Anda di halaman 1dari 191

Kuliah I: Pendahuluan

Copyright Statement:

Dengan ini dinyatakan, bahwa seluruh material (teks,


gambar, grafik dan seluruh alat bantu penjelas lainnya)
bahan kuliah dalam format .ppt sebagaimana tercantum
disini memiliki hak eksklusif intelektual bagi penyusun.
Penggunaan diluar untuk keperluan pembelajaran
sebagaimana disepakati dalam pemberian material harus
mendapatkan izin tertulis dari penyusun dan pelanggaran
dalam hal ini akan dikenakan sanksi hukum sebagaimana
berlaku di Negara Kesatuan Republik Indonesia.

Rekayasa Genetika
Nomor Kode/Beban SKS : PAE 412/ 3 (2-1) Smester VII diusulkan menjadi semester VI
Prasyarat : Lulus minimal nilai C mata kuliah
Pengantar Bioteknologi Pertanian (PAE311) dan
Biologi Molekuler (AEP 312)
Pengasuh: 1. Prof. Dr. Sc. Agr. Ir. Jamsari, MP

2. Dr. Yusniwati, SP. MP.

3. Lily Syukriani, SP. MP.

Deskripsi Singkat
Mata kuliah ini memberikan pembekalan tentang
pengertian rekayasa genetika dan prinsip-prinsip serta
metode yang dipergunakan dalam menghasilkan
organisme transgenik. Lebih detail mata kuliah ini
memberikan informasi tentang metode isolasi gen
target dan proses penyelipannya serta prinsip analisis
integrasi gen tersebut kedalam organisme target.
Disamping itu, juga diuraikan penggunaan beberapa
teknologi analisis molekuler yang dapat dipergunakan
untuk keperluan analisis genom. Pad bagian akhir juga
diuraikan tentang potensi resiko dan upaya-upaya yang
dilakukan untuk memperkecil potensi resiko yang
selama ini menjadi kekuatiran masyarakat.

Tujuan Instruksional Umum


Setelah lulus mengikuti perkuliahan rekayasa
genetika ini mahasiswa diharapkan mampu
menjelaskan pengertian dan potensi
manfaatnya dalam perbaikan dan peningkatan
kesejahteraan masyarakat. Lebih jauh
mahasiswa diharapkan mampu menjelaskan
prinsip isolasi gen target, penyelipan dan
prosedur analisisnya. Mahasiswa juga mampi
menjelaskan kemungkinan potensi resikonya
serta kemungkinan upaya-upaya yang dapat
dipergunakan untuk menghindari resiko yang
mungkin terjadi.

Strategi Perkuliahan
SCL : Student centerred learning
Ceramah, diskusi, pemecahan masalah, tugas
terstruktur, pemberian hand out, praktikum,
dan ujian

Materi Kuliah
Minggu
I
II
III
IV
V
VI
VII
VIII
IX
X
XI
XII
XIII
XIV

Materi
Pengertian dan Kontribusi Rekayasa genetika dalam berbagai kehidupan manusia
Vektor kloning untuk transformasi genetik: plasmid, Phagemid.
Vektor kloning berkapasitas besar : BAC, YAC, Cosmid
Transformasi genetik : heat shock, elektrophorasi, Agrobacterium mediated, Biolistik.
Analisis Transforman : berbasis PCR, restriksi, hibridisasi.
Isolasi gen target I: berbasis fungsi dan Penyusunan Peta Genetik.
Isolasi Gen target II: Penyusunan Peta Fisik dan kloning berbasis PCR
Analisis fungsional transforman
UTS
Pustaka cDNA dan EST (Expressed Sequence Tagged)
Genome, Chromosome, Primer Walking untuk isolasi Gen.
Rekayasa Genetik untuk Peningkatan produksi dan perbaikan kwalitas Hasil Pertanian
Rekayasa Genetik untuk Produksi Ternak dan perbaikan kwalitas Ternak
Sistem penanda molekuler untuk analisis genom I.-RAPD, isozym, RFLP, AFLP.
Sistem penanda molekuler untuk analisis genom II.STS, CAPS, Mini/Mikrosatellit, SNP.

XV Stabilitas ekspresi genetik transgenik.


XVI Keamanan produk-produk transgenik.
UAS

Daftar Buku:

Jamsari. 2007. Bioteknologi Pemula, Prinsip Dasar Teknik Analisis Molekuler. Unri-Press.
180 halaman.
Jamsari, 2008. Pengantar Pemuliaan, Landasan Biologis, Genetis dan Molekuler. Unri Press.
Lewin, B. 2000. Genes. Oxford-University Press. 990 pp.
Watson, J.D., J. Tooze, D.T. Kurtz. 1983. Recombinant DNA, A short course. Scientific
American Book. 260 pp.
Marshall, G., D. Walters. 1994. Molecular Biology in Crop Protection. Chapmann & Hall.
283 pp.
Suzuki, D.T., A.J.F. Griffith, J. H. Miller, R.C. Lewontin. 1989. An Introduction to Genetic
Analysis. W.H. Freeman and Company. 768 pp.
Kempken, F and R. Kempken. 2000. Gentechnik bei Pflanzen. Springer-Verlag. Berlin. 245
pp.
Nevers, P. 1991. Pflanzenzchtung aus der Nhe gesehen. Max-Planck-Institut fr
Zchtungsforschung. 87 p
Brown, T.A. 2007. Genomes 3. Garland Science Publishing.
Clarck, D.P. 2005. Molecular Biology, Understanding the genetic revolution. Elsevier
Academic Press. USA.

Kriteria Penilaian :
Skoring penilain dilakukan sesuai dengan kriteria penilain yang
berlaku ditingkat Fakultas sebagai berikut:
Nilai dalam
huruf
A
AB+
B
BC+
C
CD
E

Point

Rentang skor

4,00
3,50
3,25
3,00
2,75
2,25
2,00
1,75
1,00
0,00

85-100
80-84
75-79
70-74
65-69
60-64
55-59
50-54
40-49
00-39

Komponen Penilaian:
1. Penguasaan Teori
Parameter : 1. UTS = 25%
2. UAS = 25%
3. Kuis (I+II) = 10%
2. Penguasaan Praktek Nilai Praktikum (30%), terdiri dari
a. UAP = 40%
b. Aktifitas selama praktikum (bertanya, diskusi, inisiatif,
kreatifitas)= 10%
c. Laporan praktikum = 20%
d. Seminar hasil praktikum = 20%
e. Kehadiran praktikum = 10%
Aturan dan ketentuan praktikum dibuat dalam ketentuan
tersendiri.
3. Tugas mandiri : 10%

Disiplin:
Toleransi keterlambatan dalammengikuti
perkuliahan maksimal 15 menit berlaku untuk
Dosen dan mahasiswa yang disepakati pada hari
pertama perkuliaahan.
Seluruh tugas yang diberikan dikumpulkan
sebelum perkuliahan dimulai. Setelah kuliah
dimulai, maka tidak akan diterima.
Segala bentuk kecurangan (ujian, tugas,
plagiarisme, dll.) merupakan tindakan kriminal
dan memiliki sanksi akademik dan hukum yang
berlaku.

Kontrak Perkuliahan:
Kuliah berdasarkan tatap muka, dan diskusi. Bilamana terjadi
pembatalan kuliah, maka akan diganti sesuai dengan jadwal yang
disepakati.
Kuliah menerapkan sistem SCL (student centered learning)
Pakaian kuliah harus rapi, tidak boleh berambut gondrong, pakai
kaos oblong dan sandal.
Mahasiswa hanya diperkenankan mengikuti perkuliahan jika
terlambat 15 menit (besaran waktu ini ditentukan berdasarkan
kesepakatan bersama pada hari pertama kuliah)
Kehadiran kuliah minimal 75 % atau 12 kali jika total kuliah 16 kali.
Kehadiran praktikum 100 %.
Praktikum diatur sendiri oleh Penanggung jawab praktikum dengan
asistennya.
Demikian kontrak perkuliahan ini dibuat, agar disetujui dan ditaati
oleh semua pihak.
Dosen Penanggungjawab

Padang, ....
Perwakilan/Komting Mahasiswa
.

Prof. Dr. Sc.agr. Ir. Jamsari, MP.

..................................................

Materi I. Pengertian dan Kontribusi Rekayasa genetika dalam


berbagai kehidupan manusia
No

1.

Tujuan
Instruksional
Khusus
Mahasiswa
mampu
menjelaskan
pengertian
rekayasa
genetika dan
manfaatnya
bagi
kehidupan
manusia.

Pokok Bahasan

Pengertian dan
Kontribusi Rekayasa
genetika dalam
berbagai kehidupan
manusia

Sub Pokok Bahasan

1. Pengertian rekayasa
genetika.
2. Sejarah perkembangan
teknologi Rekayasa
Genetika.
3. Potensi pemanfaatan
teknologi rekayasa
genetika dalam berbagai
aspek kehidupan
manusia.
4. Keahlian yang dibutuhkan
dalam teknologi rekayasa
genetika.
5. Potensi Resiko
penggunaan produk
rekayasa genetika
terhadap kehidupan
manusia.

Est. Waktu

20 menit
20 menit
20 menit
20 menit
20 menit

Kepustak
aan
1, 6, 7

1. Pengertian Rekayasa Genetika.

1. Pengertian Rekayasa Genetika.


Scientific alteration of the structure of genetic
material in a living organism. It involves the
production and use of recombinant DNA and has
been employed to create bacteria that synthesize
insulin and other human proteins.
(Life Sciences & Allied Applications / Genetics)
alteration of the DNA of a cell for purposes of
research, as a means of manufacturing animal
proteins, correcting genetic defects, or making
improvements to plants and animals bred by man

1. Pengertian Rekayasa Genetika.


The science of altering and cloning genes to
produce a new trait in an organism or to make a
biological substance, such as a protein or hormone.
Genetic engineering mainly involves the creation of
recombinant DNA, which is then inserted into the
genetic material of a cell or virus.

2. Sejarah Perkembangan Teknologi


Rekayasa Genetika

Timeline Perkembangan rekayasa Genetika


Tahun

Kejadian penting

1865

Gen dianggap sebagai faktor partikulat

1900

Penemuan kembali hukum Mendel (Correns, Tschermak, de Vries)

1903

Khromosome adalah unit keturunan

1910

Gen-gen terletak pada kromosom

1913

Kromosome mengandung gen-gen yang tersusun secara linear

1927

Mutasi adalah perubahan physik pada gen

1931

Rekombinasi disebabkan oleh pindah silang

1944

DNA adalah materi genetik

1945

Gen adalah pengkode protein

1953

DNA berbentuk double helix (Watson dan Crick)

1958

Replikasi DNA bersifat semikonservatif

1961

Kode genetik tersusun secara triplet

1972

Kloning DNA ke dalam plasmid vektor

1976

Kloning gen pengendali insulin

Timeline Perkembangan Bioteknologi


Tahun
1972
1973
1975
1975
1977
1978
1981
1982
1983
1984
1985
1987
1988
1989
1992

Kejadian
Dihasilkannya rekombinan DNA pertama dengan bantuan enzim Ligase,
Dihasilkannya organisme transgenik pertama oleh Cohen, et al.
Ditemukannya teknik elektrophoresis dengan Agarose
Sekuensing dengan metode pemutusan berantai
Metode hibridisasi DNA
Didirikannya perusahaan yang bergerak dalam teknologi gen: Genentech
Diperkenalkannya RFLP (Restriction Fragment Length Polymorphism)
579 gen manusia berhasil dipetakan diperkenalkannya Hibridisasi in-situ
Genbank sekuens pertama didirikan
Identifikasi pertama penyakit Huntingtons pada kromosom IV
Diperkenalkannya Pulsefield Gel Elektroporesis (PFGE)
Diperkenalkannya PCR (Polymerase Chain Reaction)
Diperkenalkannya YAC (Yeast Artificial Chromosome)
Didirikannya proyek pensekuenan genom manusia
Peta lengkap pertama genome Hemophilius influenzae
Peta tautan lengkap genome manusia pertama

Timeline Perkembangan Bioteknologi


Tahun
Kejadian
1993
Diperkenalkannya ESTs (Expressed Sequences Tags), Dipublikasikannya
peta fisik pertama genome manusia
1995
Genom Haemophilus influenza dan Mycoplasma genitalium lengkap
disekuens
1996
Genom Saccharomyces cereviceae (Eukaryot) lengkap disekuens, juga
Eschericia coli , Methanococcus fannaschii (Archaeobacteria) lengkap
disekuens, Diperkenalkannya teknologi chip
1997
Dipublikasikannya peta fisik genom manusia yang lengkap
1998
Genom C. elegans selesai disekuens
1999
Genom Drosophila melanogaster selesai disekuens
2000
Genom Arabidopsis thaliana selesai disekuens
2000
Genome manusia H.sapiens selesai disekuens
2000
Genom Oriza sativa selesai disekuens
2002
Genom nyamuk Anopheles gambiae dan Plasmodium palcifarum
selesai disekuens

3. Potensi pemanfaatan teknologi


rekayasa genetika dalam berbagai
aspek kehidupan manusia

Penciptaan Varietas Resisten


Resistensi terhadap Herbisida

Tanaman dengan resistensi terhadap herbisida adalah tanaman transgenik


pertama yang diusahakan secara komersial, dengan alasan:
1.Relatif mudah untuk menghasilkannya

2.Gulma dapat menyebabkan 10-15% pengurangan hasil


3.Penggunaan herbisida yang tidak saja mahal, akan tetapi juga tidak ramah
lingkungan.

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Herbisida Total X Herbisida Selektif


Meracun terhadap semua jenis
tumbuhan
Cepat terurari di tanah
(Phosphinothricin, Basta=(WP)
PPT/10 hari), Glyphosat (Round up
(WP)/3-60 hari)

Aktif pada dosis tertentu


terhadap tumbuhan tertentu
dengan karakter morfologi dan
fisiologi tertentu
Persistensi lama di tanah dan
air.
Atrazin, Bromoxynil, 2.4-D

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Penciptaan Tanaman Resistensi terhadap Herbisida


Herbisida Basta
Sumber gen Resisten: gen bar- dan gen pat- diisolasi dari
Bakteri tanah Streptomyces hygroscopicus dan S. viridochromogenes
Mutan Lucerne (Medicago sativa) gen toleran terhadap Basta
Produk: Phosphinothricin-acetyltransferase
Fungsi: detoksifikasi melalui proses acetilasi
Promotor: 35S-Promotor dari CaMV
Tanaman: lucerne, tomat, jagung, padi, gandum dan kedelai

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Glyphosat
Enzym Oxidoreduktase (bakteri) dan EPSP-Shynthase (35S-Promotor)
dari A. tumifaciens strain CP4 (mutant)
Tanaman transgenik yang dihasilkan:

Kapas, kentang, Jagung, kedelai, tembakau dan gandum


1996-1997 (USA):
Tanaman transgenik resisten herbisida menurunkan penggunaan herbisida
22-26%.
Erosi tanah menurun 90%, peningkatan produksi 5%

Problem :
kekuatiran tentang penyebaran gen herbisida resisten, dicoba
penggunaan plastida sebagai target untuk pengintegrasian gen asing
Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Resistensi terhadap herbisida

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Resistensi terhadap Serangga


Pertimbangan:
Penggunaan insektisida yang jelas selain tidak ekonomis juga tidak ramah
lingkungan

Menjadikan tanaman resisten terhadap serangga


Sumber gen resisten: Bacillus thuringiensis, Bt-toxin , -Endotoxin
Tanaman: Kapas, kentang, jagung, tomat

European corn borer

Keuntungan:
Kapas: penghematan insektisida 3,6 juta
liter, produksi 7% meningkat
Jagung : 300.000 kg (10%)
Western corn rootworm

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Resistensi terhadap Serangga

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Problem:
Ada serangga yang resisten terhadap _endotoxin,

Strategi lain:
Serin-Proteinase-inhibitor (menghambat enzim
pencernaan)

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Resistensi terhadap Virus


Cross protection
Coat protein gen ditransfer sebagai pelindung thdp. virus asing

Source: www.apsnet.org
Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

R-Gene (-Resistent Gen)


Resistensi terhadap Bakteri dan jamur
200 jenis bakteri bersifat pathogen (prokaryot)
8000 jenis jamur bersifat pathogen (Eukaryot) (100.000 jenis
nonpathogen)
Pathogen

Tanaman Inang

Gejala Penyakit

Bakteri

Agrobacterium tumifaciens

Tumbuhan dikotil

Erwinia amylovora

Apel, peer

Pseodomonas syringae pv. lachrymans

Timun

Bercak daun

Streptomyces scabies

Kentang

Bisul

Xanthomonas oryzae pv. oryzae

Padi

Blast

Ophiostoma novo-ulmi

Ulm

Mati ulm

Phytoptora infestans

Kentang

Busuk umbi

Puccinia graminis

Gandum

Karat hitam

Pembentukan tumor

Jamur

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Kerusakan akibat Jamur dan Bakteri:


Kerusakan morfologis, fisiologis
kontaminasi (mycotoksin) didalam bahan makanan dalam jangka panjang bersifat carcinogenic
Kasus Phytoptora infestans
Tanaman kentang di USA (1845),
kelaparan terparah di dunia sehingga
menyebabkan migrasi besar-besaran
dari Irlandia ke USA

Strategi:
- Chitinase untuk mencerna lapisan chitin dinding sel jamur (spesifik)
- -Thionin terhadap Pseudomonas syringae, dan Fusarium oxysporum
Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Strategi
- Gen Cholinoxygenase dari bakteri Arthrobacter globiformis
menghasilkan Transgenik Arabidopsi thaliana toleran terhadap
kadar garam tinggi (Glycinbetain)
- Mannitol-Dehydrogenase (E. coli )menyebabkan akumulasi
mannitol yang bisa meningkatkan toleransi terhadap
kekeringan pada tanaman tembakau
- Quicsilberreduktase (bakteri) pada tanaman Liriodendron
tulipifera meningkatkan toleransi terhadap logam perak
- Gen Metallothionin pada tanaman tembakau meningkatkan
resistensi terhadap logam Cadmium

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Toleran terhadap stress lingkungan (abiotic-stress)


Panas,
Dingin,
Kekeringan
Kadar Garam yang tinggi
Kekurangan mineral
Logam berat
Radiasi UV-B

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Gene glutathione dari E. coli


berperan dalam chelating untuk
mengurangi keracunan pollutant.

Deteksi pollutant

Rumput lapangan golf

Tahan herbisida
Tumbuh lambat
mengurangi pemangkasan
mengurangi polusi
Bio Steel
Jaring laba-laba adalah protein terkuat
Protein penyusu jaring laba-laba
diekspresikan di bulu domba
Hasilnya utuk membuat baju tahan
peluru (Nexia)

Deteksi Ranjau Darat


Dibutuhkan oleh Angkatan Darat,
Tanpa upaya ini,anak-anak dan penduduk sipil terancam
Bantuan Bioteknologi Tanaman
(dikembangkan oleh Aresa Biodetection)
Gen yang peka terhadap logam dimasukkan ke dalam
tanaman
Apabila akar tanaman menyentuh ranjau darat,
Tanaman berubah warna dari hijau menjadi merah

Mendeteksi ranjau darat

Perubahan pada bahan makanan


Negara berkembang: kekurangan pangan
Negara Maju : Alergi, kualitas bahan makanan, transportasi

Strategi
- Gen AGPase (ADP-Glucose-phsoporilase) dari E. coli digunakan untuk
meningkatkan kandungan pati pada tanaman kentang
Sebaliknya teknik ekspressi antisense
Dihasilkan kentang yang menghasilkan amylopketin, tapi tanpa amylosa
(penting untuk industri)
- Gen Thioesterase dari Umbellularia californica dapat meningkatkan kandungan
Laurat pada tanaman Raps, berguna dalam pembuatan margarin

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Perubahan pada bahan makanan


Kandungan Protein dan asam amino esensial, vitamin

- Pada tanaman padi dihasilkan tanaman transgenikj yang


mampu menghasilkan kadar -Carotin yang tinggi. Untuk itu
empat macam gen pengkode empat macam enzim
diintegrasikan:
- Phyton-Synthase, Phytoen-Desaturase, -Carotin-Desaturase
dan Lycopen--Cyclase.

- Golden Rice

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Rasa dan Daya Simpan

Polygalacturonase dengan teknik antisense


dapat diinaktifkan dan daya simpan
menjadi lama.
Tomat dengan tanda Flavr Savr.

Bahan baku industri


Poly (3HB) = PHB untuk menghasilkan materi
bioplastik. Berhasil dicobakan pada plastida
tanaman Arabidopsis thaliana dari gen
Ralstonia eutropha

Source: Wikipedia
E. coli

Produksi Metabolik Sekunder


Alkaloid : Morphin = Atropin (Papaver somniferum)
Taxol untuk kanker dari Taxus brevifolia
Bahan untuk imunisasi: Gen spaA menghasilkan
protein yang mampu mencegah karies gigi

proteins such as growth hormones, insulin, blood


substitutes, and trypsin inhibitor
Promega-3 fatty acid not from fish
Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

PENGANTAR PEMULIAAN TANAMAN

Barnase-Barstar-System ON MALE STERILITY


RNase dari Bacillus amyloliquefaciens >< Barstar
Tumbuhan Steril (MS)

Tumbuhan Normal
TA29

Barnase

TA29

Barnase

TA29

Barstar

Barnase

Barstar

Barnase
Degradasi RNA di tapetum
Tapetum mati
Tapetum hidup
Pollen tidak terbentuk

Pollen terbentuk normal

Dr. Jamsari-program study pemuliaan tanaman-BDP-FPUA

References:
1. Hayward, et al. (1993). Plant Breeding-principles and prospects. Chapman & Hall.
2. Fehr, W.R. (1987). Prnciples of cultivar development. Macmillan Publishing. Co. New York.

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

4. Keahlian yang dibutuhkan dalam


teknologi rekayasa genetika.

Keahlian yang dibutuhkan


Ilmu
pendukung
sesuai bidang
kajian

Bidang Kajian
Pertanian

Kedokteran
Peternakan

Rekaya
sa
Genetik

Farmasi
?????????

Teknologi pangan
Lingkungan
Kehutanan

Industri
Nanoteknologi

5. Potensi Resiko penggunaan


produk rekayasa genetika
terhadap kehidupan manusia.

Potential Risk of GMOs


Ecological aspects:
- Biodiversity of plants, insects, spiders, and other
animals.

- Crosspollination concerns,
Human health aspects: Allergens and toxins, gene
transfer to microorganism within the body
Horizontal gene transfer: soil bacteria could be
pesticide resistant

Strategies for Stopping the Spread of Foreign


Genes
Male sterility - Stopping pollen production
Termination gene

Chloroplast transformation - Keeping pollen


transgene-free

Keeping transgenic seeds from sprouting

Selesai

Bioteknologi Tanaman

Vektor Kloning Untuk


Transformasi Genetik:
Plasmid dan Phagemid.

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Copyright Statement:

Dengan ini dinyatakan, bahwa seluruh material (teks,


gambar, grafik dan seluruh alat bantu penjelas lainnya)
bahan kuliah dalam format .ppt sebagaimana tercantum
disini memiliki hak eksklusif intelektual bagi penyusun.
Penggunaan diluar untuk keperluan pembelajaran
sebagaimana disepakati dalam pemberian material harus
mendapatkan izin tertulis dari penyusun dan pelanggaran
dalam hal ini akan dikenakan sanksi hukum sebagaimana
berlaku di Negara Kesatuan Republik Indonesia.

Sub Pokok Bahasan


1. Pengertian vektor kloning untu transformasi
genetik.
2. Pengertian dan karakteristik plasmid.
3. Kapasistas kloning plasmid.
4. Pengertian phagemid.
5. Kapasistas kloning phagemid

1. Pengertian vektor kloning untuk


transformasi genetik.

Vektor Kloning

?
VEKTOR: Media untuk dan memperbanyak dan
mentransformasi fragmen DNA

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman

TRANSFORMASI GENETIK
1. Transformasi dengan Agrobacterium tumifaciens

Agrobacterium tumifaciens

adalah bakteri tanah penyebab


tumor pada tanaman
dikotiledon.
Pertama ditemukan tahun
1907, dilanjutkan dengan
penemuan plasmidnya yang
berukuran 200-800 kb.

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman

TRANSFORMASI GENETIK
Plasmid mengandung gen penyebab tumor sehingga disebut
dengan Tumour inducing-plasmid (Ti-Plasmid)
tms

tmr nos

noc = katabolisme
Nopalin

T-DNA
LB

nos = sinthesis Nopalin

RB

tmr = sintesis Sitokinin


noc

vir

T-DNA = DNA transfer

tms = sintesis Auxin


vir = daerah virulen

Ti-Plasmid

ori = asal replikasi


tra

LB = batas kiri
RB = batas kanan

ori
Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman


Kromosom dalam inti
sel tumbuhan
Agrobacterium

Pelukaan
Sel tumbuhan

Infeksi pada sel tumbuhan dan


transfer T-DNA

Tumor
T-DNA didalam
kromosom inti
sel

Agrobacterium di
dalam tumor

Infeksi pada sel tumbuhan dan


transfer T-DNA

Tumor
T-DNA didalam
kromosom inti
sel

Agrobacterium di
dalam tumor
Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Vektor Kloning
Persyaratan Suatu Vektor:
1. Replikasi Autonom Dalam Inang
2. Berpenanda Untuk Seleksi
3. Berposisi Kloning Tunggal
4. Berberat Molekul Kecil
5. Memiliki Beberapa Kopi Pada Setiap Sel
6. Tidak Berkonjugasi
Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Vektor Kloning
Contoh Vektor:
1. Plasmid
2. Fag (Fag M13)
3. Kosmid
4. P1- (PAC) (Plasmide Artificial Chrom.)
5. BAC (Bacterial Artificial Chromosome)

6. YAC (Yeast Artificial Chromosome)


Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

2. Pengertian dan Karakteristik


Plasmid

PLASMID:
Dna Ekstrakromosomal Berbentuk Sirkular Tertutup,
Berpita Ganda..

KROMOSOMAL DNA

PLASMID

Sumber: Wikipedia
Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Jenis-jenis Plasmid
F-plasmid: F adalah singkatan dari fertility,
Plasmid ini mengandung perangkat gen-gen tra.
R-plasmid: R adalah singkatan dari resistance
Col-plasmid, adalah plasmid yang mengandung
gen yang mengkode produksi senyawa
bakteriosin
Degradative plasmid, plasmid yang dapat
mencerna beberapa senyawa yang tidak umum
seperti toluene atau asam salisilat.
Virulence plasmid, adalah plasmid yang dapat
menyebabkan (Ti plasmid :Tumour inducing
plasmide

Elemen-elemen penyusun faktor F :


1. Ori T (origin of transfer): sekuens yang berfungsi
menandai titik awal selama transfer konjugatif.
2. Ori V (origin of replication): sekuen yang
berfungsi dalam replikasi di dalam sel resipien.
3. Daerah tra (transfer genes): gen yang mengkode
F-pilus dan pori-pori untuk transfer.
4. IS (elemen insersi): disebut juga dengan gen
egois yang fragmen yang dapat
mengintegrasikan dirinya sendiri pada lokasi yang
berbeda-beda.

Jenis bakteri berdasarkan keberadaan faktor F


1. Bakteri Hfr: bakteri yang memiliki faktor F yang
terintegrasi di dalam genom bakteri.
2. Bakteri F+: bakteri memiliki faktor F sebagai
plasmid yang independen dari genom bakteri.
Plasmidnya hanya mengandung sekuen dari
faktor F dan tidak mengandung sekuen DNA dari
genom bakteri.
3. Bakteri F (F-prime): bakteri yang memiliki
plasmid F tetapi didalamnya juga terdapat sekuen
DNA yang berasal dari genom bakteri.
4. Bakteri F-: bakteri yang tidak memiliki faktor F.

Kelengkapan Plasmid
Promoter
Marker (penanda) genetik
Resistensi antibiotik
Epitop
Daerah MCS

Kendali Host terhadap Replikasi Plasmid

Kontrol ketat (stringed control)

Kontrol longgar (relaxed control)


(10-200 kopi)

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Contoh Peta Plasmid

Bioteknologi Tanaman

SISTEM VEKTOR - INANG


Eco RI

Kpn I Sma I Bam HI Xba I Sal I Hind III


MCS = Multicloning Site

P O Z
lac

Km

pBin19
10 kb

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Bioteknologi Tanaman

SISTEM VEKTOR - INANG


KLONING DALAM PLASMID
Bam HI
Eco RI

Bam HI

Bam HI

Kpn I Sma I Bam HI Xba I Sal I Hind III


MCS = Multicloning Site

DNA Asing
P O Z
lac

Km

pBin19
10 kb

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Ligasi fragmen dengan plasmid


DNA Asing

Km

DNA Ligase

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Ligasi fragmen dengan plasmid

DNA Asing

Km

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Isolasi DNA Plasmid

CENTRIFUSE

Tris, Buffer EDTA


NaOH dan SDS

PELLET

Km

CENTRIFUSE

Km
Km

Km

Km

Km

Km

Km

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Penampilan DNA plasmid stlh diisolasi

Isolasi DNA Plasmid


M

10

Plasmid untuk Kloning Produk PCR

Produk PCR

Produk PCR yang dihasilkan oleh enzim


DNA Polymerase non Proofreading
biasanya menghasilkan ujung Adenyl (A)

Plasmid Kloning Produk PCR

Source: Promega, USA

Differential RAPD-Fingerprinting

AA

B
B

C
C

Cutting of specific fragments


OPN15-Cg
Before cutted

After cutted
1400 bp (A#1)

900 bp (A#2)

750 bp (A#3)

Cloning RAPD specific fragment

pGem-T Easy Vector, supplied by Promega-USA

Cloning RAPD specific fragment

E. coli, strain DH5

Analisis DNA Plasmid dan insersi

Sumber: Jamsari

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Analisis DNA Plasmid dan insersi dengan PCR

1000 bp
750 bp
500 bp

520 bp

250 bp
200 bp

Analisis DNA Plasmid dan insersi dengan PCR

1000 bp
750 bp
500 bp

520 bp
370 bp

250 bp

Visualisasi hasil restriksi insert menggunakan enzim BamHI

3. Kapasistas Kloning Plasmid.

Kapasitas Tampung Beberapa Vektor


Vektor

Plasmid
Plasmid
Plasmid
-Phage
Cosmid

P1-(PAC)
BAC
YAC

Inang

Escherichia coli
Saccharomyces
cerevisiae
Bacillus subtilis
Escherichia coli
Escherichia coli
Escherichia coli
Escherichia coli
Saccharomyces
cerevisiae

Kapasitas kloning

~ 5000 bp
~ 5000 bp
~ 5000 bp
9 23 kb
30 48 kb
85 110 kb
30 350 kb
50 kb 2 Mb

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Vektor Berkapasitas Besar

4. Pengertian Phagemid
hibrida of the filamentous phage M13 dan
plasmids untuk menghasilkan vektor yang
dapat tumbuh sebagai plasmid dan juga dapat
dimuat sebagai DNA pita tunggal dalam
partikel virus.

Phagemid

Disamping memiliki ColEI ori plasmid tersebut juga memiliki f1ori. MCS diletakkan diantara gen Lac-Z. Vektor juga dilengkapi
dengan gen resisten antibiotik ampicilin

5. Kapasistas kloning phagemid


Vektor
Plasmid
Phagemid
-Phage
Cosmid

Kapasitas maks.(kb)
10-15 kb
< 6 kb
< 25 kb
< 50 kb

YAC

20-2000 kb

P1-Phage
BAC
PAC

30-100 kb
100-300 kb
100-300 kb

Catatan

Sering ditemukan
khimera

Bioteknologi Tanaman

SELESAI

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Kuliah III.
Vektor kloning berkapasitas besar :
Cosmid, BAC, YAC,

Copyright Statement:

Dengan ini dinyatakan, bahwa seluruh material (teks,


gambar, grafik dan seluruh alat bantu penjelas lainnya)
bahan kuliah dalam format .ppt sebagaimana tercantum
disini memiliki hak eksklusif intelektual bagi penyusun.
Penggunaan diluar untuk keperluan pembelajaran
sebagaimana disepakati dalam pemberian material harus
mendapatkan izin tertulis dari penyusun dan pelanggaran
dalam hal ini akan dikenakan sanksi hukum sebagaimana
berlaku di Negara Kesatuan Republik Indonesia.

Sub Pokok Bahasan


1. Manfaat kloning berkapasistas besar.
2. Jenis-jenis vektor plasmid berkapasitas
besar.
3. Pengertian dan karakteristik BAC, YAC dan
Cosmid.
4. Kekurangan sistem BAC, YAC dan Cosmid

Manfaat kloning berkapasistas besar.


Memperkecil jumlah klon pustaka
DNA/genom yang harus dibuat.
Memudahkan penanganan dan
penyimpanannya.
Memudahkan/mempercepat proses seleksi
tranformant target.

Pustaka DNA
Disebut juga bank klon (clone bank) atau gen
bank, atau pustaka klon.

Sekumpulan klon (bakteri) transformant


yang mengandung set potongan DNA
(cDNA) dari sebagian atau keseluruhan set
genom lengkap suatu organisme (bakteri,
virus, tumbuhan, hewan, manusia).

Pustaka DNA

Library at Melk Abbey in Austria, Source: Wikipedia

Pustaka Klon/Pustaka DNA

PENYUSUNAN PUSTAKA DNA

Km

10 11 12

A
B
C
D
E
F
G
H
Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Pustaka DNA

Simpan pada
suhu -80oC atau -20oC

Memperkecil Jumlah Klon Pustaka

Ukuran Genom

125 Mb

125 Mb

Jumlah Klon Pustaka


125 Mb

EcoRI (6) = 46 = 4 kb =
125.000.000/4096 = 30.517 klon
MSeI (4) = 44 = 4 kb =
125.000.000/256 = 488.281 klon

2. Jenis-jenis vektor plasmid berkapasitas besar.


Vektor
Plasmid
Phagemid
-Phage
Cosmid

Kapasitas maks.(kb)
10-15 kb
< 6 kb
< 25 kb
< 50 kb

YAC

20-2000 kb

P1-Phage
BAC
PAC

30-100 kb
100-300 kb
100-300 kb

Catatan

Sering ditemukan
khimera

3. Pengertian dan Karakteristik


Cosmid , BAC, dan YAC.

Cosmid
Kosmid merupakan vektor yang
dikembangkan dari plasmid dilengkapi
dengan sekuen Cos
Selain memiliki gen Cos juga memiliki gen Ori
yang memungkinkan untuk bisa bereplikasi
didalam E. coli.
Istilah cosmid diperkenalkan pertama kali
oleh Collins dan Hohn (1978).

Cosmid

Karakteristik
Sekuen cos berasal dari phage yang
merupakan sekuen berpita tunggal.
Adanya sekuen cos memungkinkan cosmid
untuk masuk kedalam struktur bakteriophage
sehingga dapat dimasukkan kedalam sel bakteri.
Vektor cosmid biasanya banyak dipergunakan
dalam penyusunan pustaka DNA dengan ukuran
37 sampai 57 kb,
Fragmen cosmid itu sendiri hanya 4-9 kb.

Transfeksi Cosmid sebagai


Vektor Transformasi

YAC (Yeast Artificial Chromosome)


Butuh kloning dengan kapasitas besar:
Gen faktor VIII pada manusia yang mengkode
faktor defisiensi koagulasi (pembekuan)
darah pada jenis hemopilia A, memiliki
ukuran 190 kb
sifat bithorax pada Drosophila yang berfungsi
dalam regulasi perkembangan pola
segmentasi dada membentang sepanjang
320 kb.
Dikembangkan oleh Burke et al (1987)

Karakteristik penting plasmid YAC


Dikembangkan dari plasmid pBR322
Memiliki komponen gen yeast : SUP4, 7RP1,
HIS3 dan URA3.
Kloning pada sisi gen SUP4 (supressor untuk
pengendali gen tRNA tyrosin)
Host (inang) yang digunakan untuk
transformasi adalah spheroplast sel yeast

Prinsip kloning dengan YAC

Kelemahan
Sering mengandung khimera.
Sebab: artefak ligasi atau disebut juga
dengan kokloning, delesi serta bisa
diakibatkan oleh adanya rekombinasi
Nagaraja et al (1994) 50% nya ;Olson et al
(1987) =10%

BAC (Bacterial Artificial Chromosome)


Plasmid yang dilengkapi dengan faktor F
Mengandung:
oriS, repE F: replikasi dan pengaturan
jumlah salinan plasmid di dalam sel inang.
parA and parB: pembagian plasmid F
kedalam sel anak dan menjamin stabilitas
insersi
Kisaran kapasitas kloning vektor BAC adalah
150 sampai 350 kb (bisa capai 700 kb)
Dikembangkan oleh Kim, Shizuya, dll.

Beberapa Contoh Vektor


BAC

BAC (Bacterial Artificial Chromosome)


Spesies
Sorghum BTX623
Kedelai (Forrest)
Beet Gula
Tomat (L. esculentum)
Mogeor
Gandum Chinese Spring
Hewan
Ayam White Leghorn (female)
Kuda
Tikus
Serangga
Anopeles gambiae PEST
Semut api
Nyamuk
Ulat Sutera (Bombyx mori)
P50
Mikroba
Bakteri

insert
(kb)
145
125
140

Jumlah Equivalensi
klon
genom
10,752
2.0X
35,328
4.8X
57,600
10.6X
4.8X

pBeloBAC11
pCLD04541
pCLD04541

Sisi
kloning
BamHI
BamHI
BamHI

BIBAC2

BamHI

pBeloBAC11

HindIII

Vektor

125

36,864

210

4,608

134
130
150

49,920
50,688
99,840

5.5X
2.2X
5.0X

pECBAC1
pECBAC1
pECBAC1

HindIII
BamHI
HindIII

133
140
180

30,720
23,040
50,688

14.0X
5.3X
8.2X

pECBAC1
pECBAC1
pECBAC1

HindIII
HindIII
EcoRI

165

21120

6.6X

pBeleoBAC11

Bam HI

65

3,840

pECBAC1

BamHI

4. Kekurangan sistem BAC, YAC dan


Cosmid

Kelebihan Cosmid, YAC, BAC: kapasitas besar


Kekurangan terutama YAC: Chimera
Cosmid juga tidak stabil: 35%
BAC lebih sedikit mengandung khimera dan
efisiensi transformasi 100x dibanding YAC.

Kestabilan Pustaka
Klon

Sumber: Ioannou, et al., (1994).

Selesai

Materi IVTRANSFORMASI GENETIK

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Copyright Statement:

Dengan ini dinyatakan, bahwa seluruh material (teks,


gambar, grafik dan seluruh alat bantu penjelas lainnya)
bahan kuliah dalam format .ppt sebagaimana tercantum
disini memiliki hak eksklusif intelektual bagi penyusun.
Penggunaan diluar untuk keperluan pembelajaran
sebagaimana disepakati dalam pemberian material harus
mendapatkan izin tertulis dari penyusun dan pelanggaran
dalam hal ini akan dikenakan sanksi hukum sebagaimana
berlaku di Negara Kesatuan Republik Indonesia.

TRANSFORMASI GENETIK

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Beberapa Tanaman Budidaya Transgenik.


Buah

Sayuran

Butiran

Tanaman lain

Bunga2an

Apel

Kol Bunga

Jagung

Kapas

Krisantemum

Pisang

Brokolli

Padi

Luzerne

Kalankoa

Peer

Chikori

Gandum

Raps

Pelargonia

Strawberry

Timun

Lada

Petunia

Kiwi

Kentang

Kol liar

Mawar

Melon

Wortel

Kedelai

Jeruk

Kol

Bg Matahari

Pepaya

Selada

Tembakau

Plum

Oliv

Tebu

Anggur

Asparagus

Beet gula

Ubi Jalar
Tomat
Zucchini
Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman

TRANSFORMASI GENETIK
METODE TRANSFORMASI
1. Transformasi dengan Agrobacterium tumifaciens
2. Transformasi dengan Biolistik
3. Transformasi dengan fusi protoplasma

4. Transformasi dengan mikroinjeksi


5. Transformasi dengan elektrophorasi (Electrophoration)
6. Transformasi dengan chemical (heat shock)

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman

TRANSFORMASI GENETIK
1. Transformasi dengan Agrobacterium tumifaciens

Agrobacterium tumifaciens

adalah bakteri tanah penyebab


tumor pada tanaman
dikotiledon.
Pertama ditemukan tahun
1907, dilanjutkan dengan
penemuan plasmidnya yang
berukuran 200-800 kb.

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman

TRANSFORMASI GENETIK
Plasmid mengandung gen penyebab tumor sehingga disebut
dengan Tumour inducing-plasmid (Ti-Plasmid)
tms

tmr nos

T-DNA = DNA transfer


noc = katabolisme Nopalin

T-DNA

nos = sinthesis Nopalin

LB

tmr = sintesis Sitokinin

RB

tms = sintesis Auxin


noc
vir

Ti-Plasmid

vir = daerah virulen


ori = asal replikasi
LB = batas kiri

tra

RB = batas kanan

ori
Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman


Kromosom dalam inti
sel tumbuhan
Agrobacterium

Pelukaan
Sel tumbuhan

Infeksi pada sel tumbuhan dan


transfer T-DNA

Tumor
T-DNA didalam
kromosom inti
sel

Agrobacterium di
dalam tumor

Infeksi pada sel tumbuhan dan


transfer T-DNA

Tumor
T-DNA didalam
kromosom inti
sel

Agrobacterium di
dalam tumor
Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman


LB

RB

1
T-DNA
LB

RB

2
T-DNA

virD2
LB

RB

3
virD2

virE2

virD2
LB

RB

Komplek T-DNA-Protein
Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman

TRANSFORMASI GENETIK
LB

T2 Gen P2

T1 SMG P1 RB

T-DNA dimodifikasi

LB

vir

Ti-Plasmid
tanpa T-DNA

A.t. ori

RB

E. coli - plasmid
dengan T-DNA

E.c. ori

Kan

SKEMA SISTEM VEKTOR BINER


Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman

TRANSFORMASI GENETIK
TRANSFORMASI BIOLISTIK
= PARTIKEL BOMBARDEMEN
= MIKROPROJEKTIL

KELEBIHAN:
1. TIDAK MEMERLUKAN PENGHILANGAN DINDING SEL
2. TEORITIS SETIAP SEL ATAU JARINGAN BISA DITRANSFORMASI
3. CARA TRANSFORMASI TIDAK SEKOMPLEKS A. TUMIFACIENS
4. VEKTOR YANG DIPERLUKAN UNTUK TRANSFORMASI SEDERHANA
5. DAPAT MENGAKOMODASI LEBIH DARI 10 GEN SEKALIGUS PADA
PLASMID YANG BERBEDA
6. METODENYA DAPAT DITERAPKAN PADA SETIAP ORGANISME DAN
GENOTIP
Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman

TRANSFORMASI BIOLISTIK
Hind III
Eco RI

Sma I

Plasmid untuk transformasi biolistik

Amp = gen resistensi ampicilin


Amp

SMG

= Gen penanda untuk


tumbuhan

= promotor

= terminator

SMG

E.c. ori

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman

TRANSFORMASI BIOLISTIK

KAMAR TEKANAN

PEMEGANG MAKRO

DNA BERLAPIS
PARTIKEL EMAS

CAWAN PETRI DGN


JARINGAN
TANAMAN

BIORAD

PRINSIP ALAT TRANSFORMASI BIOLISTIK


Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Particle Bombardment

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman

TRANSFORMASI BIOLISTIK

KELEMAHAN:
1. EFISIENSI RENDAH (0,05%)
2. TIDAK SETIAP DNA YG DITRANSF. STABIL
TERINTEGRASI DIDALAM INTISEL
3. KEBANYAKAN HARUS MENGGUNAKAN
JARINGAN MERISTEM

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman

Transf. potongan daun dgn A. tumifaciens


Potongan daun dengan A. tumifaciens
dikokultivasi
1-2 hari
Potongan daun dicuci
Perlakuan antibiotik untuk mematikan
Bakteri dan menseleksi sel-sel
transformant
2-4 minggu
Transfer potongan daun ke medium
regenerasi dan seleksi (pembentukan
kalus dan tunas)
6-10 minggu
Potongan daun diletakkan pada medium
tanpa phytohormon untuk pembentukan
akar
4-6 minggu
Regenerasi tanaman transgenik

Transformasi kalus dengan biolistik

Embrio/Kallus diinisiasi dan dikultivasi

8-12 minggu
Transformasi biolistik

Pertumbuhan kallus tanpa seleksi


4 hari

Pertumbuhan kallus dengan media


seleksi
8-12 minggu
Regenerasi dan seleksi lanjutan
8-12 minggu
Regenerasi tanaman transgenik

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

DNA MICROINJECTION
direct microinjection of a chosen gene
construct
(a single gene or a combination of genes)
from another member of the same species or
from a different species
into the pronucleus of a fertilized ovum
one of the first methods that proved to be
effective in mammals (Gordon and Ruddle,
1981)
the introduced DNA may lead to the over- or
under-expression of certain genes

The insertion of DNA is random process


high probability that the introduced gene will
not insert itself into a site on the host DNA
manipulated fertilized ovum is transferred
into the oviduct of a recipient female or
foster mother
induced to act as a recipient by mating with a
vasectomized male
Applicable to a wide variety of species.

Procedure for DNA microinjection


fertilized eggs to be inoculated by microinjection is
increased by superovulation
female mice are given an initial injection of
pregnant mares serum and another injection,
about 48 hours later, of human chorionic
gonadotropin.
the super- ovulated females are mated and killed
the fertilized eggs are flushed from their oviducts
microinjection of the fertilized eggs
the microinjected transgene construct is often in a
linear form and free of prokaryotic vector DNA
sequences

Peralatan Mikroinjeksi

Transgenic mice by DNA microinjection

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman

3. Transformasi Dengan Fusi Protoplasma


LANGKAH PERTAMA:
MEMBEBASKAN PROTOPLASMA DARI DINDING SEL
(ENZIMATIS) :

UTAMA PEKTINASE DAN CELLULASE


PROTOPLASMA DIPELIHARA DALAM MEDIUM: ISO-OSMOSIS
VEKTOR TRANSFORMASI = BIOLISTIK
METODE : PEG (POLYETHYLENGLYKOL)
ELECTROPHORATION

PROBLEM: REGENERASI TRANSFORMANT


Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Fusi Protoplasma

Inter-specific and inter-generic fusion achievements


Cross
Oat
Brassica sinensis
Torrentia fourneri
Brassica oleracea
Datura innoxia
Nicotiana tabacum
Datura innoxia
Arabidopsis thaliana
Petunia hybrida

Crossed with
Maize
B. oleracea
T. bailloni
B. campestris
Atropa belladonna
N. glutinosa
D. candida
Brassica campestris
Vicia faba

Electrophorasi

Electrophorasi

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman

SISTEM SELEKSI DAN REPORTER


NH2

1. SELEKSI DOMINAN:

CH2

ANTIBIOTIK KELAS AMINOGLYCOSID:

OH

Kanamycin dari Streptomyces kanamyceticus HO

HO

Gentamycin dari Micromonospora purpurea


Neomycin dari Streptomyces fradiae

HO

O
NH2

Streptomycin dari Streptomyces griseus


CH2O O
O

NH2

HO
NH2 OH
STRUKTUR FORMULA KANAMYCIN
Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Dasar-Dasar Bioteknologi Untuk Pemuliaan Tanaman

SELESAI

Dr. Jamsari, Prog. Studi Pemuliaan Tanaman Jurusan BDP-FPUA

Materi VI.
Isolasi gen Target I:
Berbasis Fungsi dan Peta

Copyright Statement:

Dengan ini dinyatakan, bahwa seluruh material (teks,


gambar, grafik dan seluruh alat bantu penjelas lainnya)
bahan kuliah dalam format .ppt sebagaimana tercantum
disini memiliki hak eksklusif intelektual bagi penyusun.
Penggunaan diluar untuk keperluan pembelajaran
sebagaimana disepakati dalam pemberian material harus
mendapatkan izin tertulis dari penyusun dan pelanggaran
dalam hal ini akan dikenakan sanksi hukum sebagaimana
berlaku di Negara Kesatuan Republik Indonesia.

Sub Pokok Bahasan


1. Prinsip dan tujuan isolasi gen
target.
2. Pengertian isolasi gen target
berbasis fungsi.
3. Pengertian isolasi gen target
berbasis posisi/peta.
4. Pengertian dan prinsip penyusunan
peta genetik.

1. Prinsip dan Tujuan Isolasi Gen Target.

Isolasi Gen TargeT

Isolasi gen target

PS

T
Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

Mengisolasi gen mengisolasi DNA


genom

Gn

Gn = DNA genom

G = gen

Hubungan Gen-DNA/Protein
ATGTTACGTCCTGTAGAAACCCC..........GCAGGGAGGCAAACAATGA Gen/DNA
Reverse transkripsi

Transkripsi

AUGUUACGUCCUGUAGAAACCCC..........GCAGGGAGGCAAACAAUGA mRNA
Sekuensing Asam amino

Translasi

MLRPVEUP..........QQGGKQ.

Asam
amino/polipept
ida/protein

Sekuens nukleotida gen GUS


ATGTTACGTCCTGTAGAAACCCCAACCCGTGAAATCAAAAAACTCGACGGCCTGTGGGCATTCAGTCTGGATCGCG
AAAACTGTGGAATTGATCAGCGTTGGTGGGAAAGCGCGTTACAAGAAAGCCGGGCAATTGCTGTGCCAGGCAGT
TTTAACGATCAGTTCGCCGATGCAGATATTCGTAATTATGCGGGCAACGTCTGGTATCAGCGCGAAGTCTTTATACCG
AAAGGTTGGGCAGGCCAGCGTATCGTGCTGCGTTTCGATGCGGTCACTCATTACGGCAAAGTGTGGGTCAATAATC
AGGAAGTGATGGAGCATCAGGGCGGCTATACGCCATTTGAAGCCGATGTCACGCCGTATGTTATTGCCGGGAAAAG
TGTACGTATCACCGTTTGTGTGAACAACGAACTGAACTGGCAGACTATCCCGCCGGGAATGGTGATTACCGACGAA
AACGGCAAGAAAAAGCAGTCTTACTTCCATGATTTCTTTAACTATGCCGGAATCCATCGCAGCGTAATGCTCTACACC
ACGCCGAACACCTGGGTGGACGATATCACCGTGGTGACGCATGTCGCGCAAGACTGTAACCACGCGTCTGTTGACT
GGCAGGTGGTGGCCAATGGTGATGTCAGCGTTGAACTGCGTGATGCGGATCAACAGGTGGTTGCAACTGGACAAG
GCACTAGCGGGACTTTGCAAGTGGTGAATCCGCACCTCTGGCAACCGGGTGAAGGTTATCTCTATGAACTGTGCGT
CACAGCCAAAAGCCAGACAGAGTGTGATATCTACCCGCTTCGCGTCGGCATCCGGTCAGTGGCAGTGAAGGGCGA
ACAGTTCCTGATTAACCACAAACCGTTCTACTTTACTGGCTTTGGTCGTCATGAAGATGCGGACTTGCGTGGCAAAG
GATTCGATAACGTGCTGATGGTGCACGACCACGCATTAATGGACTGGATTGGGGCCAACTCCTACCGTACCTCGCAT
TACCCTTACGCTGAAGAGATGCTCGACTGGGCAGATGAACATGGCATCGTGGTGATTGATGAAACTGCTGCTGTCG
GCTTTAACCTCTCTTTAGGCATTGGTTTCGAAGCGGGCAACAAGCCGAAAGAACTGTACAGCGAAGAGGCAGTCA
ACGGGGAAACTCAGCAAGCGCACTTACAGGCGATTAAAGAGCTGATAGCGCGTGACAAAAACCACCCAAGCGTG
GTGATGTGGAGTATTGCCAACGAACCGGATACCCGTCCGCAAGGTGCACGGGAATATTTCGCGCCACTGGCGGAA
GCAACGCGTAAACTCGACCCGACGCGTCCGATCACCTGCGTCAATGTAATGTTCTGCGACGCTCACACCGATACCAT
CAGCGATCTCTTTGATGTGCTGTGCCTGAACCGTTATTACGGATGGTATGTCCAAAGCGGCGATTTGGAAACGGCAG
AGAAGGTACTGGAAAAAGAACTTCTGGCCTGGCAGGAGAAACTGCATCAGCCGATTATCATCACCGAATACGGCG
TGGATACGTTAGCCGGGCTGCACTCAATGTACACCGACATGTGGAGTGAAGAGTATCAGTGTGCATGGCTGGATAT
GTATCACCGCGTCTTTGATCGCGTCAGCGCCGTCGTCGGTGAACAGGTATGGAATTTCGCCGATTTTGCGACCTCGC
AAGGCATATTGCGCGTTGGCGGTAACAAGAAAGGGATCTTCACTCGCGACCGCAAACCGAAGTCGGCGGCTTTTC
TGCTGCAAAAACGCTGGACTGGCATGAACTTCGGTGAAAAACCGCAGCAGGGAGGCAAACAATGA

Sekuens Asama amino gen GUS


MLRPVETPTREIKKLDGLWAFSLDRENCGIDQRWWESALQESRAI
AVPGSFNDQFADADIRNYAGNVWYQREVFIPKGWAGQRIVLRFD
AVTHYGKVWVNNQEVMEHQGGYTPFEADVTPYVIAGKSVRITVC
VNNELNWQTIPPGMVITDENGKKKQSYFHDFFNYAGIHRSVMLYT
TPNTWVDDITVVTHVAQDCNHASVDWQVVANGDVSVELRDAD
QQVVATGQGTSGTLQVVNPHLWQPGEGYLYELCVTAKSQTECDIY
PLRVGIRSVAVKGEQFLINHKPFYFTGFGRHEDADLRGKGFDNVLM
VHDHALMDWIGANSYRTSHYPYAEEMLDWADEHGIVVIDETAAV
GFNLSLGIGFEAGNKPKELYSEEAVNGETQQAHLQAIKELIARDKNH
PSVVMWSIANEPDTRPQGAREYFAPLAEATRKLDPTRPITCVNVM
FCDAHTDTISDLFDVLCLNRYYGWYVQSGDLETAEKVLEKELLAWQ
EKLHQPIIITEYGVDTLAGLHSMYTDMWSEEYQCAWLDMYHRVF
DRVSAVVGEQVWNFADFATSQGILRVGGNKKGIFTRDRKPKSAAF
LLQKRWTGMNFGEKPQQGGKQ.

2. Pengertian isolasi gen target


berbasis fungsi dan Peta

ISOLASI GEN
FuncTional
cloning

Isolasi Gen TargeT

DikeTahui

PosiTional cloning

Produk

Tidak dikeTahui

biokimia

Analisis ProTein

Posisi
(geneTis/fisik)

Analisis AA

Kloning/Isolasi

Sekuensing

DNA

PE

DNA

T
Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

Isolasi gen target berbasis fungsi

1. Kloning Berbasis Fungsi

Isolasi gen yang didasarkan atas informasi produk biokimia


dari gen Target

PRASYARAT:
ADA PRODUK BIOKIMIA DARI GEN TARGET
DIUJI DENGAN METODE MUTANT KOMPLEMENTER
DITRACE/TELUSURI DARI PROTEIN; ASAM AMINO;
DAN LEVEL ASAM NUKLEOTID (DNA)

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

1. Kloning Berbasis Fungsi

Seleksi
karakTer

IdenTifikasi
biokimiawi

Purifikasi
proTein
TargeT
IdenTifikasi
proTein TargeT
Sekuensing
proTein/DNA

ACGTCTTGAACCT

ACGTCTTGAACCT

1. Kloning Berbasis Fungsi

Problem FuncTional Cloning


Kebanyakan Produk Gen Tidak
DikeTahui
PhenoTyp Yang Bisa DiamaTi
TnTukmengukur Produk Biokimia Gen
TerbaTas
Penggunaannya TerbaTas
Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

2D-elekTrophoresis

Sumber: ProTeomic of M. TrauncaTula, Nagaraj, eT al., (2007)

Maldi Toff

Profil respon Arabidopsis


Thaliana Terhadap kondisi
dingin menggunakan Gas
chromaTography-mass
specTromeTry (GC-MS)

3. Isolasi Gen Berbasis Peta

2. Kloning Berbasis Posisi

PERSYARATAN:
1.TERSEDIA PETA GENETIK YANG AKURAT
MATERIAL DASAR UNTUK MELOKALISASI
POSISI GEN TARGET SECARA GENETIS.
2.TERSEDIANYA PETA FISIK DISEKITAR GEN
TARGET
MATERIAL FISIK POSISI GEN TARGET
SECARA AKTUAL

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

2. Kloning Berbasis Posisi

2. Kloning Berbasis Posisi

Prinsip Penyusunan Peta Genetik


dan Fisik

2. Kloning Berbasis Posisi

PETA GENETIK:

POSISI TARGET GEN SECARA TEORITIS YANG DITENTTKAN


BERDASARKAN HASIL ANALISIS GENETIS SEGREGASI ALELALEL TETUA DAN KETURUNANNYA.

LANGKAH PENYUSUNAN PETA GENETIK:

1. MENEMUKAN PENANDA ANTARA ALLEL DOMINANRESESIF


2. MELAKTKAN PERSILANGAN INDIVIDU YANG
MENGANDUNG ALEL DOMINAN DAN RESESIF
3. MELAKUKAN ANALISIS PEDIGREE POLA PEWARISAN ALELALEL
Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

2. Kloning Berbasis Posisi

Langkah Penyusunan PeTa GeneTik:


Menemukan Penanda AnTara Allel Dominan-resesif
Melakukan Skrining Marker (Bsa=bulked SegreganT
Analysis) (SisTem Penanda: RFLP, AFLP, SSR, STS, SNP, Dll)
UNTUK MEMPEROLEH
MARKER POLYMORPHISME PADA ALEL TARGET
Menggunakan Marker Polymorphismus untuk Melakukan
Analisis Pedigree Alel-alel Dari TeTua Kepada
KeTurunannya
Analisis TauTan (Linkage Analysis) Marker Masing-masing
Alel
MenenTukan Jarak GeneTis

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

2. Kloning Berbasis Posisi

Genotiping Karakter Penotif

2. Kloning Berbasis Posisi

Genotiping Karakter Penotif

2. Kloning Berbasis Posisi

BSA=Bulked SegreganT Analysis


48

49

50

51

52

53

54

55

56

57

58

Bulked segreganT
analysis

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

2. Kloning Berbasis Posisi

Single planT analysis


F M M M M F F F F F M F F F M F F M F M F M M M M M F M M M M MM M M M M M M M M M M M

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

2. Kloning Berbasis Posisi

L5

Peta Genetik kromosm L5


terdiri dari 19 marker AFLP
dan 5 marker STS, serta
lokus sex (M)

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

2. Kloning Berbasis Posisi

Hibridisasi fragmen lokus marker AFLP secara In Situ

Hibridisasi Southern bloT

Fluorescence in situ hybridization


(FISH)

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

2. Kloning Berbasis Posisi

2. PENYTSTNAN PETA FISIK


PeTa fisik : peTa posisi suaTu lokus (gen) TerTenTu yang besarannya
dinyaTakan dengan saTuan pasangan basa (pb) aTau basepair
(bp)
PeTa fisik disusun dari:
1. Hibridisasi in-siTu dengan menggunakan probe-probe spesifik yang
posisinya secara geneTik sudah dikeTahui
2. Menggunakan sekuens DNA berukuran besar (HMW) yang dicerna
dengan rarecuTTer dan dirunning dengan PFGE, dihibridisasi dengan
probe yang posisi geneTiknya sudah dikeTahui

3. Penyusunan conTig dari klon-klon yang mengandung insersi dengan


ukuran besar (PAC, Kosmid, BAC, YAC, dll.).

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

2. Kloning Berbasis Posisi

cM

PENYTSTNAN PETA FISIK

0.0

PM3159

7.8
15.4
18.2
24.7
25.6

PM3449
PM4461
PM4151
STS3660
EM3660

25.6
27.9
28.0
29.5

EM4447.2
EM4447.1
EM3950

30.0
30.0
33.8

EM3156
STS3156
SEX (M)
STS4150.3
STS4150.2
STS4150.1
EM4150
EM3353
PM3551
EM3251

33.8

EM4654

36.8
36.8
40.1
42.1

PM4455
PM3648
PM3262
PM4050

55.3

PM 3148

29.6
29.7
29.8
29.8
29.9
30.0

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

2. Kloning Berbasis Posisi

Sumber: SMR-BTTner

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

2. Kloning Berbasis Posisi

BioTeknologi TnTuk PerlinTan

2. PENYTSTNAN PETA FISIK

Hibridisasi in-siTu :

Sumber: SMR-BTTner
Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

HMW-DNA

HMW-DNA di resTriksi
dengan enzim RarecuTTer

1 2 3 4 5 6 7 8 9 10

1 2 3 4 5 6 7 8 9 10
750 kb

SouThern

500 kb

Transfer;
Hibridisasi
dengan

350 kb

150 kb

spesific
probe

50 kb

20 kb

5 kb

Sumber: SMR-BTTner

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

PENYTSTNAN PETA FISIK DGN. KLON BERINSERSI BESAR


. planT maTerial : YY male planTs
vecTor: pBeloBAC-kan, pBeloBAC11
hosT: DH10B (E. coli)

resTricTion cloning siTes : HindIII, BamHI


BAC inserT size

kb

50

194.0

40

145.5

30

97.0
Frequency

20

48.5
23.1

10
200

175

150

125

75

50

100

9.4

0
25

no. of clones in a size


class

BAC inserT size disTribuTion

VecTor

size (kb)

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

2. PENYUSUNAN PETA FISIK

M 1 2 3 E V P11

P19 RA

RH C1

C12 MT73-MT76 3 2 1 M

300 bp

PTSTAKA BAC
*
200 bp

AFLP-BASED SCREENING
100 bp

*
*
M 1

E V

P91

B C

MT361-MT364

COLONY HYBRIDIZATION

434 bp

184 bp

165F12
124 bp

PCR-BASED SCREENING
Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

2. Kloning Berbasis Posisi

Kombinasi Primer untuk Skrining Klon-klon BAC

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

2. Kloning Berbasis Posisi

Assembling Contig
A

1 2 3 4 5 6 7 8
A

12 kb
6 kb

77E 7

73F6

4 kb
B

2 kb

54G 8

1 kb
364C 6

0.5 kb
55B 1

347D 2

1 2 3 4 5 6 7 8

1 2 3 4 5 6 7 8
45B 2

12 kb
6 kb

3E 11

4 kb

407A 8
10C 2

2 kb
1 kb

373B 5
= SP6-end
= T7-end

0.5 kb
115G 11

100 k b

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

Perbandingan Peta Genetik dan Fisik


~ 106 kb/cM

~ 880 kb/cM
383B 6

385C3

77E7

364C6 381C5

407A8

73F6

4.34

0.47

0.44

0.86

46C7

0.20

0.07

115G11

10C2

EM3353

EM3156
STS3156
STS4150.1
EM4150
PM3551

EM4447.1

PM3159

EM3950

EM4447.2

55B1

373B 5

3E11

0.33

EM4654

151F5

347D2
45B2

54G8

3.27

cM

9.94 cM

555 kb (3-4 CW???)

EM4150

EM4447.1

1.06 cM = 932 kb

Prediksi Gap

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

2. Kloning Berbasis Posisi

Chromosome Walking !!!


1. Jika berTemu dengan daerah sekuens repeTiTive,
maka proses walking Tidak bisa dilanjuTkan
2. MendapaTkan ujung klon yang bersifaT single
copy cukup suliT

3. Jika daerah TargeT merupakan daerah cold spoT


region maka korelasi jarak fisik dengan jarak
geneTik bisa sangaT Tinggi, sehingga beberapa
kali walking harus dilakukan

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

555 kb (3-4 CW???)

EM4150

1.06 cM = 932 kb
EM4447.1

2. Kloning Berbasis Posisi

Chromosome Walking

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA

Sekuens nukleotida gen GUS


ATGTTACGTCCTGTAGAAACCCCAACCCGTGAAATCAAAAAACTCGACGGCCTGTGGGCATTCAGTCTGGATCGCG
AAAACTGTGGAATTGATCAGCGTTGGTGGGAAAGCGCGTTACAAGAAAGCCGGGCAATTGCTGTGCCAGGCAGT
TTTAACGATCAGTTCGCCGATGCAGATATTCGTAATTATGCGGGCAACGTCTGGTATCAGCGCGAAGTCTTTATACCG
AAAGGTTGGGCAGGCCAGCGTATCGTGCTGCGTTTCGATGCGGTCACTCATTACGGCAAAGTGTGGGTCAATAATC
AGGAAGTGATGGAGCATCAGGGCGGCTATACGCCATTTGAAGCCGATGTCACGCCGTATGTTATTGCCGGGAAAAG
TGTACGTATCACCGTTTGTGTGAACAACGAACTGAACTGGCAGACTATCCCGCCGGGAATGGTGATTACCGACGAA
AACGGCAAGAAAAAGCAGTCTTACTTCCATGATTTCTTTAACTATGCCGGAATCCATCGCAGCGTAATGCTCTACACC
ACGCCGAACACCTGGGTGGACGATATCACCGTGGTGACGCATGTCGCGCAAGACTGTAACCACGCGTCTGTTGACT
GGCAGGTGGTGGCCAATGGTGATGTCAGCGTTGAACTGCGTGATGCGGATCAACAGGTGGTTGCAACTGGACAAG
GCACTAGCGGGACTTTGCAAGTGGTGAATCCGCACCTCTGGCAACCGGGTGAAGGTTATCTCTATGAACTGTGCGT
CACAGCCAAAAGCCAGACAGAGTGTGATATCTACCCGCTTCGCGTCGGCATCCGGTCAGTGGCAGTGAAGGGCGA
ACAGTTCCTGATTAACCACAAACCGTTCTACTTTACTGGCTTTGGTCGTCATGAAGATGCGGACTTGCGTGGCAAAG
GATTCGATAACGTGCTGATGGTGCACGACCACGCATTAATGGACTGGATTGGGGCCAACTCCTACCGTACCTCGCAT
TACCCTTACGCTGAAGAGATGCTCGACTGGGCAGATGAACATGGCATCGTGGTGATTGATGAAACTGCTGCTGTCG
GCTTTAACCTCTCTTTAGGCATTGGTTTCGAAGCGGGCAACAAGCCGAAAGAACTGTACAGCGAAGAGGCAGTCA
ACGGGGAAACTCAGCAAGCGCACTTACAGGCGATTAAAGAGCTGATAGCGCGTGACAAAAACCACCCAAGCGTG
GTGATGTGGAGTATTGCCAACGAACCGGATACCCGTCCGCAAGGTGCACGGGAATATTTCGCGCCACTGGCGGAA
GCAACGCGTAAACTCGACCCGACGCGTCCGATCACCTGCGTCAATGTAATGTTCTGCGACGCTCACACCGATACCAT
CAGCGATCTCTTTGATGTGCTGTGCCTGAACCGTTATTACGGATGGTATGTCCAAAGCGGCGATTTGGAAACGGCAG
AGAAGGTACTGGAAAAAGAACTTCTGGCCTGGCAGGAGAAACTGCATCAGCCGATTATCATCACCGAATACGGCG
TGGATACGTTAGCCGGGCTGCACTCAATGTACACCGACATGTGGAGTGAAGAGTATCAGTGTGCATGGCTGGATAT
GTATCACCGCGTCTTTGATCGCGTCAGCGCCGTCGTCGGTGAACAGGTATGGAATTTCGCCGATTTTGCGACCTCGC
AAGGCATATTGCGCGTTGGCGGTAACAAGAAAGGGATCTTCACTCGCGACCGCAAACCGAAGTCGGCGGCTTTTC
TGCTGCAAAAACGCTGGACTGGCATGAACTTCGGTGAAAAACCGCAGCAGGGAGGCAAACAATGA

SELESAI

Dr. Jamsari, Prog. STudi Pemuliaan Tanaman Jurusan BDP-FPTA