
digunakan

dalampembangunan

masyarakat

sebagai

upaya

untuk

mewujudkan

kemampuan dan kemandiriandalam kehidupan bermasyarakat, berbangsa dan bernegara


(Pasal 1 , ayat (8)).
Inti
pengertian

pemberdayaan

masyarakat

merupakan

strategi

untuk

mewujudkankemampuan dan kemandirian masyarakat. Selain itu, pemberdayaan


masyarakat adalah suatu proses untuk meningkatkan kemampuan atau kapasitas
masyarakat dalam memamfaatkan sumber daya yang dimiliki, baik itu sumber daya
manusia (SDM) maupun sumber daya alam (SDA) yang tersedia dilingkungannya agar
dapat meningkatkan kesejahteraan hidupnya. Namun upaya yang dilakukan tidak hanya
sebatas untuk meningkatkan kemampuan atau kapasitas dari masyarakat untuk memenuhi
kebutuhan hidupnya, tetapi juga untuk membangun jiwa kemandirian masyarakat agar
berkembang dan mempunyai motivasi yang kuat dalam berpartisipasi dalam proses
pemberdayaan. Masyarakat dalam hal ini menjadi pelaku atau pusat proses
pemberdayaan. Hal ini juga dikuatkan oleh pendapat Sumodingrat (2009:7), yang
mengemukakan bahwa masyarakat adalah makhluk hidup yang memiliki relasi sosial
maupun ekonomi, maka pemberdayaan sosial merupakan suatu upaya untuk membangun
semangat hidup secara mandiri dikalangan masyarakat untuk memenuhi kebutuhan hidup
masing-masing secara bersama-sama.
Tujuan dan Strategi Pemberdayaan Masyarakat
Tujuan pemberdayaan masyarakat adalah memampukan dan memandirikanmasyarakat
terutama dari kemiskinan dan keterbelakangan/kesenjangan/ketidakberdayaan.Kemiskinan
dapat dilihat dari indikator pemenuhan kebutuhan dasar yang belummencukupi/layak.
Kebutuhan dasar itu, mencakup pangan, pakaian, papan, kesehatan,pendidikan, dan
transportasi. Sedangkan keterbelakangan, misalnya produktivitas yangrendah, sumberdaya
manusia yang lemah, terbatasnya akses pada tanah padahalketergantungan pada sektor
pertanian masih sangat kuat, melemahnya pasar-pasarlokal/tradisional karena dipergunakan
untuk memasok kebutuhan perdaganganinternasional. Dengan perkataan lain masalah
keterbelakangan menyangkut struktural(kebijakan) dan kultural (Sunyoto Usman, 2004).
Ada beberapa strategi yang dapat menjadi pertimbanganuntuk dipilih dan kemudian
diterapkan dalam pemberdayaan masyarakat, yaitu :
1. Menciptakan iklim, memperkuat daya, dan melindungi.Dalam upaya memberdayakan
masyarakat dapat dilihat dari tiga sisi, yaitu ;pertama, menciptakan suasana atau iklim
yang memungkinkan potensi masyarakatberkembang (enabling). Disini titik tolaknya
adalah pengenalan bahwa setiap manusia,setiap masyarakat, memiliki potensi yang
dapat dikembangkan.

2. Memperkuat potensi atau daya yang dimiliki masyarakat (empowering).Dalam rangka


pemberdayaan ini, upaya yang amat pokok adalah peningkatan tarafpendidikan, dan
derajat kesehatan, serta akses ke dalam sumber-sumber kemajuan ekonomiseperti
modal,

teknologi,

informasi,

lapangan

kerja,

dan

pasar.

Masukan

berupapemberdayaan ini menyangkut pembangunan prasarana dan sarana dasar fisik,


sepertiirigasi, jalan, listrik, maupun sosial seperti sekolah dan fasilitas pelayanan
kesehatan, yangdapat dijangkau oleh masyarakat pada lapisan paling bawah, serta
ketersediaan lembagalembagapendanaan, pelatihan, dan pemasaran di perdesaan,
dimana terkonsentrasipenduduk yang keberdayaannya amat kurang. Untuk itu, perlu
ada program khusus bagimasyarakat yang kurang berdaya, karena program-program
umum

yang

berlaku

ini.Pemberdayaan

bukan

tidakselalu

dapat

hanya

meliputi

menyentuh

lapisan

penguatan

masyarakat

individu

anggota

masyarakat,tetapi juga pranata-pranatanya. Menanamkan nilai-nilai budaya modern,


seperti kerjakeras, hemat, keterbukaan, dan kebertanggungjawaban adalah bagian
pokok dari upayapemberdayaan ini. Demikian pula pembaharuan institusi-institusi
sosial danpengintegrasiannya ke dalam kegiatan pembangunan serta peranan
masyarakat didalamnya. Yang terpenting disini adalah peningkatan partisipasi rakyat
dalam prosespengambilan keputusan yang menyangkut diri dan masyarakatnya. Oleh
karena itu,pemberdayaan masyarakat amat erat kaitannya dengan pemantapan,
pembudayaan,pengamalan demokrasi.
3. Memberdayakan mengandung pula arti melindungi. Dalam prosespemberdayaan,
harus dicegah yang lemah menjadi bertambah lemah, oleh karenakekurangberdayaan
dalam menghadapi yang kuat. Oleh karena itu, perlindungan danpemihakan kepada
yang lemah amat mendasar sifatnya dalam konsep pemberdayaan masyarakat.
Melindungi tidak berarti mengisolasi atau menutupi dari interaksi, karena halitu justru
akan mengerdilkan yang kecil dan melunglaikan yang lemah. Melindungi harusdilihat
sebagai upaya untuk mencegah terjadinya persaingan yang tidak seimbang,
sertaeksploitasi yang kuat atas yang lemah. Pemberdayaan masyarakat bukan
membuat masyarakat menjadi makin tergantung pada berbagai program pemberian
(charity).Karena, pada dasarnya setiap apa yang dinikmati harus dihasilkan atas usaha
sendiri (yanghasilnya dapat dipertikarkan dengan pihak lain). Dengan demikian tujuan
akhirnya

adalahmemandirikan

masyarakat,

memampukan,

dan

membangun

kemampuan untuk memajukandiri ke arah kehidupan yang lebih baik secara


berkesinambungan.

3. Pemberdayaan Masyarakat Berbasis Kearifan Lokal di Era Globalisasi


Dalam Kamus Inggris Indonesia, local berarti setempat,sedangkan wisdom (kearifan)
sama dengan kebijaksanaan. Secara umum maka local wisdom(kearifan setempat) dapat
dipahami sebagai gagasan-gagasan setempat (local) yang bersifatbijaksana, penuh
kearifan, bernilai baik, yang tertanam dan diikuti oleh anggotamasyarakatnya (Sartini,
2004). Kearifan lokal atau sering disebut local wisdom dapatdipahami sebagai usaha
manusia dengan menggunakan akal budinya (kognisi) untukbertindak dan bersikap
terhadap sesuatu, objek, atau peristiwa yang terjadi dalam ruangtertentu (Ridwan, 2007).
Pengertian di atas, disusun secara etimologi, di mana wisdomdipahami sebagai
kemampuan seseorang dalam menggunakan akal pikirannya dalambertindak atau bersikap
sebagai hasil penilaian terhadap sesuatu, objek, atau peristiwa yangterjadi.
Sebagai
sebuah
istilah
wisdom
sering
diartikan

sebagai

kearifan/kebijaksanaan.Kearifanlokal merupakan pengetahuan yang eksplisit yang


muncul

dari

periode

panjang

yangberevolusi

bersama-sama

masyarakat

dan

lingkungannya dalam sistem lokal yang sudahdialami bersama-sama. Proses evolusi yang
begitu panjang dan melekat dalam masyarakatdapat menjadikan kearifan lokal sebagai
sumber energi potensial dari sistem pengetahuankolektif masyarakat untuk hidup bersama
secara dinamis dan harmonis. Pengertian ini melihat kearifan lokal tidak sekadar sebagai
acuan tingkah-laku seseorang, tetapi lebih jauh,yaitu mampu mendinamisasi kehidupan
masyarakat yang penuh keadaban. Pada akhirnya kearifan lokal dijadikan pandangan
hidup dan ilmu pengetahuan serta berbagai strategikehidupan yang berwujud aktivitas
yang dilakukan oleh masyarakat lokal dalam menjawabberbagai masalah dalam
pemenuhan kebutuhan mereka yang meliputi seluruh unsurkehidupan: agama, ilmu
pengetahuan, ekonomi, teknologi, organisasi sosial, bahasa dankomunikasi, serta
kesenian. Mereka mempunyai pemahaman, program, kegiatan, pelaksanaanterkait untuk
mempertahankan, memperbaiki, mengembangkan unsur kebutuhan mereka,dengan
memperhatikan lingkungan dan sumber daya manusia yang terdapat pada wargamereka.
Masyarakat tanpa konflik yang majemuk jika dipahami secara sepintas merupakan
format kehidupan sosial yangmengedepankan semangat demokratis dan menjunjung
tinggi nilai-nilai hak asasi manusia.Dalam masyarakat tanpa konflik yang majemuk ,
warga bekerjasama membangun ikatan sosial, jaringanproduktif dan solidaritas
kemanusiaan yang bersifat non-govermental untuk mencapaikebaikan bersama. Beberapa
indikator yang dapat digunakan sebagai ukuran dalammewujudkan tercapainya
masyarakat tanpa konflik yang majemuk, yaitu: 1) terpeliharanya eksistensi agama atau

ajaran-ajaran

yang

ada

dalam

masyarakat;

2)

terpelihara

dan

terjaminnya

keamanan,ketertiban, dan keselamatan; 3) tegaknya kebebasan berpikir yang jernih dan


sehat; 4)terbangunnya eksistensi kekeluargaan yang tenang dan tenteram dengan penuh
toleransi dantenggang rasa; 5) terbangunnya kondisi daerah yang demokratis, santun,
beradab sertabermoral tinggi; dan 6) terbangunnya profesionalisme aparatur yang tinggi
untukmewujudkan tata pemerintahan yang baik, bersih berwibawa dan bertanggung
jawab.
Dalam masyarakat multikultural seperti Indonesia di era globalisasi, paradigma
hubungan dialogal atau pemahaman timbal balik sangat dibutuhkan, untuk mengatasi
ekses-ekses negatif dari suatu problem disintegrasi bangsa dengan masuknya budayabudaya luar harus mengupayakan adanya filterisasi budaya. Oleh karena itu,
multikulturalisme bukan sekedar mengakuiyang berbeda dan lebih merupakan pembedaan
yang simetris (symetrical differentiatedcitizenship) dengan mengakui adanya pluralitas
identitas dalam masyarakat. Hal inilah yangmestinya didorong oleh kebijakan Otonomi
Daerah dalam rangka mengeliminir munculnyaloyalitas sempit atas dasar agama maupun
ikatan kesukuan belaka. Selain itu, melaluipluralitas identitas, maka perjuangan
kepentingan masyarakat lokal tidak lagi terjebak padaisu-isu primordial dan sekterian
yang bisa mengancam harmoni lokal itu sendiri.Implementasi Otonomi Daerah juga
meniscayakan

pemberian

ruang

politik

dan

aspirasikepada

masyarakat

untuk

berpartisipasi secara luas. Prinsip penerimaan dan penghargaanterhadap keberagaman


nilai-nilai merupakan pembiakan dari prinsip demokrasi yang tidaksaja mendorong
terciptanya partisipasi dari dan pemberdayaan bagi semua golonganmasyarakat. Akan
tetapi pembiakan dari prinsip demokrasi ini juga akan terwujud dalambentuk mengakui
dan menghargai keberagaman budaya serta ide atau pendapat yang salingberbeda maupun
mengakui dan menghargai prinsip Otonomi Daerah yang luas dan nyatayaitu keberadaan
hak-hak asli daerah dan hak-hak rakyat didaerah.
Globalisasi merupakan suatu proses meningkatnya saling ketergantungan ekonomi,
kultural, lingkungan, sosial dan lingkungan lintas negara yang bebas, serta munculnya
kecenderungan bentuk dan proses homogenisasi, hibridisasi dan diferensiasi kultur (nilainilai, kebiasaan-kebiasaan, dan perilaku masyarakat) global. Selain itu, globalisasi adanya
perkembangan dalam proses penyatuan integrasi ekonomi masyarakat yang disebabkan
oleh kemajuan teknologi komunikasi-informasi, yang menjadikan dunia semakin kecil
sehingga faktor faktor produksi dapat bergerak antar bangsa dengan cepat nyaris tidak
dapat dikontrol di masyarakat. Di masyarakat Indonesia, perkembangan globalisasi

semakin pesat dan canggih. Dengan adanya globalisasi maka semakin hilang jati diri
bangsa Indonesia yang dahulunya adanya budaya rewangsekarang mulai hilang yang
digantikan dengan catering.
Kemajemukan (pluralitas) dan keanekaragaman (heterogenitas atau diversitas)
masyarakatdan kebudayaan di Indonesia merupakan kenyataan sekaligus keniscayaan,
nilai aslimasyarakat Indonesia adalah nilai yang didalamnya melekat dengan konsep
multikultural,nilai-nilai seperti toleransi beragama, agregasi sosial, kemajemukan kultural
dan etnik,menjadi alasan mengapa para pendiri bangsa ini memilih Pancasila dari pada
pada ideologibernuansa agama. Keniscayaan ini harus kita akui secara jujur, terima
dengan lapang dada,kelola dengan cermat, dan jaga dengan penuh rasa syukur; bukan
harus kita tolak, abaikan,sesalkan, biarkan, dan diingkari hanya karena kemajemukan dan
keanekaragaman itu menimbulkan berbagai ekses negatif, antara lain benturan
masyarakat dan kebudayaan lokal di pelbagai tempat di Indonesia, apalagi zaman
sekarang adanya arus globalisasi yang sudah merajalela dalam bidang transportasi,
teknologi dan komunikasi, dan pengembangan media massa.
Strategi pemberdayaan masyarakat berbasis kearifan lokal di era globalisasi yakni
dengan memperkuat nilai-nilai dan norma-norma leluhur dari nenek moyang yang ada di
masyarakat agar terjaga utuh kearifan lokal; mempertahankan budaya yang ada di
masyarakat dengan bertindak secara rasional sebagai akibat dari arus globalisasi;
menyaring budaya dari luar (globalisasi) dengan menilai baik buruknya pengaruh dalam
bidang teknologi dan komunikasi, transportasi, pengembangan media massa, perubahan
gaya hidup, pendidikan, budaya, politik, agama, hukum dll.
Salahsatuindicator
darikeberdayaanmasyarakatadalahkemampuandankebebasanuntukmembuatpilihan

yang

terbaikdalammenentukanataumemperbaikikehidupannya.Pendekatanpemberdayaanmasya
rakatdalampembangunanmengandungartibahwamanusiaditempatkanpadaposisipelakudan
penerimamanfaatdari

proses

mencarisolusidanmeraihhasilpembangunan.

Dengandemikianmakamasyarakatharusmampumeningkatkankualitaskemandirianmengat
asimasalah

yang

dihadapi.Upaya-

upayapemberdayaanmasyarakatseharusnyamampuberperanmeningkatkankualitassumberd
ayamanusia

(SDM)

terutamadalammembentukdanmerubahperilakumasyarakatuntukmencapaitarafhidup yang
lebihberkualitas.
Pemberdayaankomunitastidak

lain

adalahmemberikanmotivasidandorongankepadamasyarakat

agar

mampumenggalipotensidirinyadanberanibertindakmemperbaikikualitashidupnya,
melaluicaraantara

lain

denganpendidikanuntukpenyadarandanpemampuandirimereka.

Permberdayaanmasyarakatdilakukanpadabeberapakelompoksosial

yang

ada

di

dalammasyarakat.Untukmelakukanpemberdayaanmasyarakatsecaraumumdapatdiwujudka
ndenganmenerapkanprinsip-prinsipdasarpendampinganmasyarakat, sebagaiberikut : (1)
Belajar Dari Masyarakat, (2)PendampingsebagaiFasilitator, Masyarakatsebagipelaku, (3)
SalingBelajar,

SalingBerbagiPengalaman.

Padaprinsipnyapemberdayaanbukanmerupakansuatu

program

ataukegiatan

berdirisendiri.Pemberdayaanmerujukpadaserangkaiankegiatan

yang
yang

bertujuanuntukmerubahlebihdarisatuaspekpadadiridankehidupanseseorangatausekelompo
k

orang

agar

mampumelakukantindakan-tindakan

yang

diperlukanuntukmembuatkehidupannyalebihbaikdansejahtera.Upayapemberdayaanmasya
rakatmerupakanjalan

yang

masihpanjangdanmasihpenuhtantangan.Model

pembangunanekonomi

yang

sentralistikdansangatkapitalistiktelahmelembagasangatkuatbaiksecaraekonomi,
politikmaupunbudaya,
yang

sehinggatidakmudahuntukmenjebolnya.Hanyadengankomitmen

kuatdankeberpihakanyang

tulus,

sertaupaya

yang

sungguh-sungguh,

pemberdayaanmasyarakatakandapatdiwujudkan.
Pemberdayaanmasyarakat
agar
mampumenjawabtantangan

di

era

globalisasimembutuhkankomitmen yang kuatdaripemerintah, parapelakuekonomi, rakyat,


lembagapendidikan,

organisasiprofesi,

sertaorganisasi-organisasi

non

pemerintahlainnya.Komitmenitudapatdiwujudkandalambentukmemberikankepercayaanbe
rkembangnyakemampuan-kemampuan

local

atasdasarkebutuhansetempat.Penguatanperansertamasyarakatsebagaipelakupembangunan,
harusdidorongseluas-luasnyamelalui

program-program

pendampinganmenujusuatukemandirianmereka.Disampingitu

pula,

perlupengembanganorganisasi, ekonomijaringandanfaktor-faktorpendukunglainnya.
Denganusahapemberdayaanmasyarakat yang adadalammasyarakat yang demikianitu,
diharapkandapatmembebaskanmerekadariberbagaipermasalahan socialuntuk
menujukehidupanyanglebihbaik.

BAB III
PENUTUP
A. KESIMPULAN
Strategi pemberdayaan masyarakat berbasis kearifan lokal di era globalisasi
yakni dengan memperkuat nilai-nilai dan norma-norma leluhur dari nenek moyang
yang ada di masyarakat agar terjaga utuh kearifan lokal; mempertahankan budaya
yang ada di masyarakat dengan bertindak secara rasional sebagai akibat dari arus
globalisasi; menyaring budaya dari luar (globalisasi) dengan menilai baik buruknya
pengaruh dalam bidang teknologi dan komunikasi, transportasi, pengembangan media
massa, perubahan gaya hidup, pendidikan, budaya, politik, agama, hukum dll.
Salahsatuindicator
darikeberdayaanmasyarakatadalahkemampuandankebebasanuntukmembuatpilihan
yang
terbaikdalammenentukanataumemperbaikikehidupannya.Pendekatanpemberdayaanma
syarakatdalampembangunanmengandungartibahwamanusiaditempatkanpadaposisipel
akudanpenerimamanfaatdari

proses

mencarisolusidanmeraihhasilpembangunan.

Dengandemikianmakamasyarakatharusmampumeningkatkankualitaskemandirianme
ngatasimasalah

yang

dihadapi.Upaya-

upayapemberdayaanmasyarakatseharusnyamampuberperanmeningkatkankualitassum
berdayamanusia

(SDM)

terutamadalammembentukdanmerubahperilakumasyarakatuntukmencapaitarafhidup
yang lebihberkualitas.