Anda di halaman 1dari 30

PEMICU 1 AGAMA

HUMANIORA
Tumor Ganas

LO 1:Definisi,Unsur dan Syarat


Euthanasia

Definisi Eutanasia Menurut terminologis


(BahasaYunani:-,euyangartinya
indah,bagus,terhormat,dan
,thanatosyangberartikematian)adalah
praktikpencabut
kehidupanmanusiaatauhewanmelaluicara
yangdianggaptidakmenimbulkanrasasakit
ataumenimbulkanrasasakityangminimal,
biasanyadilakukandengancaramemberikan
suntikanyangmematikan.

Euthanasia Menurut Etimologis


Hippokratespertamakalimenggunakanistilah"eutanasia"inipada
"sumpahHippokrates"yangditulispadamasa400-300SM.
Sumpahtersebutberbunyi:"Sayatidakakanmenyarankandanatau
memberikanobatyangmematikankepadasiapapunmeskipuntelah
dimintakanuntukitu".
DalamsejarahhukumInggrisyaitucommon lawsejaktahun1300
hinggasaat"bunuhdiri"ataupun"membantupelaksanaanbunuh
diri"tidakdiperbolehkan.
Eutanasia dalam dunia modern
Sejakabadke-19,eutanasiatelahmemicutimbulnyaperdebatan
danpergerakandiwilayahAmerikaUtaradandiEropaPadatahun
1828undang-undangantieutanasiamulaidiberlakukandinegara
bagianNewYork,yangpadabeberapatahunkemudian
diberlakukanpulaolehbeberapanegarabagian.
SetelahmasaPerangSaudara,beberapaadvokatdan
beberapadoktermendukungdilakukannyaeutanasiasecara
sukarela.

Kelompok-kelompokpendukungeutanasiamulanyaterbentukdiInggrispada
tahun1935dandiAmerikapadatahun1938yangmemberikandukungannya
padapelaksanaaneutanasiaagresif,walaupundemikianperjuanganuntuk
melegalkaneutanasiatidakberhasildigolkandiAmerikamaupunInggris.
Padatahun1937,eutanasiaatasanjurandokterdilegalkan
diSwisssepanjangpasienyangbersangkutantidakmemperoleh
keuntungandaripadanya.
Padaerayangsama,pengadilanAmerikamenolakbeberapapermohonan
daripasienyangsakitparahdanbeberapaorangtuayangmemilikianak
cacatyangmengajukanpermohonaneutanasiakepadadoktersebagai
bentuk"pembunuhanberdasarkanbelaskasihan".
Padatahun1939,pasukanNaziJermanmelakukansuatutindakan
kontroversialdalamsuatu"program"eutanasiaterhadapanak-anakdibawah
umur3tahunyangmenderitaketerbelakanganmental,cacattubuh,ataupun
gangguanlainnyayangmenjadikanhidupmerekatakberguna.Programini
dikenaldengannamaAksi T4 ("Action T4")yangkelakdiberlakukanjuga
terhadapanak-anakusiadiatas3tahundanparajompo/lansia.
Eutanasia pada masa setelah perang dunia
SetelahduniamenyaksikankekejamanNazidalammelakukankejahatan
eutanasia,padaeratahun1940dan1950makaberkuranglahdukungan
terhadapeutanasia,terlebih-lebihlagiterhadaptindakaneutanasiayang
dilakukansecaratidaksukarelaataupunkarenadisebabkanoleh
cacatgenetika.

EuthanasiadariaspekHukum
UUyangtertulisdalamKUHPhanyamelihatdoktersebagaipelakuutama
euthanasia,khususnyaeuthanasiaaktifdandianggapsebagaisuatu
pembunuhanberencana,ataudengansengajamenghilangkannyawa
seseorang.Dalamaspekhukum,dokterselalupadapihakyang
dipersalahkandalamkasuseuthanasia,tanpamelihatlatarbelakang
dilakukannyaeuthanasiatersebut,tidakpeduliapakahtindakantersebut
ataspermintaanpasienitusendiriataukeluarganya,untukmengurangi
penderitaanpasiendalamkeadaansekaratataurasasakityangsangat
hebatyangbelumdiketahuipengobatannya.Dilainpihakhakimdapat
menjatuhkanpidanamatibagiseseorangyangmasihsegarbugaryang
tentunyamasihinginhidup,danbukanmenghendakikematiannyaseperti
pasienyangsnagatmenderitatersebut,tanpadijeratolehpasaldalamUU
yangterdapatdalamKUHP.BeberapapasalyangterdapatdalamKUHP
yangberkaitandenganeuthanasiaantaralainpasal338,340,344,345dan
359.Hubunganhukumdokter-pasienjugadapatditinjaudarhukum
perdata.SecaraformaltindakaneuthanasiadiIndonesiabelummemiliki
dasarhukumsehinggaselaluterbukakemungkinanterjadinyapenuntutan
hukumterhadapeuthanasiayangdilakukan.

EuthanasiadariaspekHAM
HAMselaludikaitkandenganhakhidup,damaidan
sebagainya.Tapitidaktercantumdenganjelas
adanyahakseseoranguntukmati.Matijustru
dikaitkandenganpelanggaranHAM.Haliniterbukti
dariaspekhukumeuthanasia,yangcenderung
menyalahkantenagamedisdalam
euthanasia.Sebetulnyadengandianutnyahakuntuk
hiduplayakdansebagainya,secaratidaklangsung
seharusnyaterbersithakuntukmati,apabiladipakai
untukmenghindarkandiridarisegala
ketidaknyamanan(penderitaanyanghebat).

Aspek Agama

KelahirandankematianmerupakanhakdariTuhansehingga
tidakadaseorangpundiduniainiyangmempunyaihakuntuk
memperpanjangataumemperpendekumurnyasendiri.
Pernyataanahli-ahliagamasecarategasmelarangtindakan
euthanasia,apapunalasannya.Dokterbisadikategorikan
melakukandosabesardanmelawankehendakTuhanyaitu
memperpendekumur.Orangyangmenghendakieuthanasia,
walaupundenganpenuhpenderitaanbahkankadangkadang
dalamkeadaansekarat,dapatdikategorikanputusasa,dan
putusasatidakberkenandihadapanTuhan.Tapiputusan
hakimdalampidanamatipadaseseorangyangsegarbugar,
dantentunyasangattidakinginmati,dantidakdalam
penderitaanapalagisekarat,tidakpernahdikaitkandengan
pernyataanagamayangsatuini.Aspeklaindaripernyataan
memperpanjangumur,sebenarnyabiladikaitkandengan
usahamedisbisamenimbulkanmasalahlain.

Mengapaorangharuskedokterdanberobatuntuk
mengatasipenyakitnya,kalaumemangumurmutlakdi
tanganTuhan,kalaubelumwaktunya,tidakakanmati.
Kalauseseorangberupayamengobatipenyakitnyamaka
dapatpuladiartikansebagaiupayamemperpanjang
umurataumenundaproseskematian.Jadiupayamedis
pundapatdipermasalahkansebagaimelawankehendak
Tuhan.Dalamhal-halsepertiinimanusiasering
menggunakanstandarganda.Hal-halyangmenurutnya
baik,tidakperlumelihatpadahukumhukumyangada,
ataubahkanmencarikandalillainyangbisamendukung
pendapatnya,tapipadasaatmanusiamerasabahwahal
tersebutkurangcocokdenganhatinya,maka
dikeluarkanlahberbagaidaliluntukmenopangnya.

Aspek IPTEK
Pengetahuankedokterandapatmemperkirakan
kemungkinankeberhasilanupayatindakanmedisuntuk
mencapaikesembuhanataupenguranganpenderitaan
pasien.Apabilasecarailmukedokteranhampirtidakada
kemungkinanuntukmendapatkankesembuhanataupun
penguranganpenderitaan,apakahseseorangtidak
bolehmengajukanhaknyauntuktidakdiperpanjanglagi
hidupnya?Segalaupayayangdilakukanakansia-sia,
bahkansebaliknyadapatdituduhkansuatukebohongan,
karenadisampingtidakmembawakepada
kesembuhan,keluargayanglainakanterseretdalam
pengurasandana

LO 2:Jenis2 Euthanasia

Eutanasia ditinjau dari sudut cara pelaksanaannya


Biladitinjaudaricarapelaksanaannya,eutanasiadapatdibagimenjaditiga
kategori,yaitueutanasiaagresif,eutanasianonagresif,daneutanasiapasif.
Eutanasia agresif,disebutjugaeutanasiaaktif,adalahsuatutindakan
secarasengajayangdilakukanolehdokteratautenagakesehatanlainnya
untukmempersingkatataumengakhirihidupseorangpasien.Eutanasia
agresifdapatdilakukandenganpemberiansuatusenyawayangmematikan,
baiksecaraoralmaupunmelaluisuntikan.Salahsatucontohsenyawa
mematikantersebutadalahtabletsianida.
Eutanasia non agresif,kadangjugadisebuteutanasiaotomatis
(autoeuthanasia)digolongkansebagaieutanasianegatif,yaitu
kondisidimanaseorangpasienmenolaksecarategasdandengansadar
untukmenerimaperawatanmedismeskipunmengetahuibahwa
penolakannyaakanmemperpendekataumengakhirihidupnya.Penolakan
tersebutdiajukansecararesmidenganmembuatsebuah"codicil"
(pernyataantertulistangan).Eutanasianonagresifpadadasarnyaadalah
suatupraktikeutanasiapasifataspermintaanpasienyangbersangkutan.

Eutanasia pasifdapatjugadikategorikansebagaitindakaneutanasia
negatifyangtidakmenggunakanalat-alatataulangkah-langkahaktifuntuk
mengakhirikehidupanseorangpasien.Eutanasiapasifdilakukandengan
memberhentikanpemberianbantuanmedisyangdapatmemperpanjang
hiduppasiensecarasengaja.Beberapacontohnyaadalahdengantidak
memberikanbantuanoksigenbagipasienyangmengalamikesulitandalam
pernapasan,tidakmemberikanantibiotikakepada
penderitapneumoniaberat,meniadakantindakanoperasiyangseharusnya
dilakukangunamemperpanjanghiduppasien,ataupunpemberianobat
penghilangrasasakitsepertimorfinyangdisadarijustruakan
mengakibatkankematian.Tindakaneutanasiapasifseringkalidilakukan
secaraterselubungolehkebanyakanrumahsakit.
Penyalahgunaaneutanasiapasifbisadilakukanolehtenagamedismaupun
pihakkeluargayangmenghendakikematianseseorang,misalnyaakibat
keputusasaankeluargakarenaketidaksanggupanmenanggungbeban
biayapengobatan.Padabeberapakasuskeluargapasienyangtidak
mungkinmembayarbiayapengobatan,akanadapermintaandaripihak
rumahsakituntukmembuat"pernyataanpulangpaksa".Meskipunakhirnya
meninggal,pasiendiharapkanmeninggalsecaraalamiahsebagaiupaya
defensifmedis.

Eutanasia ditinjau dari sudut pemberian izin


Ditinjaudarisudutpemberianizinmakaeutanasiadapat
digolongkanmenjaditigayaitu:
Eutanasia di luar kemauan pasien :yaitusuatutindakan
eutanasiayangbertentangandengankeinginansipasien
untuktetaphidup.Tindakaneutanasiasemacaminidapat
disamakandenganpembunuhan.
Eutanasia secara tidak sukarela:Eutanasiasemacam
iniadalahyangseringkalimenjadibahanperdebatandan
dianggapsebagaisuatutindakanyangkeliruoleh
siapapunjuga.Haliniterjadiapabilaseseorangyangtidak
berkompetenatautidakberhakuntukmengambilsuatu
keputusanmisalnyastatusnyahanyalahseorangwalidari
sipasien(sepertipadakasusTerriSchiavo).Kasusini
menjadisangatkontroversialsebabbeberapaorangwali
mengakumemilikihakuntukmengambilkeputusanbagisi
pasien.
Eutanasia secara sukarela:dilakukanataspersetujuan
sipasiensendiri,namunhalinijugamasihmerupakanhal
kontroversial.

Euthanasia Dari sudut otonomi Penderita


Darisudutotonomipenderitaeuthanasiadapatdibedakanmenjadi3jenis:
A.Penderitasadardandapatmenyatakankehendakatautidaksadardan
tidakdapatmenyatakankehendak
B.Penderitatidaksadartapipernahmenyatakankehendakdandiwakili
oranglain
C.Penderitatidaksadardankehendaknyadidugaolehoranglain.

Euthanasia dari sudut motif dan prakarsa


Darisudutmotifdanprakarsaeuthanasiadibedakanmenjadidua:
a.Prakarsadaripenderitasendiri,artinyapenderitasendiriyangmemintaagar
hidupnyadihentikanentahkarenapenyakityangtaktersembuhkanatau
karenasebablain
b.Prakarsadaripihakluarartinyaoranglainyangmemintaagarseorangpasien
dihentikankehidupannyakarenaberbagaisebab.Pihaklainitumisalnya
keluarganyadenganmotivasimenghentikanbebanataubelaskasih.Bisa
jugaprakarsaitudatangdaripemerintahkarenaideologiataukepentingan
yanglain.

Euthanasia dari sudut maksud


Dari sudut maksud, euthanasia dibedakan:
a.Euthanasia langsung:tujuan diarahkan
langsung pada kematian.
b.Euthanasia tidak langsung:tujuan tidak
diarahkan langsung untuk kematian tetapi
untuk tujuan lain misal untuk meringankan
penderitaan.

LO 3:Pandangan Agama Terhadap


Jiwa dan Euthanasia

Pandangan Agama Terhadap Jiwa

Pandangan Agama Terhadap Euthanasia


Dalam ajaran gereja Katolik Roma
Sejakpertengahanabadke-20,gerejaKatoliktelah
berjuanguntukmemberikanpedomansejelasmungkin
mengenaipenangananterhadapmerekayangmenderita
sakittaktersembuhkan,sehubungandenganajaranmoral
gerejamengenaieutanasiadansistempenunjang
hidup.PausPiusXII,yangtakhanyamenjadisaksidan
mengutukprogram-programegenetikadaneutanasiaNazi,
melainkanjugamenjadisaksiatasdimulainyasistemsistemmodernpenunjanghidup,adalahyangpertama
menguraikansecarajelasmasalahmoralinidan
menetapkanpedoman.Padatanggal5Meitahun1980,
kongregasiuntukajaranimantelahmenerbitkanDekalarasi
tentangeutanasia("Declaratio de euthanasia")yang
menguraikanpedomaninilebihlanjut,khususnyadengan
semakinmeningkatnyakompleksitassistem-sistem
penunjanghidupdangencarnyapromosieutanasiasebagai
saranayangsahuntukmengakhirihidup."

PausYohanesPaulusIIjugamenegaskan
bahwaeutanasiamerupakantindakanbelas
kasihanyangkeliru,belaskasihanyangsemu:
"Belaskasihanyangsejatimendoronguntuk
ikutmenanggungpenderitaansesama.Belas
kasihanitutidakmembunuhorang,yang
penderitaannyatidakdapatkitatanggung"
(EvangeliumVitae,nomor66).ParaUskup
GerejaKatolikmengukuhkanbahwaeutanasia
itupelanggaranberathukumAllah,karena
berartipembunuhanmanusiayangdisengaja
dandarisudutmoriltidakdapatditerima
(EvangeliumVitae,No.65).

Dalam ajaran agama Buddha


AjaranagamaBuddhasangatmenekankankepada
maknadarikehidupandimanapenghindaranuntuk
melakukanpembunuhanmakhlukhidupadalah
merupakansalahsatumoraldalamajaranBudha.
Berdasarkanpadahaltersebutdiatasmakanampak
jelasbahwaeuthanasiaadalahsesuatuperbuatanyang
tidakdapatdibenarkandalamajaranagamaBudha.
Selaindaripadahaltersebut,ajaranBudhasangat
menekankanpada"welasasih"("karuna")
Mempercepatkematianseseorangsecaratidakalamiah
adalahmerupakanpelanggaranterhadapperintahutama
ajaranBudhayangdengandemikiandapatmenjadi
"karma"negatifkepadasiapapunyangterlibatdalam
pengambilankeputusangunamemusnahkankehidupan
seseorangtersebut.

. Euthanasia Menurut Agama Kristen Protestan

GerejaProtestanterdiridariberbagaidenominasiyangmanamemiliki
pendekatanyangberbeda-bedadalampandangannyaterhadapeutanasia
danorangyangmembantupelaksanaaneutanasia.
Beberapapandangandariberbagaidenominasitersebutmisalnya:
GerejaMethodis(United Methodist church)dalambukuajarannya
menyatakanbahwa:penggunaanteknologikedokteranuntuk
memperpanjangkehidupanpasienterminalmembutuhkansuatukeputusan
yangdapatdipertanggungjawabkantentanghinggakapankahperalatan
penyokongkehidupantersebutbenar-benardapatmendukungkesempatan
hiduppasien,dankapankahbatasakhirkesempatanhiduptersebut.
GerejaLutherandiAmerikamenggolongkannutrisibuatan
danhidrasisebagaisuatuperawatanmedisyangbukanmerupakansuatu
perawatanfundamental.Dalamkasusdimanaperawatanmedistersebut
menjadisia-siadanmemberatkan,makasecaratanggungjawabmoral
dapatdihentikanataudibatalkandanmembiarkankematianterjadi.

Seorangkristianipercayabahwamerekaberadadalamsuatu
posisiyangunikuntukmelepaskanpemberiankehidupandari
Tuhankarenamerekapercayabahwakematiantubuhadalah
merupakansuatuawalperjalananmenujukekehidupanyang
lebihbaik.
Lebihjauhlagi,pemimpingerejaKatolikdanProtestanmengakui
bahwaapabilatindakanmengakhirikehidupaninidilegalisasi
makaberartisuatupemaafuntukperbuatandosa,jugadimasa
depanmerupakansuaturacunbagiduniaperawatankesehatan,
memusnahkanharapanmerekaataspengobatan.
Sejakawalnya,carapandangyangdilakukankaumkristiani
dalammenanggapimasalahbunuhdiridanpembunuhan
berdasarkanbelaskasihan(mercy killing)adalahdarisudut
kekudusankehidupansebagaisuatupemberianTuhan.
Mengakhirihidupdenganalasanapapunjugaadalah
bertentangandenganmaksuddantujuanpemberiantersebut.

Pandangan Iman Kristen


ImanKristen,secarategasmenolakeuthanasiaaktifini
(entahsuntikmatiataubunuhdiriberbantuan).Alasannya
adalahbahwaTuhanlahyangmemberikankepada
manusianafaskehidupan(Kej2:7),makaTuhanjugalah
yangberhakmemanggilnyakembali.Hidupdanmati
adalahhakprerogatifTuhansebagaiSangKhalik.Alasanalasansepertirasakasihanmelihatpenderitaanpasien,
alasanekonomi,ataukerepotanmenguruspasien,adalah
tidakbisamengesampingkanhakprerogatifAllahtersebut.
Euthanasiaaktifpadahakikatnyasamadengan
membunuh(menghilangkannyawa)pasien,sekalipun
dengandalihyangargumentatif.

Danmanusiasebenarnyaadalahmahlukyangunik.Bedadengan
binatang;tidakadakeberatanuntukmengakhiripenderitaanyang
terjadipadabinatang.Tapimanusiatidakpantasdiperlakukan
dengancarademikian.ManusiadiberianugeraholehTuhanuntuk
melangsungkankehidupannya,akantetapijugauntukmenemui
kematiannya.Kitaharusmerawatnyabaik-baiksampatsaat
terakhir.TentangkematiankitaserahkankepadaTuhan.
Kedua,dalampenderitaanyangsangatitulahkerapmanusia
menemukansesuatuyangpalinghakikidalamhidupnya.
BandingkandenganpengalamanAyubselepasiamelewati
penderitaannya.Ayub42:5,Hanyadarikataorangsajaaku
mendengartentangEngkau,tetapisekarangmatakusendiri
memandangEngkau.DisiniAyubseolahhendakmengatakan.
Duluketikaiamasihsukses,makmur,hidupbergelimang
kemewahaniahanyatahutentangTuhandariajaran-ajarandan
nasihat-nasihatoranglain.Tetapisekarangsetelahiamelewati
berbagaipenderitaanitu,iamengalamisendiriAllah.

Euthanasia menurut Agama Islam

DalambahasaArabdikenaldenganistilahqatluar-rahmaatautaysiralmaut

SyariahIslammengharamkaneuthanasiaaktif,karenatermasukdalam
kategoripembunuhansengaja(al-qatlual-amad)walaupunniatnya
baikyaituuntukmeringankanpenderitaanpasien.Hukumnya
tetapharam,walaupunataspermintaanpasiensendiriatau
keluarganya.

Hukumeuthanasiapasifdalamartimenghentikanpengobatandengan
mencabutalat-alatbantupadapasiensetelahmatinya/rusaknyaorgan
otakhukumnyaboleh(jaiz)dantidakharambagidokter.

Euthanasiadalamkeadaanaktifmaupundalamkeadaanpasif,menurut
fatwaMUI,tidakdiperkenankankarenaberartimelakukanpembunuhan
ataumenghilangkannyawaoranglain.Lebihlanjut,KHMarufAmin
(KetuaKomisiFatwaMajelisUlamaIndonesia)mengatakan,
euthanasiabolehdilakukandalamkondisipasifyangsangatkhusus.

LO 4:Contoh Kasus

Kasus Hasan Kusuma - Indonesia


Sebuahpermohonanuntukmelakukaneutanasiapada
tanggal22Oktober2004telahdiajukanolehseorang
suamibernamaHassanKusumakarenatidaktega
menyaksikanistrinyayangbernamaAgianIsnaNauli,33
tahun,tergolekkomaselama2bulandandisampingitu
ketidakmampuanuntukmenanggungbebanbiaya
perawatanmerupakansuatualasanpula.Permohonan
untukmelakukaneutanasiainidiajukankePengadilan
NegeriJakartaPusat.Kasusinimerupakansalahsatu
contohbentukeutanasiayangdiluarkeinginanpasien.
PermohonaniniakhirnyaditolakolehPengadilanNegeri
JakartaPusat,dansetelahmenjalaniperawatanintensif
makakondisiterakhirpasien(7Januari2005)telah
mengalamikemajuandalampemulihankesehatannya.

Kasus seorang wanita New Jersey - Amerika Serikat


Seorangperempuanberusia21tahundariNewJersey,Amerika
Serikat,padatanggal21April1975dirawatdirumahsakitdengan
menggunakanalatbantupernapasankarenakehilangankesadaran
akibatpemakaianalkoholdanzatpsikotropikasecara
berlebihan.Olehkarenatidaktegamelihatpenderitaansanganak,
makaorangtuanyamemintaagardoktermenghentikanpemakaian
alatbantupernapasantersebut.Kasuspermohonaninikemudian
dibawakepengadilan,danpadapengadilantingkatpertama
permohonanorangtuapasienditolak,namunpadapengadilan
bandingpermohonandikabulkansehinggaalatbantupun
dilepaskanpadatanggal31Maret1976.Pascapenghentian
penggunaanalatbantutersebut,pasiendapatbernapasspontan
walaupunmasihdalamkeadaankoma.Danbarusembilantahun
kemudian,tepatnyatanggal12Juni1985,pasientersebut
meninggalakibatinfeksiparu-paru(pneumonia).

Terri Schiavo
TerriSchiavo(usia41tahun)meninggalduniadinegara
bagianFlorida,13harisetelahMahkamah
AgungAmerikamemberiizinmencabutpipa
makanan(feedingtube)yangselamainimemungkinkan
pasiendalamkomainimasihdapathidup.Komanya
mulaipadatahun1990saatTerrijatuhdirumahnyadan
ditemukanolehsuaminya,MichaelSchiavo,dalam
keadaangagaljantung.Setelahambulanstimmedis
langsungdipanggil,Terridapatdiresusitasilagi,tetapi
karenacukuplamaiatidakbernapas,iamengalami
kerusakanotakyangberat,akibatkekuranganoksigen.
Menurutkalanganmedis,gagaljantungitudisebabkan
olehketidakseimbanganunsurpotasiumdalamtubuhnya.
Olehkarenaitu,dokternyakemudiandituduhmalapraktik
danharusmembayargantirugicukupbesarkarenadinilai
lalaidalamtidakmenemukankondisiyang
membahayakaninipadapasiennya.

SetelahTerriSchiavoselama8tahunberadadalamkeadaankoma,maka
padabulanMei1998suaminyayangbernamaMichaelSchiavo
mengajukanpermohonankepengadilanagarpipaalatbantumakanan
padaistrinyabisadicabutagaristrinyadapatmeninggaldengantenang,
namunorangtuaTerriSchiavoyaituRobertdanMarySchindler
menyatakankeberatandanmenempuhlangkahhukumgunamenentang
niatmenantumerekatersebut.DuakalipipamakananTerridilepaskan
denganizinpengadilan,tetapisesudahbeberapahariharusdipasang
kembaliatasperintahhakimyanglebihtinggi.Ketikaakhirnyahakim
memutuskanbahwapipamakananbolehdilepaskan,makaparapendukung
keluargaSchindlermelakukanupaya-upayagunamenggerakkanSenat
AmerikaSerikatagarmembuatundang-undangyangmemerintahkan
pengadilanfederaluntukmeninjaukembalikeputusanhakimtersebut.
Undang-undanginilangsungdidukungolehDewanPerwakilanAmerika
SerikatdanditandatanganiolehPresidenGeorgeWalkerBush.Tetapi,
berdasarkanhukumdiAmerikakekuasaankehakimanadalahindependen,
yangpadaakhirnyaternyatahakimfederalmembenarkankeputusanhakim
terdahulu.

Kasus "Doctor Death"


Dr.JackKevorkiandijuluki"Doctor Death",sepertidilaporkanLoriA.Roscoe.Pada
awalApril1998,diPusatMedisAdvenGlendale,Californiadidugapuluhanpasien
telah"ditolong"olehKevorkianuntukmengakhirihidup.Kevorkianberargumenapa
yangdilakukannyasematademi"menolong"pasien-pasiennya.Namun,para
penentangnyamenyebutapayangdilakukannyaadalahpembunuhan.
Kasus rumah sakit Boramae - Korea
Padatahun2002,adaseorangpasienwanitaberusia68tahunyangterdiagnosa
menderitapenyakitsirosishati.Tigabulansetelahdirawat,seorangdokterbermarga
Parkumur30tahun,telahmencabutalatbantupernapasan(respirator)atas
permintaananakperempuansipasien.PadaDesember2002,anaklelakialmarhum
tersebutmemintapolisiuntukmemeriksakakakperempuannyabesertaduaorang
dokteratastuduhanmelakukanpembunuhan.Seorangdokteryangbernamadr.Park
mengatakanbahwasipasiensebelumnyatelahmemintauntuktidakdipasangialat
bantupernapasantersebut.Satuminggusebelummeninggalnya,sipasienamat
menderitaolehpenyakitsirosishatiyangtelahmencapaistadiumakhir,dandokter
mengatakanbahwawalaupunrespiratortidakdicabutpun,kemungkinanhanyadapat
bertahanhidupselama24jamsaja.

LO 5:Solusi

Solusi untuk kasus dalam pemicu ini adalah


memberikan alternatif perawatan/pengobatan
di rumah terhadap pasien,dan alternatif lainnya
adalah terpaksa dilakukan euthanasia
pasif,yaitu menghentikan obat obatan yang
diberikan pada pasien sehingga apabila pasien
tersebut pada akhirnya mengalami
kematian,yang terjadi pada pasien tersebut
adalah kematian yang alamiah,tentunya dengan
persetujuan keluarga pasien .

Namunsedapatmungkineuthanasiadihindarikarena
beberapaalasan:
1.Manusiatidakbolehmemaksaoranguntuktetap
hidup.Jikakitatidakbolehmemaksaoranguntuktetap
hidup,makakitajugatidakbolehmemaksaoranguntuk
mati,sekronisapapunpenyakitnyakitatidakboleh
membunuhnya.
2.Untukmasalahtidakdapatmembayarbiaya
kesehatan,inimembutuhkancampurtanganpemerintah
untukmenjaminkesehatanwarganya.Mekanismenya
bisamelaluijaminankesehatanatau
asuransi.Dibutuhkankepedulian
dankeseriusandaripemerintahagartidakadalagi
warganyayangharusmeninggal,dansecaratidaksadar
melakukaneuthanasia,hanyakarenaketidaktersediaan
biaya.

Anda mungkin juga menyukai