Anda di halaman 1dari 11

SATUAN ACARA PENYULUHAN (SAP) KELOMPOK 2

DI PUSKESMAS TAMBAK REJO


SURABAYA

Disusun Oleh :
Afissa Rahma Ayunda
Agita Anggun Mawarni
Hanny Horizoni
Hilda Rosa Nilasari
R. Kamaliyatul Adiybah
Raihatus Sofia

(121.0004)
(121.0005)
(121.0043)
(121.0044)
(121.0080)
(121.0082)

PROGRAM STUDI S1 KEPERAWATAN


SEKOLAH TINGGI ILMU KESEHATAN HANG TUAH
SURABAYA
2016

SATUAN ACARA PENYULUHAN (SAP)


LUKA BAKAR

A.

Pokok Bahasan

: Luka Bakar

Sub Pokok Bahasan

: Penatalaksanaan Luka Bakar

Sasaran

: Pasien Puskesmas Tambak Rejo Surabaya

Tempat

: Puskesmas Tambak Rejo Surabaya

Latar Belakang
Luka bakar merupakan kerusakan atau kehilangan jaringan yang disebabkan

oleh kontak dengan sumber panas seperti air panas, api, bahan kimia, listrik, dan
radiasi. Luka bakar mengakibatkan peningkatan permeabilitas pembuluh darah
sehingga air, klorida, dan protein tubuh akan keluar dari dalam sel dan
menyebabkan edema yang dapat berlanjut pada keadaan hipovolemia dan
hemokonsentrasi burn shock (shock hipovolemik) merupakan komplikasi yang
sering terjadi.

Statistikmenunjukkanbahwa60%lukabakarterjadikarenakecelakaan
rumahtangga,20%karenakecelakaankerja,dan20%sisanyakarenasebab
sebab lain, misalnya bus terbakar, ledakan bom, dan gunung meletus.
Penanganan dan perawatan luka bakar (khususnya luka bakar berat)
memerlukan perawatan yang kompleks dan masih merupakan tantangan
tersendiri karena angka morbiditas dan mortalitas yang cukup tinggi.1 Di
Amerikadilaporkansekitar23jutapenderitasetiaptahunnyadenganjumlah
kematiansekitar56ribukematianpertahun.DiIndonesiasampaisaatini
belumadalaporantertulismengenaijumlahpenderitalukabakardanjumlah
angkakematianyangdiakibatkannya.DiunitlukabakarRSCMJakarta,pada
tahun2008dilaporkansebanyak107kasuslukabakaryangdirawatdengan
angka kematian 37,38%. Dari unit luka bakar RSU Dr. Soetomo Surabaya
padatahun2008didapatkandatabahwakematianumumnyaterjadipadaluka

bakardenganluaslebihdari50%ataupadalukabakaryangdisertaicedera
padasalurannapasdan50%terjadipada7haripertamaperawatan.
Beberapa karakteristik luka bakar yang terjadi membutuhkan tindakan
khususyangberbeda.Karakteristikinimeliputiluasnya,penyebab(etiologi)dan
anatomilukabakar.Lukabakaryangmelibatkanpermukaantubuhyangbesar
atauyangmeluaskejaringanyanglebihdalam,memerlukantindakanyanglebih
intensifdaripadalukabakaryanglebihkecildansuperficial.Lukabakaryang
disebabkanolehcairanyangpanas(scaldburn)mempunyaiperbedaanprognosis
dankomplikasidaripadalukabakaryangsamayangdisebabkanolehapiatau
paparanradiasiionisasi.Lukabakarkarenabahan kimia memerlukan pengobatan
yang berbeda dibandingkan karena sengatan listrik (elektrik) atau persikan api. Luka
bakaryangmengenaigenetaliamenyebabkanresikonifeksiyanglebihbesardaripadadi
tempat lain dengan ukuran yang sama. Luka bakar pada kaki atau tangan dapat
mempengaruhikemampuanfungsikerjakliendanmemerlukantehnikpengobatanyang
berbedadarilokasipadatubuhyanglain.Pengetahuanumumperawattentanganatomi
fisiologikulit,patofisiologilukabakarsangatdiperlukanuntukmengenalperbedaandan
derajat luka bakar tertentu dan berguna untuk mengantisipasi harapan hidup serta
terjadinyakomplikasimultiorganyangmenyertai.
Prognosisklienyangmengalamisuatulukabakarberhubunganlangsungdengan
lokasidanukuranlukabakar.Faktorlainsepertiumur,statuskesehatansebelumnyadan
inhalasiasapdapatmempengaruhiberatnyalukabakardanpengaruhlainyangmenyertai.
Klienlukabakarseringmengalamikejadianbersamaanyangmerugikan,sepertilukaatau
kematiananggotakeluargayanglain,kehilanganrumahdanlainnya.Klienlukabakar
harusdirujukuntukmendapatkanfasilitasperawatanyanglebihbaikuntukmenangani
segeradanmasalahjangkapanjangyangmenyertaipadalukabakartertentu.

B.

Tujuan Instruksional Umum


Setelah dilakukan penyuluhan diharapkan para peserta mampu memahami

dan mengaplikasikan penatalaksanaan luka bakar.


C.

Tujuan Instruksional Khusus


Setelah mengikuti proses penyuluhan selama 30 menit, peserta mampu :
1.

Menjelaskan tentang pengertian luka bakar.

2.

Menyebutkan tentang penyebab luka bakar.

3.

Menyebutkan tentang derajat luka bakar.

4.

Menyebutkan tentang tanda dan gejala luka bakar.

5.

Menyebutkan tentang penanganan pada luka bakar.

6.

Menyebutkan tentang hal-hal yang tidak boleh dilakukan dalam


menangani luka bakar.

D.

Pengorganisasian

No.
1.
2.
3.
4.
5.
6

Nama
Afissa Rahma Ayunda
Agita Anggun
Hilda Rosa N
Hanny Horizoni
Raihatus Sofia
R. Kamaliyatul Adiybah

E.

NIM
121.0004
121.0005
121.0044
121.0043
121.0082
121.0080

Waktu dan Tempat Pelaksanaan

Hari/Tanggal

: Senin, 1 April 2016

Waktu

: 07.30 08.00 WIB

Tempat

: Puskesmas Tambak Rejo Surabaya

F.

Keterangan
Penyaji
Dokumentasi
Fasilitator
Observer
Fasilitator
Moderator

Sasaran
Beberapa pasien di Puskesmas Tambak Rejo Surabaya.

G.
No.
1.
2.
3.
4.
5.
6

H.

Pengorganisasian
Nama
Afissa Rahma Ayunda
Agita Anggun
Hilda Rosa N
Hanny Horizoni
Raihatus Sofia
R. Kamaliyatul Adiybah

Setting Tempat

NIM
121.0004
121.0005
121.0044
121.0043
121.0082
121.0080

Keterangan
Penyaji
Dokumentasi
Fasilitator
Observer
Fasilitator
Moderator

Keterangan :

I.

J.

: Dokumentasi

: Penyaji

: Observer

: Pasien

: Moderator

Metode
1.

Ceramah

2.

Diskusi dan Tanya jawab

Media
1.

K.

: Fasilitator

Leaflet

Materi
Terlampir

L.

Kegiatan Penyuluhan
No Tahap / Waktu

Kegiatan Penyuluhan

Kegiatan Klien

Pembukaan
3 Menit

Mengucapkan salam
pembuka

Menjawab salam

Memperkenalkan diri

Menjelaskan maksud dan

Mendengarkan

tujuan
2

Pelaksanaan
15 menit

Menjelaskan tentang
pengertian luka bakar.

Memperhatikan

Menyebutkan tentang
penyebab luka bakar.

Menyebutkan tentang

Mendengarkan

derajat luka bakar.

Menyebutkan tentang
tanda dan gejala luka

Mendengarkan

bakar.

Menyebutkan tentang
penanganan pada luka

bakar.

Mendengarkan

Menyebutkan tentang halhal yang tidak boleh


dilakukan dalam

menangani luka bakar

Memperhatikan

Memperhatikan
3

Penutup
10 menit

Memberi kesempatan
peserta untuk bertanya

Bertanya

Menjawab pertanyaan
yang diajukan peserta

Memperhatikan

Menanyakan kembali pada


peserta tentang materi

yang telah disampaikan

Menjawab
pertanyaan

Menyimpulkan hasil
penyuluhan

Mengucapkan salam

Memperhatikan

Menjawab salam
penutup
M.

Evaluasi
Evaluasi dilakukan secara lisan :
1.

Pasien mampu menjelaskan tentang pengertian luka bakar.

2.

Pasien mampu menyebutkan tentang penyebab luka bakar.

3.

Pasien mampu menyebutkan tentang derajat luka bakar.

4.

Pasien mampu menyebutkan tentang tanda dan gejala luka bakar.

5.

Pasien mampu menyebutkan tentang penanganan pada luka bakar.

6.

Pasien mampu menyebutkan tentang hal-hal yang tidak boleh


dilakukan dalam menangani luka bakar.

LUKA BAKAR
A.

Pengertian Luka Bakar


Luka bakar adalah kerusakan atau kehilangan jaringan yang disebabkan

kontak dengan sumber panas seperti api, air panas, bahan kimia, listrik, dan
radiasi. Luka bakar sendiri didefinisikan sebagai luka yang diakibatkan oleh
adanya sentuhan permukaan tubuh dengan benda-benda yang menghasilkan panas
(thermal) atau zat-zat yang bersifat membakar.
B.

Penyebab Luka Bakar

1.

Panas
Akibat terpapar atau kontak dengan api, cairan panas, benda atau objek
panas lainnya.

2.

Listrik
Disebabkan oleh panas dari energy listrik yang dihantarkan melalui tubuh.
Berat ringan luka dipengaruhi oleh lama kontak, voltage, dan cara
gelombang elektrik mengenai tubuh.

3.

Zat Kimia
Kontak jaringan tubuh dengan asam atau basa kuat. Konsentrasi zat kimia,
lama kontak, dan banyak perluasnya jaringan tubuh yang terpapar
menentukan derajat luka bakar karena zat kimia ini. Luka bakar kimia ini
dapat terjadi misalnya karena kontak dengan zat-zat pembersih yang sering
digunakan untuk keperluan rumah tangga dan berbagai zat kimia yang
digunakan dalam bidang industry, pertanian, maupun militer.

4.

Radiasi
Karena tubuh kontak dengan sumber radio aktif. Luka bakar tipe ini sering
berhubungan dengan penggunaan radiasi ion pada industri atau dari

sumber radiasi untuk keperluan terapi di bidang kedokteran. Terbakar oleh


sinar matari akibat terpapar yang terlalu lama juga merupakan salah satu
contoh luka bakar radiasi.

C.

Derajat Luka Bakar

1.

Derajat 1
Luka bakar yang hanya mempengaruhi kulit bagian luar (epidermis), kulit
tanpak kemerahan, nyeri, dan tidak ada bula. Dikenal sebagai luka bakar
superfisial.

2.

Derajat 2
Luka bakar yang mempengaruhi kulit bagian epidermis dan sebagian dari
dermis, terdapat proses eksudasi, ada bula, dasar luka berwarna merah atau
pucat, nyeri.

3.

Derajat 3
Luka bakar yang kerusakan meliputi seluruh bagian kulit dermis dan
lapisan yang lebih dalam.

4.

Derajat 4
Luka bakar yang meluas ke seluruh lapisan kulit, dan kedalam lapisan
lemak, otot, dan tulang dibawahnya.

D.

Tanda dan Gejala Luka Bakar

1.

Kulit memerah

2.

Kulit mengelupas

3.

Luka melepuh

4.

Nyeri

5.

Kulit hangus

6.

Pembengkakan

E.

Penanganan Luka Bakar

1.

Dinginkan luka bakar dengan menggunakan air mengalir selama 15 menit.

2.

Pertolongan pertama pada luka bakar karena api adalah menjauhkan


korban dari sumber panas (api). Penanganan luka bakar akibat api yang
terpenting adalah jangan merasa panic dan berlari mencari air, karena hal
tersebut dapat memperbesar kobaran api akibat tertiup angina. Api yang
masih membara pada tubuh atau pakaian dimatikan dengan handuk atau
karung basah. Jika pakaian korban bisa dibuka, segera lepaskan. Lepaskan
juga perhiasan, jam tangan, cincin, dan ikat pinggang.

3.

Pertolongan pertama pada luka bakar yang disebabkan oleh air panas
adalah menjauhkan korban dari air panas. Basahi bagian tubuh dengan
menggunakan air mengalir untuk meredakan rasa sakitnya sekaligus
meredakan trauma pada kulit. Jangan gunakan air es atau es batu ataupun
menclempungkan diri dalam bak mandi, karena perubahan suhu yang tibatiba (antara panas dan dingin) akan memperdalam luka bakar. Keringkan
bagian tubuh yang terkena luka bakar dengan handuk bersih dan
permukaannya lembut, lalu balut dengan perban agar steril dari kuman.

4.

Pertolongan pertama pada korban luka bakar akibat gas LPG, segera
jauhkan korban dari sumber gas. Bawa ke tempat yang terbuka, jauh dari
jangkauan gas tersebut dengan posisi menunduk untuk mencegah trauma
inhalasi akibat menghirup gas tersebut. Rasa panas pada bagian tubuh
korban ditangani dengan menempelkan handuk atau kain basah.

5.

Pertolongan pertama pada luka bakar karena bahan kimia adalah


menjauhkan korban dari bahan kimia penyebab luka bakar. Selanjutnya
perlu dilakukan netralisasi dengan air mengalir (guyur bahan kimia dari
permukaan kulit) selama 15-30 menit. Baju yang terkena harus segera
dibuka untuk mencegah kontak lebih lanjut bahan kimia dengan kulit.

6.

Bila disebabkan oleh aliran listrik, pertolongan pertama yang harus


dilakukan adalah sumber listrik harus diputus dahulu atau korban
dijauhkan dari sumber listrik. Lalu lepaskan penderita dari bahan yang
mengandung aliran listrik dengan bahan isolator, misalnya: sepotong
dahan kering atau papan. Penolong pun harus terisolasi misalnya harus
berdiri di atas papan kering.

F.

Hal Hal Yang Tidak Boleh Dilakukan Dalam Menangani Luka


Bakar

1.

Jangan mengobati luka bakar dengan menggunakan pasta gigi karena hal
tersebut dapat mengakibatkan infeksi. Yang paling tepat luka bakar ringan
dan sedang ditolong dengan cara menyiram dengan air mengalir.

2.

Jangan memecahkan gelembung kulit yang akibat luka. Biarkan


gelembung tertutup untuk mencegah terjadinya infeksi.

3.

Jangan membalut luka dengan kapas karena akan melekat pada luka.
DAFTAR PUSTAKA

Brunner & Sudarth. 2006. Keperawatan Medikal Bedah Jilid 8. EGC: Jakarta
Herdman, T. Heather. 2012. Diagnosis Keperawatan : Definisi dan Klasifikasi
2012-2014. EGC: Jakarta
Nurarif, Amin Huda. 2013. Aplikasi Asuhan Keperawatan Berdasarkan Diagnosis
Medis & NANDA NIC NOC. Media Action Publising: Jakarta
Smeltzer & Bare. 2002. Buku Ajar Keperawatan Medikal Bedah Edisi 8 Volume
3. EGC: Jakarta