Anda di halaman 1dari 30

KEMENTERIAN PENDIDIKAN DAN KEBUDAYAAN

DIREKTORAT JENDERAL PENDIDIKAN MENENGAH


DIREKTORAT PEMBINAAN SMA

TEST TINGKAT KABUPATEN/KOTA


SELEKSI CALON PESERTA
INTERNATIONAL BIOLOGY OLYMPIAD (IBO)
TAHUN 2013
PETUNJUK:
1.
Setiap soal memiliki bobot nilai 1.
2.
Isilah nama, asal sekolah dan nomor peserta anda pada setiap
halaman serta pada lembar jawaban.
3.
Gunakan ballpoint/pulpen untuk mengisi jawaban yang tepat
pada lembar yang telah disediakan dengan cara mencantumkan
hurufnya saja.
4.
Tidak ada sistem minus.
5.
Waktu Test = 120 menit.

TIM OLIMPIADE BIOLOGI INDONESIA


2012

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
BIOLOGISELMOLEKULER,MIKROBIOLOGI,&BIOTEKNOLOGI
1. Retikulum endoplasma merupakan salah satu organel utama yang terdapat pada sel
eukaryotik.Organeliniterdiridariduakelompokstrukturalutamayangberperandalam
berbagaifungsifisiologissel.ManakahdiantaraketerangandibawahiniyangBUKAN
merupakanfungsidariretikulumendoplasma?
A. Sintesisproteinnukleus
B. Sintesisfosfolipidmitokondria
C. Detoksifikasiobat
D. Penyimpanankalsium
E. Metabolismekarbohidrat
2. Agenpenginfeksimanakahdibawahiniyangstrukturfungsionalnyahanyaterdiridari
molekulRNA?
A. Virion
B. Mycoplasma
C. Prion
D. Viroid
E. Liposom
3. Manakah di antara molekul di bawah ini yang TIDAK termasuk kelompok molekul
penyusunmatriksekstraseluler?
A. Keratin
B. Lignin
C. Selulosa
D. Kolagen
E. Laminin
4. Anda mengisolasi plasmid dari bakteri E.coli, dan memperoleh 4 tipe plasmid yang
berbedasecarakonformasiataustruktur,akantetapimemilikimemilikijumlahpasang
basayangsamauntukmasingmasingunitnya.

II

IV

III

Manakahdiantaramolekuldiatasyangakanbermigrasipalingcepatketikadilakukan
proseselektroforesispadamatriksagarose?

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
II

III

Sumurtempat
memasukkan
sampel

I
V

Arahmigrasi
__

Diagramkhayal
matrikagarose

A.
B.
C.
D.
E.

I
II
III
IV
Keempatmolekulbermigrasidengankecepatanyangsama

5. Geri melakukan suatu percobaan untuk melihat kemampuan bakteri Bacillus sp.
menghasilkan senyawa antimikroba. Bakteri Bacillus sp. diinokulasikan secara streak
padasuatumediumpertumbuhan,membentukgarisvertikalpadacawanpetri.Setelahitu
diinokulasikanbakterilainsecarahorizontaldisebelahgarisstreakvertikalnamuntidak
tumpangtindih.Kulturtersebutdiinkubasipadasuhu37oCselama2hari.Ilustrasidan
hasilpercobaanditampilkanpadagambardibawahini.
Keterangan:1= Pseudomonasaeruginosa,2= Streptococcus sp.,3= Listeria sp.,4=
Eschericiacoli,Bt=Bacillussp.
1

Bt
o

37 C,2hari

Bt
2

4
2

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................

Berdasarkan hasil percobaan di atas spektrum target senyawa anti mikroba yang
dihasilkanbakteriBacillussp.tersebutadalah...
A. Grampositif
B. Gramnegatif
C. Aktinobakter
D. Grampositifdangramnegatif
E. Bakteritahanasam
6. Gunarta melakukan percobaan klasik untuk melihat pengaruh penambahan substansi
asingdalammenginduksisistemimuninangmenghasilkanantibodi.Percobaandibagi
menjadi tiga tipe (AC). Pada percobaan A, protein hasil purifikasi dari bakteri X
diinjeksikan ke tikus. Percobaan B, protein hasil purifikasi dari bakteri X + isolat
membran/dinding sel bakteri X diinjeksikan ke tikus. Sedangkan pada percobaan C,
hanya isolat membran/dinding sel bakteri X yang diinjeksikan ke sel tikus. Setelah
inkubasiselamasatuminggu,dilakukanpengujiankehadiranantibodipadasampeldarah
tikus,yangdapatmengenaliproteinhasilpurifikasidaribakteriX.Manakahdiantaratipe
percobaandiatasyangpalingtinggiaktivitasproduksiantibodiuntukproteinX?
A. PercobaanA
B. PercobaanB
C. PercobaanC
D. PercobaanAdanPercobaanC
E. PercobaanBdanC
7. Manakah di antara pernyataan di bawah ini yang BUKAN merupakan sifat reaksi
spontan/eksorgenik?
A. Meningkatkanentropi
B. Tidakmemerlukanenergiaktivasi
C. Dapatdipercepatdenganpenambahankatalis
D. Menurunkanenergibebas(G)molekul
E. Melepaskanpanaskelingkungan
8. OrganismeyangdapatmenggunakanCO2sebagaisumberkarbonnyatermasukkedalam
kelompokorganisme
A. Auxotrof
B. Heterotrof
C. Prototrof
D. Autotrof
E. Chemotrof

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
9. DibawahinimerupakandiagramkompleksDNAoperonlac.

Pernyataanmanakahdibawahiniyangbenartentangaktivitasoperonlacketikabagian
operatordarioperontersebutdihilangkan?
A. RNApolymerasetidakdapatmenempelpadakomplekDNAoperonlac
B. Ekspresi gen Galaktosidase tetap tinggi meskipun medium pertumbuhan bakteri
hanyadisuplementasikandengansumberkarbonglukosa
C. ProteinrepressormenempelpadabagianlacP
D. Gen Galaktosidase diekspresi secara konstitutif ketika bakteri ditumbuhkan di
mediumpertumbuhantanpakehadiranglukosa
E. Bakteritidakdapatmentransportlaktosakedalamselkarenaproteinpermeasetidak
dihasilkan
10. DibawahiniditampilkankurvapertumbuhandarikulturbakteriBacillustobi.

Manakah pernyataan di bawah ini yang benar tentang karakteristik kultur sel bakteri
tersebut?
A. Kulturselsinkron
B. Mediumpertumbuhanterdiridariduasumberkarbonberbeda
C. Kulturseltidaksinkron
D. Kulturselditumbuhkandalamkehadiranagenbakteriostatik
E. Kulturselberadadalamfasepertumbuhantua(senescentgrowth)
SoalNo11s.d.13berdasarkanketeranganberikut:
Dibawahiniditampilkandiagramsiklusseldariragi, Schizosaccharomycessp beserta
lamawaktumasingmasingfasenya

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................

11. SelpadafasemanakahyangpalingbanyakAndatemukanpadasuatukulturasinkrondari
ragiSchizosaccharomycessp
A. G1
B. S
C. G2
D. M
E. Jumlahselpadamasingmasingfasesamabanyaknya
12. Jikajumlahselawalkulturasinkronragi Schizosaccharomyces sp adalah106,berapa
lamawaktuyangdiperlukanagarjumlahseltersebutmeningkatmenjadi3x106?
A. 2jam
B. 9jam
C. 14jam
D. 23jam
E. 46jam
13. BerdasarkanketerangansoalNo12,berapajumlahselyangberadapadafaseMpada
waktuawalinkubasi?
A. 3x105
B. 8.7x104
C. 3x106
D. 2.2x105
E. 4x105
14. BagianselberikutiniyangTIDAKmengandungribosomfungsionaladalah...
A. Mitokondria
B. Kloroplas
C. Retikulumendoplasma
D. Nukleus
E. Sitoplasma
15. Bagian dari mitokondria yang memiliki pH relatif rendah dibanding bagian sel pada
umumnyaadalah...
5

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
A.
B.
C.
D.
E.

Krista
Ruangantarmembran
Membranluar
Membrandalam
Lumen

16. Enzim adalah biokatalis yang kerjanya dipengaruhi oleh banyak faktor lingkungan.
Faktorfaktorberikutinidapatmempengaruhikecepatanmaksimumenzim,KECUALI...
A. Konsentrasisubstrat
B. pH
C. Inhibitorkompetitif
D. Inhibitornonkompetitif
E. Suhu
17. Pada sel manusia, ditemukan ribuan kopi dari struktur ini yang terdiri dari 6 basa
(TTAGGG). Telah diketahui jika fungsi dari struktur ini adalah untuk menjaga agar
kromosom tidak semakin pendek pada saat pembelahan, pengaturan kromosom dan
translokasi. Apakah struktur spesifik yang ditemukan pada ujung kromoson di sel
eukariot?
A. Promoter
B. Intron
C. Ekson
D. Telomer
E. Gen
18. Dalam proses pemisahan panjang basa DNA digunakan metode elektroforesis. Pada
elektroforesis tersebut melibatkan gel agarose dan running buffer. Konsentrasi gel
agarosejugamenjadihalyangdiperhatikandalamproseselektroforesis,semakintinggi
konsentrasigelagaroseyangdigunakanmakasemakinrapatporiporiyangdihasilkan
dari gel tersebut. Apabila seorang peneliti ingin memisahkan DNA hasil pemotongan
menggunakan enzim restriksi dengan ukuran sebesar 2kb bentuk linear, maka pada
konsentrasi gelagarose berasadi bawah iniyang mampu memisahkan DNA tersebut
lebihcepat?
A. 2%
B. 1%
C. 1,5%
D. 0,8%
E. 1,8%
19. Pada proses pemisahan DNA berdasarkan panjang basa menggunakan metode
elektroforesis. Ketika elektroforesis sudah selesai dijalankan, dan untuk mengamati
molekulDNAsehinggaterlihatbeberapapitaDNA,makamatriksgelagaroseyangsudah
6

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
mengandung DNA harus diwarnai terlebih dahulu oleh suatu senyawa yang bekerja
dengancarainterkalasipadaDNAdanmamputerlihatapabiladilihatdibawahsinarUV.
Senyawakimiaapakahyangdigunakan?
A. SYBRGreenI
B. Xylenecyanol
C. BromphenolBlue
D. Etidiumbromide
E. OrangeG
20. Pada sel eukariot maupun prokariot DNA akan mengalami penggandaan atau
perbanyakan melalui tahap replikasi DNA. Proses perbanyakan DNA ini juga dapat
dilakukansecarainvitroyangdikenalsebagaiteknikPolymeraseChainReaction(PCR).
ApabiladalamPCRtersebutdilakukantahapperbanyakanselama5siklus.Berapakah
jumlahsalinantotal(totalcopynumber)DNAyangdihasilkan?
A. 2
B. 4
C. 8
D. 16
E. 32

ANATOMIDANFISIOLOGITUMBUHAN
1. Tanaman pasak bumi (Eurycoma longifolia) memiliki senyawa kimia yang disebut
quassinoid, sejenisterpenyangmerupakankelompokmetabolitsekunder.Senyawaini
umumdiekstrakdariakartanamanpasakbumi.Dariberbagaijenisselyangadadiakar
tumbuhan, jenis sel yang kemungkinan menghasilkan metabolit sekunder tersebut
adalah...
A. Selparenkim
B. Selkolenkim
C. Selsklerenkim
D. Seltrakea
E. Seltapis
2. Sebuahtanamandipotongbagianakarnyadanditaruhdidalamlarutanberisitintaselama
beberapajamsepertiyangditunjukkanolehgambarberikut.

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................

Sebuahdaerahpadabatangdipotongmelintang.Sayatansepertiapayangakanterlihat?

3. Manapernyataandibawahiniyangkurangtepat?
A. Prosestransportsecarasimplasmelibatkanadanyahubungansitoplasmadiantarasel
selhidup
B. Padaakar,airdapatmasukkejaringanpembuluhtanpamelaluijalursimplas
C. Pita Caspary akan menghalangi pergerakan air di antara selsel pada jaringan
endodermis
D. Endodermismerupakanlapisanjaringanyangterdapatpadabagiankorteks
E. Airdapatbergeraksecarabebaspadaapoplastanpamemasukisel
4. Apabilakitamenyemprotkanherbisidauntukmembasmigulmadiperkebunantomat,apa
yangakanmencegahsenyawakimiatersebutmemasukidaun?
A. Stomata
B. Kutikula
C. PitaCaspary
D. Empulur
E. Periderm
5. BagiandariWortelyangbiasakitamakanmerupakancontohdari...
A. Akarserabut
B. Akaradventif
C. Akartunjang
D. Akartunggang
E. Nodulakar

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
6. Tumbuhan memiliki pigmen selain klorofil yang berperan untuk mencegah rusaknya
molekuldariradikalbebasakibatpenyinaranberlebih.Salahsatujenispigmentersebut
adalahzeaxantin.Molekulinimemilikistrukturyanghampirsamadengan:
A. Klorofila
B. Klorofilb
C. Betakaroten
D. Fosfogliserida
E. Fikobilin
7. Padatumbuhandikenalistilahpergiliranketurunan(alterationofgeneration).Berikutini
manakahpernyataanyangSALAHmengenaifasepergiliranketurunanpadatumbuhan
Angiospermae?
A. Sporofitmenghasilkanspora
B. Gametofitmenghasilkangamet
C. Sporaberkembangmenjadigametofit
D. Gametofitbetinaadalahovulumdangametofitjantannyaadalahpolen
E. Selspermadihasilkanolehgametofitjantansecaramitosis
8. Misalkanandamemasangpakuyangsangatkecilpadadindingseltumbuhan.Manakah
bagiandaridindingselyangpalingakhirtertembuspakutersebut?
A. Lamellatengah
B. Dindingsekunder(S1)
C. Dindingsekunder(S2)
D. Dindingsekunder(S3)
E. Dindingprimer
9. Angkutan air dan mineral pada tumbuhan berpembuluh melibatkan beberapa gaya
penggeraksepertitarikantranspirasiolehdaun,kohesi,tegangan(tension)dantekanan
akar.Naiknyaairpadatumbuhanredwood(Gymnospermae)setinggi200meterpaling
utamadisebabkanoleh...
A. Tekananakarmenekanairkeatas
B. Penguapanairmelauistomatamenarikairkeatas
C. Gravitasimenciptakantekanandidalamxilem
D. Fotosintesisdidaunyangmemerlukanair
E. Airsecaraalamibergerakdariakarkedaun
PertanyaanNo.1011mengacupadadatayangditampilkanpadagrafikselseltembakau
yang ditumbuhkan pada kultur jaringan. Angka pada kurva menunjukkan konsentrasi
indoleaceticacid(IAA)dengansatuanmilligramperliter.

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................

10. Konsentrasi optimum dari zat pengatur tumbuh untuk merangsang pertumbuhan sel
tembakausecaramaksimumadalah
A. 27mg/literIAAsaja
B. 27mg/literIAAdan2,56mg/literkinetin
C. 27mg/literIAAdan0,64mg/literkinetin
D. 24mg/literIAAdan0,64mg/literkinetin
E. 21mg/literIAAdan0,64mg/literkinetin
11. Tujuandaripercobaaninisecaraumumadalahuntukmenentukan
A. PengaruhIAApadapertumbuhanselseltembakau
B. Jumlahzatpengaturtumbuhyangdilepaskansecaranormalolehselseltembakau
padakulturjaringan
C. Responselseltembakaupadakulturjaringanterhadapzatpengaturtumbuhsintetik
D. ResponkinetinterhadapberbagaikonsentrasiIAA
E. ResponselseltembakaupadakulturjaringanterhadapkombinasiIAAdankinetin
12. Beberapakelompokalgamerahdapattumbuhdilautanpadakedalamanmelebihijarak
penetrasicahayabirudanmerah.Penjelasanyangmungkinadalahbahwa...
A. Alga merah memiliki pigmen aksesoris yang dapat menyerap panjang gelombang
cahayalainyangtersediapadakedalamantersebut
B. Algamerahtersebutmenggunakanenergiinframerahuntukmenjalankanfotosintesis
C. Alga merah memiliki sistem penyerapan cahaya yang lebih efisien untuk panjang
gelombangcahayabirudanmerah
D. Algamerahmerupakanorganismheterotrof
E. Kelompokalgamerahtersebutsalahdiidentifikasi
13. Tanamankantungsemarmerupakantanamankarnivoryangmenjebakseranggauntuk
10

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
memenuhiunsurunsuryangtidakdapatdisediakanpadalingkungantempattumbuhnya.
Apa unsur yang diperoleh tanaman kantung semar tersebut dari serangga dan apa
kegunaanutamaunsurtersebut?
A. Tanamankantungsemarmemperolehair,karenamerekatinggaldilingkunganyang
sangatkering
B. Tanamantersebutmemperolehnitrogen,yangdigunakanuntukmembentukgula
C. Tanamantersebutmemperolehsenyawafosforus,untukmembentukprotein
D. Tanaman tersebut memperoleh gula, karena tidak dapat memproduksi gula yang
cukupmelaluifotosintesis
E. Tanamantersebutmemperolehnitrogen,yangdigunakanuntukmembentukprotein
14. Padasuatuketika,Andamembutuhkansejumlahbesarbuahpiruntukkeperluanpesta
yangakandiselenggarakan3harilagi.Masalahtimbulketikabuahpirtersebuttidak
cukupmatanguntukdigunakan.Apacarayangpalingbaikuntukmempercepatproses
pemasakanbuah?
A. Meletakkanbuahpirpadakeadaangelapgulita
B. Menyimpanbuahpirdidalammesinpendingin(kulkas)
C. Meletakkanbuahpirpadatepijendela
D. Meletakkanbuahpirpadakantungkertascoklatbersamasamadenganbuahapelyang
sudahmatang
E. Semuajawabandiatasbenar
15. Berdasarkanhasilpenelitian,telahditemukanbahwasuspensicairdarikloroplasyang
terisolasidapatmenghasilkanoksigenjikadiiluminasidandiberikansenyawatertentu.
Tipesenyawasepertiapakahdanwarnacahayaapayangdibutuhkanuntukmenghasilkan
oksigensecaramaksimum?
A. Akseptorelektron;cahayabirudanhijau
B. Akseptorelektron;cahayamerah
C. Akseptorelektron;cahayamerahdanbiru
D. Donorelektron;cahayabirudanoranye
E. Donorelektron;cahayamerahdanungu

ANATOMIDANFISIOLOGIHEWAN
1. Penyuntikanvaksinkedalamtubuhmengakibatkanreaksi...didalamtubuh
A. AktivasiselTspesifik
B. AktifasiselBspesifik
C. DiferensiasiselBmenjadiselplasma
D. Produksiantibodi
E. Semuapernyataandiatasbenar
11

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
2. Seoranganakmengalamikesulitanmencernaproteinpadadagingsapinamunmasihdapat
mencernaproteindaritelurdankacangkacangan.AnaktersebutkemungkinanTIDAK
mampumensekresienzim
A. Amilase
B. Lipase
C. Pepsin
D. Tripsin
E. Enterokinase
3. Didalamtubuh,pelekatanantibodikepatogendapatmemicuhalberikutini:
1.Aglutinasipatogen
2.Presipitasipatogen
3.Lisisdaripatogen
4.Fagositosispatogenolehmakrofag
Jikaantibodiberhasildimurnikandandiujikanpadalarutanyangmengandungpatogen,
makadarikeempatfungsidiatas,fungsiyangmasihbertahanpadaujiinvitrotersebut
adalah...
A. Hanya1,2,3
B. Hanya1dan2
C. Hanya3
D. Hanya4
E. 1dan4
4. LoopofHenle merupakanbagianyangpetingdariginjalvertebratayanghidupdidarat.
Keberadaan loop of Henle memugkinkan terbentuknya urin yang pekat dengan
meningkatkanpenyerapanairpada
A. Tubulusproksimal,tubulusdistal,dantubuluspengumpul
B. Tubulusproksimaldandistalsaja
C. Tubulusdistaldanpengumpulsaja
D. Hanyatubulusdistal
E. Hanyatubuluspengumpul
5. BerikutiniadalahkondisiionikdariselsarafdancairaneksraselulerketikaselsarafTIDAK
menghantarkanrangsangadalah
A. [K+]sitoplasma>[K+]ekstraseluler;[Na+]sitoplasma>[Na+]ekstraseluler
[K+]sitoplasma=[K+]ekstraseluler;[Na+]sitoplasma>[Na+]ekstraseluler
B.
[K+]sitoplasma>[K+]ekstraseluler;[Na+]sitoplasma<[Na+]ekstraseluler
C.
[K+]sitoplasma=[K+]ekstraseluler;[Na+]sitoplasma>[Na+]ekstraseluler
D.
[K+]sitoplasma=[K+]ekstraseluler;[Na+]sitoplasma=[Na+]ekstraseluler
E.
6. Jikakuatkontraksidanlajudetakjantungtetapnamunukuranaortaberkurang1/4nyamaka
12

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
perubahanyangakanterjadiadalah...
A. Strokevolume(voumeyangdipompaolehjantungsekaliberkontraksi),curahjantung
(volume darah yang dipompa selama satu menit), dan volume jantung setelah
kontraksimengalamipenurunan
B. Stroke volume dan curah jantung tetap, namun volume jantung setelah kontraksi
menurun
C. Strokevolume(volumeyangdipompaolehjantungsekaliberkontraksi),curahjantung
(volumedarahyangdipompaselamasatumenit)menurun,namunvolumejantung
setelahkontraksimengalamipeningkatan
D. Strokevolume(voumeyangdipompaolehjantungsekaliberkontraksi),curahjantung
(volume darah yang dipompa selama satu menit), dan volume jantung setelah
kontraksimengalamipeningkatan
E. Strokevolumedancurahjantungmenurun,namunvolumejantungsetelahkontraksi
tetap
7. Hbadalahpigmendarahyangumumditemukanpadavertebrataterutamamamalia.Dengan
adanyaHb,pertukaranoksigenantaraparuparudengandarahmenjadilebihefisien.Jika
seseorang meminum ramuan yang dapat meningkatkan kadar Hb di dalam darahnya,
makaperubahanyangTIDAKmungkinterjadipadaorangtersebutadalah...
A. PeningktankadarO2didalamdarah
B. PeningkatankadarO2didalamplasmadarah
C. PeningkatanlajudifusiO2dariparuparukedalamdarah
D. Peningkatansuplaidarahkejaringan
E. Peningkatanlajudifusidaridalamdarahkejaringan
8. Pernyataanberikutiniyangtepatmengenaitermoregulasipadaburungadalah...
A. Semuaburungadalahendotermik
B. Semuaburungadalahhomeotermik
C. Semuaburungadalahheterotermik
D. Semuaburungadalahpoikiloterm
E. Semuaburungaalahektotemik
9. PernyataanberikutyangTIDAKtepatmengenaikutubanimadanvegetalpadaembriokatak
adalah
A. Selseldikutubanimalmembelahlebihcepatdariselseldikutubvegetal
B. Selseldikutubvegetalberukuranlebihbesardariselseldikutubanimal
C. Semualapisanembrionaldibentukdikutubanimal
D. Kutubvegetalkayaakankuningtelur
E. Sebagianselyangmenyusunsistempencernaanberasaldarikutubvegetal
10. Berikutiniadalahduatipesaluranperncernaandarihewanhebivora.
13

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................

(sapi)

(kuda)

Sapi merupakan hewan memamah biak dan fermentasi dan fermentasi makanan
berlangsung di daerah rumen sedangkan kuda bukan hewan memamah biak dan
fermentasimakananterjadidicecum.PernyataanberikutyangTIDAKtepatadalah
A.
Sapimampumenyerapnutrisilebihbanyakdarimakananyangdimakannya
B.
Feses kuda mengandung biomasa yang lebih tinggi per kilogram makanan
yangdimakannya
C.
Sistempencernaansapilebihefisiendarikuda
D.
Konsumsi makanan dari sapi lebih tinggi dari kuda (jumlah makanan yan
dimakan/kilogramberatbadan/hari)
E.
Baiksapimaupunkudamengandalkanmikroorganismeuntukmendegradasi
selolosapadamakananyangdicernanya
11. Enterokinasemerupakanenzimyangberperandalammengaktifasienzimenzimpencernaan
diusushalus.Enziminidiproduksioleh
A. Selselendokrinpankreas
B. Selseleksokrin(asinar)pankreas
C. Selselpenyusundindingusushalus
D. Selselhepatositdihati
E. Selselpenyusunkantungempedu
12. Berikutiniadalahdiagramkontraksitunggaldariotot.

14

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................

Darifaktorfaktorberikutini,faktormanakahyangmenentukanbesarnyanilaiB?
A.
Besarnyaberkasserabutotot
B.
Panjangsarkomer
C.
KonsentrasiATPdisitoplasmaselotot
D.
LamanyaionkalsiumdiserapkembalikeREhalus
E.
Lamanyanatriumberdifusidaricairanekstraselulerkesitoplasmaselotot
13. Berikut ini pernyataan yang tepat mengenai kondisi cairan ekstraseluler dan cairan
intraselulerdidalamtubuhadalah...
A. Molaritascairanekstraseluler=intraseluler;volumecairanekstraseluler=intraseluler
B. Molaritascairanekstraseluler>intraseluler;volumecairanekstraseluler>intraseluler
C. Molaritascairanekstraseluler<intraseluler;volumecairanekstraseluler<intraseluler
D. Molaritascairanekstraseluler=intraseluler;volumecairanekstraseluler<intraseluler
E. Molaritascairanekstraseluler=intraseluler;volumecairanekstraseluler>intraseluler
14. PernyataanberikutiniyangTIDAKtepatmengenaiimunitaspasifadalah
A. Dapatterjadisecaraalamidariibukeanaknyabaikdidalamkandunganataupun
selamamenyusui
B. DapatdiberikandenganpenyuntikanselselimmunitassepertipenyuntikanselT
C. Dapatdilakukandenganpenyuntikanserumkedalamdarah
D. Dapatmemberikanperlindunganterhadaptubuhdalamjangkapanjang
E. Tidakmenghasilkanmemoriimunologi
15. Manakahdarihalhalberikutiniyangdapatmeningkatkanlajufiltrasiglomerolus...
A. PeningkatantekananhidrostatikpadakapsulaBowman
B. Vasokonstriksiarteriolaeferen
C. Peningkatantekananosmotikpadakapiler
D. Peningkatankadarproteinplasmadarah
E. Aktivitassarafsimpatikpadaarteriolginjal
16. Membukamulutpadasaatmendengarsuarakerasdapatmembantumenyeimbangkantekanan
15

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
udaraantaratelingaluardengantelingatengah.Halinikarenaadanyahubunganlangsung
antaratelingatengandenganronggamulutmelalui...
A. 3saluransetengahlingkaran
B. Rumahsiput
C. Choclea
D. SaluranEustachius
E. Sakulus
17. Seorangsiswamelakukanpengukuranbesarandepolarisasiyangterjadipadaaksonselsaraf
secara ex vitro. Untuk melakukan pengukuran tersebut, sel saraf yang telah diisolasi
diletakkankedalamlarutanfisiologisdankemudiandirangsangdengankejutanlistrik.
Hasilnyaadalahsebagaiberikut:

Siswatersebutkemudianmenambahkanlarutanyangmengandungionspesifikkelarutan
fisiologis tempat sel saraf diletakkan. Setelah dirangsang ternyata besarnya nilai
depolarisasi meningkat. Ion spesifik yang mungkin terkandung dalam larutan yang
ditambahkanadalah..
A.
K+
B.
Mg2+
C.
Ca2+
D.
Na+
E.
Fe3+
18. Terdapat berbagai sistem yang menyusun tubuh manusia. Dari sistemsistem berikut ini,
sistemmanakahyangpertamakaliterbentuk?
A. Saraf
B. Ekskresi
C. Sirkulasi
D. Pernafasan
E. Reproduksi
19. Berikutiniadalahkomponenreproduksipriadanwanita.
No Pria
Wanita
16

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
1
2.
3.

Testis
Oviduk
Uterus

Ovarium
Vasdeferens
Kelenjarprostat

Darikomponendiatas,komponenmanakahyangmemilikiasalusulyangsama?
A.
Hanya1
B.
Hanya2
C.
Hanya3
D.
1dan2
E.
1,2,3
20. Berikutdibawahiniyangmembantupengembaliandarahdarivenamenujujantung(venous
return)KECUALI...
A. Asetilkolin
B. Epinefrin
C. Kontraksiotot
D. Volumedarah
E. Inhalasi
21. Deteksikematianseseorangdapatdilakukandenganmemberikansorotancahayakemata
seseorangyangdidugatelahmeninggal.Pemberiancahayainibertujuanuntukmelihat
respon mata terhadap adanya cahaya. Jika orang tersebut belum meninggal maka
pemberiancahayaakanmenimbulkanperubahanpada
A. Diameterlensa
B. Ukuranpupil
C. Ukurankornea
D. Ukuranretina
E. Ukuranfovea
22. NotokordmerupakankarakterpentingpadafilumChordata.Pernyataandibawahiniyang
TIDAKtepatmengenainotokordpadaChordataadalah...
A. Berfungsisebagaikerangkahidrostatik
B. Menginduksipembentukankepingneural
C. Pada perkembangannya pada subfilum vertebrata akan mengalami kalsifikasi
membentukvertebrae
D. Apabila bagian dari notokord dipindahkan ke bagian ventral gastrula lain, akan
terbentukduabagiandorsaltubuh
E. Merupakansatusatunyamesodermyangberperandalampembentukantabungneural
23. Manakahperyataanberikutyangbenarjikasuatuototrangkayangdiisolasidarikakikatak
17

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
kemudiandiletakkandalamlarutanfisiologisyangTIDAKmengandungkalsium...
A.
Kontraksi akan terjadi jika stimulasi diberikan dengan mendepolarisasi
membranototsecaralangsung
B.
Kontraksitidakakanterjadimeskipunmembranototdidepolarisasikarena
tidakterdapatkalsiumyangterikatpadatroponin
C.
Kontraksi akan terjadi jika stimulasi diberikan pada saraf yang
menginervasiotottersebut
D.
Kontraksitidakakanterjadikarenakalsiumdiperlukanuntukmengubah
myosindarikonfigurasienergirendahmenjadimenjadikonfigurasienergitinggi
E.
Tidakadajawabanyangbenar
24. Sekresidarihormonmanakahyangtergangguakibattumorpadakelenjarpituitariposterior?
A. Melanositstimulatinghormone
B. Lipotropin
C. Leutinizinghormone
D. Oksitosin
E. Thyroidstimulatinghormone
25. Seorang pasien yang mengalami gagal ginjal akibat hiperkalemia diberikan infuse yang
mengandungglukosadaninsulin.Manakahdibawahiniyangterjadipadapasientersebut
sebagaiakibatpemberianinsulin?
A. Perubahanglikogenmenjadiglukosa
B. Stimulasiglukoneogenesis
C. Peningkatankonsentrasiasamaminodiplasma
D. Peningkatanmasuknyaionkaliumkedalamsel
E. Penurunanlajupembentukanurin

GENETIKADANEVOLUSI
1. Lokasirelatifempatgenpadasatukromosomdapatdipetakandaridatafrekuensihasil
pindahsilangberikutini.
GenFrekuensipindahsilang
BdanD5%
CdanA15%
AdanB30%
CdanB45%
CdanD50%
18

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................

A.
B.
C.
D.
E.

Manakahberikutyangmerepresentasikanposisirelatifdariempatgenpadakromosom
tersebut?
ABCD
ADCB
CABD
CBAD
DBCA
PertanyaanNo.2dan3mengacupadaketeranganberikutini.
Padaanjing,satupasangalelmenentukanwarnarambut(gelapdanalbino).Pasanganalel
yang lain menentukan panjang rambut (pendek dan panjang). Oleh karena itu, setiap
gametakanmemilikisatudarialelwarnarambut,Catauc,dansatudarialelpanjang
rambut,Bataub.Padapersilanganberulangantaraanjingberambutpendekdanberwarna
gelapdengananjingberambutpanjangdanalbino,menghasilkanketurunanyangsemua
berambut pendek dan berwarna gelap seperti yang ditunjukkan pada persilangan I.
Namun, pada persilangan yang lain antara anjing berambut pendek dengan anjing
berambutpanjangdanberwarnagelap,rasiofenotipsepertipadapersilanganIIdiperoleh.
Persilangan

2.
A.
B.
C.
D.
E.

Induk

Keturunan

I.Gelap,rambutpendekxAlbino,rambutpanjangSemuagelap,rambutpendek
II.Gelap,rambutpendekxGelap,rambutpanjang3gelap,rambutpendek

3gelap,rambutpanjang

1albino,rambutpendek
1albino,rambut panjang

PadapersilanganII,genotipedariindukberwarnagelapdanberambutpendekadalah
CcBb
ccbb
CCBB
CCbb
ccBB

3. Manakahberikutinimerupakangenotipyangmungkindariindukberwarnagelapdan
berambutpendekpadapersilanganI?
A. CcBb
B. ccbb
C. CCBB
D. CCbb
E. ccBB
4. JikaurutansuatuDNAadalah5'TACGATTAG3',urutanRNAyangdihasilkandari
transkripsidariDNAiniadalah
A. 3'TACGATTAU5'
19

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
B.
C.
D.
E.

3'ATGCTAATA5'
3'UACGAUUAG5'
3'AACGAUUAA5'
3'AUGCUAAUC5'

5. Persilangan di antara dua galur murni yaitu bunga berwarna biru tua dengan bunga
berwarnaputihmenghasilkanketurunanF1bungaberwarnabirumuda.Ketikaketurunan
F1 tersebutdisilangkansesamanyamakandiperolehrasiofenotipbungaberwarnabiru
tua, biru muda dan putih adalah 1:2:1. Apakah fenomena genetik yang terjadi pada
mekanismetersebut?
A. Epistasis
B. Dominantaklengkap
C. Poligeni
D. Alelmajemuk(multipleallele)
E. Perkawinanacak
6. Di bawah ini merupakan silsilah dari suatu keluarga yang memiliki riwayat kelainan
selaputtangan.Individuiniketikalahirmasihmemilikistrukturselaputdiantarajarijari
tangannya,sehinggaperludihilagkandenganoperasi.Individuyangmemilikikelainan
selaputtangandiberitandahitam,sedangkanyangnormaldiberitandaputih.Berdasarkan
silsilahtersebuttentukanmoduspewarisansifatnya.

A.
B.
C.
D.
E.

TerpautkromosomX
Autosomaldominan
Autosomalresesif
Terpautgenommitokondria
TerpautkromosomY

7. Mutasi yang terjadi pada sel tubuh yang TIDAK membentuk sel gamet dapat
dikelompokkansebagai
A. Mutasiauksotropik
20

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
B.
C.
D.
E.

Mutasisomatik
Mutasimorfologi
Oncogen
Mutasisensitiftemperatur

8. Padafasemanadalammeiosisterbentukpasangankromosomdanterjadipindahsilang?
A. ProfaseI
B. MetafaseI
C. ProfaseII
D. MetafaseII
E. AnafaseII
9. KomponenmanakahdariRNAhasiltranskripsidieukariotyangadapadatahapakhir
transkripsitetapiakandibuangsebelumprosestranslasi?
A. Intron
B. 3'polyAtail
C. Ribosombindingsite
D. 5'cap
E. kodon
PernyataanNo.10dan11mengacupadaketeranganberikut.
Suatupopulasihewanlaboratoriumyangbesardikondisikanagardapatkawinsecaraacak
selama beberapa generasi. Setelah beberapa generasi, 49% hewan menunjukkan sifat
resesif (bb), persentase yang sama seperti saat awal program perkembangbiakan.
Sedangkansisanyamenunjukkanfenotipdominandenganheterozigotyangtidakdapat
dibedakandaridominanhomozigot.
10. Kesimpulanapayangpalingmasukakalyangdapatdiambildarifaktabahwafrekuensi
alelbTIDAKberubahdariwaktukewaktu?
A. Populasimengalamigeneticdrift
B. Duafenotipsamasamaadaptifdibawahkondisilaboratorium
C. GenotipeBBbersifatlethal
D. TerdapatlajumutasiyangtinggidarialelBmenjadialelb
E. Terdapatseleksiseksualyangmenyukaialelb
11. Berapafrekuensidarialelbpadagenepool?
A. 0,70
B. 0,51
C. 0,49
D. 0,30
E. 0,07
12. BerapakahfrekuensidiperolehindividuAaBBccdarihasilperkawinan2parentaldengan
genotypeAaBbCc?
21

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
A. 1/64
B. 1/32
C. 1/16
D. 1/8
E. 3/16
13. Manakahberikutiniyangmerupakansubjekumumyangditelitipadakajian
mikroevolusi?
I.
Efekimigrasipadafrekuensialel
II.
Peranandariseleksikawinpadavariasigenetik
III.
Lajumunculnyaspesiesbaru
A.
B.
C.
D.
E.

I
II
III
IdanII
IIdanIII

14. BerapapeluangdapatdihasilkanduaanakbergenotipeAadarikeluargadengantiga
oranganakjikadiketahuikeduaorangtuabergenotipeAa?
A. 1/16
B. 1/4
C. 3/8
D. 3/4
E. 1/8
15. Manakahdariprosesprosesdibawahiniyangterjadiselamaekspresigen?
I. ReplikasiDNA
II. Transkripsi
III. Translasi
A.
B.
C.
D.
E.

HanyaI
HanyaII
HanyaIII
IdanII
IIdanIII

16. Daritipetipemutasidibawahini,manakahyangdapatmenyebabkanpemendekanrantai
polipeptida?
I. Mutasimissense
II. Mutasinonsense
III. Mutasisilent
A. HanyaI
22

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
B.
C.
D.
E.

HanyaII
HanyaIII
IdanII
IIdanIII

17. Seorang peneliti menginfeksi suatu kultur Eschericia coli dengan virus yang
menginterupsi siklus lisogenik segera setelah infeksi. Kemudian, peneliti tersebut
memanaskanbakteriyangtelahterinfeksidengantemperaturyangsangattinggi,sehingga
dapatmematikansemuabakteridanmenghancurkansemuavirusyangtersisapadakultur.
Kemudian, peneliti tersebut menambahkan sebuah sampel yang telah dipanaskan
sebelumnya ke kultur bakteri Eschericia coli yang masih sehat. Dua hari setelah
penambahan, peneliti tersebut mengisolasi bakteri dari kultur dan menemukan bahwa
bakteribakteriyangmasihsehatmengandungurutanDNAyangberhubungandengan
tahapanprophagedarivirusyangdiinfeksikanpadakulturawal.Secaraurut,manakah
duaprosesyangberperanpadapercobaanini?
A. Konjugasi,transformasi
B. Konjugasi,transduksi
C. Transduksi,konjugasi
D. Transduksi,transformasi
E. Transformasi,transduksi
18. Sekitar0,04%populasiras KaukasiandiAmerikaSerikatmenderitakelainangenetik
cysticfibrosis.Individuyangmembawaduasalinandarialelmutanresesifmenunjukkan
penyakit tersebut. Berapa persentase dari carrier yang TIDAK terkena penyakit pada
populasitersebut?
A. 16%
B. 1,96%
C. 3,92%
D. 0,0004%
E. Tidakterdapatinformasiyangcukupuntukmenjawabpertanyaan
19. Apakahmanfaatyangpalingmungkindarireproduksiseksualjikaditinjausecara
evolusi?
A. Reproduksiseksuallebihefisiendaripadareproduksiaseksual
B. Reproduksiseksualmeminimalisirmutasiyangtidakmenguntungkan
C. Reproduksiseksualberkaitandenganreplikasiyanglebihcepat
D. Reproduksiseksualmenyebabkanrekombinasigenetikyangnyata
E. Reproduksiseksualberkaitandenganjumlahketurunanyanglebihbanyak
20. Manakahberikutiniyangmenjelaskanmengapapopulasidianggapsebagaiunitevolusi?
A. Perubahangenetikhanyaterjadipadatingkatpopulasi
B. Genepoolpadasuatupopulasiselalutetapdariwaktukewaktu
23

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
C. Seleksialamberdampakpadaindividubukanpadapopulasi
D. Individutidakdapatberevolusitetapipopulasidapatberevolusi
E. Sebagianbesarperubahanpadagenepoolpopulasitidakmenghasilkanevolusi
ETOLOGI
1. Berikut adalah berbagai perilaku yang dilakukan hewan yang melakukan reproduksi
seksualuntukmendukungkelestariangennya.
I.
Spermasejenisspesieskumbangjantanmemilikimorfologikepalaspermayangdapat
menghalangispermakumbangjantanlainmasuk
II.
Mencitbetinamenghasilkansumbatvaginasetelahkawindenganmencitjantan
III.
Singa jantan membunuh anakanak singa dari sekumpulan singa betina yang
didatanginya
IV.
Ayamhutanbetinahanyamemilihayamjantanyangmelakukandisplaypalingbagus
Perilaku yang TIDAK memungkinkan dihasilkannya keturunan dari lawan jenis yang
berbeda(poligami/poligini)adalah...
A. IdanII
B. IdanIII
C. IIdanIV
D. IIIdanIV
E. IV
2. Berikut ini yang TIDAK termasuk perilaku yang menunjukkan komunikasi yang
dilakukanhewanadalah...
A. Harimaumengencingisudutsudutdaerahyangmenjaditeritorinya
B. Kunangkunangmenghasilkancahayauntukmenarikperhatianpasangankawin
C. Sejenis lalat mengembangkan sayapnya yang memiliki corak sedemikian rupa
sehinggatampaksepertilabalabapredator
D. Paus biru mengeluarkan gelombang ultrasonik untuk memanggil anak
anaknya/kawanannya
E. Burung merak jantan mengembangkan ekor belakangnya untuk menarik perhatian
burungmerakbetina
3. Saatmenjelangmusimkawin,katakjantanbernyanyidenganpolasuaratertentusehingga
menarik katak betina dari spesies yang sama. Stimulus utama yang diberikan oleh
individujantantersebutberupa...
A. Stimuluskimia
B. Stimulusvisual
C. Stimulusauditori
D. Stimulusolfaktori(penciuman)
E. Stimulustaktil(sentuhan)
24

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................

4. Seekor predator pada ekosistem akuatik mengeluarkan senyawa yang dapat merubah
respondarimangsanya.Sangmangsamerespondenganmemperbesarukurantubuhdan
membentuk struktur morfologi tambahan pada cangkangnya yang berfungsi sebagai
pertahanan.Senyawayangdikeluarkanpredatortersebuttermasukkedalam...
A. Feromon
B. Khairomone
C. Allomon
D. Synamon
E. Hormon
5. Pada konsep Hamiltons rule (C < r.B), antara Paman dan keponakan perempuan
memilikikoefisienkekerabatan/relatedness(r)sebesar
A. 1/2
B. 1/4
C. 1/6
D. 1/8
E. 1/3

EKOLOGI
1. OrganismeyangTIDAKmembutuhkanenergimatahariuntukdapathidupadalah
A. Alga
B. Bakteriheterotrofik
C. Bakterifotosintetik
D. Bakterikemosintetik
E. Lumutkerak
2. Seekorularmemakankatakyangsebelumnyatelahmemakanseranggaherbivor.Ular
tersebuttergolongsebagai
A. Produsentingkatsatu
B. Konsumentingkatsatu
C. Konsumentingkatdua
D. Konsumentingkattiga
E. Konsumentingkatempat
3. Diantaraberikutini,yangTIDAKdidaurkandalamekosistem/biosferadalah
A. Air
B. Nitrogen
25

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
C. Energi
D. Sulfur
E. Fosfor
4. Kondisiutamayangmenentukantipekomunitastumbuhanpadasuatubiomaadalah
A. Curahhujandanpenyinaranmatahari
B. Curahhujandansuhuudara
C. Penyinaranmataharidansuhuudara
D. Ketinggiantempatdansuhuudara
E. Ketinggiantempatdanpenyinaranmatahari
5. Unsurkarbondidaurkandalambiosfermelaluiprosesprosesberikut,KECUALI
A. Fotosintesis
B. Transpirasi
C. Dekomposisi
D. Pembakaranbahanbakarfosil
E. Respirasi
6. Prosesfiksasinitrogenterutamaberlangsungkarenaadanyaperan
A. Manusia
B. Tumbuhan
C. Hewan
D. Bakteri
E. Fungi
7. Bentukinteraksiantarspesiesdimanasuatuorganismemenangkapdanmengkonsumsi
organismelainnyadisebutsebagai
A. Kompetisi
B. Simbiosis
C. Predasi
D. Mutualisme
E. Parasitisme
8. Prosessuksesiprimerdapatberlangsungsetelahterjadi
A. Kebakaranhutan
B. Hujanbadai
C. Aliranlavagunungberapi
D. Penebanganhutan
E. Banjir
26

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................

9. Suatupopulasiakanmengalamipertumbuhanjika
A. Lajukelahirantetapdanlajukematianmeningkat
B. Lajukelahiranlebihrendahdaripadalajukematian
C. Lajukelahirandanlajukematiantetap
D. Lajukelahiranlebihtinggidaripadalajukematian
E. Lajuemigrasilebihtinggidaripadalajuimigrasi
10. Keseluruhananggotasuatuspesiesyanghiduppadadaerahtertentudisebutsebagai
A. Individu
B. Populasi
C. Komunitas
D. Ekosistem
E. Bioma

BIOSISTEMATIK
1. BerdasarkandaerahZoogeografi,PulauPapuatermasukdaerah
A. Neotropical
B. Oriental
C. Australian
D. OrientaldanAustralian
E. Paleartic
2. PernyataandibawahiniyangTIDAKmerupakankarakterdariprotistaadalah
A. Uniseluler
B. Prokaryot
C. Autotrof
D. Heterotrof
E. Eukaryote
3. Tabel di bawah ini, meskipun TIDAK diisi secara lengkap namun informasi datanya
dapatdigunakanuntukmenjawabpertanyaandibawahini.
Takson
Filum
Kelas
Ordo
Famili
Genus

HewanI
Arthropoda
Insecta
Lepidoptera
Torticidae
Archips

HewanII

HewanIII

HewanIV

Lepidoptera
Psychidae
Solenobia

Archips

Torticidae
Eulia

27

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
Spesies

A.rosana

S.walshella

A.fevidara

E.pinatubana

Hewanhewanyangtermasukkedalamkelassama,yaitu
A. I,II,danIII
B. I,II,danIV
C. I,IIIdanIV
D. IdanIV
E. E.I,II,III,danIV
4. Gunakanlahtabeldibawahiniuntukmenjawabpertanyaanberikut!
Vertebrata
(I)
O
P
Q
R
S
T
U
V
W
X
Y

Macam
anggota tubuh
(II)
kaki
kaki
kaki
sayap
tidakada
sirip
kaki
tidakada
kaki
sirip
kaki

Cara perkembang Suhutubuh


biakan(III)
(IV)

Kulittubuh
(V)

ovipar
ovipar
ovipar
ovipar
ovipar
vivipar
ovipar
ovipar
ovipar
ovovivipar
vivipar

karapas,plastron
bersisik
berambut
berbulu
licin
licin
licin
bersisik
kasar,lembab
bersisik
bersisik,berambut

Poikilothermis
Poikilothermis
Homoiothermis
Homoiothermis
Poikilothermis
Homoiothermis
Poikilothermis
Poikilothermis
Poikilothermis
Poikilothermis
Homoiothermis

HewanvertebratamanakahyangtermasukkelasAmphibia?
A. O,Q,&S
B. P,U,&V
C. P,T,&V
D. S,U,&W
E. R,U,&W
5. Beberapakarakterberikutinimerupakankarakteryangdimilikiolehdikotildanatau
monokotil:
1. kotiledonberkepingsatu
6.berbunga
2. kotiledonberkepingdua
7.uratdaunsejajar
3. seltelurdilindungiolehovarium
8.akarserabut
4. akartunggang
9.polen
5. xylemberupatracheadantracheid
10.spora
Karakteryangdimilikibaikolehmonokotildandikotiladalah....
A. 2,4,5,6
B. 2,4,5,10
28

Nama:.......................................................................................
SeleksiCalonPesertaIBO
...........
2013
AsalSMA/Kelas:
TingkatKabupaten/Kota
................................................................................
C. 1,3,4,5
D. 3,5,6,9
E. 1,3,4,8

29