Anda di halaman 1dari 54

BAB I

PENDAHULUAN

1.1 Latar Belakang


Indonesia merupakan salah satu negara dengan jumlah penduduk yang besar.Laju
pertumbuhan penduduk Indonesia cukup besar, sehingga perlu dilakukan program
pembatasan angka kelahiran.Program pembatasan angka kelahiran di Indonesia dikenal
dengan program keluarga berencana yang disingkat dengan KB. Pembatasan kelahiran
tersebut bertujuan tidak hanya untuk membatasi angka kelahiran tetapi juga mengurangi
angka mortalitas ibu dan anak, terutama ibu dengan usia tua, yang ketika hamil, angka
morbiditas dan mortalitas cukup tinggi dan juga kemungkinan anak yang dilahirkan
menderita gangguan kromosomal seperti sindrom Down dan sebagainya cukup tinggi.
Program KB di Indonesia dijalankan dengan cara kontrasepsi yaitu upaya untuk mencegah
terjadinya kehamilan. Upaya tersebut dapat bersifat sementara, dapat pula bersifat
permanen. Namun sampai saat ini belum ada suatu cara kontrasepsi yang 100% ideal, karena
idealnya suatu kontrasepsi dilihat dari daya guna, aman, murah, estetik, mudah didapat,
tidak memerlukan motivasi terus-menerus, dan efek samping minimal .
Sejak diberlakukannya program KB di Indonesia dan sejak berkembangnya kontrasepsi
di Indonesia, penggunaan kontrasepsi masih dalam taraf belum cukup memuaskan , sampai
saat ini masih banyak masyarakat Indonesia yang enggan untuk menggunakan kontrasepsi
dengan alasan takut akan efek samping yang merugikan bahkan lebih memprihatinkan
adalah bahwa masih banyak masyarakat Indonesia yang belum tahu apa itu kontrasepsi,
terutama masyarakat Indonesia yang tinggal di daerah terpencil dan yang tidak
berpendidikan. Padahal sampai saat ini kontrasepsi di Indonesia telah mengalami evolusi
yang cukup signifikan dalam hal daya guna, aman, murah, estetik, mudah didapat dan efek
samping minimal. Dengan mengenal seluk beluk alat kontrasepsi, mulai dari apa itu
kontrasepsi hingga efek samping yang ditimbulkan diharapkan kedepannya kontrasepsi
1

dapat dengan mudah diterima dan jangkau oleh masyarakat Indonesia terutama masyarakat
Indonesia yang tinggal di daerah terpencil. Untuk itu perlunya digalakkan edukasi yang
optimal mengenai kontrasepsi.Oleh karena itu, adalah sebuah langkah yang baik jika
pemahaman tentang kontrasepsi ditingkatkan oleh tenaga medis.Sehingga nantinya
diharapkan tenaga medis mampu melakukan edukasi dan penatalaksanaan secara paripurna
mengenai kontrasepsi.Dan pada akhirnya, dengan pemahaman yang baik di kalangan tenaga
medis program keluarga berencana di Indonesia dapat berjalan dengan baik. Salah satu
metode kontrasepsi yang sudah digunakan sejak lama adalah dengan melakukan intervensi
pada sistem hormonal seorang wanita.Berdasarkan waktunya, kita bisa membedakan
menjadi kontrasepsi hormonal jangka pendek dan jangka panjang. Kontrasepsi hormonal
jangka pendek dapat berupa pil kontrasepsi yang harus

diminum setiap hari. Disebut

sebagai jangka pendek karena memang kerja dari pil yang sudah dikonsumsi tersebut hanya
terjadi dalam waktu singkat.Seorang wanita harus setiap hari secara disiplin mengkonsumsi
pil tersebut. Jika terlewat, resiko terjadi kehamilan setelah berhubungan seksual akan besar.
Sementara itu, kontrasepsi hormonal jangka panjang dapat berupa injeksi atau suntik KB
serta implan.Kontrasepsi dengan injeksi dapat berlaku selama 1 bulan atau 3 bulan
tergantung dari regimen yang diberikan.Mungkin memang lebih tepat jika disebut sebagai
jangka menengah daripada jangka panjang.Sementara untuk implan, masa kerjanya dapat
bervariasi dari 3 tahun hingga 5 tahun.Penggunaan metode kontrasepsi hormonal sering
digunakan dan cukup disukai karena tidak menimbulkan gangguan dalam berhubungan
seksual.
Hormon yang berperan penting dalam pengaturan pembuahan serta fungsi rahim maupun
lendir leher rahim adalah estrogen dan progesteron. Karena itulah, tidak heran jika metode
kontrasepsi hormonal yang digunakan melibatkan intervensi pada kedua hormon
tersebut.Secara garis besar, terdapat kontrasepsi yang berupa pemberian progesteron saja
serta yang berupa pemberian kombinasi antara progesteron dan estrogen.

1.2 Tujuan
1.
2.
3.
4.
5.

Mengetahui dan memahami kontrasepsi hormonal


Mengetahui efek kontrasepsi hormonal terhadap wanita yang terdiagnosa TB
Mengetahui obat TB yang mempengaruhi efektifitas kontrasepsi hormonal
Mengetahui isi kontrasepsi hormonal esterogen dan progesterone
Mengetahui jenis Injeksi kontrasepsi hormonal.

1.3 Rumusan Masalah


1.
2.
3.
4.

Apa yang dimagsud dengan kontrasepsi hormonal?


Apa obat TB yang yang mempengaruhi efektifitaskontrasepsi hormonal pada wanita.
Apa isi kontrasepsi hormonal esterogen dan progesterone
Apa saja jenis Injeksi kontrasepsi hormonal.

BAB II
TINJAUAN PUSTAKA
3

2.1 Kontrasepsi
Kontrasepsi berasal dari kata Kontra berarti mencegah atau melawan. Sedangkan
Konsepsi adalah pertemuan antara sel telur (sel wanita) yang matang dan sel sperma (sel pria)
yang mengakibatkan kehamilan. Jadi kontrasepsi adalah menghindari /mencegah terjadinya
kehamilan sebagai akibat pertemuan sel telur yang matang dengan sel sperma tersebut.
Kontrasepsi adalah pencegahan kehamilan dengan menghambat sperma mencapai sel telur
matang atau dengan mencegah ovum dibuahi dari menanamkan dalam endometrium Dalam
menggunakan kontrasepsi, keluarga pada umumnya mempunyai perencanaan atau tujuan yang
ingin dicapai. Tujuan tersebut diklasifikasikan dalam tiga kategori, yaitu menunda/mencegah
kehamilan, menjarangkan kehamilan, serta menghentikan /mengakhiri kehamilan atau
kesuburan.
Cara kerja kontrasepsi bermacam-macam tetapi pada umumnya yaitu (BKKBN,2002) :
1. Mengusahakan agar tidak terjadi ovulasi.
2. Melumpuhkan sperma.
3. Menghalangi pertemuan sel telur dengan sperma.
2.1.1 Siklus Menstruasi
Panjang rata-rata siklus menstruasi adalah 28 hari (kisaran 21-40 hari). Hari pertama
menstruasi adalah hari 1. Ovulasi biasanya terjadi pada hari 14. Setelah ovulasi, fase luteal
berlangsung sampai awal siklus berikutnya. Hipotalamus mengeluarkan hormon gonadotropinreleasing, yang merangsang hipofisis anterior untuk mensekresikan gonadotropin, hormon
perangsang folikel (FSH), dan luteinizing hormone (LH).
Pada fase folikuler, kadar FSH meningkat dan menyebabkan perekrutan sekelompok
kecil folikel untuk pertumbuhan lanjutan. Antara hari 5 dan 7, salah satu dari ini menjadi folikel
dominan, yang kemudian pecah untuk melepaskan oosit. Folikel dominan berkembang,
peningkatan jumlah estradiol dan inhibin, memberikan umpan balik negatif pada sekresi
4

gonadotropin-releasing hormone dan FSH. Folikel dominan terus tumbuh dan mensintesis
estradiol, progesteron, dan androgen. Estradiol menghentikan aliran menstruasi dari siklus
sebelumnya, mengental lapisan endometrium, dan menghasilkan lendir serviks encer yang tipis.
FSH mengatur enzim aromatase yang menginduksi konversi androgen menjadi estrogen dalam
folikel.

Pituitary melepaskan pertengahan siklus lonjakan LH yang merangsang tahap akhir


pematangan folikel dan ovulasi. Ovulasi terjadi 24 sampai 36 jam setelah puncak estradiol dan
10 sampai 16 jam setelah puncak LH. Gelombang LH adalah prediktor yang paling berguna
secara klinis mendekati ovulasi. Konsepsi yang paling sukses saat hubungan seksual berlangsung
dari 2 hari sebelum ovulasi pada hari ovulasi. Setelah ovulasi, folikel luteinized tersisa menjadi
korpus luteum, yang mensintesis androgen, estrogen, dan progesteron . Jika kehamilan terjadi,
human chorionic gonadotropin mencegah regresi korpus luteum dan merangsang produksi
lanjutan dari estrogen dan progesteron. Jika kehamilan tidak terjadi, korpus luteum
berdegenerasi, penurunan progesteron, dan menstruasi terjadi.
2.1.2 Terapi Non Farmakologi
a. Teknik Barier
Diafragma efektif karena mereka hambatan dan karena spermisida ditempatkan di
diafragma sebelum penyisipan. Ini harus dimasukkan hingga 6 jam sebelum berhubungan dan
harus dibiarkan di tempat selama setidaknya 6 jam setelah. Ini tidak harus dibiarkan di tempat
selama lebih dari 24 jam karena risiko sindrom syok toksik (TSS)

GAMBAR 30-1. Peristiwa siklus menstruasi, ideal siklus 28 hari. (FSH, follicle-stimulating hormone, HCG, human
chorionic gonadotropin, LH, hormon luteinizing.) LH: 15 mIU / mL = 15 IU / L; 50 sampai 100 IU / mL = 50
sampai 100 IU / L. FSH: 10 sampai 12 mIU / ml = 10 sampai 12 IU / L; 25 mIU / Ml = 25 IU / L. Estrogen: 40 pg /
mL = ~ 150 pmol / L; 250-400 pg / mL = ~ 920-1470 pmol / L; 125-250 pg / mL = ~ 460-920 pmol / L. Progesteron:
1 ng / mL = 3 nmol / L; 10 sampai 15 ng / mL = ~ 30 sampai 50 nmol / L. Suhu: 99 F = 37,2 C; 98 F = 36,7
C; 97 F = 36,1 C.

2.1.3 Terapi Farmakologi


Spermisida dan Tehnik Implan Penghalang Spermisida :
Kebanyakan spermisida mengandung nonoxynol -9, surfaktan yang menghancurkan
dinding sel sperma dan menghalangi dan menghalangi jalan masuk ke dalam OS serviks.
Mereka tidak memberikan perlindungan terhadap STDs, dan ketika digunakan lebih dari
2x sehari, nonoxynol -9 dapat meningkatkan penularan HIV.
Sponge kontrasepsi untuk vagina mengandung nonoxynol -9 dan terbukti melindungi
selama 24 jam. Setelah berhubungan intim, sponge tersebut harus didiamkan
(ditinggalkan, jangan dicopot) sekurang-kurangnya 6 jam sebelum dilepas, sponge
kontrasepsi tersebut tidak boleh didiamkan didalam lebih dari 24 jam sampai 30 jam

untuk mengurangi resiko dari TTS, hal tersebut dapat dilakukan/diperbolehkan tanpa
resep lanjutan.

2.2. Kontrasepsi Hormonal


Alat atau obat kontrasepsi yang bertujuan untuk mencegah terjadinya kehamilan dimana
bahan bakunya mengandung preparat esterogen dan progesteron, hormon-hormon ini bekerja
sebagai penghambat pengeluaran folicel stimulating

hormon

dan luiteinizing

hormon

sehingga proses konsepsi terhambat.


Kontrasepsi hormonal mengandung kombinasi baik estrogen sintesis dan progestin
sintesis atau progestin saja.
Tabel 30-2

Perbandingan tingkat kehamilan yang tidak diinginkan dan tingkat kelanjutan untuk metode
kontrasepsi farmakologi.
Presentase wanita

Presentase wanita

dengan kehamilan yang

dengan kehamilan yang

mempunyai penggunaan

mempunyai penggunaan

yang khasa

yang sempurnaa

0.3

68

0.3

68

0.3

68

medroxyprogesterone

0.3

56

asetat
IUD tembaga
IUD levonogetrel
Progestin-hanya implan

0.8
0.2
0.05

0.6
0.2
0.05

78
80
84

Metode

Presentase wanita
dengan penggunaan yang
berlanjut/terus menerusb

Kombinasi kontrasespi
oral dan progestir
hanya kontrasepsi oral
Kombinasi kontrasepsi
hormonal transdermal
patch
Kombinasi kontrasepsi
hormonal cicin vagina
Depo-

a) Tingkat kesalahan /kekeliruan di US selama penggunaan 1 tahun pertama.


b) Tingkat kelanjutan di US pada pengunaan 1 tahun pertama.

Bercak dan
Penerobosan
Berdarah
Produk
Ortho-Cyclen,
Mononessa, MonoLinyah, Previfem,
Sprintec
Ovcon-35, Balziva,
Femcon Fe
chewable,
Zenchent, Briellyn,
Gildagia, Philith,
Zeosa
Chewable
Yasmin, Ocella,
Safyral, Syeda,
Zarah
Loestrin-24 FE
Lybrel, Amethyst
Introvale,
Seasonale, Jolessa,
Quasense d
Beyaz, Gianvi,
Loryna, Vestura,
Yaz c
Caziant, Cyclessa,
Cesia, Velivet
Estrostep Fe, Tilia
Fe, Tri-Legest Fe

Kariva, Mircette,
Azurette, Viorele
Necon 10/11
Ortho-Novum
7/7/7, Nortrel 7/7/7,
Necon 7/7/7,

Estrogen
Etinil estradiol

Mikrogram
35

Progestin
Norgestimate

Miligram
0,25

14,3

Etinil estradiol

35

Norethindrone

0,4

11

Etinil estradiol

30

Drospirenone

14,5

Sub-50 mcg Estrogen Monophasic Diperpanjang Cycle


Etinil estradiol
20
Norethindrone
1
Etinil estradiol
20
Levonorgestre
0,09
l
Etinil estradiol
30
Levonorgestre
0,15
l
Etinil estradiol

20

Drospirenone

Sub-50 mcg Estrogen Multiphasic


Etinil estradiol
25 (7)
Desogestrel
25 (7)
25 (7)
Etinil estradiol
20 (5)
Norethindrone
30 (7)
acetate
35 (9)
Norethindrone
acetate
Norethindrone
acetate
Etinil estradiol
20 (21)
Desogestrel
10 (5)
Desogestrel
Etinil estradiol
35 (10)
Norethindrone
35 (11)
Norethindrone
Etinil estradiol
35 (7)
Norethindrone

50
52
58,5

52,5

0,1 (7)
0,125 (7)
0,15 (7)
1 (5)
1 (7)
1 (9)

11,1

21,7

0,15 (21)

19,7

0,5 (10)
1 (11)
0,5 (7)

17,6
14,5

Alyacen 7/7/7,
Cyclafem 7/7/7,
Dasetta 7/7/7
Etinil estradiol
Etinil estradiol
Etinil estradiol

35 (7)
35 (7)
35 (7)

Etinil estradiol
Etinil estradiol
Ortho Tri-Cyclen Lo, Etinil estradiol
Tri Lo Sprintec
Etinil estradiol
Etinil estradiol
Aranelle, Leena, Tri- Etinil estradiol
Norinyl
Etinil estradiol
Etinil estradiol
Enpresse, Trivora,
Etinil estradiol
Levonest Myzilra
Etinil estradiol
Etinil estradiol
Natazia
Estradiol
valerate

35 (7)
35 (7)
25 (7)
25 (7)
25 (7)
35 (7)
35 (9)
35 (5)
30 (6)
40 (5)
30 (10)
3 (2)
2 (22)
1 (2)

Ortho Tri-Cyclen,
Trinessa, TriPrevifem, TriSprintec,
Tri-Estarylla, TriLinyah

Norethindrone
Norethindrone
Norgestimate

Norgestimate
0,215 (7)
Norgestimate
0,25 (7)
Norgestimate
0,18 (7)
Norgestimate
0,215 (7)
Norgestimate
0,25 (7)
Norethindrone
0,5 (7)
Norethindrone
1 (90)
Norethindrone
0,5 (5)
Levonorgestrel
0,05 (6)
Levonorgestrel
0,075 (5)
Levonorgestrel
0,125 (10)
Dienogest
0 (2)
2 (5)
3 (17)
0 (4)

Sub-50 mcg Estrogen Multiphasic Extended Cycle


Amethia, Seasonique Ethinyl estradiol 30 (84)
Ethinyl estradiol 10 (7)
Progestin Only
Camila, Errin,
Ethinyl estradiol Heather, Jolivette,
Micronor, Nor-QD,
Nora-BE

B.
C.
D.
E.

0,75 (7)
1 (7)
0,18 (7)

17,7

11,5

25,5

Levonorgestrel
Levonorgestrel

0,15 (84)
0,15 (7)

42,5

Norethindrone

0,35

42,3

A. Rejimen 28 hari (pil aktif 21 hari, kemudian 7 hari pil bebas interval) kecuali dinyatakan
lain.
Nomor di kurung Mengacu pada jumlah hari dosis yang diterima di kontrasepsi oral
multifase.
28-hari rejimen (pil aktif 24 hari, maka interval pil bebas 4 hari).
91 hari rejimen (pil aktif 84 hari, maka interval pil bebas 7 hari).
pelaporan persen dan setelah 6 sampai 12 bulan penggunaan.

Perbandingan metode non hormonal

Metode

Keuntungan

Kerugian

kontraindikas
i absolut

Kondom
pria

Alergi lateks
atau karet

Murah,
perlindungan
STD,
termasuk HIV
(lateks saja)

Kondom
wanita

sejarah tss,

perlindungan
STD,
termasuk HIV

Diafragma
dengan
sperticida
cap serviks
(femcap),

Alergi latex,
karet atau
spermisida
alergi
terhadap
spermisida
alergi
terhadap
spermisida

Biaya yg
murah

spermisida
saja

spon

alergi
terhadap
spermisida

biaya rendah,

Murah

Murah

tingkat tinggi pengguna


kegagalan, lemah diterima,
kemungkinan kerusakan,
khasiat menurun pelumas
berbasis minyak mungkin
reaksi alergi terhadap lateks
baik Pasangan
Kegagalan pengguna yang
tinggi, cincin tidak suka
menggantung di luar
vagina rumit
Kegagalan pengguna yang
tinggi,, iritasi cervicks
penurunan efektivitas dengan
paritas tidak dapat digunakan
selama menstruasi
harus diterapkan kembali
sebelum setiap melakukan
hubungan dapat
meningkatkan penularan HIV
penurunan efektivitas dengan
paritas tidak dapat digunakan
selama menstruasi

STD, penyakit menular seksual, toxic shock syndrome, infeksi saluran kemih,
tingkat kegagalan di AS selama tahun pertama untuk digunakan
tingkat kegagalan dengan famcap dilaporkan 24% per paket insert
tingkat kegagalan dengan hari spons dilaporkan 20% per wanita parous
tingkat kegagalan dengan hari spons dilaporkan 32% per wanita parous

10

Persen
wanita
dengan
kehamila
n
Penggun
aan
sempurna
2

penggunaa
n yang khas
15

21

12

16

18
28

12

2.3 Macam-Macam Kontrasepsi Hormonal


Berdasarkan jenis dan cara pemakaianya di kenal empat macam kontrasepsi hormonal yaitu
kontrasepsi pil, kontrasepsi suntikan, implant, dan alat kontrasepsi dalam rahim yang
mengandung hormon esterogen.
A. Kontrasepsi Oral (Pil)
Kontrasepsi oral adalah kontrasepsi untuk wanita yang berbuat tablet, mengandung
hormon.Pada dasarnya terdapat dua jenis pil kontrsepsi oral yaitu pil kombinasi dan pil
yang berisi hanya progesteron saja.

Pil Kombinasi

Merupakan

pil

kontrasepsioral

kombinasiyang

menggunakan esterogen dan

progesteron untuk mencegah kehamilan.


1. Mekanisme kerja
Mekanisme kerja pil kombinasi adalah dengan cara menekan gonadotropin releasing
hormon.Pengaruhnya pada hifofisis terutama adalah penurunan sekresi luitenezing
hormon (LH), dan sedikit folikel stimulating hormon.

Dengan

tidak

adanya

puncak LH, maka ovulasi tidak terjadi. Disamping itu, ovarium menjadi tidak
aktif, dan pemasakan folikel terhenti. Lendir sevik juga mengalami perubahan,
menjadi lebih kental, gambaran daun pakis menghilang, sehingga penetrasi sperma
menurun (Siswosudarmo,et al. 2001, hlm 15).
2. Jenis pil kombinasi
Ada tiga jenis pil kombinasi :
o

Pil monofasik, berisi esterogen dan progesteron dalam jumlah sama yang
digunakan selama 21 hari.

Pil bifastik, adalah pil 21 hari yang berisi esterogen dalam jumlah yang sama
selama penggunaan paket tetapi ada pil yang memiliki dua kadar progesteron yang
11

berbeda di dalamnya.Biasanya pil ini di beri kode yang dengan warna yang
berbeda.
o

Pil trifasik, adalah pil 21 hari yang berisi jumlah esterogen yang bervariasi
(biasanya dua kadar yang berbeda) selama paket penggunaan tetapi memiliki tiga
kadar progestero, yang berbeda di dalamnya, yang di beri kode warna.

3. Efektiffitas
Pada pemakaian yang seksama, pil kombinasi 99% efektif mencegah kehamilan.
Namun, pada pemakaian yang kurang seksama, efektifitasnya masih mencapai 93%
(Everett, 2008, hlm.119).
4. Keuntungan
o Mudah menggunakannya
o Cocok untuk menunda kehamilan pertama dari pasangan usia subur yang masih
muda
o Mengurangi dismenoroe pada saat menstruasi
o

Dapat mencegah defisiensi zat besi

Mengurangi resiko kanker ovarium

Tidak mempengaruhi produksi ASI

5. Keterbatasan
o

Harus diminum setiap hari dan pada waktu yang sama


o Tidak melindungi diri dari infeksi menular seksual atau HIV /AIDS
o Tidak dapat diberikan pada wanita yang sedang menyusui karena dapat
mengurangi asi (Saifuddin, 2004, hal. MK 29 )
12

6. Efek samping
o Gangguan menstruasi
o Mual muntah
o Sakit kepala
o Berat badan bertambah
o Sindrom pra menstruasi seperti payudara tegang
o Libido berkurang
o Jerawat
o Hipertensi(Darney,Speroff, 2005, hlm.90).

Kontrasepsi Pil Progestin


Kontrasepsi ini sering juga disebut mini pil.Merupakan pil yang hanya
mengandung hormon progesteron, tetapi dosisnya lebih rendah dibandingkan
dengan progestin yang ada pada pil kombinasi.

1. Mekanisme kerja
Cara kerja utama kontrasepsi ini adalah dengan mengentalkan lendir serviks,
sehingga menghambat penetrasi sperma untuk masuk lebih jauh. Disamping itu
progestin juga menghambat ovulasi, mengganggu motilitas tuba sehingga
sehingga transfortasi sperma terganggu, dan mengganggu perubahan fisiologis
endometrium sehingga menghalangi nidasi (Saifuddin, 2004, hlm.MK 47).
2. Efektifitas
Bagi ibu yang menyusui, sampai sembilan bulan post partum keefektifan pil

13

mencapai 98,5%. Bagi ibu yang tidak menyusui dan sedang dalam masa interval
turun menjadi 96% (Siswosudarmo, et al.2001, hlm.18).
3. Keuntungan
Manfaat pil ini sama dengan pil kombinasi, selain itu pil ini lebih kecil
menyebabkan peningkatan tekanan darah dan nyeri kepala. (Cunningham,et
al.2006, hlm 1712).
4. Keterbatasan
o Harus diminum setiap hari dan pada waktu yang sama
o Tidak melindungi diri dari infeksi menular seksual atau HIV /AIDS c). Bila
lupa satu pil dapat meningkatkan resiko kehamilan
o Efektivitas berkurang jika digunakan bersamaan dengan obat tuberkolosis
(Saifuddin, 2004, hal. MK 49 )
5.

Efek samping
o Hampir 30-60% mengalami gangguan haid.
o Perubahan berat badan.
o Mual.
o Payudara tegang.
o Pusing
o Resiko kehamilan ektopik tinggi (4 dari 100 kehamilan).
o

Jerawat
(Saifuddin, 2004, hlm.MK 49).
14

Kontrasepsi Suntikan
suntikan adalah kontrasepsi untuk wanita yang diberikan dalan bentuk suntikan
yang mengandung hormon.Terdapat dua jenis suntikan kontrsepsi oral yaitu
suntikan kombinasi dan suntikan progestin.
a. Suntikan Kombinasi
Suntikan kombinasi adalah kontasepsi kombinasi esterogen dan progesteron
yang di berikan secara I.M.
1. Jenis suntikan kombinasi
Ada dua jenis kontrasepsi suntikan kombinasi :
o Suntikan kombinasi yang berisi 25 mg depo medroksiprogesteron asetat dan
5 mg estradiol spinoat yang diberikan injeksi I.M. sebulan sekali atau yang
biasa di sebut cyclofem.
o Suntikan yang berisi 50 mg noretrindon enantat dan 5 mg estradiol vaerat
yang di beri secara I.M. sebulan sekali.
2. Cara kerja
Mekanisme kerja kontrasepsi ini adalah dengan cara menekan ovulasi. Membuat
lendir serviks menjadi kental sehingga penetrasi sperma terganggu, Perubahan
pada endrometrium sehingga implantasi terganggu, Menghambat transfortasi
gamet oleh tuba.
3. Effektifitas
Sangat efektif 0,1 0,4 kehamilan per 100 perempuan selama tahun pertama
penggunaan (Saifuddin,et al. 2004, hlm.MK 33)
4. Keuntungan
o Mengurangi jumlah perdarahan.

15

o Mengurangi nyeri saat haid.


o Mencegah anemia.
o Khasiat terhadap kanker ovarium dan kanker endometrium.
o Mencegah kehamilan ektofik.
o Mengurangi penyakit payudara dan kista ovarium.
o Mencegah kehamilan ektofik dan penyakit radang panggul.
5. Keterbatasan
o Ketergantungan klien terhadap pelayanan kesehatan.klien harus kembali setiap
30 hari untuk mendapat suntikan
o Efektifitas berkurang jika digunakan bersama dengan obat-obatan epilepsi
o Tidak menjamin terhadap penularan penyakit menular seksual
6. Efek samping
o Terjadi perubahan pola haid, seperti tidak teratur, spotting, atau perdarahan
selama 10 hari.
o Sakit akibat suntikan.
o Mual, sakit kepala, nyeri payuda ringan, dan keluhan ini akan hilang setelah
suntikan ke dua dan ke tiga.
o Penambahan berat badant (dapat ditunkan dengan olah raga dan pengaturan
makanan)(Saifuddin,et al. 2004, hlm.MK 33).
b. Suntikan Progesteron
16

Suntikan progesteron adalah kontrasepsi yang berisi hormon progesteron yang di


berikan secara I.M.
1. Jenis suntikan progestin
Ada dua jenis kontrasepsi suntikan yang berisi progestin :
o Depo medrosiprogesteron asetat (DMPA), mengandung 150 mg DMPA, yang
di berikan tiga bulan secara I.M.
o Depo noretisteron enantat (Depo Noristerat), yang mengandung 200 mg
noretindron enantat, diberikan setiap 2 bulan secara I.M.
2. Cara kerja
Sebagai derivat progesteron, kerjanya sebagai berikut, mencegah ovulasi,
mengentalkan lendir serviks sehingga menurunkan kemampuan penetrasi sperma,
menjadikan selaput lendir tipis dan atropi, menghambat transportasi gamet oleh
tuba
3. Effektifitas
Kedua kontasepsi ini mempunyai efektivitas yang tinggi, dengan 0,3 kehamilan
per 100 perempuan-tahun, jika penyuntikan dilakukan secara teratur.
4. Keuntungan
o Efektivitas tinggi
o Tidak mengganggu ASI
o Tidak ditemukan efek samping yang disebabkan esterogen seperti mual
o Menurunkan terjadinya penyakit kangker payudara
o Mencegah radang panggul
17

o Mencegah kanker endometrium dan KET (Saifuddin,et al. 2004, hlm.MK 41)
5. Keterbatasan
Keterbatasan suntikan progestin sama dengan suntikan kombinasi(Saifuddin,et al.
2004, hlm.MK 41).
6. Efek samping
o Perdarahan yang tidak menentu
o Terjadinya amenore yang berkepanjangan
o Berat badan bertambah
o Sakit kepala
o Rasa sakit akibat suntikan
o Kembalinya kesuburan lama (Hartanto, 2004, hlm.26).

B. Kontrasepsi Implant
Implant adalah jenis kontrasepsi dalam bentuk kapsul yang mengandung hormon
progesteron yang dimasukkan di bawah kulit.
a. Mekanisme kerja
1. Membuat lendir serviks lebih kental, sehingga mengganggu penetrasi spermatozoa
untuk masuk lebih dalam lagi.
2. Mengganggu motilitas tuba, sehingga transport sperma maupun sel telur terganggu.
3. Mengganggu kapasitas sperma sehingga kemampuan membuahi menurun.
18

4. Mengganggu pemasakan endometrium sehingga mengganggu implantasi sel telur.


5. Mengganggu keseimbangan hormon esterogen, progesteron, dan gonadotropin,
sehinnga menghambat ovulasi (Siswosudarmo,et al. 2001, hlm 25 ).
b. Jenis jenis implant
1. Norplan
Terdiri dari 6 batang silastik lembut berongga dengan panjang 3,4 cm, dengan
diameter 2,4 mm, yang di isi dengan 36 mg levonolgestrel dengan lama kerjanya 5
tahun.
2. Implanon
Terdiri dari satu batang putih lentur dengan panjang kira kira 40 mm, dan siameter 2
mm, yang di isi dengan 68 mg 3-keto-desogestrel dan lama kerjanya 3 tahun.
3. Jedena dan indoplan
Terdiri dari 2 batang yang di isi dengan 75 mg levonolgester dengan lama kerjanya 3
tahun.
c. Efektifitas
Kontasepsi implan ini sangat efektif 0,2 1 kehamilan per 100 perempuan.

d. Keuntungan
1. Efektifitas tinggi.
2. Tidak mengganggu ASI.
3. Mengurangi nyeri haid.
4. Mengurangi jumlah darah haid
5. Mengurangi resiko penyakit radang panggul.
19

6. Menurunkan angka kejadian endometriosis .


7. Menurunkan kejadian kanker payudara.
e. Keterbatasan
1. Memerlukan tindakan pembedahan minor
2. Tidak memberikan efek protektif terhadap infeksi menular seksual
3. Klien tidak dapat menghentikan sendiri penggunaan sesuai dengan keinginannya, akan
tetapi harus pergi ke klinik untuk pencabutan.
4. Efektifitas menururun jika digunakan bersama obat-obat tuberkolosis.
f. Efek samping
1. Gangguan siklus menstruasi (amenoroe, spotting)
2. Infeksi tempat implantasi
3. Nyeri kepala.
4. Perubahan berat badan.
5. Mual.
6. Jerawat.
7. Nyeri payudara (Hartanto, 2006, hlm.29).
C. Alat Kontrasepsi Dalam Rahim (AKDR) dengan Progestin
Jenis AKDR ini di sebut juga sistem intra uterus penghasil levonogestrel (levonegestrelreleasing intra uterin system; LNG-IUS). Dimana alat ini terdiri dari sebuah rangka
nova T dengan sebuah kolom LNG di dalam suatu membran (yang berfungsi membatasi
pengeluaran zat) yang membungkus batang vertikal alat.Alat ini mengandung 52 mg
20

LNG yang dilepaskan dengan kecepatan 20 g / hari. Jenis kontrasepsi ini efektif
selama 10 tahun (Glasier, Gabbie, 2006 hlm 119).
a. Mekanisme kerja
1. Mencegah terjadinya pembuahan dengan mengeblok bersatunya ovum dengan
sperma.
2. Mengurangi jumlah sperma yang mencapai tuba fallopi.
3. Menginaktifkan sperma.
4. Endometrium mengalami atrofi, sehingga mengganggu implantasi.
b. Efektivitas
Sangat efektif, yaitu 0,5 1 kehamilan per 100 perempuan selama tahun pertama
penggunaan.
c. Keuntungan
1. Efektif dengan proteksi panjang (satu tahun).
2. Tidak berpengaruh tehadap ASI.
3. Kesuburan segara kembali setelah AKDR di buka.
4. Efek samping kecil .
5. Mengurangi nyeri haid ( Saifuddin,et al.2004 hal MK 62).
d. Keterbatasan
1. Diperlukanpemeriksaandalamdanpenyaringaninfeksisebelum pemasangan AKDR
2. Diperlukan tenaga ahli untuk pemasangan dan pencabutan

21

3. Klien tidak dapat menghentikan sendiri setiap saat Mahal


e. Efek samping
1. Dapat menyebabkan infeksi jika pemasangan tidak menggunakan akseptik yang
benar.
2. AKDR dapat berpindah ke luar rongga rahim (angka kejadian 3%-10% pada tahun
pertama pemakaian.
3. Menstruasi lebih banyak dan lebih lama (Glasier,Gabbie, 2006 hlm 122-124).
4. Dapat terjadi perporasi uterus saat insersi.
5. Memperbesar resiko penyakit radang panggul.
6. Memperburuk perjalanan penyakit kanker payudara.
7. Perogesteron dapat memicu pertumbuhan mioma uterus ( Saifuddin,et al. 2004 hal
MK 63).
TABEL 30-4

Gejala serius yang mungkin terkait dengan kontrasepsi hormonal


kombinasi

Gejala serius
Penglihatan
kabur,
diplopia,
berkedip, kebutaan, papilledema.

Mungkin masalah yang mendasari


lampu Stroke, hipertensi, masalah vaskeler
sementara banyak situs mungkin, trombosis
retina ateri
Mati rasa, kelemahan, kesemutan pada Hemoragik atau stroke
ekstremitas, bicara cadel.
Sakit kepala sebelah
Vaskular kejang, stroke
Masa payudara nyeri atau pembengkaan
Kanker payudara
Sakit dada (menjalar kelengan kiri atau Emboli paru, infark miokard.
dada) sesak nafas, batuk berdarah.
Nyeri perut, massa hati atau nyeri, sakit Penyakit kandungan empedu, adenoma hati,
kuning
pankreatitis trombosis ateri perut atau vena
Berlebihan terobosan bercak pendarahan Endometrium, kangker serviks atau vagina
parah sakit kaki ,betis, paha, nyeri bengkak, deep-vein trombosis
kehangatan
22

a) Diabetes
Diabetes progestin baru diyakini memiliki sedikit, jika ada, efek pada metabolisme
karbohidrat. Wanita muda dari 35 tahun dengan diabetes tetapi tidak ada penyakit pembuluh dara
yang tidak merokok dapat aman menggunakan CHCs. Wanita diabetes dengan penyakit
pembuluh darah atau diabetes durasi lebih dari 20 tahun tidak harus menggunakan CHCs.
b) Dislipidemia
Umumya progestin sintetis menurunkan high density lipoprotein (HDL) dan meningkatkan
low density lipoprotein (LDL) estrogen menurunkan LIDL tetapi meningkatkan HDL dan
moderat dapat menigkatkan trigliserida. Kebanyakan CHCs dosis rendah (kemungkinan
pengecualian dari pil levonorgestrel, yang dapat mengurangi HDL tingkat pada beberapa
pasien) tidak berdampak segnifikan pada trigliserida HDL LIDL atau total kolestrol.Mekanisme
untuk penyakit kardiovaskular meningkat pada pengunaan CHC diyakini tromboemboli dan
trombotik perubahan, tidak aterosklerosis.
Wanita dengan dislipidemia dikendalikan dapat menggunakan CHCs dosis rendah,
pemantauan puasa lipid profil wanita dengan dislipidemia yang tidak terkendali (LIDL 160
mg/dl 4,14 mmol/Ll. HDL 35 mg/dl (0.91 mmol/Ll. Trigliserida 250 mg/dl 12,83 mmol/Ll) dan
faktor resiko tambahan (minsalnya penyakit ateri koroner,diabetes, hipertensi, perilaku merokok,
atau riwayat keluarga yang positif) harus mengunakan metode alternatif kontrasepsi.
c) Tromboemboli
Estrogen memiliki efek yang berhubungan dengan dosis dalam pengembangan tromboemboli
vena (VTE) dan emboli paru, terutama pada wanita dengan negara agulable mendasari atau
yang telah memperoleh kondisi (minsalnya, obesitas, kehamilan , imobilitas, trauma, oprasi dan
keganasan tertentu) yang mempengaruhi mereka untuk kelainan koagulasiResiko VTE pada
wanita yang menggunakan kontrasepsi oral dosis rendah (<50 mcg EE) adalah empat kali resiko
di non pengguna. Namun resiko ini kurang dari resiko kejadian thromboernbolic selama
kehamilan. OCs mengandung resorestrel, drospirerone, dan norgestimate telah sedikit

23

meningkat resiko trombosis. Transdermal dan cincin vaginanya mengekspos perempuan untuk
estrogen yang lebih tinggi dan berkaitan dengan peningkatan resiko tromboemboli
2.4 Kriteria Medis di AS tentang kelayakan untuk penggunaan Kontrasepsi dan klasifikasi
untuk kombinasi kontrasepsi hormonal
a) Kategori 4: resiko kesehatan yang tidak dapat diterima (metode tidak digunakan)
Menyusui atau non-menyusui <21 hari pascapersalinan,kanker payudara saat,parah
(dekompensasi) sirosis,Sejarah / risiko atau vena trombosis / emboli paru yang mendalam saat
(Bukan pada terapi antikoagulan); mutasi thrombogenic, Operasi Mayor dengan imobilisasi
berkepanjangan,Migren dengan aura, usia,Tekanan darah sistolik 160 mm Hg atau diastolik
100 mm Hg,saat ini dan riwayat penyakit jantung iskemik. tumor hati jinak atau tumor hati
ganas,Cukup atau sangat terganggu fungsi jantung; normal atau sedikit terganggu,fungsi jantung
<6 bulan, Merokok 15 batang per hari dan usia 35,komplikasi transplantasi organ padat
,Sejarah kecelakaan serebrovaskular,SLE; antibodi antifosfolipid positif atau tidak diketahui dan
komplikasi Penyakit katup jantung
b) Kategori 3: Teori atau terbukti risiko biasanya lebih besar dari pada keuntungan
Menyusui 21-30 hari postpartum dengan atau tanpa faktor risiko VTE,Menyusui 30-42
hari postpartum dengan faktor risiko lain untuk VTE,Non-menyusui 21-42 hari postpartum
dengan faktor risiko lain untuk VTE,kanker payudara masa lalu dan tidak ada bukti penyakit
selama 5 tahun,Sejarah DVT / PE (tidak pada terapi antikoagulan), tetapi risiko lebih rendah
untuk berulang DVT / PE,Penyakit kandung empedu sekarang, gejala dan diobati secara
medis,Migren tanpa aura, usia 35 (kategori 4 dengan penggunaan lanjutan),Sejarah operasi
bariatrik; prosedur malabsorptive,Sejarah kolestasis, melewati COC-terkait,Hipertensi; tekanan
darah sistolik 140-159 mm Hg atau diastolik 90-99 mm Hg,Normal atau sedikit gangguan fungsi
jantung 6 bulan,Postpartum 21-42 hari dengan faktor risiko lain untuk VTE,Merokok <15
batang per hari dan usia 35,Penggunaan PI ritonavir,Penggunaan antikonvulsan tertentu
(fenitoin,

carbamazepine,

barbiturat,

primidone,

topiramate,oxcarbazepine,

dan

lamotrigin),Penggunaan rifampisin atau terapi rifabutin,Diabetes dengan penyakit pembuluh


24

darah atau> 20 tahun lamanya (mungkin kategori 4 tergantung pada keparahan) faktor risiko
Beberapa penyakit arteri jantung (usia tua, merokok, diabetes, dan hipertensi) (mungkin kategori
4 tergantung pada kategori dan tingkat keparahan)
c) Kategori 2: Keuntungan umumnya lebih besar daripada risiko teoritis atau terbukti
Umur 40 (tanpa adanya kondisi komorbiditas lain yang meningkatkan risiko CVD),
Penyakit sel sabit, massa payudara terdiagnosis,Kanker serviks dan pengobatan menunggu;
serviks intraepithelial neoplasia,(keluarga tingkat pertama) Riwayat keluarga DVT / PE,operasi
utama tanpa imobilisasi berkepanjangan,Diabetes mellitus (tipe 1 atau tipe 2),Penyakit Kandung
empedu; gejala dan dirawat oleh kolesistektomi atau asimtomatik, Migren tanpa aura, usia <35
(kategori 3 dengan penggunaan lanjutan),Sejarah kolestasis yang berhubungan dengan
kehamilan,Sejarah tekanan darah tinggi selama kehamilan, tumor hati jinak; hiperplasia nodular
fokal, Obesitas,Menyusui 30-42 hari postpartum tanpa faktor risiko VTE,Menyusui> 42 hari
pascapersalinan,Non-menyusui 21-42 hari postpartum tanpa faktor risiko VTE,Rheumatoid
arthritis atau menonaktifkan terapi imunosupresif, Merokok dan <35 tahun, terkomplikasi dijual
transplantasi organ, tromboflebitis superfisial,SLE dan trombositopenia berat atau imunosupresif
pengobatan, perdarahan vagina yang tidak dapat dijelaskan sebelum evaluasi,komplikasi
Penyakit

katup

jantung

,Penggunaan

transcriptase

inhibitor

nonnucleoside

terbalik,Hiperlipidemia (mungkin kategori 3 berdasarkan jenis, tingkat keparahan, danfaktor


risiko lainnya),Penyakit radang usus (mungkin kategori 3 bagi mereka dengan peningkatan risiko
VTE)
d) Kategori 1: Tidak ada pembatasan (metode dapat digunakan)
Thalassemia, anemia defisiensi besi, sirosis kompensasi Mild,Minor operasi tanpa
imobilisasi Depresi, diabetes mellitus gestasional,endometrium kanker / hyperplasia,
endometriosis,Epilepsi, penyakit trofoblas gestasional,sakit kepala Nonmigrainous,Sejarah
operasi bariatrik; prosedur ketat,Sejarah operasi panggul,Risiko terinfeksi atau tinggi
HIV,Malaria,Kanker ovariumkehamilan ektopik Past,PID,Pasca-aborsi, Non-ASI> 42 hari
pascapersalinan,dismenore

berat,Infeksi

25

menular

seksual,Varises,Gangguan

tiroid,Tuberkulosis,Uterine

fibroid,Penggunaan

nucleoside

reverse

transcriptase

inhibitor,penggunaan antibiotik spektrum luas, antijamur, dan antiparasitics


CHC, dikombinasikan kontrasepsi hormonal; HIV, human immunodeficiency virus; VTE,
tromboemboli vena; PE, emboli paru; CVD, penyakit kardiovaskular; PID, infl panggul penyakit
peradangan.
Untuk wanita penigkatan thromboebuli (diatas 35 tahun, kegemukan, merokok, seorang atau
keluarga

yang

mempunyai

riwayat

vena

thrombosis

(imobilisasi

berkepanjangan)

mempertimbangkan dosis rendah kontrasespsi estrogen oral mengandung progestin tua atau
hanya progestin. Kontrasespi dalam keadaan darurat (EC) belum terkait dengan peningkatan
resiko trhomboebolic.
Sakit Kepala Sebelah
Wanita dengan migrain mungkin mempunyai pengalaman dengan frekuensi yang
menurun dan meningkat. Ketika menggunakan CHCs. CHCs mungkin dianggap untuk
kesehatan. Wanita yang tidak merokok dengan migrain tanpa aura. Wanita dari segala usia yang
mempunyai migrain dengan aura wanita diatas 35 tahun dengan berbagai dengan berbagai tipe
migrain jangan menggunakan CHCs. Wanita yang mengembangkan migrain (dengan atau tanpa
aura) saat menerima CHCs harus segera dihentikan penggunaannya

dan dianggap hanya

progestin sebagai opsi.


Kanker Payudara
Pilihan untuk menggunakan CHCs seharusnya tidak berpengaruh oleh kehadiran dari
penyakit payudara yang jinak atau riwayat keluarga dari kanker payudara dengan baik mutasi
dari BRCA1 atau BRCA2. Tapi wanita dengan riwayat kanker payudara sekarang atau masa lalu
jangan menggunakan CHCs.
Sistemik Lupus Erythomasus

26

OCs tidak meninggkatkan resiko dari suar diantara wanita dengan sistemik lupus
erythomasus (SLE) yang stabil dan tanpa antibodi antiphospolipid/anticardiopilin atau
komplikasi vaskular. Hanya progestin kontrasepsi pada wanita ini.\
Obesitas
OCs mempunyai khasiat yang lebih rendah pada wanita yang obesitas dan mungkin
terutama dosis rendah OCs bermasalah. Wanita obesitas akan meningkatkan resiko untuk VTE.
American Congress Of Obstetries and Gynecology merekomendasikan kontrasepsi transdermal
tidak digunakan sebagai pilihan utama pada wanita dengan berat badan 90 kg (198 lbs) dan
progestin Kontrasepsi mungkin lebih baik digunakan untk wanita obesitas diatas 35 tahun.

2.5 Pertimbangan untuk kontrasepsi oral


Dengan penggunaan yang sempurna, khasiat nya lebih 99% tapi dengan pengunaan yang
khas.

Sampai

8%

dari

wanita

mungkin

mengalami

kehamilan

yang

tidak

di

inguinkan.Monophastic OCs mengandung jumlah konstan dari estrogen dan progestin untuk 21
hari, diikuti dengan 7 hari plasebo. Pil bhipastic dan triphastic mengandung variasi jumlah dari
estrogen dan progestin untuk 21 hari dan di ikuti 7 hari plasebo.
Siklus pil diperpanjang dan berlanjut dengan kombinasi rejimen mungkin menyebabkan
efek samping dan manfaat kenyamanan. Satu siklus tertentu diperpanjang OC meningkatkan
kandungan hormon pil dari 21 hari sampai 84 hari diikuti 7 hari plasebo. Hasilnya dalam empat
siklus menstruasi dalam satu tahun. Kelanjutan kombinasirejimen menyediakan OCs untuk
21hari. Kemudian dosis estrogen dan progestin rendah untuk tambahan 4sampai 7 hari.
Generasi ke 3 OCs mengandung progestin baru (eg, derogestrel, drospirenone, gertodene,
dan norgrestimate). Potensi progestin tidak ada efek estrogen dan androgenik lebih rendah dari
levogestrel.Progestin mini pil cenderung kurang efektif dari kombinasi OCs dan terkait dengan
tidak teratur dan tidak bisa diprediksi mennstruasi. harus diambil setiap hari dari siklus
menstruasi sekitar pada waktu yang sama pada hari itu untuk mempertahankan khasiat
27

kontrasepsi dan terkait dengan kehamilan ektopok. Dari kontrasepsi hormonal lain.Pada awal
cepat metode untuk memulai OCs waktu mengambil pil pertama pada hari dia mengunjungi
kantor ( setelah tes urin kehamilan negatif) pada hari pertama mulai.
2.6

Mekanisme

terjadinya

interaksi

antara

pil

KB

dengan

obat

antibiotika/antijamur pada wanita TB


Etinil estradiol adalah estrogen pilihan yang banyak digunakan dalam pil KB, dan
merupakan senyawa yang aktif utama pil KB. Dari total zat aktif dalam satu pil,
hanya kira-kira 40-50 %-nya saja yang dapat mencapai peredaran darah sistemik
dalam bentuk tidak berubah, dengan rentang variasi individual berkisar 10 s/d
70%.

Sisanya

dimetabolisir

selama first

pass

metabolisme melalui

saluran

pencernaan dan liver/hati. Etinil estradiol yang telah melalui peredaran darah akan
diserap oleh tubuh, dan sisa yang tidak terserap akan mengalami konjugasi dengan
senyawa sulfat, terutama di dinding saluran cerna, lalu ditranspor di pembuluh
darah vena ke dalam liver dimana akan terjadi hidroksilasi dan konjugasi dengan
asam glukoronat. Dengan proses metabolisme ini, etinil estradiol berubah menjadi
senyawa yang tidak aktif, yang pada akhirnya akan dikeluarkan melalui feses/tinja.
Proses hidroksilasi ini dikatalisir oleh suatu enzym spesifik yang disebut sitokrom
P450, yang dipengaruhi oleh sifat genetik, yang berarti tergantung pada sifat gen
manusia. Dengan demikian, hal ini dapat menjelaskan mengapa setiap individu,
termasuk dari etnik yang berbeda, bisa memiliki perbedaan kemampuan untuk
memproses

hidroksilasi

etinil

estradiol

dalam

tubuh.

Estrogen

yang

tidak

terhidroksilasi akan mengalami konjugasi dengan glukoronat, dan kemudian


diekskresikan ke dalam empedu, lalu masuk ke dalam usus dan dikeluarkan
melalaui tinja. Tetapi, sebagian dari estrogen yang melalui usus tadi masih dapat
diproses lagi oleh suatu bakteria usus yaitu spesies Clostridia kembali menjadi
bentuk yang aktif/bebas dan dapat mengalami re-sirkulasi dalam peredaran darah
sistemik dan mengalami penyerapan lagi.
Ada

beberapa

(antibiotika/antijamur)

keadaan
dapat

di

mana

mempengaruhi

secara

teroritik

penyerapan,

antimikroba

metabolisme

dan

pengeluaran etilen estradiol, menurunkan potensinya serta dapat menyebabkan

28

pendarahan, bahkan kegagalan KB, yaitu kehamilan. Rifampisin, suatu antibiotika


yang digunakan untuk mengobati TBC, adalah yang pertama kali dilaporkan
menyebabkan berkurangnya efek pil KB pada sekitar tahun 1971 di Jerman.Di
antara 88 wanita yang menggunakan pil KB dan Rifampisin, 62 orang diantaranya
dilaporkan mengalami gangguan menstruasi dan 5 orang gagal berKB atau hamil.
Rifampisin adalah induser yang poten terhadap enzym sitokrom P450, sehingga
meningkatkan proses metabolisme etinil estradiol menjadi senyawa tak aktif, yang
pada gilirannya menyebabkan berkurangnya konsentrasi pil KB tersebut dalam
tubuh dan menyebabkan efeknya jadi berkurang.
Griseofulvin, suatu obat jamur, juga dilaporkan memiliki efek yang serupa, yaitu
mengurangi efek kontrasepsi oral. Obat jamur lain yang dilaporkan dapat
menurunkan potensi pil KB adalah itraconazole, namun mekanismenya belum
diketahui

secara

pasti.

Yang

menarik,

obat

kelompok

triazol

yang

lain

yaituketaconazole, dan fluconazole, dilaporkan menghambat enzim sitokrom P450,


yang berarti mengurangi metabolisme pil KB menjadi bentuk tak aktifnya, yang
pada gilirannya meningkatkan efek pil KB-nya. Namun karena belum ada data
epidemiologi yang akurat, masih sulit untuk menyimpulkan secara pasti interaksi
obat jamur dengan kontrasepsi oral. Selain dengan cara meningkatkan kerja enzim
pemetabolisme tersebut, antibiotika juga dapat mengurangi efek pil KB dengan cara
membunuh bakteria usus yang dibutuhkan untuk memproses etinil estradiol
menjadi senyawa bebas yang bisa dire-sirkulasi dan dire-absorpsi. Dengan
terbunuhnya bakteri usus yang berguna, yaitu Clostridia, maka proses reabsorpsi
obat akan terhambat, kadar zat aktif dalam tubuh jadi berkurang, yang berarti
mengurangi efek pil KB. Antibiotika seperti penisilin dan tetrasiklin dilaporkan dapat
menyebabkan kegagalan pil KB.Di Selandia baru pada tahun 1987, 23% dari 163
kasus kehamilan yang dilaporkan adalah akibat kegagalan pil KB karena digunakan
bersama dengan antibiotika.Namun sekali lagi, masih terdapat kesulitan metodologi
dalam studi ilmiah tentang interaksi obat ini. Karena penggunaan parameter yang
berbeda, sebagian studi menyatakan tidak ada interaksi yang signifikan antara
obat antimikrobia ini dengan pil KB, sementara studi yang lain menyatakan
sebaliknya.

29

Sebuah penelitian yang dilakukan pada kelinci, seperti dilaporkan oleh sebuah
jurnal

ilmiah Contraception tahun

1997,

menunjukkan

bahwa

antibiotika amoksisilin tidak memiliki efek signifikan terhadap kadar etinil estradiol
dalam darah, yang berarti tidak mempengaruhi efek pil KB. Hasil penelitian yang
serupa juga ditemui pada antibiotika tetrasiklin. Sebuah studi (tahun 1991) pada 7
orang wanita yang menggunakan kontrasepsi oral dan tetrasiklin secara bersama
menunjukkan bahwa tetrasiklin tidak mengurangi secara signifikan kadar etinil
estradiol dalam darah. Penelitian lain yang melibatkan generasi baru antibiotika
yaitu roxithromycin dandirirthromycin juga gagal menunjukkan efek yang siginifikan
pada pemakaian kombinasi dengan pil KB. Namun demikian, karena penelitian
semacam ini pada manusia umumnya hanya melibatkan sejumlah terbatas wanita,
boleh jadi hasilnya tidak bisa menggambarkan hasil yang mungkin terjadi pada
sekelompok wanita yang memiliki respon yang berbeda.

Menurut beberapa studi di atas, kemungkinan kejadian interaksi ini hanya terbatas, terutama
pada wanita yang memiliki aktivitas enzim pemetabolisme dan sirkulasi enterohepatik yang
berlebihan, namun sampai saat ini tidak ada cara untuk mengindentifikasi apakah seorang wanita
termasuk kelompok tersebut atau tidak. Karena itu, untuk menghindari kemungkinan kegagalan
pil KB, adalah lebih bijaksana jika pasien maupun dokter penulis resep berhati-hati terhadap
adanya kombinasi antibiotika/antijamur dengan pil KB. Bagi wanita yang mengkonsumsi
rifampisin dalam jangka panjang, sebaiknya memilih cara kontrasepsi yang lain, misalnya
dengan suntik KB, spiral, kondom, atau lainnya. Wanita yang menggunakan obat jamur
griseofulvin juga perlu waspada terhadap berkurangnya efek pil KB, dan sebaiknya tidak
menggantungkan diri pada cara kontrasepsi ini. Cara lain adalah dengan menghindari kontak
seksual selama 7 hari pertama pemakaian antibiotika dan 7 hari berikutnya. Jadi tegasnya, jika
Anda mendapatkan resep antibiotika, sementara Anda sedang menggunakan pil KB, maka
sampaikan pada dokter Anda dan konsultasikan mengenai kemungkinan interaksi ini. Dan yang
penting, gunakan juga cara kontrasepsi lain untuk mendukung kerja pil KB yang digunakan
selama Anda mengkonsumsi antibiotika/antijamur
2.7 Isi Kontasepsi Hormonal( hormon estrogen dan progesteron).
2.7.1 Pil kombinasi
30

Dalam satu pil terdapat baik estrogen maupun progesteron sintetik.Pil diminum setiap hari
selama tiga minggu diikuti dengan satu minggu tanpa pil atau plasebo. Estrogennya adalah etinil
estradiol atau mestranol dalam dosis 0,05; 0,08 ; 0,1 mg pertablet. Progestinnya bervariasi.
a. Jenis
Monofasik
Pil yang tersedia dalam kemasan 21 tablet mengandung hormon aktif estrogen/progestin
dalam dosis yang sama, dengan 7 tablet tanpa hormon aktif.
Contoh: microgynon
Komposisi :
21 tablet masing-masing mengandung 0.15 mg Levonorgestrel dan 0.03 mg Etinilestradiol serta
7 tablet plasebo.
Dosis dan Cara Pemakaian :
Satu tablet diminum tiap hari selama 28 hari berturut-turut. Kemasan berikutnya dimulai setelah
tablet pada kemasan sebelumnya habis. Tidak menggunakan kontrasepsi hormon sebelumnya
(pada bulan yang lalu). Pemakaian tablet harus dimulai pada hari ke-1 dari siklus alami wanita
(yaitu hari pertama menstruasi) dimulai dari bidang biru dari kemasan dan pilih tablet sesuai
dengan harinya (seperti "Sen" untuk Senin). Mulai pada hari ke 2-5 diperbotehkan, akan tetapi
selama siklus pertama dianjurkan untuk menggunakan metoda pencegahan tambahan selama 7
hari pertama minum tablet.
Pemakaian selanjutnya :
Jika kemasan pertama Microgynon telah habis, mulailah kemasan yang baru tanpa terputus pada
hari berikutnya, sekali lagi pilih tablet pada bidang biru sesuai dengan hari pada saat itu.
Bifasik
Pil yang tersedia dalam kemasan 21 tablet mengandung hormon aktif estrogen/progestin dalam
dua dosuis yang berbeda, dengan 7 tablet tanpa hormon aktif.
31

Contoh: Climen 28
Komposisi :
Terdiri dari 16 tablet putih berisi estradiol valerate 2 mg dan 12 tablet pink berisi estradiol
valerate 2 mg dan cyproterone acetate 1 mg.
Cara pemakaian :
Minumkan tablet putih satu kali sehari selama 16 hari dilanjutkan dengan tablet pink satu kali
sehari hingga habis.
Trifasik
Pil yang tersedia dalam kemasan 21 tablet mengandung hormon aktif estrogen/progestin
dalam 3 dosis yang berbeda, dengan 7 tablet tanpa hormon aktif.
Contoh: TRINORDIOL*-28
Komposisi :
Tiap kemasan Trinordiol*-28 berisi 28 tablet. Tablet-tablet ini disusun dalam kemasan
menurut urutan sebagai berikut: 6 tablet kuning tua dari 0.03 mg etinilestradiol dan 0.05 mg
levonorgestrel, 5 tablet putih dari 0.04 mg etinilestradiol dan 0.075 mg levonorgestrel, 10 tablet
kuning dari 0.03 mg etinilestradiol dan 0.125 mg levonorgestrel, 7 tablet innert merah dari
31.835 mg laktosa.
Dosis dan Cara Pemakaian :
Satu tablet sehari untuk 28 hari berturut-turut dalam urutan yang tepat seperti diuraikan
di atas. Tablet-tablet diminum terus menerus tanpa dihentikan. Segera setelah satu kemasan
habis, mulailah dengan kemasan yang baru dan diminum seperti diuraikan di atas. Dianjurkan
tablet Trinordiol*-28 diminum setiap hari pada waktu yang sama, sebaiknya setelah makan atau
pada waktu mau tidur. Bila pemakai merasa mual, sebaiknya tablet diminum dengan susu.
Siklus pertama :

32

Selama pemakaian siklus pertama, pasien dianjurkan meminum satu tablet setiap hari
selama 28 hari berturut-turut, dimulai dari hari pertama dari siklus haid (hari kesatu datangnya
haid adalah hari pertama). Perdarahan akan terjadi sebelum tablet Trinordiol*-28terakhir
diminum.
Siklus-siklus Berikutnya :
Pemakai hendaknya segera mulai kemasan berikutnya walaupun perdarahan masih
berlangsung. Tiap 28 hari penggunaan Trinordiol*-28 dimulai pada hari yang samaseperti pada
pemakaian pertama kalinya pada bagian foil berwarna merah dan mengikuti jadual yang sama.
Meskipun terjadinya kehamilan sangat kecilbila tablet digunakan sesuai petunjuk bila perdarahan
tidak terjadi setelah tablet terakhir diminum, kemungkinan hamil harus dipertimbangkan. Bila
pasien tidak menuruti cara penggunaan yang tertera (lupa satu atau lebih tablet atau mulai minum
tablet yang terlupa pada hari terlambat daripada seharusnya) kemungkinan hamil harus
dipertimbangkan pada saat tidak terjadi haid dan dilakukan cara-cara dianostik yang tepat
sebelum pengobatan dilanjutkan.Bila pasien telah mengikuti petunjuk pengobatan dan telah
minum tablet dua siklus berturut-turut tidak terjadi haid, tidak terjadinya kehamilan harus benarbenar dipastikan oleh dokter atau petugas kesehatan yang ditunjuk sebelum penggunaan tablet
kontrasepsinya dilanjutkan.
Tablet-tablet yang Terlupa Diminum :
Pemakai harus diinstruksikan untuk meminum tablet yang terlupa secepatnya setelah
teringat. Bila dua tablet berturut-turut terlupakan, keduanya harus diminum setelah teringat.
Tablet berikutnya harus diminum pada waktu yang sama. Tiap saat pasien terlupakan satu atau
dua tablet , ia harus juga mnggunakan cara kontraseptiva tambahan non steroidal (misalnya cara
mekanis) sampai ia telah meminum satu tablet tiap hari untuk 7 hari berturut-turut. Bila tiga
tablet berturut-turut selain tablet berwarna merah terlupakan, semua pengobatan harus dihentikan
dan sisa obat harus dibuang. Siklus tablet yang baru harus dimulai pada hari kedelapan setelah
tablet terakhir diminum dan suatu kontraseptiva tambahan non steroidal (misalnya cara mekanis)
sampai ia telah meminum satu tablet tiap hari untuk 14 hari berturut-turut.
b. Cara kerja

33

Secara umum pil kombinasi berkerja dengan cara menekan ovulasi, mencegah
implantasi, mengentalkan lendir serviks sehingga sulit dilalui sperma, dan Pergerakan
tuba terganggu sehingga transportasi ovum akan tergenggu.
c. Manfaat
Memiliki efektifitas yang tinggi (hampir menyerupai efektivitas tubektomi), bila
digunakan setiap hari (1 kehamilan per 1000 perempuan dalam tahun pertama
penggunaan).
Risiko terhadap kesehatan sangat kecil.
Tidak mengganggu hubungan seksual.
Siklus haid menjadi teratur, banyaknya darah haid berkurang (mencegah anemia),
tidak terjadi nyeri haid.
Dapat digunakan jangka panjang, selama perempuan masih ingin menggunakannya.
Dapat digunakan sejak usia remaja hingga menopause.
Mudah dihentikan setiap saat.
Kesuburan segera kembali setelah pengunaan pil dihentikan.
Membantu mencegah kehamilan ektopik, kanker ovarium, kanker endometrium, kista
ovarium, penyakit radang panggul, kelainan jinak pada payudara, dismenore, akne.
d. Keterbatasan
Mahal dan membosankan karena harus menggunakannya tiap hari.
Mual terutama pada 3 bulan pertama.
Perdarahan bercak atau perdarahan sela terutama 3 bulan pertama.
Pusing dan nyeri payudara.

34

Berat badan naik sedikit tetapi pada perempuan tertentu kenaikan berat badan justru
memilki dampak positif.
Tidak boleh diberikan pada perempuan menyusui (mengurangi ASI).
Pada sebagian kecil perempuan dapat menimbulkan depresi dan perubahan suasana
hati sehingga keinginan untuk melakukan hubungan seksual berkurang.
Dapat meningkatkan tekanan darah dan terensi cairan, sehingga risiko stroke dan
gangguan pembekuan darah pada vena dalam sedikit meningkat. Pada perempuan
usia>35 tahun dan merokok perlu hati-hati.
e.

Yang dapat menggunakan Pil kombinasi


Pada prinsipnya hampir semua ibu boleh menggunakan pil kombinasi, seperti:

Usia reproduksi.

Telah memiliki anak ataupu yang belum.

Gemuk atau kurus.

Setelah melahirkan dan tidak menyusui.

Pasca keguguran.

Anemia karena haid berlebihan.

Nyeri haid hebat.

Siklus haid tidak teratur.

Riowayat kehamilan ektopik.

Kelainan payudara jinak.

DM tanpa komplikasi pada ginjal, pembuluh darah, mata dan saraf.

Penyakit tiroid, radang panggual, endometriosis atau tumor ovarium jinak.

35

f.

Menderita TB kecuali yang sedang menggunakan rifampisin.

Varises vena.

Yang tidak boleh menggunakan Pil kombinasi:

Hamil atau dicurigai hamil.

Menyusui eksklusif.

Perdarahan pervaginam yang belum diketahui penyebabnya.

Penyakit hati akut.

Perokok dengan usia>35 th.

Riwayat penyakit jantung, stroke, hipertensi > 180/110 mmHg.

Riwayat gangguan faktor pembekuan darah atau DM > 20th.

Kanker payudara atau yang dicurigai kanker payudara.

Migrain dan gejala neurologis fokal (epilepsi/ riwayat epilepsi).

Tidak dapat menggunakan pil secara teratur setiap hari.

g. Waktu mulai menggunakan pil kombinasi


Setiap saat selagi haid, untuk meyakinkan kalau perempuan tersebut tidak hamil.
Hari pertama sampai hari ke-7 siklus haid.
Boleh menggunakan pada hari ke-8 haid, tetapi perlu menggunakan metode
kontrasepsi yang lain (kondom) mulai hari 8 sampai hari 14 atau tidak melakukan
hubungan seksual sampai telah menghabiskan paket pil tersebut.
Setelah melahirkan: 6 bulan pemberian ASI eksklusif; setelah 3 bulan dan tidak
menyusui; pascakeguguran segera atau dalam waktu 7 hari).
36

2.8 Suntikan kombinasi


Jenis suntikan kombinasi adalah 25 mg Depo medroksiprogesteron asetat dan 5 mg Estradiol
Sipionat yang diberikan injeksi IM sebulan sekali, dan 50 mg Noretindron Enantat dan 5 mg
Estradiol Valerat yang diberikan injeksi IM. Sangat efektif 0,1-0,4 kehamilan per 100 perempuan
selama tahun pertama penggunaan.
a. Cara kerja
Secara umum menekan ovulasi, mengentalkan lendir serviks, atrofi endometrium, dan
Menghambat transportasi ovum lewat tuba.

2.9 Kontrasepsi pil progestin (minipil)


a. Jenis minipil
Kemasan dengan isi 35 pil: 300ug levonorgestrel atau 350ug noretindron.
Kemasan dengan isi 28 pil: 75ug dosegestrel.
b. Cara kerja minipil
Menekan sekresi gonadotropin dan sintesis steroid seks di ovarium (tidak begitu kuat).
Endometrium mengalami transformasi lebih awal sehingga implantasi lebih sulit.
Mengentalkan lendir serviks.
Mengubah motilitas tuba sehingga transportasi ovum terganggu.
c. Efektivitas
Sangat efektif (98,5%). Pada penggunaan minipil jangan sampai terlupa satu-dua tablet
karena akibatnya kemungkinan terjadi kehamilan sangat besar. Penggunaan obat-obat
mukolitik asetilsistein bersamaan dengan minipil perlu dihindari karena dapat
meningkatkan penetrasi sperma. Dalam menggunakan minipil sebaiknya jangan sampai

37

ada tablet yang lupa, tablet digunakan pada jam yang sama, senggama sebaiknya
dilakukan 3-20 jam setelah penggunaan minipil.
d. Keuntungan
Cocok untuk perempuan menyusui.
Sangat efektif jika digunakan secara benar.
Tidak mempengaruhi produksi ASI.
Nyaman dan mudah digunakan.
Kesuburan cepat kembali.
Sedikit efek samping.
Tidak mengandung estrogen
Dapat dipakai sebagai senggama.
Mengurangi nyeri haid dan jumlah darah haid.
Mencegah kanker endometrium.
Sedikit sekali mengganggu metabolisme karbohidrat sehingga relatif aman diberikan
pada perempuan DM yang belum mengalami komplikasi.
e. Keterbatasan
Hampir 30-60% mengalami gangguan haid.
Peningkatan/penurunan berat badan.
Harus digunakan setiap hari dan pada waktu yang sama.
Bila lupa satu pil saja maka kegagalan menjadi lebih besar.
Payudara menjadi tegang, mual, pusing, dermatitis atau jerawat.

38

Efektivitasnya menjadi lebih rendah bila digunakan bersamaan dengan obat OAT
(rifampisin) dan obat epilepsi (fenitoin, barbiturat).
f. Kontraindikasi
Hamil/diduga hamil
Perdarahan pervaginam yang belum tahu penyebabnya.
Kanker payudara.
Mioma uteri.
Riwayat stroke, PJK.
2.10 Kontrasepsi implan
a. Jenis

Norplant. Terdiri dari 6 batang silastik lembut berongga dengan panjang 3,4 cm,
diameter 3,4 mm, yang diisi dengan 36 mg Levonorgestrel dan lama kerjanya 5
tahun.

Implanon. Terdiri dari satu batang putih lentur dengan panjang kira-kira 4 mm, dan
diameter 2 mm yang diisi dengan 68 mg 3-keto-dosegestrel dan lamam kerjanya 3
tahun.

Jadena dan Indoplan. Terdiri dari 2 batang yang diisi dengan 75 mg Levonorgestrel
dengan lamam kerja 3 tahun.

b. Cara kerja
Secara umum bekerja dengan menekan ovulasi, Mengentalkan lendir serviks, Atrofi
endometrium, dan menghambat transportasi ovum lewat tuba. Efektivitas sangat efektif
0,2-1 kehamilan per 100 perempuan.
2.11 AKDR dengan progestin
Jenis AKDR yang mengandung levonogestrel.
39

a. Kontraindikasi absolut
Kondisi dengan kecenderungan infeksi termasuk leukemia, AIDS, penyalahgunaan obat,
penggunaan steroid.
Penyakit katup jantung (KI relatif).
Belum pernah melahirrkan (KI relatif).
Penyakit Wilson.
Alergi terhadap tembaga.
b. Keuntungan
Kecepatan pelepasan hormon konstan selamam 5 tahun.
Mungkin merupakan metode kontrasepsi revesibel yang paling efektif untuk periode 5
tahun.
Mengurangi dismenore dan menoragia.
2.12 Perbandingan antara obat kontrasepsi oral dan contohnya
1. Dosegestrel/Etinil estradiol.2,13
Rumus kimia: C23H27N
a. Indikasi
Dosegestrel/etinil estradiol digunakan untuk mencegah kehamilan.
b. Interaksi
Golongan azole antifungal (itraconazole), barbiturat, carbamazepine, felbarmate,
griseofulvin, ritonavir, hidantoin, nevirapine, penisilin, rifampisin, topiramate, dan
troglitazone menurunkan efektivitas dosegestrel/etinil estradiol.
Efek samping dari obat beta bloker atenolol, selegiline, teofilin, dan troleandomisin
ditingkatkan oleh dosegestrel/etinil estradiol.
40

Efektivitas lamotrigin diturunkan oleh dosegestrel/etinil estradiol.


c. Sediaan beredar
Gracial (Organon), Marvelon (Organon), Mercilon (Organon)
d. Perhatian
Resiko kehamilan jika terlupa minum pil, terutama awal siklus. Harus dilakukan
pemeriksaan darah tinggi, perabaan hati, gula darah, kadar lemak.
e. Efek samping
Mual, mastalgia, perdarahan antar haid, sakit kepala ringan, jerawat.
f. Absorbsi
Pemberian secara oral diabsorbsi dengan cepat dan lengkap dan diubah menjadi
etonogestrel. Konsentrasi plasma puncak mencapai 2 ng/ml setelah 1,5 jam setelah
minum. Bioavailabilitas 62-81%.
g. Distribusi
Etonogestrel terikat pada albumin serum dan sex hormone binding globulin(SHBG).
Hanya 2-4% dari total konsentrasi serum berada dalam bentuk steroid bebas, 40-70%
berikatan dengan SHBG. Etinil estradiol sendiri menginduksi peningkatan ikatan
desogestrel dengan SHBG dan menurunkan ikatan desogestrel dengan albumin.Volume
distribusi desogestrel adalah 1,5l/kg.
h. Metabolisme
Etonogestrel dimetabolisme seperti halnya metabolismesteroid lainnya.Laju klirens
metabolik adalah 2 ml/menit/kg.Eliminasi Desogestrel dan metabolitnya diekskresikan
melalui urindan empedu dalam perbandingan 6:4.
2. Mestranol/noretindrone.3,13
Nama generik: Mestranol/Norethindrone (MES-tra-nole/nor-eth-IN-drone)
41

Nama dagang: Norinyl 1 + 50 dan Ortho-Novum 1/50


a. Indikasi
Mencegah kehamilan.
Mengatur siklus menstruasi.
b. Kontraindikasi
Alergi
Sedang hamil atau tersangka hamil.
Perdarahan pervaginam yang belum diketahui sebabnya.
Kanker payudara, serviks ataupu uterus.
Stroke, PJK, trombosis vena.
Tumor hati.
c. Interaksi Obat
Acitretin, aprepitant, azole antifungal seperti ketoconazole, barbiturates seperti
fenobarbital), bosentan, karbamazepine, felbamate, griseofulvin, hydantoins seperti
fenitoin, modafinil, nevirapine, penicillins seperti amoxicillin, protease inhibitor
seperti indinavir, rifamycins seperti rifampin, St. John's wort, tetrasiklin seperti
doksisiklin,

topiramate,

atau

troglitazone

menurunkan

efektivitas

mestranol/norethindron.
Beta bloker seperti metoprolol, cyclosporine, theophyllines, atau troleandomycin
dengan mestranol/ norethindron efek sampingnya ditingkatkan.
Kortikosteroid seperti prednisone, efek sampingnya seperti wajah bulan, peningkatan
berat badan, retensi cairan, peningkatan tekanan darah, peningkatan gula darah,
ditingkatkan oleh mestranol/ norethindron.

42

Antikoagulan oral (warfarin) efek sampingnya yaitu perdarahan ditingkatkan oleh


mestranol/noretindron.
Efektivitas dari Lamotrigine diturunkan oleh mestranol/norethindron.
3. Depomedroksiprogesteron asetat.4,13
Nama generik: Medroksiprogesteron asetat.
Nama dagang: Depo-Provera
Merupakan kontrasepsi injeksi yang diberikan tiap 3 bulan sekali. Kontrasepsi ini kurang
ideal pada pasien yang menghendaki cepat hamil setelah menghentikan kontrasepsi ini.
Dari studi didapatkan bahwa hanya 68% saja wanita yang hamil dalam 12 bulan setelah
penghentian konrasepsi ini.Lamanya jangka waktu penggunaan kontrasepsi ini tidak
mempengaruhi lamanya penundaan kehamilan setelah menghentikan.
a. Indikasi
Kontrasepsi oral.
b. Kontraindikasi
Perdarahan di vagina atau kelainan patologis yang tidak diketahui penyebabnya,
dan kehamilan.
c. Efek Samping
Reaksi anafilaktik, tromboembolik, tromboflebitis, emboli paru, payudara lembek
dan galaktore, erosi, dan perubahan sekresi pada leher rahim, hipereksia yang
tidak diketahui penyebabnya, wajah bulan, perubahan berat badan, perubahan
warna kulit ditempat suntikan.
d. Sediaan
Cyclofem (Tunggal Idaman Abdi), Cyclogeston (Triyasa), Depogeston (triyasa),
43

Deponeo (triyasa), Depo-Progestin (Harsen).


4. Linestrenol.5,13
a. Indikasi
Kontrasepsi Oral
b. Kontraindikasi
Kehamilan, penyakit hati parah, ikterus, sindrom rotor, dan Dubbin Johnson, dan
wanita muda dengan siklus belum teratur.
c. Efek Samping
Mual, muntah, sakit kepala, nyeri payudara. Jika timbul perdarahanringan pada
bulan-bulan awal dapat dilanjutkan tapi jika parah hentikan.
d. Perhatian
Lakukanpemeriksaan fisik terautue 3 atau 6 bulan sekali. Hentikan jika timbul
gejal tromboembolik, hati-hati pada penyakit miokard, ginjal, epilepsi, atau
migran.
e. Interaksi obat
Jangan diberikan bersamaan rimfapisin, barbiturat, obat antiepilepsi tertentu.
f. Sediaan beredar
Exluton (Organon), Lyndiol (Organon), Ovostat (Organon).
5. Levonorgestrel.6,13
a. Indikasi
Kontrasepsi hormonal jangka panjang 3 tahun untuk wanita

44

b. Kontraindikasi
Perdarahan vagina dengan penyebab yang tidak jelas, kanker yang berkaitan
dengan hormonal, perdarahan uterus dengan sebab tidak jelas, gangguan
tromboemboli atautrombofleblitis.
c. Efek Samping
Menstruasi, spotting, menorrahgi, metroragi, amenorea, sakit kepala, gugup,
mual, pusing, perubahan selera makan, perubahan libido, hirsutisme, gatal-gatal,
rasa nyeri pada tempat pemasangan, anemia dan tekanan darah tinggi.
6. Etonogestrel.7,13
a. Indikasi
Kontrasepsi jangka panjnag yang reversibel
b. Kontraindikasi
Kehamilan, perdarahan vagina yang tidak terdiagnosis, hipersensitivitas.
c. Perhatiaan
Keuntungan penggunaan progesteron harus ditimbang dengan kemungkinan
resiko untuk setiap kasus individual dan dibahas dengan wanita calon akseptor
sebelum menggunakan implamt.
d. Sediaan beredar
Implanon (Organon)
7. Gestoden.8,13
a. Indikasi

45

Kontrasepsi oral
b. Kontraindikasi
Tromboemboli vena dan arteri, diabetes dengan perubahn vaskular, prankreatitis
atau hipertrigleresemia, penyakit hati, gagal ginjal akut.
c. Sediaan beredar
Gynera (Schering)
8. Drospirenon.9,13
Memiliki efek antimineral kortikoid dengan megabit sistem RAAS dan sebagai anti
antiandrogenik yang bermanfaat untuk wanita yang mengalami retensi cairan karena
hormon dan wanita yang menderita akne dan seborea.Bioviabilitas sekitar 76 % dan tidak
diikat oleh sex hormon maupun oleh kortikosteroid.Akan tetapi diikat oleh protein
serum.Pada sebagian orang dapat menyebabkan hiperkalemia jika dikombinasi oleh
sprinalaktone.
a. Indikasi
Kontrasepsi oral
b. Kontraindikasi
Tromboemboli vena dan arteri, pankreatitis atau hipertrigliseridemia, penyakit
hati, gagal ginjal akut, tumor hati (jinak atau ganas), keganasan alat genital ayau
payudara, perdarahan pervaginam yang tidak terdiagnostik, kehamilan, dan
hipersensitif.
c. Sediaan Obat
Yasmin (Schering)
9. Cyproterone Acetat.10,13
46

Nama generi

(3'H-Cyclopropa(1,2)pregna-1,4,6-triene

3,20-dione,6-chloro-1-

beta,2- beta-dihydro-17-hydroxy-).
Nama dagang

: Diane 35 (Schering)

Cyproterone acetate merupakan derivat dari 17-hydroxyprogesterone Memiliki efek


antiandrogenik dengan

efek lemah terhadap progestational dan glucocorticoid.

Cyproterone acetate dimetabolisme oleh enzim CYP3A4 menjadi bentuk aktif 15hydroxycyproterone acetate, Sebagian akan dihidrolisis menjadi cyproterone and acetic
acid. Akan tetapi seperti halnya horman steroid esterase lainnya, cyproterone acetate sulit
untuk dihidrolisis.Sehingga banyak dalam bentuk cyproterone acetate. Hal inilah yang
menyebabkan cyproterone acetate memiliki efek antiandrogenik yang kuat. Cyproterone
acetate mengahambat steroidogenic enzyme 21-hydroxylase dan 3beta-hydroxysteroid
dehydrogenase. Dimana kedua enzim terse but iguana untuk membentuk cortisol.
Hambatan terhadap 21-hydroxylase juga mongering produksi dari aldosterone. Efek
terhadap progestational dan glucocorticoid mongering hormon gonadotropins, yang
menyebabkan turunya kadar testosterone sehingga baik sebagai pengobatan antiandrogen.
Selain

itu

cyproterone

acetate

dikombinasikan

dengan

5-alpha-reductase

inhibitorfinasteride dapat mengatasi keluahan hirsutisme. Beberapa studi invitro juga


menunjukkan bahwa

cyproterone atau cyproterone acetate dapat mengobati benign

prostat hyperplasia.
a. Indikasi
Diindikasikan untuk ca prostat, benign prostat hyperplasia, hirsustisme, terapi
hormon maupun kontrasepsi oral.
b. Kontraindikasi
Wanita hamil, Tromboemboli vena dan arteri, pankreatitis akut, penyakit hati,
gagal ginjal akut, tumor hati (jinak atau ganas), keganasan alat genital atau
payudara, perdarahan pervaginam yang tidak terdiagnostik, dan hipersensitif.

47

c. Efek Sampingz
Merusak Hati, Hiperkalemi, Trombosis vena dalam, perubahan mood, dapat
menyebabkan osteoporosis.
d. Dosis
Untuk kontrasepsi 2mg cyproterone acetate dikombinasi dengan 35 atau 50 mcg
ethinylestradiol. Diminum selama 21 hari dan diintervalkan selama 7 hari.
10. Marvelon.11,13
Marvelon merupakan obat kontrasepsi hormonal yang merupakan kombinasi dari 2 zat
aktif yaitu etinilestradiol dan desogestrel.Etinilestradiol merupahan hormon sintetik dari
estrogen wanita dan desogestrel merupakan generasi ketiga hormon sintetik dari
progesteron. Sediaan dalam bentuk tablet
a. Komposisi
Merupakan kontrasepsi oral monofasik. Dua puluh satu tablet besar warna putih
mengandung 0,15 mg desogestrel dan 0,03 mg etinilestradiol. Tujuh tablet putih yang
tidak mengandung zat aktif. Yang mengandung silicon dioksida, laktosaa, magnesium
stearat, tepung kentang, povidone, asam stearat, alfa tokoferol.
b. Indikasi
Kontrasepsi oral.
c. Kontraindikasi
Trombosis atau riwayat trombosis vena dalam, emboli paru, infark miokard dan
stroke, angina pektoris.
Terdapat faktor yang meningkatkan kejadian trombosis seperti hipertensi.
Gangguan fungsi hati yang lama dan ireversibel.

48

Tumor hati.
Perdarahan pervaginam yang belum jelas sebabnya.
Diketahui atau dicurigai hamil.
DM dengan komplikasi vaskular.
Hipersensitif terhadap komponen.

11. Etinil estradiol.12,13


a. Absorbsi
Pemberian secara oral diabsorbsi dengan cepat dan lengkap.Konsentrasi plasma puncak
dicapai 80 pg/ml dalam 1-2 jam setelah pemberian.Biaoavailabilitas setelah mengalami
konjugasi presistemik dan metabolisme pintas pertama adalah 60%.
b. Distribusi
Etinil estradiol berikatan dengan albumin hampir 98,5% dan menginduksi peningkatan
kadar SHBG serum. Volume distribusi adalah 5L/kg.

c. Metabolisme
Etinil estradiol mengalami konjugasi presistemik oleh mukosa usus dan hati.
Metabolitnya akan dikonjugasi dengan glukoronida dan sulfat. Laju klirens metabolik adalah 5
ml/menit/kg.Eliminasi Metabolitnya diekskresikan lewat urin dan empedu dengan rasio
4:6.Waktu paruh ekskresi metabolitnya adalah 1 hari.
d. Cara pemberian
Tablet diminum setiap hari satu tablet sehari jika pengguna lupa minum tablet dalam
waktu kurang dari 12 jam, efektivitasnya tidak berkurang. Tablet yang terlupa harus segera
diminum dan tablet yang akan diminum berikutnya, diminum sesuai dengan waktu biasanya. Jika
49

pengguna lupa minum sampai lebih dari 12 jam maka efektivitas proteksinya berkurang. Hal ini
berlaku juga untuk pil KB yang emnggunakan pil 21 tablet.
2.13 Jenis KB Suntik
Suntikan KB merupakan salah satu metode pencegahan kehamilan yang paling banyak
digunakan di Indonesia.Secara umum, Suntikan KB bekerja untuk mengentalkan lendir rahim
sehingga sulit untuk ditembus oleh sperma. Selain itu, Suntikan KB juga membantu mencegah
sel telur menempel di dinding rahim sehingga kehamilan dapat dihindari
Suntikan KB ada 2 jenis, yaitu:
1. Suntikan

KB

Bulan.

Suntikan

KB

ini

mengandung

hormon

Depo

Medroxyprogesterone Acetate (hormon progestin) 150 mg. Sesuai dengan namanya,


suntikan ini diberikan setiap 3 bulan (12 Minggu). Suntikan pertama biasanya diberikan 7
hari pertama periode menstruasi Anda, atau 6 minggu setelah melahirkan. Suntikan KB 3
Bulanan ada yang dikemas dalam cairan 3ml atau 1ml
2. Suntikan

KB

Bulan. Suntikan

KB

ini

mengandung

kombinasi

hormon

Medroxyprogesterone Acetate (hormon progestin) dan Estradiol Cypionate (hormon


estrogen). Komposisi hormon dan cara kerja Suntikan KB 1 Bulan mirip dengan Pil KB
Kombinasi. Suntikan pertama diberikan 7 hari pertama periode menstruasi Anda, atau 6
minggu setelah melahirkan bila Anda tidak menyusui.
BAB III
PEMBAHASAN

kontrasepsi yang bertujuan untuk mencegah terjadinya kehamilan dimana bahan bakunya
mengandung preparat esterogen dan progesteron, hormon-hormon ini bekerja sebagai
penghambat,pengeluaranfolicelstimulating

hormon

proses konsepsi terhambat

50

dan luiteinizing

hormon

sehingga

Berdasarkan waktunya, kita bisa membedakan menjadi kontrasepsi hormonal jangka


pendek dan jangka panjang. Kontrasepsi hormonal jangka pendek dapat berupa pil kontrasepsi
yang harus diminum setiap hari. Disebut sebagai jangka pendek karena memang kerja dari pil
yang sudah dikonsumsi tersebut hanya terjadi dalam waktu singkat.Seorang wanita harus setiap
hari secara disiplin mengkonsumsi pil tersebut. Jika terlewat, resiko terjadi kehamilan setelah
berhubungan seksual akan besar. Sementara itu, kontrasepsi hormonal jangka panjang dapat
berupa injeksi atau suntik KB serta implan.Kontrasepsi dengan injeksi dapat berlaku selama 1
bulan atau 3 bulan tergantung dari regimen yang diberikan.Mungkin memang lebih tepat jika
disebut sebagai jangka menengah daripada jangka panjang.Sementara untuk implan, masa
kerjanya dapat bervariasi dari 3 tahun hingga 5 tahun.Penggunaan metode kontrasepsi hormonal
sering digunakan dan cukup disukai karena tidak menimbulkan gangguan dalam berhubungan
seksual.
Hormon yang berperan penting dalam pengaturan pembuahan serta fungsi rahim maupun
lendir leher rahim adalah estrogen dan progesteron. Karena itulah, tidak heran jika metode
kontrasepsi hormonal yang digunakan melibatkan intervensi pada kedua hormon tersebut.Secara
garis besar, terdapat kontrasepsi yang berupa pemberian progesteron saja serta yang berupa
pemberian kombinasi antara progesteron dan estrogen.
Bagi wanita yang mengkonsumsi rifampisin dalam jangka panjang, sebaiknya
memilih cara kontrasepsi yang lain, misalnya dengan suntik KB, spiral, kondom,
atau lainnya. Wanita yang menggunakan obat jamur griseofulvin juga perlu
waspada terhadap berkurangnya efek pil KB, dan sebaiknya tidak menggantungkan
diri pada cara kontrasepsi ini. Cara lain adalah dengan menghindari kontak seksual
selama 7 hari pertama pemakaian antibiotika dan 7 hari berikutnya. Rifampisin,
suatu antibiotika yang digunakan untuk mengobati TBC, adalah yang pertama kali
dilaporkan menyebabkan berkurangnya efek pil KB pada sekitar tahun 1971 di
Jerman.Di antara 88 wanita yang menggunakan pil KB dan Rifampisin, 62 orang
diantaranya dilaporkan mengalami gangguan menstruasi dan 5 orang gagal berKB
atau hamil. Rifampisin adalah induser yang poten terhadap enzym sitokrom P450,
sehingga meningkatkan proses metabolisme etinil estradiol menjadi senyawa tak
aktif, yang pada gilirannya menyebabkan berkurangnya konsentrasi pil KB tersebut
dalam tubuh dan menyebabkan efeknya jadi berkurang.
51

BAB IV
PENUTUP

4.1 Kesimpulan
1. Kontrasepsi adalah menghindari /mencegah terjadinya kehamilan sebagai akibat
pertemuan sel telur yang matang dengan sel sperma tersebut.
52

2. Rifampisin dapat menurunkan efektivitas pil kontrasepsi (KB)

4.2 Saran
Dua Anak Cukup (BKKBN)

DAFTAR PUSTAKA

BKKBN : (2006). Buku Panduan Praktis Pelayanan Kontrasepsi. Jakarta


Biro Pelayanan Kontrasepsi BKKBN (1985). Petunjuk Pelayanan Medis Pelayanan Kontrasepsi
di Lapangan, Jakarta.
Sastrawinata RS (1985).Teknologi KB Masa Kini dan Masa Depan. Lokakarya Sukabumi.

53

Manuaba, I. B. (2002). Ilmu Kebidanan, Penyakit Kandungan dan Keluarga


Berencana Untuk Pendidikan Bidan, Jakarta : EGC

Saifuddin, B. A., et al. (2004). Buku Panduan Pelayanan Kontrasepsi, Jakarta :


Yayasan Bina Pustaka Sarwono Prawiroharjo.

Speroff, L., Darney, P. (2003). Pedoman Klinis Kontrasepsi, Edisi 2, Jakarta: EGC
Syarief, S. (2008). kontrasepsi hormonal http//www.mucrojiahmad.com

Cunningham, F. G., et al. (2005). Obstetri Williams, Edisi 21, Jakarta : EGC

Hartanto. (2006). Ragam Metode Kontrasepsi, Jakarta : EGC

Glasier, A., Gebbie, A. (2005). Keluarga Berencana dan Kesehatan Reproduksi, Jakarta: EGC

Barbara G. Wells , Dipiro T.Joseph.2015. Pharmacoteraphy Handbook nine edition. US.Mc


Graw Hill Education

54