Anda di halaman 1dari 35

Halaman 1

1
Diperbarui Jatuh 2014
Praktik Perawatan Berdasarkan teori (TBNP)
Sebuah dokumen kerja
oleh
University of Tennessee di Chattanooga
Sekolah Keperawatan Fakultas & Mahasiswa
Halaman 2
2
Diperbarui Jatuh 2014
KATA PENGANTAR
Kami berharap paket ini akan menjadi referensi berguna bagi mahasiswa, dosen, serta untuk
Klinis
Guru. Beasiswa dan praktek profesional hanya mungkin dengan refleksi, kritik dan
pertumbuhan, dengan demikian, ini adalah "bekerja" dokumen; saran untuk konten dan
kejelasan secara aktif
diminta. Kewajiban profesionalisme adalah belajar seumur hidup dan refleksi. Orem
mengakui
bahwa pembangunan dalam peran profesional tumbuh sepanjang hidup perawat; Buku
Pegangan ini akan
mengembangkan seperti yang kita tumbuh sebagai Orem ulama dan praktisi.
Beberapa terminologi akan baru bagi Anda; beberapa akan akrab, tetapi digunakan dalam
berbagai
cara. Kata Miring adalah mereka dengan definisi teoritis tertentu sebagaimana ditentukan
oleh Dorothea Orem.
Praktek Keperawatan adalah kompleks membutuhkan waktu dan pengalaman untuk memiliki
pengetahuan
diperlukan untuk praktek keperawatan-untuk tujuan ini, kursus dalam kurikulum ini telah
dikembangkan untuk
membangun satu sama lain untuk memberikan pengetahuan untuk masuk praktek profesional.
Setelah lulus,
tanggung jawab untuk memelihara dan mengembangkan kemampuan Anda, terletak dengan
Anda. Kami berharap Anda
untuk meninggalkan program ini sebagai pengembangan pemimpin, menilai pembelajaran
seumur hidup, dan dengan keinginan untuk memelihara
dan mendukung rekan-rekan lainnya, terutama anggota terbaru dari profesi. Kami harap Anda
tumbuh dan berkembang gairah Anda di keperawatan.
Tentang Dorothea Orem
Dorothea Orem lahir di Baltimore, Maryland pada tahun 1914. Ia menerima ijazah di
keperawatan pada tahun 1934 dari Providence Hospital School of Nursing, Washington, DC
Orem menerima
sarjana sains dalam pendidikan keperawatan pada tahun 1939 dan master ilmu dalam
pendidikan keperawatan
pada tahun 1945 dari Universitas Katolik Amerika, Washington DC Dia memiliki latar
belakang yang bervariasi di
praktek klinis: OR, pediatri, dewasa med-Surg, tugas pribadi, dan ER pengawas. Dia
diajarkan

ilmu biologi, menjabat sebagai direktur pelayanan keperawatan dan direktur sekolah
keperawatan di
Providence Hospital, Detroit, Michigan. Pada tahun 1949, ia pergi ke Negara Badan Indiana
Kesehatan,
Divisi rumah sakit, di mana dia bekerja untuk membantu meningkatkan pelayanan
keperawatan di rumah sakit umum di
Indiana.
Sebagai bagian dari gelar pekerjaan tuannya, Orem harus merumuskan definisi keperawatan.
Selama
1958-1959, ia bekerja sebagai konsultan untuk Dinas Pendidikan, Departemen Kesehatan,
Pendidikan
dan Kesejahteraan di Washington dan berpartisipasi dalam sebuah proyek untuk
meningkatkan pelatihan perawat praktis. Ini
kerja dirangsang dia berusaha untuk mengidentifikasi kondisi atau keadaan di mana
keputusan adalah
dibuat bahwa perawatan yang diperlukan. Jawabannya mencakup gagasan bahwa perawat
adalah "lain diri".
Ide ini berkembang menjadi konsep keperawatan nya "perawatan diri" dan kemudian ke
Defisit Self Care
Teori keperawatan. Perawatan diri menyiratkan bahwa ketika mereka mampu, individu peduli
untuk diri mereka sendiri. Kapan
orang tersebut tidak dapat merawat diri mereka sendiri, perawat memberikan bantuan yang
dibutuhkan. Untuk anak-anak,
asuhan keperawatan yang dibutuhkan ketika orang tua atau wali tidak dapat memberikan
jumlah dan kualitas
peduli diperlukan.
Konsep ini pertama kali diterbitkan pada tahun 1959. Dia bekerja dengan anggota fakultas
perawat lainnya
dari Catholic University of America untuk melanjutkan pekerjaan dan mengembangkan
konsep ini lebih lanjut. Di
1971, Orem diterbitkan Keperawatan: Konsep Praktek. Sekarang di 6 nya
th
edisi.
Sepanjang karirnya, dia adalah penerima banyak gelar kehormatan; beberapa dokter
derajat ilmu pengetahuan, penghargaan nasional, dan penghargaan Sigma Theta Tau
Internasional. Dorothea Orem
meninggal pada bulan Juni 2007.
Halaman 3
3
Diperbarui Jatuh 2014
BAB SATU
Pengantar Keperawatan Teori Berbasis
Lingkungan kesehatan yang tanpa henti tumbuh lebih kompleks karena memiliki tanggung
jawab untuk
keperawatan profesional. Sering tidak jelas "apa keperawatan" dan "apa yang tidak,"
mengutip Florence
Nightingale (1859). UTC Sekolah Keperawatan sedang mempersiapkan siswa untuk
kompleks ini

lingkungan dengan dasar untuk semua kemungkinan yang terbentang di depan-untuk tujuan
ini, kami berkomitmen
untuk kurikulum berbasis pada Model Keperawatan, The Orem Self-care Teori Defisit
Keperawatan. ini adalah
hanya satu model keperawatan dari beberapa, tapi salah satu yang filosofis kongruen dengan
fakultas.
Apa Teori Keperawatan?
Teori keperawatan adalah istilah yang diberikan untuk tubuh pengetahuan yang digunakan
untuk mendukung praktik keperawatan.
Teori adalah cara kreatif dan sistematis dalam memandang dunia atau aspek itu untuk
menggambarkan,
menjelaskan, memprediksi, atau mengendalikannya. Istilah pertama yang perlu
dipertimbangkan dalam belajar tentang teori konsep.
Konsep mungkin empiris atau abstrak tergantung pada kemampuan mereka untuk diamati di
dunia nyata.
Konsep dikatakan empiris ketika mereka dapat diamati atau dialami melalui indera.
Contoh: Sebuah stetoskop adalah contoh dari konsep empiris karena dapat dilihat dan
disentuh.
Konsep-konsep abstrak adalah mereka yang tidak bisa diamati, seperti peduli, harapan dan tak
terhingga.
Sebuah teori keperawatan memberikan kerangka yang menghubungkan penelitian
keperawatan, praktik keperawatan, dan keperawatan
pengetahuan.
Mengapa Gunakan Orem Self Care Defisit Teori Keperawatan?
Ini menyediakan kerangka berpikir positif referensi tentang perawat, pasien, dan interaksi
antara
dua. Mempromosikan pemahaman yang jelas tentang sifat dan lingkup keperawatan,
menjelaskan apa keperawatan adalah,
apa tidak, dan apa itu bisa. Ini menyediakan komunikasi, struktur, fokus, link yang relevan
pengetahuan, memberikan kejelasan dan menentukan hasil atau tujuan untuk menyusui yang
memfasilitasi cara
yang menunjukkan efektivitas asuhan keperawatan dan akuntabilitas atas tindakan
keperawatan.
Praktik Keperawatan Orem Berbasis
Perdebatan apakah Keperawatan adalah profesi yang lebih dan meskipun perkembangan nya
Teori mulai pada saat ini adalah sebuah pertanyaan filosofis, Orem (2001) meninggalkan
keraguan bahwa
keperawatan adalah sebuah profesi, dan menjelaskan pengetahuan yang dibutuhkan untuk
praktek dalam konteks kesehatan
peduli. Berikut ini didasarkan pada buku terakhirnya (2001).
Semua profesi kesehatan berbagi pengetahuan dalam seni liberal luas. Ada juga beberapa
khusus pra-syarat untuk sebagian besar profesi-misalnya, Anatomi dan Fisiologi. Setiap
profesi, bagaimanapun, membuat kontribusi yang unik untuk orang yang menerima
perawatan kesehatan.
Selanjutnya, Orem (2001) mengatakan peran masing-masing profesi memainkan ditentukan
oleh kesehatan
kebutuhan orang (pasien), seperti penyakit, misalnya. Fenomena "penyakit" adalah
Fokus praktek medis (diagnosa medis, pengobatan, pencegahan, dll). Kebutuhan perawatan
kesehatan

pasien yang membutuhkan perawatan berhubungan dengan syarat perawatan diri. Jika orang
tersebut tidak mampu memenuhi
nya / syarat perawatan diri nya, keperawatan diperlukan. Bagaimana Anda tahu apakah
pasien memiliki kebutuhan perawatan diri?
Halaman 4
4
Diperbarui Jatuh 2014
Dengan sejarah keperawatan di mana syarat perawatan diri secara sistematis dinilai. (UTC
SON Keperawatan
Sejarah kesehatan: Berdasarkan SCDNT Orem, Lampiran A)
Apa pengetahuan yang dibutuhkan untuk praktek keperawatan di SCDNT Orem? Orem
mengakui
kompleksitas pengetahuan keperawatan; ia melukiskan tiga (3) teori yang saling terkait dalam
SCDNT.
Teori pertama, teori perawatan diri, mengasumsikan orang bawaan keinginan lembaga
perawatan diri, dan dengan demikian
lembaga perawatan diri yang dipelajari. Teori kedua, teori defisit perawatan diri, menetapkan
kebutuhan
perawatan. Teori ketiga, teori sistem keperawatan, mengarahkan peran keperawatan dalam
membantu orang
(atau tergantung wali perawatan) mengatasi, atau beradaptasi dengan defisit perawatan diri.
Peran keperawatan di
sistem perawatan kesehatan adalah untuk memfasilitasi lembaga perawatan diri bagi pasien.
Adalah penting bahwa konsep dalam model atau teori yang jelas digambarkan sehingga
semua orang berbicara
bahasa yang sama. Kejelasan istilah berarti kita semua "berbicara bahasa yang sama, apakah
praktisi, peneliti, atau teori. Praktek terkait dengan penelitian dan teori membangun Ilmu
Keperawatan.
Paradigma yang
Setiap disiplin memiliki fokus atau konsep (s) yang memandu pengembangan pengetahuan;
menyeluruh ini
Fokus disebut paradigma yang. Dari persyaratan pendidikan umum Anda banyak ini
akrab: misalnya, untuk linguistik, konsep paradigma adalah bahasa dalam semua
permutasi. Dan disiplin ilmu lainnya menggunakan pengetahuan itu, dalam contoh ini,
mungkin,
antropologi. Dalam perawatan kesehatan, profesi biasanya menggunakan pengetahuan
empiris yang
dikembangkan dari konsep paradigma yang dari disiplin lain. Ada banyak contoh:
anatomi, fisiologi, mikrobiologi, patofisiologi, farmakologi. Untuk penyedia layanan
kesehatan
Misalnya, gerakan adalah konsep paradigma pusat terapi fisik; pengetahuan bagi PT
terletak pada semua aspek gerakan: menilai dan mengobati masalah muskuloskeletal;
rehabilitasi, dll .; untuk farmasi, obat-obatan, dalam semua manifestasi terkait adalah
paradigma yang dalam;
Obat dokter, dll
Konsep paradigma yang Keperawatan adalah: Orang (man), Kesehatan, Lingkungan, dan
Keperawatan.
Sementara konsep-konsep yang menyeluruh diidentifikasi sebagai fenomena keperawatan,
definisi dan

hubungan di antara mereka ditemukan di Model Keperawatan spesifik dan Teori,


dikembangkan oleh
N ursing Teori. Model memberikan perspektif dan makna Keperawatan. Melekat pada semua
model keperawatan adalah persepsi orang (laki-laki) sebagai makhluk holistik. Dengan
kesamaan ini,
pengetahuan yang dibutuhkan untuk praktek keperawatan dibangun pada persepsi ini:
patofisiologi diabetes
tidak dengan sendirinya keperawatan pengetahuan. Kita harus tahu ini, namun, karena
diabetes memiliki
Manifestasi pada orang secara keseluruhan.
Keperawatan merupakan sebuah profesi dan disiplin. Profesi Kata berasal dari bahasa Latin
yang berarti sebuah
deklarasi publik. Deklarasi ini adalah untuk masyarakat dan komitmen kami untuk merawat
individu,
kelompok, dan masyarakat, sering ketika mereka berada dalam keadaan paling rentan
mereka. Sebagai imbalannya, masyarakat
memberikan kami izin praktek. Lisensi memberitahu masyarakat bahwa praktisi yang aman
untuk berlatih
bahwa yang profesi telah dianggap perlu.
Disiplin juga berasal dari bahasa Latin, yang berarti baik mengajar dan belajar. Pengetahuan
yang dibutuhkan
untuk praktek keperawatan profesional dikembangkan di Nursing discipline- ini tubuh
pengetahuan adalah
dikenal sebagai Ilmu Keperawatan. Ilmu Keperawatan dibangun pada studi ketat praktek,
teori, dan
penelitian. Pengetahuan bersama dari disiplin lain adalah apa bentuk ilmu. Dengan demikian,
Keperawatan
Halaman 5
5
Diperbarui Jatuh 2014
dapat diartikan sebagai kata benda berarti tubuh pengetahuan (disiplin), serta kata kerja (yang
praktek keperawatan).
Setidaknya ada tujuh Model Keperawatan dikembangkan dengan baik atau paradigma.
Paradigma ini membantu
mempelajari dan menjelaskan pikiran. Model Keperawatan yang akan mengarahkan studi
Anda dan klinis
praktek dalam SON adalah Orem (2001) Self Care Defisit Keperawatan Teori (SCDNT).
UTC SON Kurikulum lima semester. Setiap semester memiliki "agen" Tentu saja, "sistem"
Tentu saja, dan praktikum klinis. Kursus badan adalah untuk pengembangan perawat sebagai
profesional; kursus sistem memiliki "pengetahuan yang valid dan terpercaya," dengan kata
lain adalah
"Konten-driven." The practica klinis untuk sintesis dan penerapan lembaga dan
sistem program.
Halaman 6
6
Diperbarui Jatuh 2014
BAGIAN DUA
Teori Self Care

Perawatan diri adalah fungsi regulasi manusia bahwa orang-orang harus melakukan untuk
diri mereka sendiri untuk
mempertahankan hidup. Perawatan diri harus dipelajari dan harus sengaja dilakukan.
Akibatnya, orang
melalui pembelajaran ini, latihan keterampilan intelektual dan praktis untuk mengelola diri
untuk mempertahankan
motivasi penting untuk perawatan sehari-hari secara efektif. Cara seorang individu terlibat
dalam diri
perawatan akan bervariasi karena pengaruh dari budaya mereka, lingkungan dan pengaruh
luar. Menarik
dalam perawatan diri dan perawatan tergantung dipengaruhi oleh keterbatasan seseorang
dalam mengetahui apa yang harus dilakukan, ketika
melakukannya dan bagaimana melakukannya.
Teori perawatan diri adalah elemen penting dari perawatan diri teori defisit keperawatan. Ini
bagian pertama dari
teori menjelaskan dan mengembangkan alasan mengapa orang memerlukan perawatan.
Dalam teori
perawatan diri, Orem menjelaskan perawatan diri sebagai kegiatan yang dilakukan oleh
individu untuk menjaga mereka
kesehatan sendiri.
Teori ini mengusulkan konsep agen perawatan diri, apa artinya, asumsi, dan
proposisi tentang hubungan antara perawatan diri, perawatan diri yang diperlukan, lembaga
perawatan diri, dan
permintaan terapi. Selain itu, Orem mengusulkan konsep-konsep ini sebagai berlaku sebagai
penjelasan untuk
kesehatan dan kesejahteraan.
A. Apa artinya perawatan diri?
1. Sebuah fungsi regulasi yang "berdiri dalam perbedaan dari jenis lain regulasi
fungsi manusia "(Orem, p.143) seperti sistem GI, sistem endokrin, dll
2. tindakan yang disengaja diperlukan untuk perawatan diri dan perawatan tanggungan
3. tindakan yang disengaja tidak bawaan atau bawaan
4. Kemampuan dipelajari
Contoh: bayi dan anak-anak tidak memiliki kemampuan untuk mandiri dengan toileting.
Orang tua dalam hal ini akan menjadi wali perawatan tergantung. Peran ini memiliki orang
lain selain
orang yang bersangkutan mengurus ini diperlukan perawatan diri. Sebagai anak tumbuh, s /
ia menjadi toilet
terlatih, disengaja dan belajar tindakan. Masyarakat yang berbeda memiliki tindakan yang
berbeda bagi anak untuk
belajar tindakan perawatan diri ini, dan itu mungkin cukup berbeda dari kita. Setelah anak
belajar ini
disengaja tindakan perawatan diri, agen perawatan tergantung tidak perlu campur tangan.
Jika anak memiliki
diare, dan kehilangan kontrol, agen perawatan tergantung lagi perlu melakukan fungsi ini
untuk
anak.
Jika agen perawatan tergantung ingin anak harus benar-benar dilatih toilet sebelum kedua
ulang tahun, perawatan mungkin diperlukan. Apakah agen perawatan tergantung tidak
memiliki pemahaman tentang

perkembangan anak, dan dengan demikian mulai memarahi anak? Dalam hal ini agen
perawatan tergantung
kebutuhan asuhan keperawatan, khususnya, intervensi mendukung-edukatif untuk
membimbing orang tua di
memahami kemampuan perawatan diri anak untuk tujuan itu.
Halaman 7
7
Diperbarui Jatuh 2014
Jadi sekarang anak tumbuh (mungkin toilet dilatih), menjadi dewasa dan dirawat di rumah
sakit dengan
stroke. Di antara konstelasi tanda-tanda stroke adalah inkontinensia urin, menurut definisi
sebuah
defisit yang tidak diinginkan. Pasien tidak memiliki kemampuan untuk memenuhi ini
diperlukan perawatan diri, meskipun ia
telah belajar di masa lalu. Pada titik ini perawatan yang dibutuhkan. Dengan intervensi dan
waktu,
orang telah kembali kemampuan untuk mengelola ini diperlukan perawatan diri. Misalkan
pasien harus
mengelola pasca inkontinensia nya debit? Perawat akan mengajarkan pasien sampai ia
memiliki kemampuan
untuk belajar, tindakan sengaja untuk memenuhi ini diperlukan perawatan diri.
B. Apa yang dimaksud dengan syarat perawatan diri?
1. "Persyaratan" yang diperlukan untuk kesehatan dan kesejahteraan atau "Alasan yang diri
perawatan dilakukan "(Orem, 2001, p.522)
2. "kebutuhan untuk perawatan diri ... diperlukan untuk menjaga integritas fungsional ...,
kesehatan dan baikmenjadi "(Dennis, 1991, hal. 144).
3.
Ada 3 jenis syarat perawatan diri: universal, penyimpangan perkembangan dan kesehatan
Syarat-perawatan diri didasarkan pada tiga asumsi: Manusia memiliki kebutuhan umum
untuk
asupan bahan yang diperlukan untuk mempertahankan dan memelihara kehidupan;
pembangunan manusia dari dalam rahim ke
orang dewasa yang matang membutuhkan tindakan untuk mempertahankan kondisi untuk
meningkatkan pertumbuhan dan pembangunan di masing-masing
periode siklus hidup; dan penyimpangan dari struktur normal dan fungsi dan kesejahteraan
membutuhkan
tindakan untuk mencegah kejadian dan tindakan untuk mengontrol efek dari penyimpangan.
Universal Self-Care syarat (USCR) yang umum untuk semua manusia selama semua tahap
siklus hidup dengan penyesuaian sesuai dengan usia, negara perkembangan, lingkungan dan
lainnya
faktor.
1. Pemeliharaan cukup asupan udara, air, makanan
Sebuah. Mengambil dalam jumlah yang diperlukan untuk fungsi normal dengan penyesuaian
untuk
faktor internal dan eksternal yang dapat mempengaruhi kebutuhan atau, di bawah kondisi
kelangkaan, menyesuaikan konsumsi untuk membawa pulang paling menguntungkan untuk
terintegrasi
fungsi

Perawatan diri
Syarat
Universal
Pembangunan
Mempromosikan / Terlibat
Pengembangan
Mengatasi
Gangguan
w / pengembangan
Penyimpangan kesehatan
Halaman 8
8
Diperbarui Jatuh 2014
b. Menjaga integritas struktur anatomi terkait dan proses fisiologis
c. Menikmati pengalaman menyenangkan pernapasan, minum dan makan tanpa
penyalahgunaan
2. Penyediaan perawatan yang terkait dengan proses eliminatif dan kotoran
Sebuah. Mewujudkan dan memelihara kondisi internal dan eksternal yang diperlukan untuk
regulasi proses eliminatif
b. Mengelola proses eliminasi dan pembuangan kotoran
c. Memberikan perawatan higienis berikutnya permukaan tubuh dan bagian
d. Merawat lingkungan yang diperlukan untuk mempertahankan kondisi sanitasi
3. Pemeliharaan keseimbangan antara aktivitas dan istirahat
Sebuah. Memilih kegiatan yang merangsang, terlibat, dan menjaga keseimbangan gerakan
fisik,
tanggapan afektif, upaya intelektual dan interaksi sosial
b. Mengenali dan menghadiri untuk manifestasi dari kebutuhan untuk istirahat dan aktivitas
c. Menggunakan kemampuan pribadi, kepentingan, dan nilai-nilai serta budaya yang
ditentukan
norma sebagai dasar untuk pengembangan pola istirahat-aktivitas
4. Pemeliharaan keseimbangan antara kesendirian dan interaksi sosial
Sebuah. Menjaga kualitas itu dan menyeimbangkan diperlukan untuk pengembangan pribadi
otonomi dan hubungan sosial abadi yang mendorong efektivitas fungsi
individu
b. Membina hubungan kasih sayang, cinta, dan persahabatan; efektif mengelola impuls
menggunakan orang lain untuk tujuan egois, mengabaikan individualitas mereka, integritas,
dan
Hak
c. Kondisi memberikan kehangatan sosial dan kedekatan penting untuk melanjutkan
pengembangan dan penyesuaian
d. Mempromosikan baik otonomi individu dan keanggotaan kelompok
5. Pencegahan bahaya untuk hidup, fungsi, dan kesejahteraan
Sebuah. Menjadi waspada terhadap jenis bahaya yang mungkin terjadi
b. Mengambil tindakan untuk mencegah kejadian yang dapat menyebabkan perkembangan
berbahaya
situasi
c. Menghapus atau melindungi diri dari situasi berbahaya ketika bahaya tidak dapat
dieliminasi
6. Promosi normal

Sebuah. Mengembangkan dan mempertahankan konsep diri yang realistis


b. Mengambil tindakan untuk mendorong perkembangan manusia tertentu
c. Mengambil tindakan untuk mempertahankan dan mempromosikan integritas struktur
manusia seseorang dan
fungsi
d. Mengidentifikasi dan menghadiri untuk penyimpangan dari norma-norma struktural dan
fungsional seseorang
(Orem, 2001).
Perawatan diri
Syarat
Universal
Udara
Air
Makanan
Eliminasi
Kegiatan /
beristirahat
Solitude /
Aktivitas sosial
Pencegahan
Bahaya /
Promosi
baik
makhluk
Keadaan yg biasa
Mengembangkanbatin
Kesehatan
Deviatio
n
Halaman 9
9
Diperbarui Jatuh 2014
Sekarang mari kita menerjemahkan USCR ini ke dalam contoh Anda dapat menggunakan
dalam praktek Anda.
Air bernapastanpamenggunakanperalatanoksigenpada1218kalipermenit(dewasa)
Air minumenamsampaidelapan8gelasozairsetiaphari(dewasa/remaja)
Makanan mengkonsumsi18002000kalori,dietseimbangsehariharimenggunakan
kelompokmakananuntuk
bimbingan (dewasa)
Eliminasi mandisetiaphari
Aktivitas/Istirahat latihanselamaminimal30menit/harisetidaknya5kali/minggu;
tidur8
jam / malam
Solitude/InteraksiSosial berinteraksidengankeluargadantemantemanseharihari;
menghabiskanwaktusendirianuntuk
satu jam setiap hari

PencegahanBahaya/PromosiWellBeing menghindarimakanantinggilemakdangula;
berhenti
merokok; menggunakan sabuk pengaman setiap kali di kendaraan yang bergerak
normal dapatsecaraverbalmenggambarkanpersepsiAndatentangdirisendiridantingkat
kompetensi (Dennis, 1997).
Perkembangan Perawatan Diri syarat (DSCR) berhubungan dengan pertumbuhan dan
perkembangan manusia
proses dan dengan kondisi dan peristiwa yang terjadi selama berbagai tahap siklus hidup
(misalnya,
prematuritas, kehamilan) dan gangguan atau peristiwa yang dapat mempengaruhi
pembangunan.
Syarat perawatan diri perkembangan memiliki hubungan yang kuat dengan syarat perawatan
diri universal.
Fokus DSCR adalah bagaimana mereka disajikan dengan tahap perkembangan. Orem
mendefinisikan
kondisi yang berhubungan dengan DSCR sebagai berasal dari enam tahap berikut dari siklus
hidup:
janin,termasukkelahiran(intrauterine)
Neonatal
Masabayi
Anakdanremaja
MasaDewasa
Kehamilanbaikmasaremajaataudewasa
Orem mengakui bahwa setiap orang berkembang sebagai terpisah, orang yang unik dan pada
tingkat mereka sendiri.
Kondisi lingkungan dan ketersediaan sumber daya yang mempromosikan pengembangan
alam
individu bervariasi dalam keluarga, masyarakat dan bahkan masyarakat. Setiap orang di
seluruh ini
tahap mengalami kondisi internal dan eksternal yang dapat mengubah atau merugikan mereka
pengembangan. Pada tahap tertentu perkembangan, orang menjadi terlibat dalam nya
pengembangan dan gerakan menuju kedewasaan. Awalnya, pada tahap kehidupan
intrauterine,
bayi, dan anak, yang syarat perkembangan dipenuhi oleh perawatan tergantung agen, orang
tua, atau
lain. Sebagai hasil dari pekerjaannya, Orem menyarankan tiga set syarat untuk perkembangan
penentuan kegunaan mereka dalam situasi praktek.
Ketentuan Kondisi yang Mempromosikan Pembangunan
Ini adalah syarat perkembangan yang dipenuhi oleh agen perawatan tergantung pada tahap
awal
siklus hidup.
1. Menyediakan dan memelihara kecukupan bahan (makanan dan air) serta hidup
kondisi untuk mempromosikan pengembangan tubuh manusia
Halaman 10
10
Diperbarui Jatuh 2014
2. Menyediakan dan memelihara kondisi fisik, lingkungan dan sosial untuk mempromosikan
kenyamanan

dan keamanan
3. Menyediakan dan menjaga keseimbangan antara kelebihan indrawi dan kurang sensorik
4. Menyediakan dan memelihara kondisi yang mempromosikan perkembangan kognitif
5. Memberikan pengalaman untuk memfasilitasi awal dan pengembangan keterampilan
lanjutan penting untuk
kehidupan di masyarakat
6. Memberikan pengalaman yang memfasilitasi kesadaran rasa yang unik sendiri dari diri dan
atau
tempatnya di dalam keluarga, masyarakat dan dunia
7. Mengatur fisik, biologis, dan lingkungan sosial untuk mencegah perkembangan negara
takut, marah, atau kecemasan
Keterlibatan dalam Pengembangan Diri
Ini adalah syarat perkembangan yang memerlukan keterlibatan yang disengaja dari orang
(diri) di
proses pembangunan.
1. Berusahalah untuk memahami dan membentuk kebiasaan refleksi untuk mengembangkan
wawasan tentang diri, persepsi
orang lain, hubungan dengan orang lain, dan sikap terhadap mereka
2. Berusahalah untuk menerima perasaan dan emosi, setelah refleksi, yang diperlukan untuk
mengembangkan wawasan tentang
diri, hubungan, benda, atau situasi kehidupan
3. Gunakan bakat dan keterampilan dalam mempersiapkan terlibat dalam kerja produktif di
masyarakat
4. Terlibat dalam klarifikasi nilai dan tujuan dalam situasi yang memerlukan keterlibatan
pribadi
5. Undang-Undang dengan tanggung jawab dalam situasi kehidupan
6. Berusahalah untuk memahami nilai emosi positif dalam mengembangkan kebiasaan yang
dikenal sebagai
kebajikan
7. Berusahalah untuk memahami bahwa emosi negatif dan impuls terjadi ketika perilaku
keluar dari
menyeimbangkan dengan tujuan seseorang dan persepsi diri.
8. Mempromosikan kesehatan mental positif melalui kesengajaan
Gangguan dengan Pembangunan
Seluruh siklus hidup ada acara, kondisi dan masalah yang dapat mempengaruhi
pembangunan manusia pada setiap tahap siklus hidup. Orem menunjukkan dua gol untuk
sukses
navigasi pembangunan manusia. Yang pertama adalah untuk memberikan kondisi dan
mendorong perilaku yang
akan mencegah terjadinya efek samping pada pengembangan. Yang kedua adalah untuk
memberikan
kondisi dan pengalaman untuk mengatasi efek buruk pada pembangunan.
Kondisi yang merugikan dapat mencakup:
1. kekurangan Pendidikan
2. Masalah adaptasi sosial
3. Kegagalan individuasi sehat
4. Kehilangan saudara, teman, rekan
5. Kehilangan harta, hilangnya keamanan kerja
6. Perubahan mendadak dari tempat tinggal ke lingkungan yang asing
7. Status terkait masalah

8. Kesehatan yang buruk atau cacat


9. kondisi hidup menindas
10. Terminal penyakit dan kematian yang akan datang
Halaman 11
11
Diperbarui Jatuh 2014
Kondisi Orem (2001) yang tercantum di atas yang cukup jelas. Beberapa terjadi lebih sering,
tapi
setiap dapat mempengaruhi kemampuan seseorang untuk terlibat dalam perawatan diri.
Misalnya, kekurangan pendidikan
anak-anak usia sekolah. Jika orangtua menghapus anak dari sekolah di mana anak memiliki
banyak
teman, anak tidak dapat melakukannya juga yang pindah ke sekolah baru. Contoh lain akan
kegagalan individuasi yang sehat. Kekurangan ini dapat memanifestasikan dirinya sebagai
tidur enam tahun
Dengan orangtua. Kekurangan ini adalah timbal balik: anak tidak ingin tidur di tempat tidur
mereka sendiri dan
orang tua tidak ingin membuat cuti anak.
Syarat Self-care Deviasi kesehatan (HDSCR) berhubungan dengan genetik, manusia dan
penyimpangan fungsional dan efek mereka bersama dengan diagnosa medis dan pengobatan
intervensi dan efek mereka. Dengan memenuhi penyimpangan kesehatan syarat, patologi
mungkin
dikontrol dalam tahap awal (pencegahan sekunder) dan dalam pencegahan cacat dan cacat
(tersier pencegahan). Efektif memenuhi USCR dan DSCR (pencegahan primer) adalah
penting
ketika berhadapan dengan HDSCR untuk mempertahankan struktur, fungsi, mempromosikan
pengembangan dan
berkontribusi rehabilitasi. Penyimpangan kesehatan mungkin timbul dari penyakit, cedera,
cacat, cacat
(baik fisik atau mental) atau dari perawatan medis diresepkan. Syarat ini mungkin
sementara atau jangka panjang dalam durasi. Orem (2001) mengidentifikasi enam HDSCR
berikut:
1.
Mencari dan mengamankan "jenis yang tepat dari bantuan dari penyedia layanan kesehatan
2. Sadar dan tepat menghadiri efek penyimpangan kesehatan
3. Mengikuti diresepkan rejimen terapeutik
4. Sadar dan menghadiri efek dari rejimen terapi [sedikit variasi dari (2)]
5. Memodifikasi konsep diri untuk menerima kondisi saat ini
6. Belajar untuk hidup dengan efek dari kondisi, termasuk gaya hidup
Contoh untuk praktek mungkin:
1. Pergi ke ruang gawat darurat ketika Anda mengalami ketekunan nyeri dada dan sesak
napas
2. Catat waktu dan pola demam selama proses infeksi
3. Ambil Tylenol 650 mg ngengat ketika demam melebihi 101F
4. Rekam kejadian syok insulin selama satu minggu setelah perubahan dosis insulin
Perawatan diri
Syarat
Universal
Pembangunan

Mempromosikan / Terlibat
Pengembangan
Mengatasi
Gangguan
w / pengembangan
Penyimpangan kesehatan
Halaman 12
12
Diperbarui Jatuh 2014
5. Bergabung dengan kelompok pendukung kemoterapi pasien kanker untuk mendiskusikan
perasaan tentang hilangnya
rambut
6. Berpartisipasi dalam Olimpiade Senior (Dennis, 1997).
Semua pasien yang memiliki penyimpangan kesehatan memiliki HDSCR. Ini berarti bahwa
semua pasien Anda akan
memiliki HDSCR, kalau tidak mereka tidak akan pasien Anda dan mencari perawatan.
Sebagai perawat
kita mungkin tidak dapat memperbaiki defisit perawatan diri tapi itu tidak berarti bahwa kita
tidak dapat membantu pasien.
Mengetahui pasien USCR Anda dan DSCR akan membantu Anda dalam membantu mereka
memenuhi tantangan
HDSCR mereka. Hal ini penting untuk memperlakukan setiap pasien sebagai individu ketika
merencanakan perawatan mereka
karena setiap pasien akan bereaksi dan merespon secara berbeda. Mengajukan pertanyaan
yang tepat akan membantu Anda
menentukan di mana pasien Anda berdiri dan bagaimana Anda harus merencanakan
perawatan mereka serta memberikan
pendidikan bagi mereka dan atau keluarga mereka dalam mengobati penyimpangan kesehatan
khusus mereka. Mari kita lihat
setiap HDSCR khusus.
1. Mencari dan mengamankan jasa medis yang tepat
Sebuah. Apakah orang atau wali perawatan tergantung mengakui ada penyimpangan
kesehatan? Ini
termasuk onset akut (cedera tiba-tiba) dan onset bertahap atau terjadinya ringan
gejala yang semakin memburuk (seperti penyakit kandung empedu). Jika kesehatan
penyimpangan tidak diakui, perawatan medis tidak akan dicari.
b. Berapa lama itu telah sejak timbulnya cedera atau gejala nyata? Ini bisa
memberikan petunjuk ke wawasan pasien dan pada titik apa yang mereka lihat kebutuhan
untuk mendapatkan
perhatian medis. Jika saat itu sudah terlambat, mendidik pasien tentang kapan medis
perawatan diperlukan mungkin tepat.
c. Apakah orang atau wali perawatan tergantung tahu di mana untuk mendapatkan bantuan?
Apakah ada
penyedia perawatan primer? Di mana orang mencari perawatan medis saat ini? Apakah itu
ruang gawat darurat setelah luka parah menjadi terinfeksi? Itu pasti
sesuai untuk orang ini untuk mencari bantuan medis lebih cepat?
Perawatan diri
Syarat
Universal

Mengembangkanbatin
Kesehatan
Deviasi
Carilah medis
bantuan
Hadir untuk, menyadari
Dari kondisi jalan
Bawa
Ditetapkan
Pengobatan
mengukur
Menyadari
Hadir untuk
Discomforting
Pengaruh medica l
pengobatan
Memodifikasi seseorang
Konsep diri
Belajar untuk hidup
Dengan efek
Yang mempromosikan
Pengembangan diri
Halaman 13
13
Diperbarui Jatuh 2014
d. Apakah pasien tahu apa gejala melaporkan, kapan dan bagaimana melaporkan mereka
gejala, setelah diagnosis kondisi medis atau operasi?
e. Apakah ada keterbatasan untuk mencari dan mengamankan perawatan medis? Angkutan
masalah? Keuangan atau masalah asuransi? Apakah ada anggota keluarga lain yang
kesehatannya
masalah mengambil prioritas? Apakah ada sesuatu yang akan membatasi orang yang tahu ada
kebutuhan untuk perawatan medis dari mencari dan / atau mengamankan perawatan?
2. Menjadi Sadar dan Hadir dengan Efek dari Deviasi Kesehatan
Sebuah. Apakah orang atau wali perawatan tergantung mengetahui dan memahami apa
kesehatan
deviasi dan bagaimana mengelola secara efektif? Sebagai contoh, pasien dengan
diabetes memahami peran insulin dalam mengatur gula darah. Apakah
orang tahu kapan dan bagaimana untuk mengelola insulin? Apakah orang memahami diet
pembatasan? Apakah pasien yang menjalani hip penggantian atau perbaikan fraktur
operasi memahami pembatasan gerakan dan posisi di awal dan akhir
periode pasca-operasi? Apakah pasien tahu cara merawat luka dan
mengubah saus? Jika tidak, apakah ada anggota keluarga (wali perawatan tergantung) yang
bisa melakukannya untuk mereka?
b. Pada dasarnya, tanyakan pada diri sendiri, "Apakah pasien memahami penyimpangan
kesehatan dan bagaimana
untuk mengelola secara efektif? "
3. Efektif Melaksanakan medis Ditetapkan Diagnostik, Terapi dan
Tindakan rehabilitatif

Sebuah. Hal ini mengacu pada nomor dua, tetapi lebih memfokuskan pada apakah pasien
memiliki kemampuan
dan motivasi untuk melaksanakan tindakan-tindakan yang ditentukan, sedangkan nomor dua
berfokus pada
apakah pasien tahu apa langkah-langkah yang.
b. Rejimen pengobatan, sesuai dengan statusnya NPO untuk prosedur diagnostik (yang
pasien lebih mungkin untuk mematuhi jika mereka tahu mengapa), perubahan rias, diri
suntikan, kolostomi atau perubahan urostomy.
c. Apakah pasien memiliki sarana untuk melaksanakan di atas? Dapatkah pasien dengan
diabetes menangani jarum dengan tangan mantap? Bisakah dia / dia melihat cukup baik untuk
menyusun
insulin dari botol ke dalam alat suntik?
d. Jika pasien tidak mampu melaksanakan tugas-tugas manual dan teknis yang diperlukan
untuk
mengelola penyimpangan kesehatan, yang tersedia di rumah yang dapat membantu pasien,
atau
melakukannya untuk mereka? Adalah rujukan untuk perawatan kesehatan di rumah
dibutuhkan?
e. Apakah pasien mengalami rasa sakit? Apakah ada kontrol nyeri yang memadai untuk
berpartisipasi dalam
terapi fisik?
f. Sadarilah apa pun yang akan membatasi kemampuan pasien untuk melaksanakan
diresepkan
langkah-langkah dan perawatan. Meminta pasien, "Apakah Anda mengantisipasi mengalami
masalah dengan
semua ini perawatan diresepkan? "" Apakah Anda mengalami kesulitan di masa lalu
melaksanakan
perawatan yang diresepkan oleh dokter Anda? "
4. Menjadi Sadar dan Hadir dengan Efek tidak menyenangkan dari medis Ditetapkan
Tindakan
Sebuah. Efek samping obat - mengetahui apa yang mereka dan bagaimana untuk
meminimalkan mereka jika
mungkin
Halaman 14
14
Diperbarui Jatuh 2014
b. Prosedur bedah - semua akan menyebabkan beberapa ketidaknyamanan dalam periode
pasca-operasi.
Derajat nyeri dan ketidaknyamanan tergantung pada prosedur tetapi pastikan
pasien tahu bagaimana meminimalkan ini sebanyak mungkin.
c. Hal lain yang akan menyebabkan rasa sakit, ketidaknyamanan, atau efek samping
mengganggu. Untuk
Misalnya, beberapa pasien mungkin merasa lebih baik ketika mengubah posisi sering tetapi
mereka dapat melakukan hal ini? Apakah mereka membutuhkan pengasuh yang bisa
membantu mereka bergerak di tempat tidur?
5. Memodifikasi Self-Concept dan Menerima Satu Kesehatan Negara
Sebuah. Seorang pasien wanita yang baru-baru ini menjalani mastektomi untuk kanker
payudara - apa

perasaannya tentang citra tubuh? Tidak semua wanita akan merasakan hal yang sama, penting
untuk
individualize tanggapan Anda dan perawatan pasien.
b. Seorang pasien baru-baru ini didiagnosis dengan diabetes, baik tipe 1 atau 2. Apapun,
itu adalah kondisi seumur hidup dan tidak dapat disembuhkan. Hal ini penting bagi pasien
untuk
memahami mereka harus memantau penyakit selama sisa hidup mereka dan bahwa
efektif mengelola penyakit memerlukan perubahan gaya hidup.
6. Belajar untuk Hidup dengan Efek Deviasi Kesehatan dan Pengobatan Kesehatan yang
Deviasi
Sebuah. Hal ini berkaitan erat dengan angka 5 tetapi lebih fokus pada gaya hidup dan pasien
pemahaman tentang perlunya perubahan.
b. Pasien mungkin tidak dapat melakukan hal-hal yang pernah mereka menikmati karena
permanen menonaktifkan cedera. Bahkan arthritis parah drastis dapat mengubah
gaya hidup seseorang.
c. Tanyakan: Apa sistem pendukung utama pasien? Apakah ini cukup? (Biasanya terbaik
untuk membiarkan pasien membuat tekad).
d. Apakah rujukan untuk kelompok dukungan yang tepat?
e. Apa prospek keseluruhan pasien hidup sejak cedera atau diagnosis dari
penyakit? Tanyakan, "Bagaimana Anda mengantisipasi ini akan mempengaruhi kehidupan
Anda?"
Ingat bahwa setiap HDSCR sangat individual dan spesifik untuk setiap pasien. Dengan
mengetahui
USCR pasien Anda dan DSCR dapat membantu dalam bagaimana Anda mendekati
perawatan untuk pasien ini dan
apakah agen perawatan tergantung atau di luar rujukan diperlukan.
Halaman 15
15
Diperbarui Jatuh 2014
BAB TIGA
Teori Self-Care Defisit
Teori perawatan diri terutama berkaitan dengan membangun apa artinya perawatan diri.
Membangun teori ini sebagai yang sah diperlukan untuk memahami dua teori lain
Orem dikembangkan. Syarat perawatan diri seperti yang dibahas dalam bab dua dikondisikan
atau dipengaruhi
oleh beberapa faktor. Ini adalah faktor penyejuk dasar dan komponen listrik. Dasar
Faktor pengkondisian (BCF) pengaruh baik kebutuhan dan kemampuan orang tersebut untuk
melakukan diri
peduli. Faktor pengkondisian mendasar adalah faktor-faktor yang mempengaruhi semua
orang. Mereka terdaftar sebagai berikut:
Umurusiakronologissaatorang
Jeniskelaminbaiksebagailakilakiatauperempuan
Pembangunannegaraorangyangtingkatfisik,fungsional,kognitifdanpsikososial
negaraKesehatannegarakesehatansaatinidanmasalaluorangtersebutdanpersepsi
merekatentangmereka
kesehatan
orientasisosialbudayasistemyangsalingterkaitdarilingkungansosialseseorang,
keyakinan spiritual, hubungan sosial dan fungsi unit keluarga

sistemperawatankesehatansumberdayadimanaperawatankesehatandapatdiaksesdan
tersediauntuk
orang untuk modalitas diagnostik dan pengobatan
faktorsistemKeluargaperan/hubungananggotakeluargadanoranglainyangsignifikan;
itu
peran orang dalam keluarga
Polahidupbiasaaktivitasnormalseseoranghidupseharihari
Faktorlingkunganpengaturandimanaorangbiasanyamelakukanperawatandiri; itu
lingkungan rumah
Sumberdayayangtersediainitermasukekonomi,personel,lembagadanwaktu
(Orem, p. 245, 2001)
Hal ini penting untuk memahami faktor-faktor pendingin dasar untuk orang-orang seperti
mereka melakukan
perawatan diri atau perawatan tergantung. Orang harus mengembangkan pengetahuan tentang
cara di mana faktor-faktor ini
Pengaruh kedua syarat perawatan diri dan kemampuan untuk memenuhi perawatan diri atau
perawatan tergantung.
Perawat perlu pengetahuan ini untuk membedakan karakteristik individu orang sehingga
mereka
lebih mampu untuk membantu dan berkolaborasi dengan pertemuan dan mencapai perawatan
diri terapeutik. Pengetahuan tentang
faktor pengkondisian dasar juga dapat membantu perawat untuk memprediksi jenis dan
jumlah bantuan
orang akan menerima. Perawat juga harus memiliki wawasan faktor penyejuk sendiri dasar
seperti ini
akan mempengaruhi lembaga keperawatan dan asuhan keperawatan yang mereka berikan.
Seseorang juga memiliki komponen power. Ini adalah kemampuan seseorang yang
memungkinkan
orang untuk memenuhi syarat perawatan diri. Komponen listrik dapat dinilai dengan
mengamati
pasien ketika melakukan riwayat kesehatan dan penilaian fisik. Ada sepuluh listrik
komponen menurut Orem. Ini pertama kali diterbitkan pada tahun 1979.
1. Perhatian dan kewaspadaan - Bisa petunjuk ulangi pasien yang diberi? Dapatkah
Pasien ingat informasi sebelumnya diberikan? Apakah pasien mudah terganggu? Jumlah
Halaman 16
16
Diperbarui Jatuh 2014
perhatian dan kewaspadaan pasien memberi dapat dipengaruhi oleh beberapa faktor, seperti
bagaimana
banyak rasa sakit s / dia di, obat diambil, masalah perkembangan, sikap, dll Faktor-faktor ini
perlu dipertimbangkan ketika menilai pasien. Ketika seorang pasien dapat mengekspresikan
pemahaman mereka tentang langkah-langkah pencegahan dan rejimen pengobatan, mereka
menunjukkan kewaspadaan.
2. Energi - Apa kapasitas seseorang untuk mengambil tindakan? Ini akan dipengaruhi oleh
keparahan kondisi pasien, efek obat, usia, gaya hidup, dll Orang mungkin
memiliki tingkat energi yang tinggi dan mampu ambulasi tanpa bantuan atau memiliki tingkat
rendah
energi dan tidak mampu mengubah diri mereka di tempat tidur setiap dua jam. Energi dapat

diukur dengan mengamati berapa banyak tugas orang dapat melakukan secara mandiri,
seperti mandi,
makan sendiri, ambulating, dll
3. Pengendalian posisi tubuh - Seberapa baik dapat pasien melakukan aktivitas hidup seharihari
(ADL) dan melakukan rejimen pengobatan? Misalnya, apakah pasien memiliki cukup
kekuatan untuk menekan dan memutar topi untuk membuka botol pil? Apakah pasien
memiliki cukup
kekuatan di jari-jari mereka untuk memahami garpu dan angkat ke mulut mereka? Tindakan
ini dapat
terhubung ke pasien yang telah mengalami stroke yang mungkin telah kehilangan beberapa
fungsi motorik.
4. Kemampuan untuk alasan - Apakah pasien mental, fisik atau emosional mampu untuk
berpikir dan
membuat keputusan? Hal ini penting untuk menilai kekuatan pasien untuk berpikir dan
orientasi mereka.
Adalah penting bahwa pasien mengerti instruksi dan dapat membawa mereka keluar. Sebuah
contoh
penalaran akan pernyataan oleh pasien, "Aku bisa mandi sendiri, tapi Anda bisa
mengubah seprai sementara aku mandi ".
5. Motivasi - Jika pasien tidak termotivasi maka mereka tidak akan membuat mereka tampil
pengobatan rejimen prioritas. Jika pasien melakukan semua yang mereka bisa untuk mencoba
dan mendapatkan baik, ini
merupakan indikasi tingkat tinggi motivasi. Adalah tujuan pasien berorientasi pada ingin
mengambil
lebih perawatan mereka sendiri?
6. Kemampuan untuk membuat keputusan - komponen listrik ini dapat dipengaruhi oleh nyeri
pasien
tingkat, tingkat keparahan kondisi pasien, tingkat perkembangan, dll Ketika menentukan
kemampuan pasien untuk membuat keputusan, penting untuk diingat bahwa jika Anda tidak
setuju dengan
keputusan pasien, itu tidak berarti bahwa pasien tidak mampu membuat keputusan.
Dapat pasien benar-benar memutuskan mereka akan mengurangi stres mereka dengan
menebang pada
bekerja jam dan kemudian benar-benar melakukannya?
7. Kemampuan untuk memperoleh, mempertahankan, dan mengoperasionalkan pengetahuan
teknis - Apakah mampu pasien untuk
melaksanakan rencana perawatan secara mandiri? Apakah pasien dapat meminta bantuan
(konsultasi
dengan orang yang tepat) ketika ia / dia dapat mengetahui pompa insulin dan kemudian
mampu
melakukan penyesuaian atau mengurus masalah dengan petunjuk?
8. kognitif, manipulatif, komunikasi, dan keterampilan interpersonal - Apakah pasien
memiliki
pengetahuan keseluruhan yang diperlukan untuk hidup sendiri, minum obat dan hadir untuk
mereka yang universal
syarat perawatan diri? Bagaimana pasien berinteraksi dengan orang lain? Apakah pasien
terlibat
lain dalam percakapan?

9. Kemampuan untuk memprioritaskan dan menghubungkan tindakan - Cara terbaik untuk


menentukan kemampuan pasien untuk
memprioritaskan adalah untuk mengamati tindakan pasien dan mendengarkan dengan penuh
perhatian selama penilaian. Sebuah
Misalnya mungkin melibatkan pasien diabetes. Negara sabar, "Aku tahu aku tidak bisa makan
makanan saya
Halaman 17
17
Diperbarui Jatuh 2014
tanpa terlebih dahulu memiliki injeksi insulin saya, jadi saya akan menunggu perawat untuk
memberikan saya
injeksi sebelum makan ". Pasien tahu bahwa sejak s / dia adalah seorang penderita diabetes,
mendapatkan insulin
injeksi sebelum makan adalah prioritas yang lebih tinggi daripada makan makanan secepat itu
dibawa ke dia / dia.
10. Kemampuan untuk konsisten dan mengintegrasikan - Jika pasien belajar dan konsisten
menerapkan
rejimen pengobatan selama di rumah sakit, maka mereka lebih cenderung untuk melanjutkan
bila
boleh pulang. Meninjau langkah-langkah dari rejimen pengobatan dengan pasien dan mereka
verbalisasi dan / atau menunjukkan mereka memahami dan dapat melakukan sendiri.
Sekali lagi, menilai dasar faktor penyejuk dan komponen listrik dapat menjadi bagian dari
kesehatan
sejarah dan penilaian fisik. Ini akan mengungkapkan kemampuan perawatan diri orang
tersebut. Misalnya, Anda
memiliki pasien yang baru didiagnosis dengan diabetes dan belum punya ajaran yang
pengelolaan. Mengetahui apa yang Anda ketahui dan apa pasien tahu, memungkinkan Anda
untuk memprioritaskan
kebutuhan pengajaran yang relevan.
Apa Self-Care Agency artinya?
Badan adalah "kekuatan untuk terlibat dalam tindakan untuk mencapai tujuan tertentu"
(Orem, 2001, hal. 514).
Lembaga-perawatan diri mengacu pada kekuatan atau kemampuan untuk terlibat dalam
tindakan untuk memenuhi syarat perawatan diri
(universal, perkembangan, dan penyimpangan kesehatan). Dengan kata lain, tindakan yang
dilakukan di peduli
untuk diri. Kekuatan ini atau kemampuan ini berkembang dari waktu ke waktu dan dapat
bervariasi dalam tingkat kecukupan dari
satu waktu ke yang lain. Apa yang mempengaruhi tingkat kecukupan adalah faktor
pengkondisian dasar seperti
usia dan negara perkembangan.
Apa itu Permintaan Terapi?
Ini adalah penjumlahan dari langkah-langkah perawatan yang diperlukan pada waktu tertentu
untuk memenuhi semua
dari dikenal syarat perawatan diri individu. Akibatnya, orang tersebut mampu mencapai
perawatan diri.
Teori perawatan diri mengusulkan bahwa konsep (syarat perawatan diri, faktor penyejuk
dasar,

dan komponen listrik) sebagai penjelasan berlaku untuk persyaratan yang diperlukan untuk
kesehatan dan
kesejahteraan.
Teori Self-Care Defisit
Teori defisit perawatan diri menjelaskan dan mengembangkan alasan mengapa orang
membutuhkan
asuhan keperawatan. Penilaian terhadap syarat perawatan diri (universal, perkembangan,
penyimpangan kesehatan)
akan menetapkan bahwa ada permintaan terapi. Langkah selanjutnya adalah menentukan
kemampuan seseorang
untuk memenuhi permintaan terapi. Hal ini dilakukan melalui menilai faktor penyejuk dasar
dan
komponen listrik yang kemudian akan membentuk kebutuhan untuk menyusui.
Teori defisit perawatan diri adalah identifikasi "apa" sifat perawatan diri
defisit dan tindakan yang akan diperlukan untuk memenuhi permintaan terapi. Analisis ini
memberikan dasar untuk bagaimana keperawatan akan membantu orang dalam lembaga
perawatan diri. Defisit perawatan diri
keperawatan diidentifikasi sebagai teori umum tentang apa keperawatan dan harus seperti
yang terbentuk di
situasi praktik keperawatan beton. Teori defisit perawatan diri berfokus pada hubungan
Halaman 18
18
Diperbarui Jatuh 2014
antara permintaan perawatan diri terapeutik (TSCD) (total semua syarat perawatan diri) dan
self yang
peduli atau agen perawatan tergantung (kemampuan untuk memenuhi syarat perawatan diri).
Delapan fungsi
perawatan diri teori defisit keperawatan telah diidentifikasi oleh perawat sebagai penting
untuk menjelaskan
apa teori ini. Fungsi adalah:
Untukditetapkanpandanganmanusiayangtepatuntukkeperawatan
Untukmengungkapkanfokustertentuatauobjekyangtepatkeperawatandimasyarakat
manusia
Untukditetapkankonsepkonsepkuncikeperawatandianggapsebagaibidangpengetahuan
danpraktek
dan untuk membangun sistem simbol atau bahasa
Untukmenetapkanbatasdanpemikiranorientasidanusahapraktisdalampraktek
keperawatan,penelitian,
pengembangan, dan pendidikan bagi keperawatan
Untukmengurangibebankognitifdenganmenyediakansubsumersuntukinformasiyang
masukdanmemungkinkan
orang yang memahami teori untuk mengkategorikan dan membentuk konsep-konsep dari
wawasan terkait
tentang fitur dari situasi keperawatan beton
Untukmemungkinkankesimpulanyangakandibuattentangartikulasikeperawatandengan
bidanglain
pelayanan manusia dan dengan pola hidup sehari-hari dari individu dan keluarga di
masyarakat

Untukmenghasilkandiperawatdanmahasiswakeperawatangayaberpikirdan
berkomunikasikeperawatan
Untukmembawaperawatbersamasebagaikomunitasulamaterlibatdalammelanjutkan
pembangunan, penataan, dan validasi pengetahuan keperawatan (Orem, 2001, hal.
137)
Delapan fungsi teori defisit perawatan diri didasarkan pada perawat yang dirasakan dan
diekspresikan
nilai-nilai teori dalam membimbing pengamatan mereka, kegiatan intelektual mereka, gaya
mereka
berpikir, dan mereka menggunakan bahasa berkembang dalam komunikasi mereka tentang
keperawatan. Diri yang
peduli teori defisit keperawatan tidak hanya mengidentifikasi apa keperawatan, tetapi juga
menyediakan konsep
yang memandu pengembangan awal dan berkelanjutan dari ilmu praktis keperawatan (Orem,
2001).
Lihat Lampiran B untuk Praktek Model Self-Care Teori Defisit Keperawatan Orem
Halaman 19
19
Diperbarui Jatuh 2014
BAB EMPAT
Teori Sistem Keperawatan
Dua yang pertama teori menggambarkan sifat-perawatan diri dan perawatan diri defisit.
Orang dengan
kesehatan yang berasal atau defisit perawatan diri yang berhubungan dengan kesehatan (atau
defisit perawatan tergantung) memiliki kebutuhan untuk
perawatan. Teori sistem keperawatan mencakup dua pertama teori dan mendefinisikan sifat
membantu layanan yang disediakan oleh perawat. Teori ini memperkenalkan variabel
keperawatan disebut keperawatan
lembaga dan konsep yang berkaitan dengan hal itu. Untuk memahami teori sistem
keperawatan, salah satu harus menerima
bahwa:
KeperawatanadalahlayananHelpingsanksidandilembagakanolehmasyarakat
Keperawatanadalah,tindakansengajakompleksdilakukanolehperawatuntukmembantu
oranglain(Orem,2001).
Ide utama di balik teori sistem keperawatan adalah bahwa perawat memberikan layanan
bantuan.
Sistem keperawatan adalah "seri dan urutan tindakan praktis sengaja perawat dilakukan pada
kali berkoordinasi dengan tindakan pasien mereka untuk mengetahui dan memenuhi
komponen pasien mereka '
tuntutan perawatan diri terapi dan untuk melindungi dan mengatur latihan atau
pengembangan pasien
lembaga perawatan diri "(Orem, p. 519). Hal ini dilakukan melalui pelaksanaan lembaga
keperawatan. Itu
Konsep lembaga keperawatan muncul ketika ada kebutuhan untuk menyusui.
Lembaga keperawatan di definisi paling dasar adalah keterampilan dan kehidupan
mengalami bahwa perawat memiliki
diperoleh melalui tahun pendidikan dan praktek yang mereka gunakan untuk secara efektif
mengobati pasien. Satu

tidak dapat memperoleh keterampilan untuk mencapai sebuah lembaga keperawatan sukses
dalam semalam. Hal pertama yang harus
dikuasai adalah sebuah "konstruksi operasi diperlukan" yang terdiri dari sosial, interpersonal,
dan
domain profesional-Technologic. Domain pertama, karakteristik sosial merujuk untuk
memiliki
pengetahuan tentang bagaimana untuk menerima budaya lain, nilai-nilai, etika, dan moral.
Perawat mampu berinteraksi
dengan pasien, keluarga mereka, dan penyedia perawatan kesehatan lainnya dengan kebaikan
dan kesopanan. The sosial
mengacu pada profesi keperawatan secara keseluruhan dan kontrak sosial yang melekat
dalam Perawat Praktek
Bertindak, misalnya. Lisensi keperawatan memberi legitimasi hukum praktik keperawatan.
Di lain
kata, seseorang yang tidak memiliki pendidikan perawat, tidak dapat berlatih menyusui, atau
bahkan mengatakan
dia / dia adalah seorang perawat. Masyarakat memberi kita legitimasi kami sebagai perawat
ketika kita memiliki pendidikan dan memiliki
lulus ujian lisensi (NCLEX) (Secrest, 2008).
Domain kedua, interpersonal, mengacu pada pengetahuan tentang bagaimana berinteraksi
dengan orang-orang pada
tingkat yang lebih dalam. Apakah ini berarti bahwa perawat mampu menunjukkan empati
untuk pasien serta
memiliki keinginan untuk membantu pasien yang mencapai tujuan perawatan diri mereka.
Perawat menyadari pentingnya
hubungan dan bagaimana berkomunikasi secara efektif dengan pasien dan lain-lain. Perawat
yang mencerminkan
pada hubungan ini pengalaman akan memiliki pertumbuhan yang jauh lebih kaya dalam
domain interpersonal. Saya t
juga mengembangkan pengetahuan estetika. Pengalaman dengan demonstrasi empati tumbuh
dari masing-masing
interaksi. Intuisi mengembangkan pengetahuan, sikap, dan keterampilan berkembang.
Pengulangan akan membantu
mentransfer keterampilan ini untuk pengetahuan yang terkandung di mana Anda tidak perlu
memikirkan setiap langkah.
Pengetahuan Diwujudkan kontribusi untuk intuisi Anda.
Halaman 20
20
Diperbarui Jatuh 2014
Domain terakhir, profesional-Technologic mengacu pada pengetahuan tentang bagaimana
melakukan keperawatan
tugas, seperti tekanan darah, dengan keyakinan dan kemudahan serta kemampuan berpikir
kritis diperlukan
untuk proses keperawatan dan penelitian keperawatan. Sebagai contoh, perawat dapat
membantu pasien bertemu
Tujuan perawatan diri mereka menggunakan proses metodis (proses keperawatan). Semua
karakteristik ini mendefinisikan
pengembangan kompleks kemampuan perawat. Seperti kita terus tumbuh sebagai perawat,
kita

terus mendapatkan pengetahuan dan kemampuan ini sosial, interpersonal, dan profesionaldomain Technologic. Kita dapat menambahkan pertumbuhan ini untuk repertoar kami yang
menyebabkan keperawatan pribadi kita
lembaga untuk menjadi lebih kuat (Fulkerson, 2007). Lihat Lampiran C untuk elemen kunci
dari
komponen sosial, interpersonal, dan profesional-Technologic dari proses keperawatan.
Orem berbicara dengan karakteristik yang dianggap diinginkan dalam tiga domain
keperawatan
agen. Sekolah Keperawatan Fakultas telah mengidentifikasi tujuh karakteristik penting untuk
keperawatan
agen:
1. repertoar Efektif keterampilan komunikasi
2. mengajar Transformatif
3. Kepemimpinan
4. praktek Etis
5. Prudent (hukum) praktek
6. sensitivitas Budaya
7. perilaku profesional (Keatley, 2008).
Dalam rangka untuk mengenali dan menerapkan karakteristik ini, bagaimanapun, yang
pertama harus telah memungkinkan
kemampuan, seperti seni dan kehati-hatian.
Sedangkan satu dapat diajarkan tiga operasi yang diperlukan dari lembaga keperawatan, yang
memungkinkan
kemampuan seni dan kehati-hatian yang diperoleh melalui pengalaman hidup dan
kepribadian sendiri seseorang
dan akan berbeda dengan setiap perawat. Orem mendefinisikan seni sebagai "kualitas
intelektual orang yang
terungkap dalam apa yang mereka buat, yaitu, produk dari usaha mereka "(Orem, p. 293).
Seni adalah
tindakan melihat ke pasien dan melihat di luar penyimpangan jelas dari mana ia / dia
menderita, dan benar-benar melihat pasien dan bekerja menuju tujuan untuk membantu dia /
nya. Hal ini seperti bekerja
teka-teki; perawat memiliki keterampilan untuk melihat pasien yang tidak hanya sebagai
pasien tetapi sebagai seorang ibu, adik,
saudara, suami, penyedia perawatan dan mampu mengumpulkan apa yang benar-benar akan
membantu ini
Pasien sekedar obat. Perawat benar-benar terampil membutuhkan waktu ini solusi logis yang
diperoleh melalui
/ nya seninya dan mampu menempatkan solusi ini ke dalam tindakan melalui / kualitas nya
kehati-hatian.
Orem mendefinisikan keperawatan kehati-hatian sebagai "kualitas perawat yang
memungkinkan mereka (a) untuk mencari dan mengambil
nasihat dalam situasi keperawatan baru atau sulit, (b) untuk membuat penilaian yang benar
tentang apa yang harus dilakukan dan
apa yang harus dihindari ketika kondisi tertentu berlaku atau tiba-tiba mengembangkan dalam
situasi keperawatan, (c) ke
memutuskan untuk bertindak dengan cara tertentu, dan (d) untuk mengambil tindakan "(hal.
293).
Seni adalah investigasi kreatif ke dalam kebutuhan pasien dan kehati-hatian adalah
bagaimana perawat

pendekatan memperbaiki penyimpangan / masalah. Karena setiap perawat adalah individu


dan memiliki yang berbeda
kepribadian serta cara situasi mendekati, kehati-hatian bukanlah sesuatu yang dapat
Halaman 21
21
Diperbarui Jatuh 2014
diajarkan secara absolut. Prudence adalah sesuatu yang kita harus mendapatkan dari waktu ke
waktu dan melalui
pendidikan dan pengalaman hidup, karena tidak ada selalu cara yang benar atau salah untuk
menangani
Situasi, hanya ada apa yang terasa benar atau salah untuk individu. Tidak akan pernah ada
panti
Situasi di mana satu solusi universal akan bekerja untuk setiap pasien; Anda harus bersedia
untuk
menyesuaikan dan meregangkan batas dan ide-ide Anda sendiri untuk beradaptasi dengan
kebutuhan yang berbeda pasien. Kedua seni
keperawatan dan keperawatan kehati-hatian berkembang perawat dengan pengalaman hidup
dan dengan upaya yang tekun
terhadap perkembangan mereka. Bagaimana mengembangkan didasarkan pada setiap
individu perawat bakat,
karakteristik kepribadian, cara berpikir, perkembangan moral pribadi, kemampuan untuk
konsep situasi yang kompleks, kemampuan untuk menganalisis dan mensintesis informasi
faktual, dan
jenis pengalaman hidup mereka telah baik pribadi dan profesional.
Ada tiga variasi dasar dalam sistem keperawatan:
Sepenuhnyakompensasi
Sebagiankompensatoris
Mendukungedukatif
Variasi ini berkaitan dengan pertanyaan: Siapa yang bisa atau harus melakukan perawatan diri
mereka
operasi? Jika itu adalah perawat karena pasien tidak mampu, sistem keperawatan sepenuhnya
kompensatoris karena perawat akan mengkompensasi total kurangnya pasien dari
kemampuan untuk
terlibat dalam aktivitas perawatan diri. Jika jawabannya adalah bahwa pasien dapat
melakukan beberapa tapi tidak semua
tindakan perawatan diri, maka sistem keperawatan adalah sebagian kompensasi. Jika
jawabannya adalah bahwa pasien
dapat dan harus melakukan semua aktivitas perawatan diri saat terlibat dalam pengembangan
perawatan diri, maka
sistem keperawatan harus bahwa dari mendukung-edukatif (Orem, p. 350). Lihat Lampiran
D.
Teori ini mengatur bagaimana perawat membantu pasien memenuhi syarat perawatan diri
mereka. Hal ini memerlukan
orang berpendidikan sebagai perawat yang akan merancang dan mengatur perawatan untuk
membantu memulihkan lembaga perawatan diri.
Bayangkan naik di kursi belakang sebuah sepeda tandem di mana pasien di kursi depan.
Awalnya, dia terlalu lemah atau sakit untuk menjajakan: pada saat ini Anda menjajakan liar
saja untuk menjaga

sepeda bergerak maju (yang sepenuhnya kompensasi). Dengan berjalannya waktu, rasa sakit
berkurang dan pasien
menjadi kuat, sehingga ia / dia mulai membantu dengan mengayuh (sebagian kompensasi).
Lebih jauh bersama,
rasa sakit diabaikan, pasien cukup kuat untuk melakukan semua mengayuh, tapi dia / dia
tidak
tahu bagaimana untuk mencapai tujuan. Anda sebagai perawat memberitahu pasien mana
harus pergi, menunjukkan
landmark untuk referensi di masa mendatang (mendukung-edukatif).
Sekali lagi, konsep lembaga keperawatan hasil dalam merancang, perencanaan, dan
memproduksi dari
sistem keperawatan yang meliputi tindakan keperawatan yang diperlukan untuk
mempertahankan dan mempromosikan kesehatan
dan kesejahteraan orang lain serta melindungi kesehatan perawat. Menjadi seorang perawat
yang baik adalah
proses yang terus berubah dan tumbuh setiap hari dengan pengalaman menyusui Anda temui.
Itu
kekuatan seseorang lembaga keperawatan adalah refleksi dari kemampuan seseorang sebagai
perawat; itu adalah sesuatu yang Anda
membangun seluruh hidup Anda, selama karir Anda, dan sesuatu yang terus tumbuh bahkan
setelah
pensiun.
Halaman 22
22
Diperbarui Jatuh 2014
LAMPIRAN A
UNIVERSITY OF Tennessee di Chattanooga
SEKOLAH KEPERAWATAN
OREM BERBASIS DIAGNOSTIK PROSES **
Lengkap DEWASA PENILAIAN
(** Subyektif-Orem Sejarah Kesehatan;
Tujuan-Fisik Ujian (inspeksi [pertama], auskultasi, palpasi dan perkusi)
Nama pewawancara __________________________
Tanggal ___________________
A. FAKTOR CONDITIONING DASAR
TERAPEUTIK
PERMINTAAN
(Periksa apakah permintaan adalah
menyajikan)
KEKUASAAN
KOMPONEN
(Kemampuan untuk memenuhi
permintaan terapi Y / N)
1. Usia _______
2. Jenis kelamin _______
3. Sistem Keluarga: a. # Anak ______ b. Status pernikahan______
c. Dengan siapakah engkau tinggal? ___________________
d. Siapa yang Anda anggap keluarga? _________________________

e. Apa peran Anda dalam keluarga? _________________________


f. Apakah Anda memiliki riwayat keluarga / masalah kesehatan medis? Jika ya, daftar
anggota keluarga dan masalah kesehatan. _____________________
g. Melampirkan genogram sebuah
4. sosiokultural dan Spiritual:
Sebuah. Apa etnismu? _______________________________
b. Apa bahasa utama Anda? ________________________
c. Apakah Anda memiliki kesulitan membaca atau menulis? ______________
d. Apakah Anda memiliki satu set keyakinan spiritual? ___________________
e. Apakah Anda memiliki praktek spiritual biasa? __________________
Halaman 23
23
Diperbarui Jatuh 2014
5. Kesehatan Negara: (data subjektif dan objektif)
SUBYEKTIF:
Sebuah. Apa alasan Anda saat mencari perawatan? (menggunakan GEROBAK OLD
sebagaimana berlaku)
saya. __________________________________
b. Diagnosis medis; DSM IV: Axis I - V; co-morbities)
saya. __________________________________
c. Apa yang paling khawatir tentang kunjungan ini?
saya. ___________________________________
d. Kesehatan negara biasa (tingkat atas skala 1-10 dengan 10 menjadi sangat baik
dan mengapa) __________________________________
e. Riwayat kesehatan masa lalu (termasuk medis, mental, operasi; keluarga
sejarah)____________________________________________
f. Obat (daftar semua resep, obat bebas, herbal, vitamin, dll)
(mengutip penjelasan Pasien untuk digunakan)
g. Selain obat-obatan, yang Anda bawah setiap pengobatan untuk
penyakit saat ini? ____________________________________
h. Alergi (menggambarkan reaksi terhadap masing-masing) _____________________
TUJUAN:
Sebuah. Ujian fisik - (bagian F)
b. Laboratorium yang bersangkutan dan tes diagnostik - (bagian G)
6. Faktor Sistem Kesehatan:
Sebuah. Agen Perawatan Kesehatan (misalnya perawatan kesehatan di rumah, PT, OT, dll)
___________________________________
___________________________________
___________________________________
7. Pola Hidup: Apa kegiatan yang biasa sehari-hari Anda?
_________________________________________
_________________________________________
_________________________________________
_________________________________________
8. Faktor lingkungan:
Sebuah. Apa di lingkungan rumah atau bekerja dapat berkontribusi untuk Anda
kesehatan negara saat ini?
___________________________________
___________________________________

Halaman 24
24
Diperbarui Jatuh 2014
b. Apakah Anda khawatir tentang rumah atau lingkungan lain
terkait dengan kondisi kesehatan Anda saat ini? Jika ya, jelaskan.
___________________________________
___________________________________
9. ketersediaan Sumber Daya / kecukupan:
Sebuah. Apakah sumber Anda / keuangan yang memadai untuk memenuhi kebutuhan untuk
obat-obatan dan perawatan yang diresepkan?
___________________________________
b. Apa jenis asuransi (jika ada) yang tersedia?
___________________________________
c. Apa sumber bantuan yang saat ini Anda gunakan untuk mengelola
kesehatan?
___________________________________
___________________________________
10. Pembangunan Tahap: Intrauterine, neonatal, bayi, anak,
remaja, dewasa. (lingkaran tahap Orem sesuai)
B. KOMPONEN DAYA: Kemampuan untuk memenuhi tuntutan terapi. Menilai setiap
komponen (dengan keterangan tertulis
dan bukti pendukung) dan membuat keputusan klinis jika mereka memadai untuk
memenuhi tuntutan terapi.
1. Kewaspadaan:
2. Energi:
3. Tubuh Control:
4. Alasan:
5. Motivasi:
6. Pengambilan Keputusan:
7. Pengetahuan Teknis:
8. Repertoire keterampilan:
9. Connect tindakan:
10. Lakukan / mengintegrasikan:
C. UNIVERSAL SELF-CARE syarat:
TERAPEUTIK
KEKUASAAN
Halaman 25
25
Diperbarui Jatuh 2014
Termasuk rincian re: positif dan negatif
PERMINTAAN
(Periksa apakah permintaan adalah
menyajikan)
KOMPONEN
(Kemampuan untuk memenuhi
permintaan terapi Y / N)
1. Air:

Sebuah. Apakah Anda memiliki masalah dengan SOB atau menggunakan perangkat apapun
untuk membantu dalam
pernafasan? Jika ya, jelaskan.
___________________________________
b. Jelaskan masalah dengan sinus / gejala hidung? Ketika kamu
memiliki URI, berapa lama waktu yang diperlukan untuk pulih dan apa
perkembangan biasa?
___________________________________
c. Apakah Anda memiliki batuk dijelaskan, sering pilek, paparan
merokok atau iritasi pernapasan lainnya?
___________________________________
d. Apakah Anda mengalami nyeri dada? (OLD GEROBAK)
___________________________________
2. Air:
Sebuah. Cairan (termasuk jumlah dan jenis) apa yang Anda minum dalam
24 jam. periode?
___________________________________
b. Telah konsumsi Anda berubah dalam setahun terakhir?
___________________________________
3. Makanan:
Sebuah. Apa yang Anda secara rutin makan di hari 24 jam? (jika diarahkan, melampirkan
1 - hari diet recall bentuk analisis gizi)
_____________________________________
b. Jelaskan nafsu makan Anda.
________________________________________
c. Apakah Anda pada, atau Anda berada di dalam masa lalu, yang secara khusus
resep diet? (jika ya,
menggambarkan)________________________________________
d. Apakah Anda mengalami kesulitan dengan makan, mengunyah, atau
menelan? (jika ya, jelaskan) ____________
e. Apakah Anda mengalami kenaikan berat badan / kerugian yang terakhir
tahun?______________
Halaman 26
26
Diperbarui Jatuh 2014
f. Apakah Anda melihat masalah dengan kulit Anda (kering, bengkak,
lesi atau gatal)?
________________________________________
g. Bila Anda memiliki luka, Anda sembuh dengan cepat?
____________________
4. Eliminasi:
Sebuah. Berapa kali dalam sehari Anda buang air kecil? _____________ Bagaimana
berkali-kali di malam hari? _______________________
b. Apa warna urin? ___________________________
c. Apakah Anda mengalami masalah dengan buang air kecil, seperti nyeri,
terbakar, dribbling, inkontinensia, retensi, atau
frekuensi?____________________
d. Adalah perangkat bantuan yang digunakan untuk buang air kecil (yaitu inkontinensia
bantalan, kateter atau cystostomy)?

______________________________________
e. Jelaskan yang normal pola yang eliminasi usus Anda
frekuensi_________; warna________________;
konsistensi____________________________
f. Apakah alat bantu apapun yang digunakan untuk eliminasi usus seperti
pencahar, supositoria, enema, atau colostomy / ileostomi?
___________________
g. Menggambarkan pengalaman salah indigestion______________,
diarrhea____________, N / V _______________,
sakit perut______________________
h. Pria-testis sakit atau massa, penis discharge atau
burut?__________
saya. Perempuan-Pernahkah Anda memperhatikan keputihan atau bau? ________
Usia onset menstruasi ____________. LMP_______________
5. Aktivitas / Istirahat:
Sebuah. Apakah Anda memiliki masalah tidur? Jika ya jelaskan
____________________________________________
b. Jelaskan pola yang biasa Anda tidur (jumlah / kapan)
____________________________________________
c. Telah pola tidur Anda berubah baru-baru? ______ Jika ya,
bagaimana_________________________________________
d. Apakah Anda menggunakan segala cara untuk membantu mempermudah tidur / istirahat?
Jika ya,
menggambarkan
(misalnya obat, OTC, alkohol, meditasi, dll)
_____________________________________________
e. Jelaskan tingkat aktivitas Anda:
____________________________________________
f. Apakah Anda berolahraga? Jika ya, jenis daftar, frekuensi dan
lamanya_____________________________________
g. Apakah Anda mengalami salah satu dari berikut selama latihan? MENANGIS,
nyeri dada, palpitasi, sakit kaki, atau nyeri pada otot atau sendi. Jika
ya, jelaskan.
_______________________________________________
Halaman 27
27
Diperbarui Jatuh 2014
h. Apakah Anda memerlukan bantuan untuk kegiatan sehari-hari berikut ini?
Makan ______ bathing_______
ke toilet ______ mobilitas tidur ________ dressing________
dandan_________
cooking_________ mobility_________ umum
rumah maintenance_________ shopping_________
6. Solitude / Interaksi Sosial:
Sebuah. Berapa banyak interaksi yang Anda miliki dengan anggota keluarga?
____________________________________________
b. Berapa banyak waktu sehari yang Anda habiskan sendirian?
____________________________________________
c. Bagaimana Anda menangani konflik?

____________________________________________
d. Apakah Anda memiliki teman dekat selain anggota keluarga?
____________________________________________
e. Apakah Anda berpartisipasi dalam kelompok-kelompok sosial?
Menggambarkan_____________________________________
f. Apakah Anda memiliki gangguan sensorik? Misalnya. gangguan pendengaran, penglihatan
masalah? ______________________________
7. Pencegahan Bahaya:
Sebuah. Apa langkah-langkah keamanan yang Anda ambil? yaitu alarm asap, kursi
ikat pinggang, dll
_____________________________________________
b. Apakah Anda mengetahui adanya faktor risiko yang Anda miliki untuk penyakit?
_____________________________________________
c. Apakah Anda aktif secara seksual? __________ Jika ya, apa usia Anda lakukan
pertama terlibat dalam aktivitas seksual? __________ Berapa banyak mitra
jangan saat ini Anda miliki? _______________
d. Apakah Anda saat ini up to date pada usia yang tepat
imunisasi? ________________________________
e. Apakah Anda secara rutin terlibat dalam perawatan kesehatan preventif? yaitu
payudara sendiri ujian, ujian testis, kolonoskopi, lainnya
____________________________
f. Apakah saat ini Anda mengkonsumsi berbahaya, adiktif
zat? ________ Jika ya, jelaskan
_____________________________________________
_____________________________________________
_____________________________________________
g. Apakah Anda mencoba untuk berhenti? ___________ Jika Anda belum mencoba
berhenti, mengapa tidak? ____________________________ Jika Anda memiliki
mencoba untuk berhenti, kau berhasil? ______________. Akan
Anda ingin membantu? ____________________________
Halaman 28
28
Diperbarui Jatuh 2014
8. normal:
a. Bagaimana Anda menggambarkan keadaan saat Anda menjadi?
________________________________________
b. Apakah Anda memiliki perasaan terus-menerus dari depresi, kecemasan, kemarahan,
bunuh diri? _________ Jika ya, silahkan rumit
_____________________________________________
_____________________________________________
c. Apakah saat ini Anda menderita masalah dengan memori,
fungsi intelektual / baik psikologis menjadi? ______ Jika ya,
apa / kapan mulai / apa yang sedang dilakukan tentang
saya t?___________________________________________
d. Bagaimana menilai tingkat stres Anda saat ini? (1-10: 10 = terburuk)
__________ Jika Anda menganggap ini tingkat stres yang tinggi, bagaimana Anda
mengelola stres Anda?
_____________________________________________
e. Apakah Anda merasa Anda memerlukan bantuan mengelola stres Anda?

_____________________________________________
f. Apakah Anda mengantisipasi perubahan besar dalam hidup di masa depan?
Misalnya, pernikahan, perceraian, kelahiran anak,
dll .__________________________________________
D. PEMBANGUNAN DIRI-CARE syarat
TERAPEUTIK
PERMINTAAN
(Periksa apakah permintaan adalah
menyajikan)
KEKUASAAN
KOMPONEN
(Kemampuan untuk memenuhi
permintaan terapi
- Y / N)
Daftar tahap perkembangan pasien Anda menurut Erikson, Sullivan,
Kolberg, dan Piaget. Menyajikan data subjektif dan objektif untuk mendukung Anda
penilaian tahap perkembangan mereka.
1. Bagaimana pasien terlibat dalam usia perkembangan yang sesuai
tugas? _______________________________________________
2. Bagaimana pasien mempromosikan perilaku sehat? __________
3. Jelaskan gangguan perawatan diri-perkembangan pasien
syarat. _______________________________________
4. Bagaimana pasien mengatasi kesulitan? (lihat Orem Handbook untuk
daftar kemalangan) _______________________________
Halaman 29
29
Diperbarui Jatuh 2014
5. Peran apa tahap perkembangan pasien terhadap mereka
permintaan terapi? ___________________________________
6. Bagaimana tahap perkembangan mempengaruhi peran Anda sebagai perawat?
__________________________________________________
E. KESEHATAN-DEVIASI syarat DIRI-CARE
KEKUASAAN
KOMPONEN
(Kemampuan untuk memenuhi
permintaan terapi
- Y / N)
Kesehatan Penyimpangan:
(Pertama: Daftar Setiap penyakit, cedera, cacat, cacat, diagnosis medis dan / atau perawatan.
Berikutnya:
Menjawab pertanyaan-pertanyaan yang mengikuti setiap penyimpangan kesehatan.)
1. _________________________________________
Sebuah. Mencari bantuan medis yang tepat
b. Menyadari efek dari kondisi
c. Melakukan langkah-langkah keluar diresepkan
d. Menyadari efek merusak dari kondisi
e. Memodifikasi konsep diri untuk menerima keadaan kesehatan
f. Belajar untuk hidup dengan kondisi
2. _________________________________________

Sebuah. Mencari bantuan medis yang tepat


b. Menyadari efek dari kondisi
c. Melakukan langkah-langkah keluar diresepkan
d. Menyadari efek merusak dari kondisi
e. Memodifikasi konsep diri untuk menerima keadaan kesehatan
f. Belajar untuk hidup dengan kondisi
3. _________________________________________
Sebuah. Mencari bantuan medis yang tepat
b. Menyadari efek dari kondisi
c. Melakukan langkah-langkah keluar diresepkan
d. Menyadari efek merusak dari kondisi
e. Memodifikasi konsep diri untuk menerima keadaan kesehatan
f. Belajar untuk hidup dengan kondisi
Halaman 30
30
Diperbarui Jatuh 2014
4. _________________________________________
Sebuah. Mencari bantuan medis yang tepat
b. Menyadari efek dari kondisi
c. Melakukan langkah-langkah keluar diresepkan
d. Menyadari efek merusak dari kondisi
e. Memodifikasi konsep diri untuk menerima keadaan kesehatan
f. Belajar untuk hidup dengan kondisi
5. _________________________________________
Sebuah. Mencari bantuan medis yang tepat
b. Menyadari efek dari kondisi
c. Melakukan langkah-langkah keluar diresepkan
d. Menyadari efek merusak dari kondisi
e. Memodifikasi konsep diri untuk menerima keadaan kesehatan
f. Belajar untuk hidup dengan kondisi
F. FISIK UJIAN - (10 MENIT PENILAIAN)
Universal Self
Perawatan Requisite
dan
sesuai
sistem
Ujian Fisik
Temuan
Terapeutik
Permintaan:
(memeriksa apakah
permintaan
menyajikan)
Kekuasaan
Komponen;
(kemampuan untuk
memenuhi
terapeutik
permintaan-

Y / N)
Pencegahan
Bahaya /
Lingkungan
Penelitian
kebersihanTangan
Mengenalkandiridantujuankunjungan
Mengidentifikasipasien(2pengidentifikasi)
Alergi
surveiRoomdankeselamatanpemeriksaan
Normal /
Neuro
LOC:kewaspadaan,interaksi,orientasi(orang,
tempat, waktu)
Pidato/visi/pendengaran
Tingkatkenyamanan(kecemasanataukegelisahan)
simetriwajahdanmurid(PERRLAdanUkuran)
TandaVital(HR,RR,BP,Temp,O2Sat,skalanyeri)
Air / Resp dan
CV
iramapernapasan,kedalaman,simetri.
oksigenasitambahanataudukunganpernapasan
Tabungatausaluranair(dengan/tanpahisap)
suaradaniramajantung
suaraNafas
pulsaPeripheral(perbandinganbilateralirama
dan amplitudo untuk radial; Perbandingan bilateral
amplitudo untuk brakialis, dorsalis pedis, posterior
tulang kering)
Kapilerrefilldansianosis
Halaman 31
31
Diperbarui Jatuh 2014
Air / Kulit
Modeasupancairan(PO,enteral,IV)
Tabung/saluran
Kulit(warna,suhu,kelembaban,turgor,lesi,tekanan
poin: tengkuk, tulang belikat, sacrum, gluteus, siku,
heels) **
Edema
Makanan dan
Penghapusan /
Daerah perut
Intake:nafsumakan,mual
Output:berkemih,BMterakhir,muntah
konturabdomen,sayatan,nyeriatau

ketegasan.
Tabungatausaluranair(dengan/tanpahisap)
suarausus(4kuadran)
Kegiatan-Rest /
Kaki dan tangan
Mobility,kekuatandansimetri
ROM
Terapi(Pengekangan,TED/SCDs,CPM,TENS,
es / panas)
Solitude-Sosial
Interaksi
Keluargaatautemantemanyanghadir
** Mengintegrasikan penilaian kulit ke dalam setiap USCR dan pemeriksaan fisik atas **
G. bersangkutan Lab dan Uji hasil:
Temuan:
Terapeutik
Permintaan:
(memeriksa apakah
permintaan
menyajikan)
Kekuasaan
Komponen;
(kemampuan untuk
memenuhi
terapeutik
permintaanY / N)
Halaman 32
32
Diperbarui Jatuh 2014
H. Ringkasan Defisit Perawatan Diri: (daftar tuntutan terapi untuk pasien yang kekurangan
daya
komponen untuk mengelola)
Halaman 33
33
Diperbarui Jatuh 2014
LAMPIRAN B
Halaman 34
34
Diperbarui Jatuh 2014
LAMPIRAN C
Halaman 35
35
Diperbarui Jatuh 2014
LAMPIRAN D

Halaman 36
36
Diperbarui Jatuh 2014
Referensi
Dennis, C. (1997). Teori Defisit perawatan diri keperawatan: Konsep dan aplikasi. St. Louis:
Mosby.
. Fulkerson, E. (2007) lembaga Keperawatan: Sebuah kertas siswa. UTC School of Nursing.
Keatley, V. (2008). Mengidentifikasi dan mengartikulasikan karakteristik lembaga
keperawatan: BSN
perspektif siswa, Self-Care, Dependent-Care & Perawatan, 16 (2), hlm. 18-21.
Nightingale, F. (1859). Catatan atas keperawatan. Philadelphia: Lippincott.
Orem, D. (2001). Konsep Keperawatan praktek (6
th
edisi). St. Louis: Mosby.
Pollard, M. (2007). Teori Defisit perawatan diri: Sebuah makalah mahasiswa. UTC School
of Nursing.
Secrest, J. (2008). Teori praktik keperawatan berdasarkan: Sebuah dokumen kerja. UTC
School of Nursing.