Anda di halaman 1dari 13

MAKALAH

TEKNOLOGI FERMENTASI PANGAN


PEMBUATAN WINE NANAS

OLEH
KELOMPOK II
ASNA AZKIA
DESAK MADE GALIH PERTIWI
HARDYANTI
LALE WIRA SELVIANA C.
NEDIA PRAMESWARI
RABIATUL ADAWIYAH
ZAIFA AYU WIRYANI

J1A 013 008


J1A 013 026
J1A 013 044
J1A 013 062
J1A 013 088
J1A 013 104
J1A 013 164

PROGRAM STUDI ILMU DAN TEKNOLOGI PANGAN


FAKULTAS TEKNOLOGI PANGAN DAN AGROINDUSTRI
UNIVERSITAS MATARAM
2016

KATA PENGANTAR
PujisyukurataskehadiratTuhan

Yang

MahaEsakarenaatasberkah,

rahmatdanhidayahnyapenyusundapatmenyelesaikanmakalahinipadawaktu

yang

telahditentukan.Makalahinidisusundengantujuanuntukmeningkatkanaktifitasbelaja
rmahasiswa

yang

tengahmempelajarimatakuliahTeknologiFermentasiPangan,

khususnyamahasiswaIlmudanTeknologiPangan di FakultasTeknologiPangandan
Agroindustri Universitastahun 2016.
Ucapanterimakasihpenyusunhaturkankepadasemuapihak

yang

telahmembantudalampenyusunanmakalahini.Penyusunmenyadarisepenuhnyabahw
amakalahinitidakluputdarikekurangan.Olehkarenanyakritikdan

saran

penyusunharapkansebagailangkahperbaikankedepannya.Akhir

kata,

semogamakalahinidapatbermanfaatbagikitasemua.
Mataram, Januari 2016
Penyususn

BAB I
PENDAHULUAN

A. LATAR BELAKANG

Banyak orang yang suka minum wine dan beberapa tidak minum
bukan karena tidak suka namun karena larangan agama. Meskipun hanya
sebuah minuman namun pembuatan wine tidak semudah pembuatan fast
food. Perlu banyak alat dan persyaratan agar pembuatan wine berhasil
dengan baik. Karena dalam pembuatan wine dibutuhkan mikrooganisme
dalam prosesnya.
Bahan yang utama diperlukan adalah buah yang di ambil sari
buahnya. Selain buah diperlukan juga peralatan (fermentor) dan
mikroorganisme yaitu yang bersumber dari khamir, dan nutrisi tambahan
untuk menunjang pertumbuhan mikroorganisme. Buah yang baik untuk
digunakan dalam pembuatan wine apabila mengandung asam-asam seperti
asam tartart, malat dan sitrat.
Nanas, nenas,atau ananas (Ananas comosus (L.) Merr.) adalah
sejenis tumbuhan tropis yang berasal dari Brasil, Bolivia, dan Paraguay.
Tumbuhan

ini

termasuk

nanasan(Famili Bromeliaceae).

dalam

familia

nanas-

Perawakan(habitus)

tumbuhannyarendahherba(menahun) dengan 30 atau lebih daunyang


panjang,berujung tajam, tersusun dalam bentuk roset mengelilingi batang
yang tebal. Buahnya dalam bahasa Inggris disebut sebagai pineapple
karena bentuknya yang seperti pohon pinus. Nanas (Ananas sativus)
merupakan salah satu jenis buah tropis yang terdapat di Indonesia dan
mempunyai penyebaran yang merata. Buah nanas banyak dimanfaatkan
oleh sebagian besar masyarakat Indonesia untuk kebutuhan konsumsi.
Selain dikonsumsi dalam kondisi segar, nanas juga banyak digunakan
sebagai bahan baku industri pertanian dengan berbagai hasil produk
macam olahan nanas seperti selai, manisan, sirup, dodol, keripik, buah
kaleng dan lain-lain.
Kandungan gizi buah Nanas segar (dalam 100 gram bahan)
KandunganGizi
Jumlah

Kalori
Protein
Lemak
Karbohidrat
Fosfor
ZatBesi
Vitamin A
Vitamin B1
Vitamin C
Air
Bagiandapatdimakan

Fermentasi adalah

proses

52 kal
0,40 g
0,20 g
16 g
11 mg
0,30 mg
130 SI
0.08 mg
24 mg
85,3 g
53%

produksi

energi

dalam sel dalam

keadaan anaerobik (tanpa oksigen). Secara umum, fermentasi adalah salah


satu bentuk respirasi anaerobik, akan tetapi, terdapat definisi yang lebih
jelas yang mendefinisikan fermentasi sebagai respirasi dalam lingkungan
anaerobik dengan tanpa akseptor elektron eksternal.
Gula adalah bahan yang umum dalam fermentasi. Beberapa contoh
hasil fermentasi adalah etanol, asam laktat, dan hidrogen. Akan tetapi
beberapa komponen lain dapat juga dihasilkan dari fermentasi seperti asam
butirat dan aseton. Ragi dikenal

bahan yang umum digunakan dalam

fermentasi untuk menghasilkan etanol dalam bir, anggur dan minuman


beralkohol lainnya.
Anggur/wine adalah suatu minuman beralkohol yang rasanya
manis, berbau harum dan dibuat dengan cara fermentasi dari sari buah oleh
suatu mikroorganisme, yaitu ragi (yeast) dari jenis Saccharomyces
cerevisiae. Khamir ini akan mengubah gula menjadi alkohol dan CO2.
Waktu fermentasi berkisar antara 7-14 hari. Dalam perombakan ini
diperlukan pula nutrien yang mendukung pertumbuhan khamir, jika tidak
tersedia pada bahan baku. Bahan yang umum dtambahkan adalah
amonium fosfat sebagai sumber nitrogen.

Reaksi:
C12H22O11 + H2O 2 C6H12O6 4 C2H5OH + 4 CO2
Wine selain dari buah anggur dapat pula dibuat dari sari buahbuahan yang manis seperti nanas, apel, jeruk, tomat, mangga, pepaya,
pisang dll. Hasil fermentasi berbau harum karena mengandung ester dari
asam yang berasal dari buah-buahan dengan alkohol. Untuk pembuatan
anggur buah nanas membutuhkan waktu sekitar 14 hari untuk fermentasi.
B. RumusanMasalah
1. Apa yang dimaksuddengan wine nanas?
2. Bagaimanaprosedurpembuatan wine nanas?
3. Bagaimanapenentuanbiayaproduksi wine nanas?
C. Tujuan
1. Untukmengetahuiapaitu wine nanas
2. Untukmengetahuiprosedurpembuatan wine nanas
3. Untukmenegetahuibiayaproduksi wine nanas

BAB II
PEMBAHASAN
2.1 Definisi Wine Nanas
Wine merupakanminumanberalkohol yang biasanyaterbuatdari jus anggur
yang difermentasi. Keseimbangansifatalami yang terkandungpadabuahanggur,
menyebabkanbuahtersebutdapatdifermentasitanpapenambahangula,
enzyme,

ataupunnutrisi

lain.

Wine

asam,

dibuatdengancaramemfermentasi

buahanggurmenggunakankhamirdari

type

tertentu.

jus
Yeast

tersebutakanmengkonsumsikandungangula

yang

adapadabuahanggurdanmengubahnyamenjadi

alcohol.

Perbedaanvarietasanggurdan strain khamir yang digunakan, tergantungpada type


dari wine yang akandiproduksi (Johnson, 1989).
Bahan

yang

utamadiperlukanadalahbuah

yang

di

ambil

sari

buahnya.Selainbuahdiperlukanjugaperalatan (fermentor) danmikroorganismeyaitu


yang

bersumberdarikhamir,

dannutrisitambahanuntukmenunjangpertumbuhanmikroorganisme.Buah
baikuntukdigunakandalampembuatan

wine

yang

apabilamengandungasam-

asamsepertiasamtartart,

malatdansitrat.

Asamtartartadalahantioksidandanmenghasilkan

rasa

asam.Asammalatjugadikenalsebagaiasam.
Nanas,
nenas,
atauananas

(Ananascomosus

(L.)Merr.)adalahsejenistumbuhantropis yang berasaldariBrasil, Bolivia, dan


Paraguay.

Tumbuhaninitermasukdalamfamilia

nanas-nanasan

(FamiliBromeliaceae).Perawakan (habitus) tumbuhannyarendah, herba (menahun)


dengan

30

ataulebihdaunyangpanjang,

berujungtajam,

tersusundalambentukrosetmengelilingibatang

yang

tebal.BuahnyadalambahasaInggrisdisebutsebagai pineapple karenabentuknya yang


sepertipohonpinus.Nama 'nanas' berasaldarisebutan orang Tupiuntukbuahini:
anana,

yang

bermakna

"buah

(hummingbird)

yang

sangatbaik".

Burungpenghisapmadu

merupakanpenyerbukalamiahdaribuahini,

meskipunberbagaiseranggajugamemilikiperan yang sama. Nanas (Ananassativus)


merupakansalahsatujenisbuahtropis

yang

terdapat

di

Indonesia

danmempunyaipenyebaran

yang

merata.Buah

nanas

banyakdimanfaatkanolehsebagianbesarmasyarakat

Indonesia

untukkebutuhankonsumsi.Selaindikonsumsidalamkondisisegar,

nanas

jugabanyakdigunakansebagaibahanbakuindustripertaniandenganberbagaihasilprod
ukmacamolahan nanas sepertiselai, manisan, sirup, dodol, keripik, buahkalengdan
lain-lain.
Di Indonesia, propinsi Lampung merupakandaerahpenanaman nanas
utama, denganbeberapapabrikpengolahan nanas jugaterdapat di sana.
Tabel 2.1.Kandungangizibuah Nanas segar (dalam 100 gram bahan).
KandunganGizi
Jumlah
Kalori
52 kal
Protein
0,40 g
Lemak
0,20 g
Karbohidrat
16 g
Fosfor
11 mg
ZatBesi
0,30 mg
Vitamin A
130 SI
Vitamin B1
0.08 mg
Vitamin C
24 mg
Air
85,3 g
Bagiandapatdimakan
53%
Wine

nanas

dibuatdengancarafermentasi.

produksienergidalamseldalamkeadaananaerobik

Fermentasiadalah

(tanpaoksigen).

proses

Secaraumum,

fermentasiadalahsalahsatubentukrespirasianaerobik, akantetapi, terdapatdefinisi


yang

lebihjelas

yang

mendefinisikanfermentasisebagairespirasidalamlingkungananaerobikdengantanpa
akseptorelektroneksternal.Keunggulanbuah nanas dibandingkanbuahlainnyaadalah
nanas

merupakanbuahtropisdenganproduksiterbanyak

ke-3,

bahanbakumudahdidapat, harganyamurah, rasanyaenak, memiliki aroma yang


khas, menambahnilaijualbuah nanas sehinggapendapatanpetanimeningkat.

2.2 Prosedurpembuatan wine


Nanas segar
Disortir
Dikupas
Dicucibersih
Dipotongkecil
Dihaluskan
Ditambah air 40% dariberatbuah
Disaring
Dipanaskanpadasuhu 70-800C selama 10 menit
Diatur pH (3-4) denganmenggunakanasamsitrat
Ditambahkangulapasirsebanyak 10%
Dipanaskanpadasuhu 700C selama 20 menit
Didinginkansampaisuhukamar
Dimasukkankedalamfermentor
Ditambahkanstarter (Saccharomyces cerevisiae) 1 gr untuk 1 liter
sari buah
Diinkubasiselama 4 minggu
Wine nanas

Nanas segar yang diperolehdariperkebunan yang ada di daerahLombok


Timursebelumdiprosesharusdilakukanpenyortiranterlebihdahuluuntukmemisahkan
nanas yang busuk agar tidakmempengaruhicitarasa wine yang akandiproduksi.
Setelah

proses

penyortiran,

dapatlangsungdikupasdandicucibersihdengan

buah

air

mengalir.

nanas
Nanas

telahbersihdipotong-potongberukurankeciluntukmempermudahdalam

yang
proses

penghalusanmenggunakan blender. Ditambahkan air sebanyak 40% dariberatbuah


yang

akandihaluskandandisaring.

Penyaringandilakukanuntukmemisahkanampasbuah nanas dari sari buah.Sari


buahkemudiandipanaskanpadasuhu 78-800C selama 10 menit. Proses pembuatan
wine

inimembutuhkankhamirdalamprosesnya,

digunakandapattumbuhbaikpada

pH

3-4

dimanakhamir

sehingga

sari

buah

yang
yang

telahdipanaskanperludilakukanpengaturanpH.pHdapatdiaturdenganpenambahanas
amataubasa.

Apabila

sari

buahmemilikipH

makaperluditambahkanasamsitratsampai
Untukmenambahcitarasadari
darijumlah

sari

wine

buah

pH

sari

diatas
buahmencapai

dapatditambahkangulapasirsebanyak

yang

4
3-4.
10%

digunakankembalidipanaskanpadasuhu

700Cuntukmelarutkangulaselama

20

menit.

Larutankemudiandidinginkansampaisuhukamar.Setelahlarutantelahmencapaisuhu
kamar, larutanditambahkanragi (Saccharomyces cereviseae) sebanyak 1 gr per 1
liter

larutandandiaduksampairagitercampur

rata

kemudiandimasukkankedalamfermentor.Dilakukaninkubasiselama
minggu.Setelah

minggutelahterbentuk

dapatdikemasdalambotolberukuran
tidakterkenamataharilangsung.

800

ml

wine

nanas.

4
Wine

dandiletakkandalamruang

nanas
yang

C. BiayaProduksi
Barang
Nanas
Ragi
Air
Gula air
Botol 800 ml
Label
Krat

Barang
Fermentor
Blender
Nampan
Pisau
Baskom

Harga
Persatuan
3000
200
1500
12.000
25.000
3000
55.000

Harga
Persatuan
15.000.000
1.000.000
10.000
15.000
10.000

BiayaVariabel
Satuan
Biji
1 gram
1 liter
1 kg
1 botol
1 biji
1 kratisi 24

BiayaTetap
Satuan

Jumlah yang Total biaya


dibutuhkan
500
1.500.000
100
20.000
15
22.500
10
120.000
125
3.125.000
125
375.000
6
330.000
5.492.500

Jumlah yang
dibutuhkan
1 fermentor (100
2
L)
1 Buah (20kg)
5
1buah
15
1buah
5
1buah
15

Total biaya
300.000.000
50.000.000
15.000.000
75.000
150.000
35.375.000

Perusahaan memproduksi Wine Nanas sebanyak 125 botoltiapsatu kali


produksidenganharga 115000 rupiah per botolnya

Jadi agar perusahaan balik modal, maka perusahaan harus menjual Wine Nanas
sebanyak 754 unit yang akan kita peroleh selama 6 kali produksi

IRR=

Laba Usaha
Modal Sendiri x 100%

Pendapatan Biayavariabel
IRR= totabiaya
x100 %
14 . 375.000 - 5.492.500
= 40 . 867 .500
x100 %
= 21,7 %
hargaperolehanasettetap - nilairesidu
Penyusutan = umure k onomis a settetap
15.000.000 0
= 10
= 1.500.00

KESIMPULAN
Berdasarkan hasil pembahasan dapat ditarik beberapa kesimpulan sebagai berikut:
1. Wine termasuk minuman beralkohol yang dihasilkan dari fermentasi gula yang
ada di dalam buah nanas.
2. Wine nanas dipilih karena buah nanas dibandingkan buah lainnya adalah buah
tropis dengan produksi terbanyak ke-3, bahan baku mudah didapat, harganya
murah, rasanya enak, memiliki aroma yang khas, menambah nilai jual buah
nanas sehingga pendapatan petani meningkat.
3. Tahap-tahap pembuatan wine meliputi:
-

Penghancuran dan Perlakuan Nanas Sebelum Fermentasi

Fermentasi Alkohol

Proses setelah fermentasi (penyimpanan)

Citarasa Wine

4. Perusahaan memproduksi Wine Nanas sebanyak 125 botol tiap satu kali
produksi dengan harga 115000 rupiah per botolnya. Jadi, nilai BEP perusahaan
harus menjual Wine Nanas sebanyak 754 unit yang akan kita peroleh selama 6
kali produksi
5. Nilai IRR perusahaan sebesar 21,7%
6. Nilai penyusutan untuk produksi wine nanas sebesar Rp. 1.500.000

DAFTAR PUSTAKA
Anonim. 2007. Fermentasi Wine.
http://ptp2007.wordpress.com/2008/02/08/fermentasi-wine/ (Diakses pada
26 Desember 2016).
Anonim. 2009. http://id.wikipedia.org. (Diakses pada hari Rabu, 10 Januari 2016).
Anonim.
2009.
Pembuatan
Wine.
http://lordbroken.wordpress.com/2010/06/14/pembuatan-wine/ (Diakses
pada 26 Desember 2016).
Reed, G. 1975. Enzymes in Food Processing Second Edition. New York:
Academic Press Inc.
Whitaker, John, R. Principles of Enzymology for the Food Science, Second
Edition. New York: Marcel Dekker Inc.