Anda di halaman 1dari 51

SKENARIO1

PENGLIHATANTERGANGGU
Tn. A, 56 tahun, mengeluh penglihatan terganggu di kedua mata sejak 2 bulan
yang lalu. Kadang-kadang terlihat bintik gelap dan lingkaran-lingkaran cahaya. Pasien
sudah mengidap DM tipe 2 sejak 5 tahun. Saat ini telapak kaki terasa kesemutan dan
nyeri bila berjalan.
Tekanan darah 130/90 mmHg, berat badan 80 kg, tinggi badan 165 cm dan
indeks massa tubuh (IMT) 29,4 kg/m, lingkar perut 108 cm. kulit teraba kering dan
pada pemeriksaan sensorik dengan Monofilament Semmes Weinstein 10 gram sudah
terdapat penurunan rasa nyeri. Pemeriksaan Ankle Brachial Indeks 0,9. Pada
pemeriksaan funduskopi terdapat mikroaneurisma dan pendarahan dalam retina. Hasil
laboratorium glukosa darah puasa 256 mg/dl, glukosa darah 2 jam setetlah makan 345
mg/dl, HbA1c 10,2 g/dl dan protein urin positif 3.
Dokter menyarankan untuk dilakukan pemeriksaan lebih lanjut untuk melihat
komplikasi kronik mikroangiopati, makroangiopati dan nefropati. Pasien juga di berikan
edukasi perencanaan makan diet 1900 kalori yang halal dan baik sesuai ajaran islam,
jenis olahraga yang sesuai dan pemberian insulin untuk mengontrol glukosa darahnya,
serta efek samping yang dapat terjadi akibat pemberian obat.

KATAKATASULIT
1. Insulin
Hormonalamiberupahormonpolipeptidayangdiproduksiolehorganpancreas(sel
selbeta),yangberfungsidalammengaturmetabolismekarbohidratdantingkatgula
darah(glukosa)dalamtubuh
2. PemeriksaanMonofilamentSemmesWeinstein
Pemeriksaan untuk mengidentifikasi pasien berisiko komplikasiextremitas bawah
dalampengaturanklinis
3. AnkleBrachialIndex
Pengukurantekanandarahdikakidantangan,laludibandingkan
4. Funduskopi
Pemeriksaanuntukmelihatfundusoculi
5. Mikroaneurisma
Aneurismaataudilatasipadapembuluhdarahkecil
6. Neuropati
Gangguansarafyangmenyebabkannyeripadatubuh
7. Mikroangiopati
Akumulasilipiddangumpalandarahpadapembuluhdarahkecil
8. Makroangiopati
Akumulasilipiddangumpalandarahpadapembuluhdarahbesar
9. HbA1c
Zat yang terbentuk dari reaksi kimia antara glukosa dan monoglobulin yang
menggambarkankonsentrasiguladarahratarataselama13bulan
2

BRAINSTORMING
1.
2.
3.
4.

Mengapatelapakkakikesemutandannyeri?
Mengapakulitpadapasienterabakering?
Mengapapadapemeriksaandidapatkanproteinurintinggi?
Mengapaterdapatbintikgelappadapenglihatandanlingkaranhitampadapasien

5.
6.
7.
8.

DM?
Mengapaterdapatperdarahanpadaretinadanmikroaneurisma?
Bagaimanacarainsulinmengontrolglukosadarah?
Mengapaharusdilakukanpemeriksaanglukosadarahpuasa?
MengapapasienDMdianjurkanuntukberolahragadanjenisolahragaapayang

dianjurkanuntukpasien?
9. Apahubungannyadiabetesmellitusdenganusia?

JAWABAN

1. Karena peningkatan glukosa darah, maka terjadi gangguan antara listrik pada
serabut saraf perifer dan pembuluuh darah kapiler, sehingga sel saraf tidak
mendapatkansirkulasi.
2. Karenaadapenumpukanglukosayangmenyebabkanhiperosmolaritassehingga
terjadipeningkatantekanandarijaringankepembuluhdarah,makaPDpecahdan
terjadiiskemik.
3. Karenahiperglikemikbisamenyebabkanglomerulussclerosissehinggaprotein
urindapatkeluardariurin.
4. Penyebabpenglihatanterganggudanterkadangterlihatbintikgelapdanlngkaran
cahaya hitam yaitu karena ada penumpukan glukosa yang menyebabkan
hiperosmolaritassehinggaterjadipeningkatantekanandarijaringankepembuluh
darah,makaPDpecahdanterjadiiskemik.Contohnyakulitjadikering.
5. Karena peningkatan glukosa darah, maka terjadi gangguan antara listrik pada
serabut saraf perifer dan pembuluh darah perifer, sehingga sel saraf tidak
mendapatkansirkulasi.
6. Peningkatan glukosa darah akan merangsang sintesis insulin sehingga
menghambatgluconeogenesisdanmerangsangglukogenesis.
7. Untukmendapatkanhasilyangakuratdanmenegakkandiagnosis.
8. PasienDMseringdikaitkandaripenyebabobesitasdanlifestyleyangtidakbaik,
sehinggadianjurkanuntukolahragauntukmenurunkanberatbadansampaiyang
idealdanuntukgayahidup(polamakan)yangseimbang.
Dianjurkanuntukmelakukansenamdiabetes.
9. Semakintuafungsipancreasmakasemakinmenurunkerjahormone
perubahanhormonal
perubahanpolamakandankomposisitubuh

SASARANBELAJAR
1. MemahamidanMenjelaskanAnatomiPankreas
1.1 Makroskopik
1.2 Mikroskopik
2. MemahamidanMenjelaskanFisiologidanBiokimiaInsulin
3. MemahamidanMenjelaskanDiabetesMellitus
3.1 Definisi
3.2 Klasifikasi
4. MemahamidanMenjelaskanDiabetesMellitusTipe2
4.1 Definisi
4.2 Etiologi
4.3 Epidemiologi
4.4 Patofisiologi
4.5 ManifestasiKlinis
4.6 DiagnosisdanDiagnosisBanding
4.7 Tatalaksana
4.8 Komplikasi
4.9 Prognosis
4.10
Pencegahan
5. MemahamidanMenjelaskanRetinopatiDiabetik
6. MemahamidanMenjelaskanGiziTerhadapPasienDiabetesMellitus
7. Memahami dan Menjelaskan Pandangan Agama Islam Terhadap Makanan yang
Halal&Thoyyiban

1. MemahamidanMenjelaskanAnatomiPankreas
1.1 AnatomiMakroskopis

http://www.buzzle.com/images/diagrams/human-body/anatomy-of-pancreas.jpg
Memiliki struktur lunak dan berlobus, berada pada abdomen di region
epigastrium.Terdiriatas4bagian:
a. Caput
:cakram,padabagiancekungduodenum,meluaskekiridandi
belakanga.v.mesenterica

superior dan terdapat

processusuncinatus
b. Collum :terletakdidepanpangkalv.portadana.mesentericasuperior
c. Corpus
:berjalankeatasdankekirimenyilanggaristengah
d. Cauda
:menujuLig.Lienorenalismenujukehiluslimpa
BatasBatas
a. Anterior :darikanankekiricolontrasnversum,mesocolontrasnversum,
bursaomentalis,gaster
b. Posterior :darikanankekiri,ductuscholedocus,v.porta,v.lienalis,v.
cava inferior, aorta, pangkal a. mesenterica superior, m. psoas sinistra,
glandulasuprarenalissinistra,renalsinistra&hiluslienalis

https://smediacache
ak0.pinimg.com/736x/5e/1b/4d/5e1b4d170b5e4efdabc89587e2b32ec9.jpg
Perdarahan
Arteri Lienalis dan Arteri pancreaticoduodenalis superior dan inferior.
VenaLienalis,V.Pancreaticoduodenalissuperiordaninferioryangbermuarake
venaportahepatica.
Persarafan
DipersarafiolehN.X(Vagus)sifatnyasimpatisdan
parasimpatis
SaluranKelenjarPankreas
a. Ductus pancreaticus mayor
(Wirsungi)
b. Ductus

pancreaticus

minor/accesorius(Santorini)
http://www.nejm.org/na101/home/literatum/publisher/mms/journals/content/
nejm/1994/nejm_1994.330.issue
17/nejm199404283301706/production/images/medium/nejm1994042833017
06_f1.gif
7

2.1AnatomiMikroskopis

Pankreasterdiridariduajaringanutama,yaitu:
(1) Asinisekresigetahpencernaankedalamduodenum.
(2) Pulau Langerhans yang tidak tidak mengeluarkan sekretnya keluar, tetapi
mensekresiinsulindanglukagonlangsungkedarah.
PulaupulauLangerhansyangmenjadisistemendokrinologisdaripankreastersebar
di seluruh pankreas dengan berat hanya 13 % dari berat total pankreas. Pulau
langerhansberbentukovoiddenganbesarmasingmasingpulauberbeda.Besarpulau
langerhansyangterkeciladalah50,sedangkanyangterbesar300,terbanyakadalah
yang besarnya 100225. Jumlah semua pulau langerhans di pankreas diperkirakan
antara12juta.
Selendokrindapatditemukandalampulaupulaulangerhans,yaitukumpulankecil
selyangtersebardiseluruhorgan.
Ada4jenisselpenghasilhormonyangteridentifikasidalampulaupulautersebut,
Sloane(2003):
a. Sel , jumlah sekitar 2040%, memproduksi glukagon yang menjadi faktor
hiperglikemik,suatuhormonyangmempunyaiantiinsulinlikeactivity.
b. Selmensekresiinsulinyangmenurunkankadarguladarah.
c. Sel mensekresisomatostatin,hormonpenghalanghormonpertumbuhanyang
menghambatsekresiglukagondaninsulin.
d. Selmensekresipolipeptidapankreas,sejenishormonpencernaanuntukfungsi
yangtidakjelas.
2. MemahamidanMenjelaskanFisiologidanBiokimiaInsulin
a Sintesisinsulin
8

Insulin merupakan hormone yang terdiri dari rangkaian asam amino,


dihasilkan oleh beta kelenjar pancreas. Dalam keadaan normal, bila ada
rangsanganpadaselbeta,insulindisintetis kemudiandiekskresikankedalam
darahsesuaikebutuhantubuhuntukkeperluanregulasiglukosadarah.
Insulin disintesis sebagai suatu preprohormon (berat molekul sekitar
11.500) dan merupakan prototype untuk peptide yang diproses dari molekul
prekusoryanglebihbesar.Angkaianpemanduyangbersifathidrofobikdengan
23 asam amino mengarahkan molekul tersebut ke dalam sisterna reticulum
endoplasma dan kemudian dikeluarkan. Proses ini menghasilkan proinsulin
dengan berat molekul 9000 yang menyediakan bentuk yang diperlukan bagi
pembentukanjembatandisulfideyangsempurna.Penyusunanproinsulin,yang
dimulaidaribagianterminalamino,adalahrantaiBpeptideCpenghubung
rantaiA.molekulproinsulinmenjalaniserangkaianpemecahanpeptidetapak
spesifiksehinggaterbentukinsulinyangmaturdanpeptideCdalamjumlahyang
seimbangdandisekresikandarigranulsekretorikpadaselbetapancreas.

Sekresiinsulin
Glukosamerupakankunciregulatorsekresiinsulinolehselbetapancreas,
walaupunasamamino,ketondannutrientlainnyajugamempengaruhisekresi
insulin.Kadarglukosa>3,9mmol/L(70mg/dl)merangsangsintesisinsulin.
Glukosamerangsangsekresiinsulindenganmasukkedalamselbetamelalui
transporter GLUT2. Selanjutnya dalam sel, glukosa mengalami proses

fosforilasi oleh enzim glukokinase dan glikolisis yang akan membebaskan


molekulATP.
Molekul ATP yang terbebas tersebut, dibutuhkan untuk mengaktifkan
prosespenutupanKchannelyangterdapatpadamembranesel.Terhambatnya
pengeluaran ion K dari dalam sel menyebabkan depolarisasi membrane sel.
Terhambatnya pengeluaran ion K dari dalam sel menyebabkan depolarisasi
membrane sel, yang diikuti kemudian oleh proses pembukaan Ca channel.
KeadaaninilahyangmemungkinkanmasuknyaionCasehinggameningkatkan
kadar ion Ca intrasek, suasana yang dibutuhkan bagi proses sekresi insulin
melaluimekanismeyangcukuprumitdanbelumseutuhnyadapatdijelaskan.
AktivasipenutupanKchannelterjaditidakhanyadisebabkanolehransangan
ATPhasilprosesfosforilasiglukosaintrasel,teteapijugadapatolehpengaruh
beberapafactorlaintermasukobatobatan.Namunsenyawaobatobatantersebut
(biasanyatergolongobatdiabetes),bekerjamengaktivasiKchanneltidakpada
reseptoryangsamadenganglukosa,tapipadareseptortersendiriyangdisebut
sulphonilureaeceptor(SUR),yangjugaterdapatpadamembraneselbeta.
c

Aksiinsulin
Insulinmempunyaifungsipentingpadaberbagaiprosesmetabolismedalam
tubuhterutama metabolismekarbohidrat.Hormoninisangatkrusialperannya
dalamprosesutilisasiglukosaolehhampirseluruhjaringantubuh,terutamapada
otot,lemak,danhepar.
Pada jaringan perifer seperti jaringan otot dan lemak, insulin berikatan
dengansejenisreseptor(insulinreceptorsubstrate= IRS)yangterdapatpada
membran sel tersebut. Ikatan antara insulin dan reseptor akan menghasilkan
semacamsinyalyangbergunabagiprosesregulasiataumetabolismeglukosa
didalam sel otot dan lemak, meskipun mekanisme kerja yang sesungguhnya
belum begitu jelas. Setelah berikatan, transduksi sinyal berperan dalam
meningkatkankuantitasGLUT4(glucosetransporter4)danselanjutnyajuga
pada mendorong penempatannya pada membran sel. Proses sintesis dan
translokasi GLUT4 inilah yang bekerja memasukkan glukosa dari ekstra ke
intraseluntukselanjutnyamengalamimetabolism(Gb.3). Untukmendapatkan
proses metabolisme glukosa normal, selain diperlukan mekanisme serta
dinamikasekresiyangnormal,dibutuhkanpulaaksiinsulinyangberlangsung
10

normal.Rendahnyasensitivitasatautingginyaresistensijaringantubuhterhadap
insulin merupakan salah satu faktor etiologi terjadinya diabetes, khususnya
diabetestipe2.
Baik atau buruknya regulasi glukosa darah tidak hanya berkaitan dengan
metabolisme glukosa di jaringan perifer, tapi juga di jaringan hepar dimana
GLUT2berfungsisebagaikendaraanpengangkutglukosamelewatimembrana
selkedalamsel.Dalamhalinilahjaringanheparikutberperandalammengatur
homeostasis glukosa tubuh. Peninggian kadar glukosa darah puasa, lebih
ditentukanolehpeningkatanproduksiglukosasecaraendogenyangberasaldari
prosesglukoneogenesisdanglikogenolisisdijaringanhepar.Keduaprosesini
berlangsung secara normal pada orang sehat karena dikontrol oleh hormon
insulin.Manakalajaringan(hepar)resistenterhadapinsulin,makaefekinhibisi
hormon tersebut terhadap mekanisme produksi glukosa endogen secara
berlebihanmenjaditidaklagioptimal.Semakintinggitingkatresistensiinsulin,
semakin rendah kemampuan inhibisinya terhadap proses glikogenolisis dan
glukoneogenesis,dansemakintinggitingkatproduksiglukosadarihepar.

1. binding kereseptor, 2.translokasiGLUT4kemembransel,3.transportasi


glukosa meningkat, 4.disosiasi insulin dari reseptor, 5. GLUT 4 kembali
menjauhimembran,6.kembalikesuasanasemula.
d

Mekanismekerjainsulin
1 Efekpadakarbohidrat
Insulinmemilikiempatefekyangdapatmenurunkankadarglukosadarah
danmeningkatkanpenyimpanankarbohidrat:
11

Insulinmempermudahmasuknyaglukosakedalamsebagianbesarsel.
Beberapajaringanyangtidaktergantunginsulinyaituotak,ototyang

aktif,hati.
Insulinmerangsangglikogenesis,pembentukanglikogendariglukosa,

baikdiototmaupunhati
Insulin menghambat glikogenolisis , penguraian glikogen menjadi
glukosa(glukagon).denganmenghambatpenguraianglikogen,insulin
meningkatkan penyimpanan karbohidrat dan menurunkan penguraian

glukosaolehhati
Insulin menghambat glukoneogenesis untuk menurunkan pengeluaran
glukosaolehhati.

Denganduacara:
Menurunkanjumlahasamaminodidalamdarahyangtersediabagihati
untukglukoneogenesis
Menghambatenzimenzimhatiyangdiperlukanuntukmengubahasam
aminomenjadiglukosa
2 Efekpadalemak
Insulinmemilikibanyakefekuntukmenurunkankadarasamlemakdarah
danmendorongpembentukantrigliserida
Insulin meningkatkan transportasi glukosa kedalam sel jaringan
adiposa.Glukosaberfungsisebagaiprekusoruntukpembentukanasam

lemakdangliserol,yaitubahanmentahuntukmembentuktrigliserida
Insulin mengaktifkan enzimenzim yang mengkatalisis pembentukan

asamlemakdariturunanglukosa
Insulinmeningkatkanmasuknyaasamasamlemakdaridarahkedalam

seljaringanadiposa
Insulinmenghambatlipolisis,sehinggaterjadipenurunanpengeluaran

asamlemakdarijaringanadiposakedalamdarah
Efekefekitumendororngpengeluaraanglukosadanasamlemakdaridarah
danmeningkatkanpenyimpanankeduanyasebagaitrigliserida
3 Efekpadaprotein
Insulin menurunkan kadar asam amino darah dan meningkatkan sintesis
proteinsebagaiberikut:
Insulin mendorong transportasi aktif asamasam amino dari darah
kedalamototdanjaringanlain,efekinimenurunkankadarasamamino
12

dalam darah dan menghasilkan bahan pembangun untuk sistesis

proteindidalamsel
Insulinmeningkatkankecepatanpenggabunganasamaminokedalam

proteindenganmerangsangperangkatpembuatproteindidalamsel
Insulinmenghambatpenguraianprotein
Akibatkolektifefekiniadalahefekanabolikprotein.karenaitu,insulin
esensialbagipertumbuhannormal
Biokimiainsulin
Insulinadalahhormoneyangdisekresiolehselselbetapancreasdanmerupakan
polipeptida yang terdiri atas dua rantai, yaitu rantai A dan B., yang saling
dihubungkanolehduajembatandisulfideantarrantaiyangmenghubungkanA7ke
B7danA20keB19.Jembatandisulfideintrarantaiyangketigamenghubungkan
residu6dan11padarantaiA.Lokasiketigajembatandisulfideiniselalutetapdan
rantaiAsertaBmasinbgmasingmempunyai21dan30asamaminopadasebagian
besarspesies.
Insulin disintesis sebagai preprohormon (berat molekul sekitar 11.500) dan
merupakanprototypeuntukpeptideyangdiprosesdarimolekulprecursoryanglebih
besar.Rangkaianpreyangbersifathidrofobikdengan23asamaminomengarahkan
molekul tersebut ke dalam sisterna reticulum endoplasma dan kemudian
dikeluarkan.Prosesinimenghasilkanmolekulproinsulindenganberatmolekul9000
yang menyediakanbentuk yangdiperlukanbagi pembentukanjembatan disulfide
yangsempurna.Molekulproinsulinmenjalaniserangkaianpemecahanpeptideyang
tapakspesifiksehinggaterbentukinsulinyangmaturdanpeptideCdenganjumlah
ekuimolar.

3. MemahamidanMenjelaskanDiabetesMellitus
9.1 Definisi

13

Diabetes melitus adalah gangguan kronis metabolisme karbohidrat, lemak, dan


protein.

Insuffisiensi relatif atau absolut dalam respon sekretorik indulin

diterjemahkan menjadi gangguan pemakaian karbihidarat (glukosa), merupakan


gambaran khas pada diabetes melitus, demikian juga dengan hiperglikemia yang
terjadi.
DM

merupakan penyakit metabolik yang ditandai

dengan timbulnya

hiperglikemia akibat gangguan sekresi insulin. Hal ini terkait dengan kelainan pada
karbohidrat, metabolism lemak dan protein (Palaian, et al., 2005). Hiperglikemia
kronik dan gangguan metabolik DM lainnya akan menyebabkan kerusakan jaringan
dan organ, seperti mata, ginjal, syaraf, dan system vaskular (Cavallerano, 2009)
9.2 Klasifikasi
Klasifikasi DM menurut World Health Organization (WHO) tahun 2008 dan
DepartementofHealthandHumanServiceUSA(2007)terbagidalam3bagianyaitu
Diabetestipe1,Diabetestipe2,danDiabetesGestational.Namun,menurutAmerican
DiabetesAssociation(2009),klasifikasiDMterbagi4bagiandengantambahanPra
Diabetes.
MenurutAmericanDiabetesAssociation2005(ADA2005)klasifikasidiabetesmelitus,
yaitu:
1. Diabetes Melitus Tipe 1 atau Insulin Dependent Diabetes Melitus/IDDM
(destruksiselbeta,umumnyamenjuruskedefisiensiinsulinabsolut)
Melalui proses imunologikBentuk diabetes ini merupakan diabetes
tergantung insulin, biasanya disebut sebagai juvenile onset diabetes. Hal ini
disebabkan karena adanya destruksi sel beta pankreas karena autoimun.
Kerusakanselbetapankreasbervariasi,kadangkadangcepatpadasuatuindividu
dankadangkadanglambatpadaindividuyanglain.
Manifestasiklinikpertamadaripenyakitiniadalahterjadiketoasidosis.
Padadiabetestipeiniterdapatsedikitatautidaksamasekalisekresiinsulindapat
ditentukan dengan level protein cpeptida yang jumlahnya sedikit atau tidak
terdeteksi sama sekali. Sebagai marker terjadinya destruksi sel beta pankreas
adalah autoantibodi sel pulau langerhans dan atau aoutoantibodi insulin dan
autoantibodi asam glutamate dekarboksilase sekitar 8590 % terdeteksi pada
diabettipeini.Diabetesmelitusautoimuniniterjadiakibatpengaruhgenetikdan
14

faktorlingkungan.b.IdiopatikTerdapatbeberapadiabetestipe1yangetiologinya
tidakdiketahui.Hanyabeberapapasienyangdiketahuimengalamiinsulinopenia
dancenderunguntukterjadinyaketoasidosistetapibukandikarenakanautoimun.
Diabetestipeinibiasanyadialamiolehindividuasalafrikadanasia.DMtipe1
merupakanbentukDMparahyangsangatlazimterjadipadaanakremajatetapi
kadangkandangjugaterjadipadaorangdewasa,khususnyayangnonobesitas
dan mereka yang berusia lanjut ketika hiperglikemia tampak pertama kali.
Keadaan tersebut merupakan suatu gangguan katabolisme yang disebabkan
hampirtidakterdapatinsulindalamsirkulasidarah,glukagonplasmameningkat
dan selsel pankreas gagal merespons semua stimulus insulinogenik. Oleh
karena itu diperlukan pemberian insulin eksogen untuk memperbaiki
katabolisme, menurunkan hiperglukagonemia dan peningkatan kadar glukosa
darah(Karam,2002).GejalapenderitaDMtipe1termasukpeningkatanekskresi
urin poliuria), rasa haus (polidipsia), lapar, berat badan turun, pandangan
terganggu,lelah,dangejalainidapatterjadisewaktuwaktu(tibatiba)(WHO,
2008).
2. DiabetesMelitusTipe2atauInsulinNondependentDiabetesMelitus(bervariasi
mulaidaripredominanresistensiinsulindisertaidefisiensiinsulinrelatifsampai
yangpredominangangguansekresiinsulinbersamaresistensiinsulin)
Pada penderita Diabet Mellitus tipe ini terjadi hiperinsulinemia tetapi
insulin tidak bisa membawa glukosa masuk kedalam jaringan karena terjadi
resistensi insulin yang merupakan turunnya kemampuan insulin untuk
merangsangpengambilanglukosaolehjaringanperiferdanuntukmenghambat
produksiglukosaolehhati.Olehkarenaterjadinyaresistensiinsulin(reseptor
insulinsudahtidakaktifkarenadianggapkadarnyamasihtinggidalamdarah)
akanmengakibatkandefisiensirelatifinsulin.Haltersebutdapatmengakibatkan
berkurangnya sekresi insulin pada rangsangan glukosa bersama bahan
perangsang sekresi insulin lain sehingga sel beta pankreas akan mengalami
desensitisasiterhadapadanyaglukosa.Onsetdiabetesmellitustipeiniperlahan
lahankarenaitugejalanyatidakterlihat(asimtomatik).Adanyaresistensiyang
terjadi perlahan lahan akan mengakibatkan pula kesensitifan akan glukosa
perlahanlahanberkurang.Olehkarenaitu,diabetestipeiniseringterdiagnosis
15

setelahterjadikomplikasi.Komplikasiyangterjadikarenaketidakpatuhanpasien
dalammenggunakanobatantibiotikoral.
DMtipe2merupakanbentukDMyanglebihringan,terutamaterjadi
pada orang dewasa. Sirkulasi insulin endogen sering dalam keadaan
kurangdarinormalatausecararelatiftidakmencukupi.Obesitaspada
umumnya penyebab gangguan kerja insulin, merupakan faktor risiko
yangbiasaterjadipadaDMtipeinidansebagianbesarpasiendengan
DM tipe 2 bertubuh gemuk. Selain terjadinya penurunan kepekaan
jaringanterhadapinsulin,jugaterjadidefisiensiresponsselpankreas
terhadapglukosa(Karam,2002).GejalaDMtipe2miripdengantipe1,
hanyadengangejalayangsamar.Gejalabisadiketahuisetelahbeberapa
tahun,kadangkadangkomplikasidapatterjadi.TipeDMiniumumnya
terjadipadaorangdewasadananakanakyangobesitas.
3. DiabetesMelitusTipeLain
Defekgenetikfungsiselbeta(MODYMaturityOnsetDiabetesofthe
Young): Kromosom12,HNF1 Kromosom7,glukokinaseKromosom
20,HNF4 Kromosom 13, insulin promoter factor Kromosom `17,

HNF1Kromosom2,NeuroD1DNAMitokondria
Defek genetik kerja insulin : resisten insulin tipe A, leprechaunism,

SindromRabsonMedenhall,diabeteslipoatropik
Penyakit Eksokrin Pankreas (suatu kelenjar yang mengeluarkan hasil
produksinya melalui pembuluh), yaitu : Pankreatitis (radang pada
pankreas) Trauma/pankreatektomi(pankreastelahdiangkat) Neoplasma
Fibrosis kistik Hemokromatosis Pankreatopati Fibrokalkulus(adanya

jaringanikatdanbatupadapankreas)
Endokrinopati : Akromegali (terlampau banyak hormon pertumbuhan)
Sindrom cushing (terlampau banyak produksi kortikosteroid dalam
tubuh)

Feokromositma (tumor anbak ginjal)

Hipertiroidisme

SomasostatinomaAldostreroma
Karena obat atau zat kimia : vacor, pentamidin, asam nikotinat,
glukokortikoid,hormontiroid,diazoxid,agonisbetaadrenergik,tiazid,

dilantin,interferonalfa
Infeksi:RubellaKongenital

16

Sebabimunologiyangjarang:antibodi,antiiinsulin(tubuhmenhasilkan
zat anti terhadap insulin sehingga insulin tidak dapat bekerja

memasukkanglugosakedalamsel)
Sindrom genetik lain yang berkaitan dengan DM : sindrom Down,
sindromKlinefelter,sindromturner,sindromWolframs.

4. DiabetesMelitusGestasional
DMiniterjadiakibatkenaikankadarguladarahpadakehamilan(WHO,
2008).Wanitahamilyangbelumpernah mengalamiDMsebelumnyanamun
memiliki kadar gula yang tinggi ketika hamil dikatakan menderita DM
gestationalPadagolonganini,kondisidiabetesdialamisementaraselamamasa
kehamilan.Artinyakondisiintoleransiglukosadidapatipertamakalipadamasa
kehamilan, biasanya pada semester kedua dan ketiga dan umumnya hilang
dengansendirinyasetelahmelahirkan.Diabetesmelitusgestasionalberhubungan
denganmeningkatnyakomplikasiperinatal(sekitarwaktumelahirkan)dansang
ibumemilikiresikountukmenderitapenyakitDMyanglebihbesardalamjangka
waktu510tahunsetelahmelahirkan.Diabetestipeinimerupakanintoleransi
karbohidratakibatterjadinyahiperglikemiadenganberbagaikeparahandengan
seranganataupengenalanawalselamamasakehamilan.
Padawanitahamil,jumlahhormonestrogenyangdimilikilebihbanyak
daripada wanita normal karena plasenta juga menghasilkan estrogen yang
bekerjasecarasimpatissehinggasecaratidaklangsungmenghambatpengeluaran
insulin (sehingga terjadi resistensi insulin), mengakibatkan aktivasi glukagon
untukmemecahglikogenyangmenyebabkankadarguladarahpadawanitahamil
meningkat. Resistensi insulin ini membuat tubuh bekerja keras untuk
menghasilkaninsulinsebanyak3kalidarinormal.DMgestationalterjadiketika
tubuhtidakdapatmembuatdanmenggunakanseluruhinsulinyangdigunakan
selamakehamilan.Tanpainsulin,glukosatidakdihantarkankejaringanuntuk
dirubahmenjadienergi,sehinggaglukosameningkatdalamdarahyangdisebut
denganhiperglikemia(Anonim,2009).Faktorrisikonyaadalahusiatua,etnik,
obesitas, multiparitas,riwayat keluarga dan riwayat diabetes gestasional
terdahulu.Diabetesgestationalterjadipada35%wanitahamil(Anonim,2009).
4.MemahamidanMenjelaskanDiabetesMellitusTipe2
4.1 Definisi
17

Menurut AmericanDiabetesAssociation (ADA)tahun2010,DiabetesMelitus


merupakansuatukelompokpenyakitmetabolicdengankarakteristikhiperglikemia
yang terjadi karena kelainan sekresi insulin, kerja insulin, atau keduaduanya.
DiabetesMelitustipe2adalahdiabetesyangtidaktergantunginsulin,sekresiinsulin
mungkin normal atau bahkan meningkat, tetapi sel sasaran insulin kurang peka
terhadaphormoneinidibandingkandenganselnormal.
4.2 Etiologi
NonInsulinDependentDiabetesMelitus(NIDDM)atauDiabetesMelitusTidak
TergantungInsulin(DMTTI)disebabkankarenakegagalanrelatifseldan resisitensi
insulin. Resistensi insulin adalah turunnya kemampuan insulin untuk merangsang
pengambilanglukosaolehjaringanperiferdanuntukmenghambat produksiglukosa
oleh hati. Sel tidak mampu mengimbangi resistensi insulin ini sepenuhnya, artinya
terjadiresistensirelatifinsulin.Ketidakmampuaniniterlihatdariberkurangnyasekresi
insulin pada rangsangan glukosa, namun pada rangsangan glukosa bersama bahan
perangsangsekresiinsulinlain.Berartiselpankreasmengalamidesensitisasiterhadap
glukosa(KapitaSelektaKedokteran,2001).
FaktorresikoDiabetesMelitusdariemedicinehealth:
1

Usiadiatas45tahun
Pada orangorang berumur fungsi organ tubuh semakin menurun, hal ini
diakibatkan aktivitas sel beta pankreas untuk menghasilkan insulin menjadi
berkurang dan sensifisitas selsel jaringan menurun sehinga tidak menerima

insulin.
Obesitasataukegemukan
Padaoranggemukaktivitasjaringanlemakdanototmenurunsehinggadapat
memicu DM. selain itu, asamasam lemak pada obesitas dapat menumpuk
abnormaldiototdanmengganggukerjainsulindiotot,asamlemakberlebihjuga

dapatmemicuapoptosisselbetapankreas.
Polamakan
Polamakanyangserbainstansaatinimemangsangatdigemariolehsebagian
masyarakat perkotaan. Pola makan yang tidak sesuai kebutuhan tubuh dapat
menjadipenyebabDM,misalnyamakanangorenganyangmengandungnilaigizi

yangminim.
RiwayatDiabetesMelituspadakeluarga
18

1520%penderitaNIDDM(NonInsulinDependenDiabetesMelitus)atauDM
tipe2mempunyariwayatkeluargaDM,sedangkanIDDM(InsulinDependen
5

DiabetesMelitus)tipe1sebanyak57%keluargaDM.
Kurangberolahragaatauberaktivitas
Dapat menurunkan sensitifitas sel terhadap insulin sehingga mengakibatkan

penumpukanlemakdalamtubuhyangdapatmenyebabkanDM.
Infeksi
Virus : Rubella, mumps, human coxsackievirus B4. Melalui infeksi sitolitik
dalam sel beta pankreas virus ini menyebabkan kerusakan dan destruksi sel.
Dapatjugamenyarangmelaluireaksiautoimunitassehinggahilangnyaautoimun
dalamselbetapankreas.DMakibatbakterimasihbelumbiasdideteksi.

4.3 Epidemiologi
KecenderunganpeningkatanangkainsidensidanprevalensiDMtipe2terjadi
diberbagaipenjurudunia.WHOmemprediksikenaikkanjumlahpenyandangDMdi
Indonesiadari8,4jutapadatahun2000menjadisekitar21,3jutapadatahun2030.
IDFmemprediksi7,0jutapadatahun2009menjadi12,0jutapadatahun2030.
Penelitian dengan rentang tahun 1980 hingga tahun 2000 terjadi peningkatan
prevalensiyangsangattajam.PenelitiandiJakarta(urban)1,7%padatahun1982,
5,7%padatahun1993,12,8%padatahun2001.
DataBadanPusatStatistikIndonesiatahun2003,pendudukyangberusia<20tahun
(jumlah133jutajiwa)14,7%daridaerahurbandan7,2%daridaerahrural,jadi
diperkirakan8,2jutapenyandangdiabetesdaerahurbandan5,5jutadidaerahrural.
4.4 Patofisiologi
SebagianbesargambaranpatologikdariDMdapatdihubungkandengansalah
satuefekutamaakibatkurangnyainsulinberikut:
1. Berkurangnyapemakaianglukosaolehselseltubuhyangmengakibatkan
naiknyakonsentrasiglukosadarahsetinggi3001200mg/dl.
2. Peningkatan mobilisasi lemak dari daerah penyimpanan lemak yang
menyebabkanterjadinyametabolismelemakyangabnormaldisertaidengan
endapankolestrolpadadindingpembuluhdarah.
3. Berkurangnyaproteindalamjaringantubuh.

19

Pasien
pasien
yang

mengalamidefisiensiinsulintidakdapatmempertahankankadarglukosaplasmapuasa
yangnormalatautoleransisesudahmakan.Padahiperglikemiayngparahyangmelebihi
ambangginjalnormal(konsentrasiglukosadarahsebesar160180mg/100ml),akan
timbulglikosuriakarenatubulustubulusrenalistidakdapatmenyerapkembalisemua
glukosa.Glukosuriainiakanmengakibatkandiuresisosmotikyangmenyebabkanpoliuri
disertaikehilangansodium,klorida,potasium,danpospat.Adanyapoliurimenyebabkan
dehidrasidantimbulpolidipsi.Akibatglukosayangkeluarbersamaurinemakapasien
akanmengalamikeseimbanganproteinnegatifdanberatbadanmenurunsertacenderung
terjadipolifagi.Akibatyanglainadalahasteniaataukekuranganenergisehinggapasien
menjadicepattelahdanmengantukyangdisebabkanolehberkurangnyaatauhilangnya
protein tubuh dan juga berkurangnya penggunaan karbohidrat untuk energi.
Hiperglikemia yang lama akan menyebabkan arterosklerosis, penebalan membran
basalisdanperubahanpadasarafperifer.Iniakanmemudahkanterjadinyagangren.

PatofisiologiDM(BrunnerandSuddarth,2002):
1.DiabetesTipe1
Terdapat ketidakmampuan untuk menghasilkan insulin karena selsel pankreas
telahdihancurkanolehprosesautoimun.Glukosayangberasaldarimakanantidak
dapat disimpan dalam hati meskipun tetap dalam darah dan menimbulkan
hiperglikemiaposprandial(sesudahmakan).
20

Jikakonsentrasiglukosadalamdarahcukuptinggi,ginjaltidakdapatmenyerap
kembalisemuaglukosayangtersaringkeluarakibatnyaglukosatersebutdieksresikan
dalam urin (glukosuria). Eksresi ini akan disertai oleh pengeluaran cairan dan
elekrolityangberlebihan,keadaaninidisebutdiuresisosmotik.Pasienmengalami
peningkatandalamberkemih(poliuria)danrasahaus(polidipsi).
2.DiabetesTipeII
Terdapat 2 masalah utama yang berhubungan dengan insulin, yaitu: resistensi
insulindangangguansekresiinsulin.Normalnyainsulinakanterikatdenganreseptor
khusus pada permukaan sel. Sebagai akibat terikatnya insulin dengan reseptor
tersebut, terjadi suatu rangkaian reaksi dalam metabolisme glukosa di dalam sel.
Resistensi insulin pada diabetes tipe II disertai dengan penurunan reaksi intrasel,
dengan demikian insulin menjadi tidak efektif untuk menstimulasi pengambilan
glukosaolehjaringan.
Untuk mengatasi resistensi insulin dan mencegah terbentuknya glukosa dalam
darahharusterdapatpeningkataninsulinyangdisekresikan.Padapenderitatoleransi
glukosa terganggu, keadaan ini terjadi akibat sekresi insulin yang berlebihan dan
kadarglukosaakandipertahankanpadatingkatyangnormalatausedikitmeningkat.
Namun,jikaselseltidakmampumengimbangipeningkatankebutuhanakaninsulin
makakadarglukosaakanmeningkatdanterjadidiabetestipeII.
Meskipunterjadigangguansekresiinsulinyangmerupakancirikhasdiabetestipe
II,namunterdapatjumlahinsulinyangadekuatuntukmencegahpemecahanlemak
danproduksibadanketon.Olehkarenaitu,ketoasidosisdiabetiktidakterjadipada
diabetes tipe II. Meskipun demikian, diabetes tipe II yang tidak terkontrol dapat
menimbulkan masalah akut lainnya yang dinamakan sindrom hiperglikemik
hiperosmoler nonketotik. Akibat intoleransi glukosa yangberlangsunglambat dan
progresif, maka awitan diabetes tipe II dapat berjalan tanpa terdeteksi, gejalanya
seringbersifatringandandapatmencakupkelelahan,iritabilitas,poliuria,pilidipsia,
lukapadakulityangtidaksembuhsembuh,infeksidanpandanganyangkabur.
3.DiabetesGestasional
Didefenisikansebagaipermulaanintoleransiglukosaataupertamasekalididapat
selamakehamilan(MichaelF.GreeneandanCarenG.Solomon,2005)
21

4.5 ManifestasiKlinis
Berbagaikeluhandapatditemukanpadapenyandangdiabetes.Kecurigaanadanya
DMperludipikirkanapabilaterdapatkeluhanklasikDMsepertidibawahini:

KeluhanklasikDMberupa:poliuria,polidipsia,polifagia,danpenurunanberat

badanyangtidakdapatdijelaskansebabnya
Keluhanlaindapatberupa:lemahbadan,kesemutan,gatal,matakabur,dan
disfungsiereksipadapria,sertapruritusvulvaepadawanita

MenurutNewsroom(2009)seseorangdapatdikatakanmenderitaDiabetesMelitus
apabilamenderitaduadaritigagejalayaitu:
a.KeluhanTRIAS:Banyakminum,BanyakkencingdanPenurunanberatbadan.
b.Kadarglukosadarahpadawaktupuasalebihdari120mg/dl.
c.Kadarglukosadarahduajamsesudahmakanlebihdari200mg/dl.
KeluhanyangseringterjadipadapenderitaDiabetesMellitusadalah:
Poliuria,Polidipsia,Polifagia,BeratBadanenurun,Lemah,Kesemutan,Gatal,Visus
menurun,Bisul/luka,Keputihan(Waspadji,1996).

Poliuri(banyakkencing)
Hal ini disebabkan oleh karena kadar glukosa darah meningkat sampai

melampauidayaserapginjalterhadapglukosasehinggaterjadiosmoticdiuresisyang
mana gula banyak menarik cairan dan elektrolit sehingga klien mengeluh banyak
kencing.

Polidipsi(banyakminum)
Hal ini disebabkan pembakaran terlalu banyak dan kehilangan cairan banyak

karenapoliuri,sehinggauntukmengimbangiklienlebihbanyakminum.

Polipagi(banyakmakan)
Halinidisebabkankarenaglukosatidaksampaikeselselmengalamistarvasi

(lapar).Sehinggauntukmemenuhinyaklienakanterusmakan.Tetapiwalaupunklien
banyakmakan,tetapsajamakanantersebuthanyaakanberadasampaipadapembuluh
darah.

Beratbadanmenurun,lemas,lekaslelah,tenagakurang.
Halinidisebabkankehabisanglikogenyangtelahdileburjadiglukosa,maka

tubuhberusamamendapatpeleburanzatdaribahagiantubuhyanglainyaitulemakdan
protein,karenatubuhterusmerasakanlapar,makatubuhselanjutnyaakanmemecah
22

cadanganmakananyangadaditubuhtermasukyangberadadijaringanototdanlemak
sehinggakliendenganDMwalaupunbanyakmakanakantetapkurus.

Matakabur
Halinidisebabkanolehgangguanlintaspolibi(glukosasarbitolfruktasi)yang

disebabkankarenainsufisiensiinsulin.Akibatterdapatpenimbunansarbitoldarilensa,
sehinggamenyebabkanpembentukankatarak.
4.6 DiagnosisdanDiagnosisBanding
DIAGNOSIS
Diagnosis DM ditegakkan atas dasar pemeriksaan kadar glukosa darah. Diagnosis
tidak dapat ditegakkan atas dasar adanya glukosuria. Guna penentuan diagnosis DM,
pemeriksaan glukosa darah yang dianjurkan adalah pemeriksaan glukosa secara
enzimatik dengan bahan darah plasma vena. Penggunaan bahan darah utuh
(wholeblood), vena, ataupun angka kriteria diagnostik yang berbeda sesuai pembakuan
oleh WHO. Sedangkan untuk tujuan pemantauan hasil pengobatan dapat dilakukan
dengan menggunakan pemeriksaan glukosa darah kapiler dengan glukometer.
Diagnosis DM dapat ditegakkan melalui tiga cara :
1. Jika keluhan klasik ditemukan, maka pemeriksaan glukosa plasma sewaktu >
200 mg/dL sudah cukup untuk menegakkan diagnosis DM
2. Pemeriksaan glukosa plasma puasa 126 mg/dL dengan adanya keluhan klasik.
3. Tes toleransi glukosa oral (TTGO). Meskipun TTGO dengan beban 75 g glukosa
lebih sensitif dan spesifik dibanding dengan pemeriksaan glukosa plasma puasa,
namun pemeriksaan ini memiliki keterbatasan tersendiri. TTGO sulit untuk
dilakukan berulang-ulang dan dalam praktek sangat jarang dilakukan karena
membutuhkan persiapan khusus.
Apabila hasil pemeriksaan tidak memenuhi kriteria normal atau DM, bergantung
pada hasil yang diperoleh, maka dapat digolongkan ke dalam kelompok toleransi
glukosa terganggu (TGT) atau glukosa darah puasa terganggu (GDPT).
1. TGT : Diagnosis TGT ditegakkan bila setelah pemeriksaan TTGO didapatkan
glukosa plasma 2 jam setelah beban antara 140 199 mg/dL (7,8-11,0 mmol/L).
2. GDPT : Diagnosis GDPT ditegakkan bila setelah pemeriksaan glukosa plasma
puasa didapatkan antara 100-125 mg/dL (5,6-6,9 mmol/L) dan pemeriksaan
TTGO gula darah 2 jam < 140 mg/dL.
Kriteria diagnosis DM :
23

1. Gejala klasik DM + glukosa plasma sewaktu 200 mg/dL (11,1 mmol/L)


Glukosa plasma sewaktu merupakan hasil pemeriksaan sesaat pada suatu hari
tanpa memperhatikan waktu makan terakhir
2. Gejala klasik DM + Kadar glukosa plasma puasa 126 mg/dL (7.0 mmol/L)
Puasa diartikan pasien tak mendapat kalori tambahan sedikitnya 8 jam
3. Kadar gula plasma 2 jam pada TTGO 200 mg/dL (11,1 mmol/L)
TTGO yang dilakukan dengan standar WHO, menggunakan beban glukosa yang
setara dengan 75 g glukosa anhidrus yang dilarutkan ke dalam air.
* Pemeriksaan HbA1c (>6.5%) oleh ADA 2011 sudah dimasukkan menjadi salah satu
kriteria diagnosis DM, jika dilakukan pada sarana laboratorium yang telah
terstandardisasi dengan baik.

Catatan :
Untuk kelompok risiko tinggi yang tidak menunjukkan kelainan hasil, dilakukan
ulangan tiap tahun. Bagi mereka yang berusia > 45 tahun tanpa faktor risiko lain,
pemeriksaan penyaring dapat dilakukan setiap 3 tahun.
Pemeriksaan Fisik :
a. Pengukuran tinggi badan, berat badan,dan lingkar pinggang
b. Pengukuran tekanan darah, termasuk pengukuran tekanan darah dalam posisi
berdiri untuk mencari kemungkinan adanya hipotensi ortostatik, serta ankle
brachial index (ABI),untuk mencari kemungkinan penyakit pembuluh darah
c.
d.
e.
f.
g.
h.

arteri tepi
Pemeriksaan funduskopi
Pemeriksaan rongga mulut dan kelenjar tiroid
Pemeriksaan jantung
Evaluasi nadi, baik secara palpasi maupun dengan stetoskop
Pemeriksaan ekstremitas atas dan bawah, termasuk jari
Pemeriksaan kulit (acantosis nigrican dan bekas tempat penyuntikan insulin)

dan pemeriksaan neurologis


i. Tanda-tanda penyakit lain yang dapat menimbulkan DM tipe-lain
Evaluasi Laboratoris / penunjang lain :
a. Glukosa darah puasa dan 2 jam post prandial
24

b.
c.
d.
e.
f.
g.
h.

A1C
Profil lipid pada keadaan puasa (kolesterol total, HDL, LDL, dan trigliserida)
Kreatinin serum
Albuminuria
Keton, sedimen, dan protein dalam urin
Elektrokardiogram
Foto sinar-x dada

DIAGNOSISBANDING
A. InsulinResistance
ResistensiInsulin(IR)adalahkondisidimanajumlahnormalinsulintidak
memadaiuntukmenghasilkanresponsinsulinnormaldarisellemak,selototdan
sel hati.resistensi insulin umumnya bersifat "pascareseptor", yang berarti
masalahterletakpadaresponselterhadapinsulinalihalihproduksiinsulin.Kadar
plasma yang tinggi dari insulin dan glukosa akibat resistensi insulin diyakini
sebagaiasalusulsindrommetabolikdandiabetestipe2,termasukkomplikasinya.
B. Hiperglikemireaktif
Hiperglikemi reaktif adalah gangguan regulasi gula darah yang dapat
terjadisebagaireaksinonspesifikterhadapterjadinyastresskerusakanjaringan,
sehinggaterjadipeningkatanglukosadarahdaripadarentangkadarpuasanormal
8090mg/dldarah,ataurentangnonpuasasekitar140160mg/100mldarah
(Pulsinelli,1996), hyperglikemia reaktif ini diartikan sebagai peningkatan kadar
glukosadarahpuasalebihdari110mg/dl(zacharia,dkk,2005),reaksiiniadalah
fenomenayangtidakberdirisendiridanmerupakansalahsatuaspekperubahan
biokimiawimultipleyangberhubungandenganstrokeakut(Candelise,dkk,1985).
C. Glucoseintolerance
DiagnosisintoleransiglukosaditegakkandenganpemeriksaanTTGOsetelah
puasa 8 jam. Diagnosis intoleransi glukosa ditegakkan apabila hasil tes
glukosadarahmenunjukkansalahsatudaritersebutdibawahini:
1. Toleransiglukosaterganggu(TGT=IGT)
ToleransiGlukosaTerganggu(TGT)adalahistilahyangdipakaiuntuk
menyatakanadanyadisglikemiyaitukenaikanglukosaplasma2jamsetelah
beban75gramglukosapadapemeriksaantestoleransiglukosaoral(TTGO)
yaituantara140mg/dlsampaidengan199mg/dl.Keadaaninidisebutjuga
25

sebagaiprediabetesolehkarenarisikountukmendapatDiabetesMelitustipe
2danpenyakitkardiovaskulersangatbesar. DisebutTGTjikaguladarah
setelahmakantidaknormal,atauberkisarantara140199mg/dL.Sedangkan
guladarahpuasanormal.
2. Guladarahpuasaterganggu(GDPT=IFG)
Kadarguladarahyangtinggi,tetapitidakcukuptinggiuntukmenjadi
diabetes.DisebutGPTjikakadarguladarahpuasa(810jamtidakmendapat
asupankalori)tidaknormal,atauberkisar100125mg/dL.
4.7 Tatalaksana
Tujuan penatalaksanaan secara umum adalah meningkatnya kualitas hidup
penyandang diabetes. Adapun tujuan penatalaksaannya terbagi atas :
Jangka pendek hilangnya keluhan dan tanda DM, mempertahankan rasa
nyaman dan tercapainya target pengendalian glukosa darah.
Jangka panjang tercegah dan terhambatnya progresivitas

penyulit

mikroangiopati, makroangiopati dan neuropati. Tujuan akhir pengelolaan adalah


turunnya morbiditas dan mortalitas DM.
Untuk mencapai tujuan tersebut perlu dilakukan pengendalian glukosa darah,
tekanan darah, berat badan dan profil lipid, melalui pengelolaan pasien secara holistik
dengan mengajarkan perawatan mandiri dan perubahan perilaku. (PERKENI, 2006)
1. Edukasi
Prinsip yang perlu diperhatikan pada proses edukasi diabetes adalah:
(PERKENI, 2006)

Memberikan dukungan dan nasehat yang positif serta hindari terjadinya

kecemasan
Memberikan informasi secara bertahap, dimulai dengan hal-hal yang sederhana
Lakukan pendekatan untuk mengatasi masalah dengan melakukan simulasi
Diskusikan program pengobatan secara terbuka, perhatikan keinginan pasien.
Berikan penjelasan secara sederhana dan lengkap tentang program pengobatan

yang diperlukan oleh pasien dan diskusikan hasil pemeriksaan laboratorium


Lakukan kompromi dan negosiasi agar tujuan pengobatan dapat diterima
Berikan motivasi dengan memberikan penghargaan
Libatkan keluarga/ pendamping dalam proses edukasi
Perhatikan kondisi jasmani dan psikologis serta tingkat pendidikan
pasien dan keluarganya
Gunakan alat bantu audio visual
26

Edukasi dengan tujuan promosi hidup sehat, perlu selalu dilakukan sebagai bagian
dari upaya pencegahan dan merupakan bagian yang sangat penting dari pengelolaan DM
secara holistik. Materi edukasi terdiri dari materi edukasi tingkat awal dan materi
edukasi tingkat lanjutan. Edukasi yang diberikan kepada pasien meliputi pemahaman
tentang: (PERKENI, 2006)

Materi edukasi pada tingkat awal adalah:


Perjalanan penyakit DM
Makna dan perlunya pengendalian dan pemantauan DM
Penyulit DM dan risikonya
Intervensi farmakologis dan non-farmakologis serta target perawatan
Interaksi antara asupan makanan, aktivitas fisik, dan obat hipoglikemik oral

atau insulin serta obat-obatan lain


Cara pemantauan glukosa darah dan pemahaman hasil glukosa darah atau
urin mandiri (hanya jika pemantauan glukosa darah mandiri tidak tersedia)
Mengatasi sementara keadaan gawat darurat seperti rasa sakit, atau

hipoglikemia
Pentingnya latihan jasmani yang teratur
Masalah khusus yang dihadapi (contoh: hiperglikemia pada kehamilan)
Pentingnya perawatan kaki
Cara mempergunakan fasilitas perawatan kesehatan.

Materi edukasi pada tingkat lanjut adalah:


Mengenal dan mencegah penyulit akut DM
Pengetahuan mengenai penyulit menahun DM
Penatalaksanaan DM selama menderita penyakit lain
Makan di luar rumah
Rencana untuk kegiatan khusus
Hasil penelitian dan pengetahuan masa kini dan teknologi mutakhir tentang

DM
Pemeliharaan/Perawatan kaki, elemen perawatan kaki dapat dilihat pada
tabel berikut:
Elemen Kunci Perawatan Kaki
Edukasi perawatan kaki harus diberikan secara rinci pada semua orang
dengan ulkus maupun neuropati perifer :
1. Tidak boleh berjalan tanpa alas kaki, termasuk pasir atau air
2. Periksa kaki setiap hari, dan laporkan pada dokter apabila ada kulit
27

terkelupas atau daerah kemerahan atau luka


3. Periksa alas kaki dari benda asing sebelum memakainya
4. Selalu menjaga kaki dalam keadaan bersih, dan mengoleskan
krimpelembab ke kulit yang kering
Edukasi perawtan kaki harus dilakukan secara teratur
2. Terapi gizi medis
Prinsip pengaturan diet pada pasien DM hampir sama dengan orang normal, yaitu
sangat penting menjaga asupan makanan dengan gizi seimbang dan sesuai kebutuhan
kalori. Hal yang perlu diperhatikan pada penderita DM adalah jadwal makan yang harus
teratur, jenis dan jumlah makanan.
Kebutuhan Kalori :
Ada beberapa cara untuk menentukan jumlah kalori yang dibutuhkan penyandang
diabetes. Di antaranya adalah dengan memperhitungkan kebutuhan kalori basal yang
besarnya 25-30 kalori / kg BB ideal, ditambah atau dikurangi bergantung pada beberapa
faktor yai tu jenis kelamin, umur, aktivitas, berat badan, dll .
Makanan sejumlah kalori terhitung dengan komposisi tersebut di atas dibagi dalam
3 porsi besar untuk makan pagi (20%), siang (30%) dan sore (25%) serta 2-3 porsi
makanan ringan (10-15%) di antaranya. Untuk meningkatkan kepatuhan pasien, sejauh
mungkin perubahan dilakukan sesuai dengan kebiasaan. Untuk penyandang diabetes
yang mengidap penyakit lain, pola pengaturan makan disesuaikan dengan penyakit
penyertanya (PERKENI, 2006).
3. Latihan jasmani
Kegiatan jasmani sehari-hari dan latihan jasmani secara teratur (3-4 kali seminggu
selama kurang lebih 30 menit), merupakan salah satu pilar dalam pengelolaan DM tipe
2. Latihan jasmani selain untuk menjaga kebugaran juga dapat menurunkan berat badan
dan memperbaiki sensitivitas insulin, sehingga akan memperbaiki kendali glukosa
darah. (PERKENI, 2006)

28

Prinsip latihan jasmani bagi diabetes, persis sama dengan prinsip latihan jasmani
secara umum, yaitu memenuhi beberapa hal, seperti : frekuensi, intensitas, durasi, dan
jenis. (IPD, 2009)
Frekuensi: Jumlah olahraga per minggu sebaiknya dilakukan dengan teratur 3-5
kali per minggu
Intensitas: ringan dan sedang ( 60-70 % Maximum Heart Rate )
Untuk menentukan Maximum Heart Rate (MHR) yaitu : 220-umur. Setelah
MHR didapatkan, dapat ditentukan THR (target Heart Rate). Sebagai contoh :
suatu latihan bagi diabetisi berumur 50 tahun didasarkan sebesar 75%, maka
THR = 75% x ( 220-60) = 120. Dengan demikian, diabetisi tersebut dalam
menjalankan latihan jasmani, sasaran denyut nadinya adalah sekitar 120x/menit.
Durasi : 30 60 menit
Jenis : latihan jasmani endurans (aerobic) untuk meningkatkan kemampuan
kardiorespirasi seperti jalan, jogging, berenang, dan bersepeda

4. Intervensi farmakologis
Intervensi farmakologis ditambahkan jika sasaran glukosa darah belum tercapai
dengan pengaturan makan dan latihan jasmani (PERKENI, 2006).
4.8 Komplikasi
Diabetes Mellitus (DM) dengan karakteristik hiperglikemia (kadar gula darah
tinggi) dapat mengakibatkan berbagai macam komplikasi berupa komplikasi akut (yang
terjadi secara mendadak) dan komplikasi kronis (yang terjadi secara menahun).
1. Komplikasi akut dapat berupa :
1

Hipoglikemia yaitu menurunnya kadar gula darah < 60 mg/d

Keto Asidosis Diabetika (KAD) yaitu DM dengan asidosis metabolic dan


hiperketogenesis

Koma Lakto Asidosis yaitu penurunan kesadaran hipoksia yang ditimbulkan


oleh hiperlaktatemia.

Koma Hiperosmolar Non Ketotik, gejala sama dengan no 2 dan 3 hanya saja
tidak ada hiperketogenesis dan hiperlaktatemia.
29

2. Komplikasi kronis :
Kadar gula darah tetap tinggi sheingga timbul komplikasi kronik. Komplikasi kronik
diartikan sebagai kelainan pembuluh darah yang akhirnya bias menyebabkan
serangan jantung, gangguan ginjal, gangguan saraf.
-

(Nephropathy ) : kerusakan ginjal. DM dapat mempengaruhi struktur dan


fungsi ginjal. Sehingga ginjal tidak dapat menyaring zat yang terkandung
dalam urin. Bila ada kerusakan ginjal, racun tidak dapat dikeluarkan,
sedangkan protein yang seharusnya dipertahankan ginjal bocor keluar
(proteinuria).

Makroangiopati, mengenai pembuluh darah besar (pembuluh darah yang


dapat dilihat secara mikroskopis) antara lain pembuluh darah jantung /
Penyakit Jantung Koroner, pembuluh darah otak /stroke, dan pembuluh darah
tepi / Peripheral Artery Disease.

Mikroangiopati, mengenai pembuluh darah mikroskopis antara lain retinopati


diabetika (mengenai retina mata) dan nefropati diabetika (mengenai ginjal).

(Neuropathy) : Bisa terjadi setelah glukosa darah terus tinggi, tidak terkontrol
dengan baik dan berlangsung sampai 10 tahun lebih. Akhirnya saraf tidak
bias mengirim atau mengahntar pesan-pesan rangsangan impuls saraf, salah
kirim, atau terlambat dikirim. Meyebabkan kelemahan otot sampai penderita
tidak bias jalan.

(Retinopathy) : kerusakan retina mata. Glukosa tinggi menyebabkan


rusaknya pembuluh darah retina bahkan dapat menyebabkan kebocoran
pembuluh darah kapiler. Darah akan menutup sinar yang menuju ke retina
sehingga pasien DM penglihatan menjadi kabur.

Penyakit jantung : DM merusak pembuluh darah yang menyebabkan


penumpukan lemak di dinding yang rusak dan menyempitkan pembuluh
darah. Jika pembuluh darah coroner menyempit, otot jantung akan
kekurangan O2 dan makanan akibat suplai darah kurang.
30

Hipertensi : DM cenderung terkena hipertensi 2x lipat dari orang normal.


Dan dapat memicu terjadinya serangan jantung, retinopati, kerusakan ginjal,
atau stroke.

Gangguan saluran pencernaan : menyebabkan urat saraf lambung akan rusak


sehingga fungsi lambung untuk mengahncurkan makanan menjadi lemah.
Gejalanya adalah sukar BAB, perut gembung, dan kotoran keras.

4.9 Prognosis
Prognosis Diabetes Melitus usia lanjut tergantung pada beberapa hal dan tidak
selamanya buruk, pasien usia lanjut dengan Diabetes Melitus tri II (Diabetes Melitus
III) yang terawat baik prognosisnya baik pada pasien Diabetes Melitus usia lanjut
yang jatuh dalam keadaan koma hipoklikemik atau hiperosmolas, prognosisnya
kurang baik. Hipoklikemik pada pasien usia lanjut biasanya berlangsung lama dan
serius dengan akibat kerusakan otak yang permanen. Karena hiporesmolar adalah
komplikasi yang sering ditemukan pada usia lanjut dan angka kematiannya tinggi.
4.10

Pencegahan

Pencegahanprimer
1).Penyuluhanditujukankepada:
A.Kelompokmasyarakatyangmempunyairisikotinggidanintoleransiglukosa
Materipenyuluhanmeliputiantaralain:
1. Program penurunan berat badan. Pada seseorang yang mempunyai risiko
diabetesdanmempunyaiberatbadanlebih,penurunanberatbadanmerupakan
carautamauntukmenurunkanrisikoterkenaDMtipe2atauintoleransiglukosa.
Beberapa penelitian menunjukkan penurunan berat badan 510% dapat
mencegahataumemperlambatmunculnyaDMtipe2.
2. Dietsehat

Dianjurkandiberikanpadasetiaporangyangmempunyairisiko.

Jumlahasupankaloriditujukanuntukmencapaiberatbadanideal.

31

Karbohidrat kompleks merupakan pilihan dan diberikan secara terbagi dan


seimbangsehinggatidakmenimbulkanpuncak(peak)glukosadarahyangtinggi
setelahmakan.

3.

Mengandungsedikitlemakjenuh,dantinggiseratlarut.
Latihanjasmani
Latihan jasmani teratur dapat memperbaiki kendali glukosa darah,
mempertahankanataumenurunkanberatbadan,sertadapatmeningkatkankadar
kolesterolHDL.

Latihanjasmaniyangdianjurkan:
dikerjakansedikitnyaselama150menit/minggudenganlatihanaerobiksedang
(mencapai 5070% denyut jantung maksimal), atau 90 menit/minggu dengan
latihan aerobik berat (mencapai denyut jantung >70% maksimal). Latihan
jasmanidibagimenjadi34xaktivitas/minggu.

3. Menghentikanmerokok
Merokok merupakan salah satu risiko timbulnya gangguan kardiovaskular.
Meskimerokoktidakberkaitanlangsungdengantimbulnyaintoleransiglukosa,
tetapi merokok dapat memperberat komplikasi kardiovaskular dari intoleransi
glukosadanDMtipe2.
B.Perencanakebijakankesehatanagarmemahamidampaksosioekonomipenyakitini
danpentingnyapenyediaanfasilitasyangmemadaidalamupayapencegahanprimer
Pengelolaanyangditujukanuntuk:

Kelompokintoleransiglukosa

Kelompokdenganrisiko(obesitas,hipertensi,dislipidemia,dll.)

AlgoritmapencegahanDMtipe2

32

PencegahanSekunder
Pencegahan sekunder adalah upaya mencegah atau menghambat timbulnya penyulit
padapasienyangtelahmenderitaDM.Dilakukandenganpemberianpengobatanyang
cukupdantindakandeteksidini.
Penyuluhan untuk pencegahan sekunder ditujukan terutama pada pasien baru.
Penyuluhandilakukansejakpertemuanpertamadanperluselaludiulangpadasetiap
kesempatanpertemuanberikutnyasalahsatupenyulitDMyangseringterjadiadalah
penyakitkardiovaskular,yangmerupakanpenyebabutamakematianpadapenyandang
diabetes.Selainpengobatanterhadaptingginyakadarglukosadarah,pengendalianberat
badan, tekanan darah, profil lipid dalam darah serta pemberian antiplatelet dapat
menurunkanrisikotimbulnyakelainankardiovaskularpadapenyandangdiabetes.
PencegahanTersier

Pencegahan tersier ditujukan pada kelompok penyandang diabetes yang telah


mengalamipenyulitdalamupayamencegahterjadinyakecacatanlebihlanjut.

Upayarehabilitasipadapasiendilakukansedinimungkin,sebelumkecacatan
menetap.Sebagaicontohaspirindosisrendah(80325mg/hari)dapatdiberikan
33

secara rutin bagi penyandang diabetes yang sudah mempunyai penyulit


makroangiopati.

Padaupayapencegahantersiertetapdilakukanpenyuluhan padapasiendan
keluarga.Materipenyuluhantermasukupayarehabilitasiyangdapatdilakukan
untukmencapaikualitashidupyangoptimal.

Pencegahantersiermemerlukanpelayanankesehatanholistikdanterintegrasiantar
disiplinyangterkait,terutamadirumahsakitrujukan.Kolaborasiyangbaikantarpara
ahli di berbagai disiplin (jantung dan ginjal, mata, bedah ortopedi, bedah vaskular,
radiologi,rehabilitasimedis,gizi,podiatrist,dll.)sangatdiperlukandalammenunjang
keberhasilanpencegahantersier.

5. MemahamidanMenjelaskanRetinopatiDiabetik
DEFINISI
Retinopati diabetik adalah suatu mikroangiopati progresif yang ditandai oleh
kerusakandansumbatanpembuluhpembuluhhalus, meliputiarteriol prekapilerretina,
kapilerkapilerdanvenavena.

ETIOLOGI
Penyebab pasti retinopati diabetik belum diketahui. Tetapi diyakini bahwa
lamanya terpapar pada hiperglikemia ( kronis ) menyebabkan perubahan fisiologi dan
biokimia yang akhirnya menyebabkan kerusakan endotel pembuluh darah. Hal ini
didukung oleh hasil pengamatan bahwa tidak terjadi retinopati pada orang muda
34

dengan diabetes tipe 1 paling sedikit 3-5 tahun setelah awitan penyakit ini. Hasil
serupa telah diperoleh pada diabetes tipe 2, tetapi pada pasien ini onset dan lama
penyakit lebih sulit ditentukan secara tepat.
Perubahan abnormalitas sebagian besar hematologi dan biokimia telah
dihubungkan dengan prevalensi dan beratnya retinopati, antara lain:

Adhesif platelet yang meningkat.

Agregasi eritrosit yang meningkat.

Abnormalitas lipid serum

35

Fibrinolisis yang tidak sempurna.

Abnormalitas dari sekresi growth hormon

Abnormalitas serum dan viskositas darah.

PATOFISIOLOGI
1. Retinopati Diabetik Non Proliferatif
Merupakan bentuk yang paling umum dijumpai. Merupakan cerminan klinis
dari hiperpermeabilitas dan inkompetens pembuluh yang terkena. Disebabkan oleh
penyumbatan dan kebocoran kapiler , mekanisme perubahannya tidak diketahui tapi
telah diteliti adanya perubahan endotel vaskuler ( penebalan membran basalis dan
hilangnya pericyte) dan gangguan hemodinamik ( pada sel darah merah dan agregasi
platelet). Disini perubahan mikrovaskular pada retina terbatas pada lapisan retina
(intraretinal), terikat ke kutub posterior dan tidak melebihi membran internal.
Karakteristik pada jenis ini adalah dijumpainya mikroaneurisma multiple yang
dibentuk oleh kapiler-kapiler yang membentuk kantung-kantung kecil

menonjol

seperti titik-titik, vena retina mengalami dilatasi dan berkelok-kelok,

bercak

perdarahan intraretinal. Perdarahan dapat terjadi pada semua lapisan retina dan
berbentuk nyala api karena lokasinya didalam lapisan serat saraf yang berorientasi
horizontal. Sedangkan perdarahan bentuk titik-titik atau bercak terletak di lapisan
retina yang lebih dalam tempat sel-sel akson berorientasi vertical.

2. Retinopati Diabetik Preproliferatif dan Edema Makula


Merupakan stadium yang paling berat dari Retinopati Diabetik Non Proliferatif.
Pada keadaan ini terdapat penyumbatan kapiler mikrovaskuler dan kebocoran plasma
yang berlanjut, disertai iskemik pada dinding retina (cotton wool spot, infark pada
lapisan serabut saraf). Hal ini menimbulkan area non perfusi yang luas dan
kebocoran darah atau plasma melalui endotel yang rusak. Ciri khas dari stadium
ini adalah cotton wool spot, blot haemorrage, intraretinal Microvasculer Abnormal
(IRMA), dan rangkaian vena yang seperti manik-manik. Bila satu dari keempatnya
dijumpai ada kecendrungan untuk menjadi progresif

(Retinopati Diabetik

Proliferatif), dan bila keempatnya dijumpai maka beresiko untuk menjadi


Proliferatif dalam satu tahun.

Edema makula pada retinopati diabetik non proliferatif merupakan penyebab


tersering timbulnya gangguan penglihatan. Edema ini terutama disebabkan oleh
rusaknya sawar retina-darah bagian dalam pada endotel kapiler retina sehingga terjadi
kebocoran cairan dan konstituen plasma ke dalam retina dan sekitarnya. Edema ini
dapat bersifat fokal dan difus. Edema ini tampak sebagai retina yang menebal dan
keruh disertai mikroaneurisma dan eksudat intraretina sehingga terbentuk zona
eksudat kuning kaya lemak bentuk bundar disekitar mikroaneurisma dan paling sering
berpusat dibagian temporal makula.
ManifestasiKlinis
SebagianbesarpenderitaretinopatiDM,padatahapawaltidakmengalamigejala
penurunantajampenglihatan.Apabilatelahterjadikerusakansawardarahretina,dapat
ditemukan mikroaneurisma, eksudat lipid dan protein, edema, serta perdarahan
intraretina. Selanjutnya, terjadi oklusi kapiler retina yang mengakibatkan kegagalan
perfusidilapisanserabutsarafretinasehinggaterjadihambatantransportasiaksonal.
Hambatan transportasi tersebut menimbulkan akumulasi debris akson yang tampak
sebagai gambaran soft exudates pada pemeriksaan oftalmoskopi. Kelainan tersebut
merupakantandaretinopatiDMnonproliferatif.
Hipoksiaakibatoklusiakanmerangsangpembentukanpembuluhdarahbarudan
inimerupakantandapatognomonikretinopatiDMproliferatif.KebutaanpadaDMdapat
terjadiakibatedemahebatpadamakula,perdarahanmasifintravitreous,atauablasio
retinatraksional.

PemeriksaandanDiagnosis
Deteksi dini retinopati DM di pelayanan kesehatan primer dilakukan melalui
pemeriksaanfunduskopidirekdanindirek.Denganfundusphotographydapatdilakukan
dokumentasikelainanretina.MetodediagnostikterkiniyangdisetujuiolehAmerican
Academy of Ophthalmology (AAO) adalah fundus photography. Keunggulan
pemeriksaantersebutadalahmudahdilaksanakan,interpretasidapatdilakukanoleh
dokter umum terlatih sehingga mampu laksana di pelayanan kesehatan primer. Di
pelayanan primer pemeriksaan fundus photography berperanan sebagai pemeriksaan
penapis. Apabila pada pemeriksaan ditemukan edema makula, retinopati DM non

proliferatifderajatberatdanretinopatiDMproliferatifmakaharusdilanjutkandengan
pemeriksaanmatalengkapolehdokterspesialismata.
Pemeriksaanmatalengkapolehdokterspesialismataterdiridaripemeriksaan
visus, tekanan bola mata, slitlamp biomicroscopy, gonioskop, funduskopi dan
stereoscopicfundusphotographydenganpemberianmidriatikumsebelumpemeriksaan.
Pemeriksaan dapat dilanjutkan dengan opti cal coherence tomography (OCT) dan
ocularultrasonographybilaperlu.
OCTmemberikangambaranpenampangaksialuntukmenemukankelainanyang
sulit terdeteksi oleh pemeriksaan lain dan menilai edema makula serta responsnya
terhadap terapi. Ocular ultrasonography bermanfaat untuk evaluasi retina bila
visualisasinyaterhalangolehperdarahanvitreousataukekeruhanmediarefraksi.
PemeriksaanFunduskopiDirekpadaRetinopatiDM
Pemeriksaanfunduskopidirekbermanfaatuntukmenilaisarafoptik,retina,makuladan
pembuluh darah di kutub pos terior mata. Sebelum pemeriksaan dilakukan, pasien
diminta untuk melepaskan kaca mata atau lensa kontak, kemudian mata yang akan
diperiksaditetesimidriatikum.Pemeriksaharusmenyampaikankepadapasienbahwaia
akanmerasasilaudankurangnyamansetelahditetesiobattersebut.Risikoglaukoma
akutsuduttertutupmerupakankontraindikasipemberianmidriatikum.
Pemeriksaanfunduskopidirekdilakukandiruanganyangcukupgelap.Pasien
duduk berhadapan sama tinggi dengan pemeriksa dan diminta untuk memakukan
(fiksasi)pandangannyapadasatutitikjauh.Pemeriksakemudianmengaturoftalmoskop
pada0dioptridanukuranaperturyangsesuai.Matakananpasiendiperiksadenganmata
kananpemeriksadanoftalmoskopdipegangditangankanan.
Mulamulapemeriksaandilakukanpadajarak50cmuntukmenilairefleksretina
yangberwarnamerahjinggadankoroid.Selanjutnya,pemeriksaandilakukanpadajarak
23cmdenganmengikutipembuluhdarahkearahmedialuntukmenilaitampilantepi
danwarnadiskusoptik,danmelihatcupdiscratio.Diskusoptikyangnormalberbatas
tegas,disc berwarna merah muda dengan cup berwarna kuning, sedangkan cupdisc
ratio<0,3.Pasienlaludimintamelihatkedelapanarahmataanginuntukmenilairetina.
Mikroaneurisma,eksudat,perdarahan,danneovaskularisasimerupakantandautama
retinopatiDM.
Terakhir,pasiendimintamelihatlangsungkecahayaoftalmoskopagarpemeriksadapat
menilaimakula.Edemamakuladaneksudatadalahtandakhasmakulopatidiabetikum.

Tatalaksana
TatalaksanaretinopatiDMdilakukanberdasarkantingkatkeparahanpenyakit.
Retinopati DM nonproliferatif derajat ringan hanya perlu dievaluasi setahun sekali.
PenderitaretinopatiDMnonproliferatifderajatringansedangtanpaedemamakulayang
nyata harus menjalani pemeriksaan rutin setiap 612 bulan. Retinopati DM
nonproliferatif derajat ringansedang dengan edema makula signifikan merupakan
indikasilaserphotocoagulationuntukmencegahperburukan.Setelahdilakukanlaser
photocoagulation,penderitaperludievaluasisetiap24bulan.PenderitaretinopatiDM
nonproliferatif derajat berat dianjurkan untuk menjalani panretinal laser
photocoagulation,terutamaapabilakelainanberisikotinggiuntukberkembangmenjadi
retinopatiDMproliferatif.Penderitaharusdievaluasisetiap34bulanpascatindakan.
PanretinallaserphotocoagulationharussegeradilakukanpadapenderitaretinopatiDM
proliferatif.ApabilaterjadiretinopatiDMproliferatifdisertaiedemamakulasignifikan,
makakombinasifocaldanpanretinallaserphotocoagulationmenjaditerapipilihan

Retinopati Diabetik Non Proliferatif dapat mempengaruhi fungsi penglihatan


melalui 2 mekanisme yaitu :4

Perubahan sedikit demi sedikit dari pada penutupan kapiler intraretinal


yang menyebabkan iskemik makular.

Peningkatan permeabilitas pembuluh retina yang menyebabkan edema


makular.

2. Retinopati Diabetik Proliferatif


Merupakan penyulit mata yang paling parah pada Diabetes Melitus. Pada jenis
ini iskemia retina yang progresif akhirnya merangsang pembentukan pembuluhpembuluh halus ( neovaskularisasi ) yang sering terletak pada permukaan diskus dan
di tepi posterior zona perifer disamping itu neovaskularisasi iris atau rubeosis iridis
juga dapat terjadi. Pembuluh-pembuluh baru yang rapuh berproliferasi dan menjadi
meninggi apabila korpus vitreum mulai berkontraksi menjauhi retina dan darah
keluar dari pembuluh tersebut maka akan terjadi perdarahan massif dan dapat timbul
penurunan penglihatan mendadak.1
Disamping itu jaringan neovaskularisasi yang meninggi ini dapat mengalami
fibrosis dan membentuk pita-pita fibrovaskular rapat yang menarik retina dan
menimbulkan kontaksi terus-menerus pada korpus vitreum. Ini dapat menyebabkan
pelepasan retina akibat traksi progresif atau apabila terjadi robekan retina, terjadi
ablasio retina regmatogenosa. Pelepasan retina dapat didahului atau ditutupi oleh
perdarahan korpus vitreum. Apabila kontraksi korpus vitreum telah

sempurna

dimata tersebut, maka retinopati proliferatif cenderung masuk ke stadium


involusional atau burnet-out.

6. MemahamidanMenjelaskanGiziTerhadapPasienDiabetesMellitus

Terapi gizi medis merupakan salah satu terapi non farmakologis yang sangat
direkomendasikan bagi pasien ddiabetes, Terapi gizi medis ini pada pronsipnya adalah
melakukan pengaturan pola makan yang didasarkan pada stasus gizi medis diabetesi
dan melakukan modifikasi diet berdasarkan kebutuhan individual.
Beberapa manfaat yang telah terbukti dari terapi gizi medis ini antara lain:
Menurunkan berat badan, Menurunkan tekanan sistolik dan diastolik, Menurunkan
kadar glukosa darah, Memperbaiki profil lipid, Meningkatkan sensitivitas reseptor
insulin, Memperbaiki sistem koagulsi darah.
Tujuan Terapi Gizi Medis
Tujuan terapi gizi medis ini adalah untuk mencapai dan mempertahankan:
1. Kadar glukosa darah mendekati normal
2. Glukosa puasa berkisar 90-130 mg/dl.
3. Glukosa darah 2 jam setelah makan <180 mg/dl.
4. Kadar A1c <7%.
5. Tekanan darah <130/80 mmHg.
6. Profil Lipid
7. Kolesterol LDL<100 mg/dl
8. Kolesterol HDL >40 mg/dl.
9. Trigliserida < 150 mg/dl.
10. Beran badan senormal mungkin.

42

Jenis Bahan Makanan


KARBOHIDRAT
Sebagai sumber energi, KH yang diberikan diabetisi tidak boleh lebih dar 55-65%
dari total kebutuhan energi sehari, atau tidak boleh lebih dari 70% jika
dikombinasikan dengan pemberian asam lemak tidak jenuh rantai tunggal (MUFA:
monounsaturated fatty acids). Pada setiap gram karbohidrat terdapat kandungan
energi sebesar 4kilokalori.
Rekomendasi karbohidrat :
1. Kandungan total kalori pada makanan yang mengandung KH, lebih ditentukan
oleh jumlahnya dibandungkan dengan jenis KH itu sendiri.
2. Dari total kebutuhan kalori perhari, 60-70% diantaranya berasal dari sumber KH.
3. Jika ditambah MUFA sebagai sumber energi, maka jumlah KH maksimal 70%
dari total kebutuhan kalori perhari.
4. Julah serat 25-50 gram per hari.
5. Jumlah sukrosa sebagai sumber energi tidak perlu dibatasi, namun jangan sampai
lebih dari total kebutuhan kalori perhari.
6. Sebagai pemanis dapat digunakan pmanis non kalori seperti sakarin, aspartame,
acesulfame, dan sukralosa.
7. Penggunaan alkohol harus dibatasi tidak boleh lebih dar10 gram/hari.
8. Fruktosa tidak boleh lebih dari 60 gram/hari.
9. Makanan yang mengandung sukrosa tidak perlu dibatasi.
PROTEIN
Jumlah kebutuhan protein yang direkomendasikan sekitar 10-15% dari total
kalori perhari. Pada penderita kelainan ginjal dimana diperlukan pembatasan asupan
protein sampai 40 gram perhari, maka perlu ditambahkan suplementasi asam amino
esensial. Protein mengandung energi sebesar 2 kilokalori/gram.
Rekomendasi pemberian protein:
1. Kebutuhan protein 15-20% dari total kebutuhan energi perhari.
2. Pada keadaan kadar glukosa yang terkontrol, asupan protein tidak akan
mempengaruhi konsentrasi glukosa darah.
3. Pada keadaan glukosa tidak terkontrol, pemberian protein sekitar 0,8-1,0 mg/kg
BB/hari.

43

4. Pada gangguan fungsi ginjal, asupan protein diturunkan sampai 0,85


gram/KgBB/hari dan tidak kurang dari 40gram.
5. Jika terdapat komplikasi kardiovaskular, maka sumber protein nabati lebih
dianjurkan dibanding protein hewani.

LEMAK
Lemak memiliki kandungan energi sebesar 9 kilokalori/gram. Bahan makanan
ini sangat penting untuk membawa vitamin yang larut dalam lemak seperti vitami A,
D, E, K. Berdasarkan rantai karbonnya , lemak dibedakan menjadi lemak jenuh dan
tidak jenuh. Pembatasan asupan lemak jenuh dan kolestrol sangat disarankan pada
diabetisi karena terbukti dapat memperbaiki profil lipid tidak normal bagi pasien
diabetes. Asam lemak tidak jenuh rantai tunggal (monounsaturated fatty acid :
MUFA), merupakan salah satu asam lemak yang dapat memperbaiki glukosa darah
dan profil lipid. Pemberian MUFA pada diet diabetisi, dapat menurunkan kadar
trigliserida, kolestrol total, kolestrol VLDL, dan meningkatkan kadar kolestrol HDL.
Sedangkan asam lemak tidak jenuh rantai panjang (polyunsaturated fatty acid=
PUFA) dapat melindungi jantung, menurunkan kadar trigliserida, memperbaiki
agregasi trombosit. PUFA mengandung asam lemak omega 3 yang dapat menurunkan
sintesis VLDL di dalam hati dan eningkatkan aktivitas enzyme lipoprotein lipase yang
dapat menurunkan kadar VLDL di jarngan perifer. Sehingga dapat menurunkan kadar
kolestrol LDL.
Rekomendasi Pemberian Lemak:
1. Batasi konsumsi makanan yang mengandung lemak jenuh, jumlah maksimal 10%
dari total kebutuhan kalori per hari.
2. Jika kadar kolestrol LDL 100 mg/dl, asupan asam lemak jenuh diturunkan
sampai maksimal 7% dari total kalori perhari.
3. Konsumsi kolestrol maksimal 300mg/hari, jika ada kolestrol LDL 100 mg/dl,
maka maksimal kolestrol yang dapat dikonsumsi 200 mg per hari.
4. Batasi asam lemak bentuk trans.
5. Konsumsi ikan seminggu 2-3 kali untuk mencukupi kebutuhan asam lemak tidak
jenuh rantai panjang.

44

6. Asupan asam lemak tidak jenuh rantai panjang maksimal 10% dari asupan kalori
perhari.
Penghitungan Jumlah Kalori
Perhitungan julah kalori ditentukan oleh stasus gizi, umur, ada tidaknya stress akut,
dan kegiatan jasmani. Penetuan stasu s gizi dapat dipakai indeks massa tubuh (IMT)
atau rumus Brocca.
Penentuan stasus gizi berdasarkan IMT
IMT dihitung berdasarkan pembagian berat badan (dalam kilogram) dibagi dengat
tinggi badan (dalam meter) kuadrat.
1. Berat badan kurang <18,5
2. Berat badan normal 18,5-22,9
3. Berat badan lebih 23,0
4. Dengan resiko 23-24.9
5. Obes I 25-29,9
6. Obes II 30

Penentuan stasus gizi berdasarkan rumus Brocca


Pertama-tama dilakukan perhitungan berat badan idaman berdasarkan rumus:
berat badan idaman (BBI kg) = (TB cm - 100) -10%.
Penetuan stasus gizi dihitung dari : (BB aktual : BB idaman) x 100%
1. Berat badan kurang BB <90% BBI
2. Berat badan normal BB 90-110% BBI
3. Berat badan lebih

BB 110-120% BBI

4. Gemuk

BB>120% BBI

Untuk kepentingan praktis dalam praktek digunakan rumus Brocca.


Penentuan kebutuhan kalori perhari:
1. Kebutuhan basal:
a. Laki-laki : BB idaman (Kg) x 30 kalor
b. Wanita

: BB idaman (Kg) x 25 kalori


45

2. Koreksi atau penyesuaian:


a. Umur diatas 40 tahun

: -5%

b. Aktivitas ringan

: +10%

c. Aktifitas sedang

: +20%

d. Aktifitas berat

: +30%

e. Berat badan gemuk

: -20%

f. Berat badan lebih

: -10%

g. Berat badan kurus

: +10%

3. Stress metabolik

: +10-30%

4. Kehamilan trimester I dan II

: +300 kalori

5. Kehamilan trimester II dan menyusui : +500 kalori


Makanan tersebut dibagi dalam 3 porsi besar untuk makan pagi (20%), makan siang
(25%), serta 2-3 porsi ringan (10-15%) di antara makan besar. Pengaturan makan ini
tidak berbeda dengan orang normal, kecuali dengan pengaturan jadwal makan dan
jumlah kalori. Usahakan untuk merubah pola makan ini secara bertahap sesuai kondisi
dan kebiasaan penderita.
7. MemahamidanMenjelaskanPandanganAgamaIslamTerhadapMakananyang
Halal&Thoyyiban
Makan sehat
Makanan sehat di dalam Islam sangatlah penting untuk disimak, hal ini beliputi
bukan hanya pada persoalan hukum halal atau haram makanan, tetapi kualitas
(bobot kandungan gizi) dan efek kesehatan makanan terhadap tubuh.
Allah berfirman dalam Al Quran surat Al Araf ayat 31.
Hai anak Adam, kenakan pakaianmu yang indah disetiap memasuki masjid,
makan dan minumlah dan janganlah berlebih-lebihan. Sesungguhnya allah tidak
menyukai orang-orang yang belebih-lebihan.
Hal senada dapat ditemukan di surat Al Baqarah 168:
Hai sekalian manusia makan-makanlah yang halal lagi baik dariapa yang
terdapatdi bumi dan jangan kamu mengikuti langkah-langkah syaitan, karena
syaitan musuh yang nyata bagimu.

46

Sesungguhnya pangkal penyakit kebanyakan bersumber dari makanan. Maka tak


heran bila Rasulullah memberi perhatian besar dalam masalah ini, karena makanan
yang sehat akan membuat tubuh sehat.
Dalam Al-Qur'an prinsip makanan sehat adalah tidak berlebih-lebihan.
Rasulullah bersabda: Anak Adam tidak memenuhkan suatu tempat yang lebih
jelek dari perutnya. Cukuplah bagi mereka beberapa suap yang dapat
memfungsikan tubuhnya. Kalau tidak ditemukan jalan lain, maka (ia dapat mengisi
perutnya) dengan sepertiga untuk makanan, sepertiga untuk minuman, dan
sepertiganya lagi untuk pernafasan (HR Ibnu Majah dan Ibnu Hibban).
Lalu prinsip lain yang disebutkan pada dalil lainnya adalah halal dan tayyiban,
yang dimaksud dengan halal yakni diketahui atau jelas riwayat makanannya
(misalnya bersumber dari mana dan diproses dengan cara seperti apa) selain itu
memenuhi standar halal makanan yang banyak disebutkan dalam Al-Qur'an
maupun Hadits. Sementara istilah tayyiban disini yakni kualitas kandungan
gizi/nutrisi dalam makanan.
Rasulullah melarang untuk makan lagi sesudah kenyang. Kami adalah kaum
yang tidak makan sebelum merasa lapar dan bila kami makan tidak pernah
kekenyangan(HR Bukhari Musim).
Suatu hari, di masa setelah wafatnya Rasulullah, para sahabat mengunjungi
Aisyah ra. Lalu, sambil menunggu Aisyah ra, para sahabat, yang sudah menjadi
orang-orang kaya, saling bercerita tentang menu makanan mereka yang meningkat
dan bermacam-macam. Aisyah ra, yang mendengar hal itu tiba-tiba menangis.
Apa yang membuatmu menangis, wahai Bunda? tanya para sahabat. Aisyah ra
lalu menjawab, Dahulu Rasulullah tidak pernah mengenyangkan perutnya dengan
dua jenis makanan. Ketika sudah kenyang dengan roti, beliau tidak akan makan
kurma, dan ketika sudah kenyang dengan kurma, beliau tidak akan makan roti.
Dan penelitian membuktikan bahwa berkumpulnya berjenis-jenis makanan dalam
perut telah melahirkan bermacam-macam penyakit. Maka sebaiknya jangan
gampang tergoda untuk makan lagi, kalau sudah yakin bahwa Anda sudah
kenyang.
Salah satu makanan kegemaran Rasul adalah madu. Beliau biasa meminum
madu yang dicampur air untuk membersihan air liur dan pencernaan. Rasul
bersabda, Hendaknya kalian menggunakan dua macam obat, yaitu madu dan
Alquran (HR. Ibnu Majah dan Hakim).Yang selanjutnya, Rasulullah tidak makan
dua jenis makanan panas atau dua jenis makanan yang dingin secara bersamaan.
47

Beliau juga tidak makan ikan dan daging dalam satu waktu dan juga tidak langsung
tidur setelah makan malam, karena tidak baik bagi jantung. Beliau juga
meminimalisir dalam mengonsumsi daging, sebab terlalu banyak daging akan
berakibat buruk pada persendian dan ginjal. Pesan Umar ra, Jangan kau jadikan
perutmu sebagai kuburan bagi hewan-hewan ternak!
Kiat Makan Sehat ala Rasulullah
Sekarang masuk pada tata cara mengonsumsinya. Ini tidak kalah pentingnya
dengan pemilihan menu. Sebab setinggi apa pun gizinya, kalau pola konsumsinya
tidak teratur, akan buruk juga akibatnya. Yang paling penting adalah menghindari
isrof (berlebihan). Rasulullah bersabda, Cukuplah bagi manusia untuk
mengonsumsi beberapa suap makanan saja untuk menegakkan tulang sulbinya
(rusuknya). Makanlah dengan sikap duduk yang baik yaitu tegap dan tidak
menyandar, karena hal itu lebih baik bagi lambung, sehingga makanan akan turun
dengan sempurna. Rasulullah bersabda, Sesungguhnya aku tidak makan dengan
bersandar.Prinsip ketiga berpuasa. Sebulan dalam setahun, umat Islam diwajibkan
bukan saja dengan mencapai ketaqwaan tetapi juga ksehatannya dapat terjaga.
Berpuasalah kamu supaya sehat tubuhmu (HR Bukhari)
Puasa akan membawa kita pada kesehatan yang sangat luar biasa. Secara
fisiologis, puasa sangat erat kaitannya dengan kesehatan tubuh manusia. Saluran
pencernaan manusia tempat menampung dan mencerna makanan, merupakan
organ dalam yang terbesar dan terberat di dalam tubuh manusia. Sistem pencernaan
tersebut tidak berhenti bekerja selama 24 jam dalam sehari. Banyak hasil penelitian
modern yang memaparkan bahwa puasa sangat menyehatkan. Diantaranya,
memberikan istirahat fisiologis menyeluruh bagi sistem pencernaan dan sistem
syaraf pusat, menormalisasi metabolisme tubuh, menurunkan kadar gula darah,
mengikis lipid jahat (kolesterol), detoksifikasi (membuang racun dari tubuh), dan
lain sebagainya.
Insulin dalam islam
Dengan semakin meningkatnya usia harapan hidup manusia, maka
kebutuhan hidup manusia terhadap insulin semakin bertambah. Karena secara
alami, dengan bertambahnya usia, maka fungsi pankreas akan semakin menurun.
Dengan menurunnya fungsi pankreas, maka menurun pula fungsi insulin yang
dapat dihasilkan tubuh manusia. Dengan menurunnya insulin dalam tubuh

48

manusia, maka kemampuan tubuh manusia untuk memecah gula dalam darah akan
semakin turun. Pada saat itulah manusia terkena penyakit yang disebut kencing
manis (diabetes melitus), dan memerlukan suntikan insulin.
Pernah dicoba membuat insulin dari ekstraksi pankreas sapi. Namun
hasilnya kurang menggembirakan, meskipun gennya cocok dengan sapi. Dari
seekor sapi, hanya dihasilkan insulin 1/2 cc saja, yang berarti tidak cukup untuk
memenuhi kebutuhan seorang sekali suntik. Percobaan pembuatan insulin dari
pankreas kera, menunjukkan gennya tidak cocok dengan manusia.
Akhirnya dicoba membuat insulin dengan ekstraksi pankreas babi, dan
ternyata hasilnya selain gennya cocok dengan manusia, jumlah cc-nya pun
mencukupi.
Mula-mula insulin dibuat dari gen pankreas babi yang diklon dalam bakteri.
Dalam waktu 24 jam, dari satu gen menghasilkan milyaran gen. Kini insulin dibuat
dari gen pankreas babi yang diklon dalam ragi. Karena organisme ragi lebih
kompleks dari bakteri, maka hasilnya lebih baik. Dari satu gen pankreas babi yang
diklon dalam ragi pada tabung fermentor kapasitas 1.000 liter dihasilkan 1 liter
insulin. Insulin dari bahan dan proses seperti itulah yang kini beredar di seluruh
dunia.
Hal ini boleh-boleh saja selama tidak ditemukan obat yang lain. Yahya bin
Syaraf an-nawawi menerangkan dalam Al-Majmu Syarh al-Muhadzdzab




Adapun berobat dengan bahan-bahan najis selain khamr itu boleh. Hal ini berlaku
pada seluruh jenis najis selain yang memabukkan. Ini adalah pendapat al-Madzhab,
al-Manshush dan Jumhur ulama memastikannya (sebagi keputusan hukum
tunggal).Sebagai pertimbangan dapat pula diqiyaskan apa yang termaktub dalam
Al-Iqna fi Hill Alfazh Abi Syuja karangan Muhammad Khatib as-Syirbini yang
membolehkan seseorag menggunakan tulang najis sebagai pengganti atau
penyambung tulang yang telah rusak.






Dan bila seseorang menyambung tulangnya karena dibutuhkan, dengan tulang
najis yang selainnya tidak layak untuk dijadikan penyambung, maka ia dianggap
udzur dalam hal itu. Oleh karenanya, shalatnya sah besertaan tulang tersebut
(berada di tubuhnya).
49

Atau juga apa yang disampaikan oleh Muhammad Khatib as-Syirbini dalam
Mughni al-Muhtaj ila Marifah Alfazh al-Minhaj mengenai kesucian barang najis
yang telah berubah bentuknya

Dan semua najis yang telah berubah bentuk menjadi hewan itu suci, seperti darah
telor yang telah berubah menjadi anak ayam, menurut qaul yang menganggapnya
najis, meski ulat dari anjing. Sebab, sifat hidup itu mempunyai dampak nyata
dalam menghilangkan najis. Oleh karenanya, maka najis itu hilang karena
hilangnya sifat hidup. Selain itu, karena ulat itu lahir dalam diri anjing, bukan
berasal darinya.
Disarikan dari Hasil Keputusan Musyawarah Nasional Alim Ulama NU 16-20
Rajab 1418 H/17-20 Nopember 1997 M Di Ponpes QOMARUL HUDA Bagu,
Pringgarata Lombok Tengah

DAFTAR PUSAKA
1.
2.
3.
4.

Sherwood. L.2004. Fisiologi Manusia: Dari sel ke Sistem


Murray, Robert K.,dkk. 2003. Biokimia Harper. Jakarta: EGC.
Guyton dan Hall.2007.Buku Ajar Fisiologi Kedokteran Edisi 11.Jakarta: EGC.
PERKENI.2002. Konsensus Pengelolaan Diabetes Melitus Type 2 Di

Indonesia.
5. Sudoyo, aru. dkk. 2009. Ilmu penyakit dalam. Jakarta: interna publishing
6. Gan S, Setiabudi R, Suyatna FD, dkk. 1995. Farmakologi dan Terapi, ed 4,
Jakarta. Bagian farmakologi FK UI.
7. http://indodiabetes.com/piramida-makanan-diabetes.html
8. http://id.shvoong.com/medicine-and-health/nutrition/2075036-diet-tepat-bagipenderita-diabetes/#ixzz27Kvc4pO3
9. http://care.diabetesjournals.org/content/36/Supplement_1/S11.full
10. http://www.makanansehat.web.id/2012/12/makanan-sehat-dalam-islam-danpola.html
11. http://www.nu.or.id/a,public-m,dinamic-s,detail-ids,11-id,38094-lang,idc,syariah-t,Hukum+Menggunakan+Insulin-.phpx
12. http://clinicaldepartments.musc.edu/medicine/divisions/endocrinology/dsc/AD
A%20Standards%20of%20Medical%20Care%20in%20Diabetes%202013.pdf
50

13. http://www.academia.edu/4053787/Revisi_final_KONSENSUS_DM_Tipe_2_
Indonesia_2011

51