Anda di halaman 1dari 2

REZA RAMADHAN ARIO 3425140761

LOCUS
2008
DEFINITION

EF450311

1428 bp

DNA

linear

PLN 28-FEB-

Piper betle ribulose 1,5-bisphosphate carboxylase/oxygenase large


subunit gene, complete cds; chloroplast.
ACCESSION
EF450311
VERSION
EF450311.1 GI:149389764
KEYWORDS
.
SOURCE
chloroplast Piper betle
ORGANISM Piper betle
Eukaryota; Viridiplantae; Streptophyta; Embryophyta; Tracheophyta;
Spermatophyta; Magnoliophyta; Magnoliidae; Piperales; Piperaceae;
Piper.
REFERENCE
1 (bases 1 to 1428)
AUTHORS
Yang,Z.Y., Huo,K.K., Chao,Z. and Pan,S.L.
TITLE
The discrimination among twelve species of Piperacea: inferences
from ITS, rbcL and matK sequences
JOURNAL
Unpublished
REFERENCE
2 (bases 1 to 1428)
AUTHORS
Yang,Z.Y., Huo,K.K., Chao,Z. and Pan,S.L.
TITLE
Direct Submission
JOURNAL
Submitted (23-FEB-2007) Fudan University, School of Pharmacy, 138
Yixueyuan Road, Shanghai, Shanghai 200032, China
FEATURES
Location/Qualifiers
source
1..1428
/organism="Piper betle"
/organelle="plastid:chloroplast"
/mol_type="genomic DNA"
/isolate="HJ6"
/specimen_voucher="05120906 Y.Kang, Z.Chao (SHMU)"
/db_xref="taxon:13217"
/note="authority: Piper betle Linn."
CDS
1..1428
/note="RbcL"
/codon_start=1
/transl_table=11
/product="ribulose-1,5-bisphosphate carboxylase/oxygenase
large subunit"
/protein_id="ABR26375.1"
/db_xref="GI:149389765"
/translation="MSPQTETKAYVGFKAGVKDYKLTYYTPEYETKDTDILAAFRVTP
QPGVPPEEAGAAVAAESSTGTWTTVWTDGLTSLDRYKGRCYHIEPVAGEENQYICYVA
YPLDLFEEGSVTNMFTSIVGNVFGFKALRALRLEDLRIPPAYSKTFQGPPHGIQVERD
KLNKYGRPLLGCTIKPKLGLSAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRF

VFCAEALYKAQAETGEIKGHYLNATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTA
NTSLAHYCRDNGLLLHIHRAMHAVIDRQKNHGMHFRVLAKALRMSGGDHVHSGTVVGK
LEGERDITLGFVDLLRDDFVEKDRSRGIYFTQDWVSMPGVLPVASGGIHVWHMPALTE
IFGDDSVLQFGGGTIGHPWGNAPGAVANRVSLEACVQARNEGRDLAREGNEIVREAAK
WSPELAAACEVWKEIKFEFEAVDTL"
ORIGIN
1 atgtcaccac aaacagaaac taaagcttac gttggattca aggctggtgt
61 aaattaactt attatactcc tgagtatgaa accaaagata ctgatatctt
121 cgagtaactc cgcaacccgg agttccgccc gaagaagcag gggctgcagt
181 tcctctactg gtacatggac aactgtatgg accgacggac ttaccagcct
241 aaaggacgat gctaccacat cgagcccgtt gctggggagg aaaatcaata
301 gtagcctatc ctttagacct ttttgaagaa ggttctgtta ctaacatgtt
361 gtgggtaatg tatttggctt caaagcccta cgagccctac gtctggaaga
421 cctcctgctt attccaaaac tttccaaggc ccaccccatg gaatccaagt
481 aaattgaaca agtatggtcg ccctttattg ggatgtacta ttaaaccaaa
541 tcggctaaga actacggtag ggcggtttat gaatgtctcc gcggtggcct
601 aaggatgatg aaaatgtgaa ctcccaacca tttatgcgct ggagagaccg
661 tgtgccgaag ctctttataa agcgcaggcc gaaacgggtg aaattaaagg
721 aatgctacgg caggtacatg cgaagaaatg ataaaaaggg ccgtatttgc
781 ggagttccta tcgtaatgca tgactactta acgggggggt tcaccgcaaa
841 gctcattatt gccgagacaa cggcctacta cttcatatcc accgtgcaat
901 attgatagac agaagaatca tggtatgcac ttccgtgtac tagcaaaagc
961 tctggtggag accatgttca ctcaggtacg gtagtaggta aactagaagg
1021 attactctgg gttttgttga tttgctacgt gatgattttg ttgaaaaaga
1081 ggtatttatt tcactcaaga ttgggtctct atgccaggcg ttttgccagt
1141 gggattcacg tttggcatat gcctgccctg accgagatct ttggggatga
1201 cagtttggtg gaggaactat aggacaccct tggggaaatg cacccggcgc
1261 cgtgtgtctt tagaagcgtg tgtacaagct cgtaatgaag gacgtgatct
1321 ggtaatgaaa ttgttcgtga agctgctaaa tggagccccg aactagcggc
1381 gtatggaaag aaatcaaatt cgaattcgaa gcagtggata ccttgtga
//

taaagattac
ggcagcattc
agctgccgaa
tgatcgttac
tatttgctat
tacttccatt
tctacgaatt
tgaaagagat
gttggggtta
tgatttcacc
tttcgtattt
acattactta
tagagaattg
tactagcttg
gcacgcagtt
attacgtatg
ggagcgggat
tcgaagtcgc
agcttcaggg
ttccgtacta
agtagcgaat
tgctcgtgag
tgcttgtgaa