Anda di halaman 1dari 18

INSULIN RESEPTOR

Nama Kelompok :
1.
2.
3.
4.
5.
6.
7.
8.

Adistasya Satria S

201310410311001

Helma Nadya

201310410311008

Eka Ismiyanti

291319419311926

Nur Muhammad Aminullah 201310410311014


Lindasari Safitri
Cynthia Anggi P

Novia Rizki Nurlaily


Nabella Murtadho

201310410311034
201310410311040
201310410311049
201310410311278

PENGERTIAN
Insulin

Hormon yang terdiri dari rangkaian asam amino yang


dihasilkan oleh sel kelenjar beta pankreas.
Insulin

reseptor

Suatu protein kinase yang merupakan glikoproteinglikoprotein


membran
dan
merupakan
reseptor
transmembran yang diaktifasi oleh insulin. Struktur reseptor
insulin terdiri atas 2 subunit dan 2 subunit dalam
konfigurasi 22 yang dihubungkan dengan ikatan disulfida

FUNGSI

Masing-masing subunit glikoprotein ini mempunyai struktur


dan fungsi yang unik,
Sub unit dengan BM 135 kDa berada seluruhnya di luar
sel (ekstraseluler) bertugas untuk mengikat insulin lewat
daerah (domain) yang kaya akan sistein.
Sub unit adalah sub unit dengan BM 95 kDa merupakan
protein transmembran yang merupakan efektor dalam
melaksanakan proses transduksi sinyal.

SINTESIS

Reseptor ini disintesis sebagai peptida rantai tunggal


dalam retikulum endoplasmik kasar dan dengan
cepat mengalami glikosilasi dalam regio aparatus
golgi. Prekursor reseptor insulin manusia mempunyai
1382 asam amino dan terpecah hingga terbentuk
subunit dan yang matur. Gen reseptor insulin
terletak pada kromosom 19. Reseptor insulin ini
ditemukan pada sebagian besar sel mamalia dengan
konsentrasi sampai 20.000 persel.

SINTESIS CONT....
Pada sel lemak, hati dan otot , ikatan insulin pada
reseptor-reseptor ini dikaitkan dengan respon biologik
jaringan-jaringan ini terhadap hormon. Reseptorreseptor ini mengikat insulin secara cepat, dengan
spesifitas tinggi dan affinitas yang cukup tinggi untuk
mengikat dalam jumlah pikomolar

SEQUENCE DNA INSULIN RESEPTOR

CCAGGCCATCTCGGAAACGCAGGTCCCTTGGCGATGTTGGGAATGTGAC
GGTGGCCGTGC
CCACGGTGGCAGCTTTCCCCAACACTTCCTCGACCAGCGTGCCCACGAG
TCCGGAGGAGC
ACAGGCCTTTTGAGAAGGTGGTGAACAAGGAGTCGCTGGTCATCTCCGG
CTTGCGACACTTCACGGGCTATCGCATCGAGCTGCAGGCTTGCAACCAG
GACACCCCTGAGGAACGGTGCAGTGTGGCAGCCTACGTCAGTGCGAGGA
CCATGCCTGAA
GTGAGTATGAGGATTCGGCCGGCGAATGCTGCTCCTGTCCAAAGACAGA
CTCTCAGATCCTGAAGGAGCTGGAGGAGTCCTCGTTTAGGAAGACGTTT
GAGGATTACCTGCACAACGTGGTTTTCGTCCCCAGG
LOKASI :

Homo sapiens insulin receptor (INSR), RefSeqGene on


chromosome 19

SEQUENCE RNA INSULIN RESEPTOR

GGUCCGGUAGAGCCUUUGCGUCCAGGGAACCGCUACAACCCU
UACACUGCCACCGGCACG
GGUGCCACCGUCGAAAGGGGUUGUGAAGGAGCUGGUCGCAC
GGGUGCUCAGGCCUCCUCG
UGUCCGGAAAACUCUUCCACCACUUGUUCCUCAGCGACCAGU
AGAGGCCGAACGCUGUGA
AGUGCCCGAUAGCGUAGCUCGACGUCCGAACGUUGGUCCUGU
GGGGACUCCUUGCCACGU
CACACCGUCGGAUGCAGUCACGCUCCUGGUACGGACUUCACU
CAUACUCCUAAGCCGGCCGCUUACGACGAGGACAGGUUUCUG
UCUGAGAGUCUAGG
ACUUCCUCGACCUCCUCAGGAGCAAAUCCUUCUGCAAACUCC
UAAUGGACGUGUUGCACC AAAAGCAGGGGUCC

KODE ASAM AMINO

5'3' Frame 1
GPVEPLRPGNRYNPYTATGTGATVERGCEGAGRTGAQASSCPE
N S S T T C S S A T S R G R T LStopS A RStopR S S T S E R W S C G D S L P R H T V
GCSHAPGTDFTHTPKPAAYDEDRFLSESLGLPRPPQEQILLQT
PNGRVAPKAGV

> 141 aminoacids; Mw=14728.96Da

GlyProValGluProLeuArgProGlyAsnArgTyrAsnProTyrThrAlaThrGlyThr
GlyAlaThrValGluArgGlyCysGluGlyAlaGlyArgThrGlyAlaGlnAlaSerSer
CysProGluAsnSerSerThrThrCysSerSerAlaThrSerArgGlyArgThrLeuSer
ThrProSerAlaArgSerThrProArgSerSerThrSerGluArgTrpSerCysGlyAsp
SerLeuProArgHisThrValGlyCysSerHisAlaProGlyThrAspPheThrHisThr
ProLysProAlaAlaTyrAspGluAspArgPheLeuSerGluSerLeuGlyLeuProArg
ProProGlnGluGlnIleLeuLeuGlnThrProAsnGlyArgValAlaProLysAlaGlyVal***

KONVERSI KODE ASAM AMINO

5'3' Frame 2
V RStopS L C V Q G T A T T L T L P P A R V P P S K G V V K E L V A R V L R P P R V
RKTLPPLVPQRPVEAERCEVPDSVARRPNVGPVGTPCHVTPSD
A V T L L V R T S L I L L S R P L T T R T G F C L R VStopD F L D L L R S K S F C K L
LMetD V L H Q K Q G S>

143 aminoacids; Mw=15593.41Da

ValArgSerThrProSerLeuCysValGlnGlyThrAlaThrThrLeuThrLeuProPro
AlaArgValProProSerLysGlyValValLysGluLeuValAlaArgValLeuArgPro
ProArgValArgLysThrLeuProProLeuValProGlnArgProValGluAlaGluArg
CysGluValProAspSerValAlaArgArgProAsnValGlyProValGlyThrProCys
HisValThrProSerAspAlaValThrLeuLeuValArgThrSerLeuIleLeuLeuSer
ArgProLeuThrThrArgThrGlyPheCysLeuArgValSerThrProAspPheLeuAsp
LeuLeuArgSerLysSerPheCysLysLeuLeuMetGluThrAspValLeuHisGlnLys
GlnGlySer***

5'3' Frame 3
S G R A F A S R E P L Q P L H C H R H G C H R R K G LStopR S W S H G C S G L L V S G K
L F H H L F L S D QStopR P N A V K C P I AStopL D V R T L V L W G L L A T S H R
RMetQ S R S W Y G L H S Y SStopA G R L R R G Q V S VStopE S R T S S T S S G A N P S
A N SStopW T C C T K S R G

> 150 aminoacids; Mw=16393.42Da

SerGlyArgAlaPheAlaSerArgGluProLeuGlnProLeuHisCysHisArgHisGly
CysHisArgArgLysGlyLeuSerThrProArgSerTrpSerHisGlyCysSerGlyLeu
LeuValSerGlyLysLeuPheHisHisLeuPheLeuSerAspGlnSerThrProArgPro
AsnAlaValLysCysProIleAlaSerThrProLeuAspValArgThrLeuValLeuTrp
GlyLeuLeuAlaThrSerHisArgArgMetGluThrGlnSerArgSerTrpTyrGlyLeu
HisSerTyrSerSerThrProAlaGlyArgLeuArgArgGlyGlnValSerValSerThr
ProGluSerArgThrSerSerThrSerSerGlyAlaAsnProSerAlaAsnSerSerThr
ProTrpThrCysCysThrLysSerArgGly***

3'5' Frame 1
G P L L L V Q H V HStopE F A E G F A P E E V E E V L D S Q T E T C P R R K R P AStopE Y
EStopS P Y Q E R D C I R R C D V A R S P H R T N V R T S S Y A I G H F T A F G L Y W S L R N K
WWKSFPDTRRPEHPCDQLLHNPFRRWHPCRWQCKGCSGSLDAKALPD

143 aminoacids; Mw=16636.76Da

GlyProLeuLeuLeuValGlnHisValHisSerThrProGluPheAlaGluGlyPheAla
ProGluGluValGluGluValLeuAspSerGlnThrGluThrCysProArgArgLysArg
ProAlaSerThrProGluTyrGluSerThrProSerProTyrGlnGluArgAspCysIle
ArgArgCysAspValAlaArgSerProHisArgThrAsnValArgThrSerSerTyrAla
IleGlyHisPheThrAlaPheGlyLeuTyrTrpSerLeuArgAsnLysTrpTrpLysSer
PheProAspThrArgArgProGluHisProCysAspGlnLeuLeuHisAsnProPheArg
ArgTrpHisProCysArgTrpGlnCysLysGlyCysSerGlySerLeuAspAlaLysAla
LeuProAsp***

3'5' Frame 2
D P C F W C N T S I R S L Q K D L L L R R S R K SStopT L R Q K P V L V V S G R L R
SMetS E V R T R S V T A S D G V T W Q G V P T G P T F G R R A T L S G T S Q R S A S T
G RStopG T S G G R V F R T R G G L S T R A T S S F T T P F D G G T R A G G S V R V V A
VPWTQRLYRT

> 143 aminoacids; Mw=15469.69Da

AspProCysPheTrpCysAsnThrSerIleArgSerLeuGlnLysAspLeuLeuLeuArg
ArgSerArgLysSerSerThrProThrLeuArgGlnLysProValLeuValValSerGly
ArgLeuArgSerMetGluThrSerGluValArgThrArgSerValThrAlaSerAspGly
ValThrTrpGlnGlyValProThrGlyProThrPheGlyArgArgAlaThrLeuSerGly
ThrSerGlnArgSerAlaSerThrGlyArgSerThrProGlyThrSerGlyGlyArgVal
PheArgThrArgGlyGlyLeuSerThrArgAlaThrSerSerPheThrThrProPheAsp
GlyGlyThrArgAlaGlyGlySerValArgValValAlaValProTrpThrGlnArgLeu
TyrArgThr***

3'5' Frame 3
T P A F G A T R P L G V C R R I C SStopG G R G S P R L S D R N L S S SStopA A G L G
VStopV K S V P G AStopL H P T VStopR G K E S P Q D Q R S D V E L R Y R A L H S V R
P L L V A E E Q V V E E F S G H E E AStopA P V R P A P S Q P L S T V A P V P V A
VStopG LStopR F P G R K G S T G

152 aminoacids; Mw=15681.56Da

ThrProAlaPheGlyAlaThrArgProLeuGlyValCysArgArgIleCysSerSerThr
ProGlyGlyArgGlySerProArgLeuSerAspArgAsnLeuSerSerSerSerThrPro
AlaAlaGlyLeuGlyValSerThrProValLysSerValProGlyAlaSerThrProLeu
HisProThrValSerThrProArgGlyLysGluSerProGlnAspGlnArgSerAspVal
GluLeuArgTyrArgAlaLeuHisSerValArgProLeuLeuValAlaGluGluGlnVal
ValGluGluPheSerGlyHisGluGluAlaSerThrProAlaProValArgProAlaPro
SerGlnProLeuSerThrValAlaProValProValAlaValSerThrProGlyLeuSer
ThrProArgPheProGlyArgLysGlySerThrGly

PUSTAKA

http://blast.ncbi.nlm.nih.gov/Blast.cgi :

http://web.expasy.org/cgi-bin/translate/dna_aa

http
://www.peptide2.com/mainNew_amino_acid_conve
rter.php

Indah sari, mutiara (2007). Insulin Reseptor.


Fakultas Kedokteran Universitas Sumatra
Utara.