Anda di halaman 1dari 88

PROSESPRODUKSIMINUMANBERKARBONASI

(MAGANGDIPT.COCACOLABOTTLINGINDONESIACENTRALJAVA)
PitriNuraeni
H.3106091
1

BABI
PENDAHULUAN

LATARBELAKANG
Airmemilikiperananpentingdalamkehidupanmanusia.Dalamtubuhmanusia,kandunganair

berkisar5070%dariseluruhberatbadan.Orangdewasaperluminumminimal1,52literair
setiap hari. Kehilangan air (dehidrasi) sebesar 15% dari berat badan akan mengganggu
keseimbanganairdalamtubuhdanharussegeradiganti.Jikatidak,dapatmenyebabkanpenyakit
karenaterjadinyakristalisasiunsurunsuryangadadidalamcairantubuh.
Airuntukminumtidakhanyasebagaipengganticairantubuhyanghilangdansuplaimineral,
tetapijugauntukkenikmatandanmemberirasasegarsebagaipelepasdahaga.Seleramasyarakat
terhadapminumansegartelahmenjadipertimbanganbagiperusahaanminuman.Berbagaiupaya
perbaikanprodukdilakukanagarmenarikdandiminatikonsumen,sepertiberbagaibentukkemasan
dancitarasayangkhasyangmembedakandenganminumansejenisnya.
Berdasarkanhasilsurveiyangdilakukanolehsebuahlembagaindependen(LPEMUniversitas
Indonesia)dansebuahperusahaanrisetpemasaranDEKApadatahun2000,menunjukkanbahwa
minumanringandikonsumsisamaseringnyadenganminumansirupdanmakananringan,danjauh
lebihseringdikonsumsidibandingkandenganeskrim.Dengankonsumsiminumanringanyang
sedemikianluasnya,produkminumanringanbukanlahbarangmewahmelainkansudahmenjadi

barangbiasadanmemilikinilaikomersialdalamperdagangan.Industriminumanringanmemiliki
potensiyangsangatbesaruntukdikembangkandenganjumlahkonsumsiperkapitayangmasih
rendahdanpendudukberusiamudayangsangatbesar(Anonim,2000).
I.2.TUJUANMAGANG
I.2.1.TujuanUmum
a.

MeningkatkanketrampilandanpengalamankerjadibidangTeknologi
HasilPertanian.

b.

Meningkatkan wawasan mahasiswa tentang berbagai kegiatan


TeknologiHasilPertanian.

c.

Menambah motivasi mahasiswa dalam melakuan penelitian tentang


minumanberkarbonasidanpembuatansirup.

d.

Meningkatkanpengetahuanmahasiswamengenaihubunganantarteori
denganpenerapandiduniakerja(lapangan)sertafaktorfaktor yang
mempengaruhinya sehingga dapat merupakan bekal bagi mahasiswa
setelahterjundimasyarakat.

e.

Agarmahasiswamemperolehketrampilandanpengalamankerja.

I.2.2.TujuanKhusus
a. Mempelajarisetiaptahapprosespembuatanfinishsirup.
b. Mempelajari setiap tahap proses pembuatan produk
minumanberkarbonasi

BABII

TINJAUANPUSTAKA

II.1.MINUMANBERKARBONASI
Minuman ringan (soft drink) adalah minuman yang tidak mengandung alkohol, merupakan
minuman olahan dalam bentuk bubuk atau cair yang mengandung bahan makanan dan bahan
tambahanlainnyabaikalamimaupunsintetikyangdikemasdalamkemasansiapuntukdikonsumsi.
Minumanringanterdiridariduajenis,yaitu:minumanringandengankarbonasi(carbonatedsoft
drink)danminumanringantanpakarbonasi.
Minuman ringan dengan karbonasi adalah minuman yang dibuat dengan mengabsorbsikan
karbondioksidakedalamairminum.Minumantanpakarbonasiadalahminumanselainminuman
ringandengankarbonasi.(Anonim,2001).

II.2.BAHANPENYUSUNMINUMANBERKARBONASI
Minumanberkarbonasimemilikikomposisiyangberbedabeda,secaragarisbesarkomposisi
minumanberkarbonasimeliputiair,konsentrat,bahanpemanis,pemberianrasaasam,pemberian
aroma,bahanbahantambahan.Adapundiskripsisingkatbahanbahantersebutsebagaiberikut:
II.21Air
Airmerupakankandunganterbesardidalamcarbonatedsoftdrink.Airyangdigunakanharus
mempunyaikualitastinggi,yaitu:jernih,tidakberbau,tidakberwarna,bebasdariorganismeyang
hidupdalamair,alkalinitasnya<50ppm,totalpadatanterlarut<500ppm,dankandunganlogam
besi dan mangaan <0,1 ppm. Sederet proses diperlukan untuk mendapatkan kualitas air yang
diinginkan, antara lain: klorinasi, penambahan kapur, koagulasi, sedimentasi, filtrasi pasir,
penyaringandengankarbonaktif,dandemineralisasidenganionexchanger.Karbondioksiodayang

digunakanjugaharussemurnimungkindantidakberbau.Airberkarbonasidibuatdengan cara
melewatkan es kering (dry ice) ke dalam air es. (Anonim, 2001). Air yang digunakan harus
berkualitastinggi,yaitu:jernih,tidakberbau,tidakberwarna,bebasdariorganismeyanghidup
dalam air, Alkalinitas < 50ppm, total padatan terlarut < 500ppm, kandungan logam besi dan
mangaan<0,1ppm.Bahanbakulaboratoriumairuntukminumanringandapatdilihatpadatabel1.
Tabel1.Bakulaboratoriumairuntukminumanringan
Karakteristik
Rasadanbau
Warna
Suspensiterlarut
Alkalinitas
Klorinebebas
Garam(NaCl)
Totalpadatanterlarut
Besi
Alumunium
Nitrat
Mikroorganisme:
a.Bakterikoliform
b.Ragidanjamur
BakteriMesophilik

Konsentrasi
Normal
Maksimal5unit
<5ppm
<85ppm(sebagaiCaCo3)
<0,05ppm
<300ppm
<500ppm
<0,1ppm
<0,1ppm
<10ppm
0per100ml
0per100ml
Maksimal100selperml

Sumber:Green,1978.

II.22Konsentrat
Konsentratadalahintisari/isi/bagianyangutamadarisuatubahan/zat.(Poerwadaminta,1984).
Misalnya: konsentrat sari buah, konsentrat protein, konsentrat whey dan lainlain. Konsentrat
digunakansebagaibahanbakuataubahanpenolongdalampembuatanminuman.(Anonim,2002).
Tujuan utama dari penggunaan konsentrat adalah sebagai pemberi flovor sekaligus sebagai
pewarna bagi minuman ringan yang diolah. Penggunaan konsentrat dalam jumlah dan jenisnya
tergantungdariprodukyangakandiolah.(Anonim,2002).

II.23BahanPemanis
Gulaselainsebagaipemanisdanpenambahkalori,jugamemberipengaruhpadakenampakan
minuman serta sebagai pembawa komponen flavour sehingga tersebar merata dalam minuman,
sedangkan pemanis buatan yang umum digunakan adalah sakarin serta natrium, kalsium,
magnesium,dankaliumsiklamat.(ThornerdanHerzberg,1978).
Bahanpemanisyangbiasanyadigunakandalamminumanringanadalah:
a) Natural,antaralaingulapasir,gulacair,gulainvertcair,gulajagungdengankadar
fruktosatinggidandektrosa.
b) Sintetikyangsatusatunyaadalahsakarin.
Sakarinmempunyaitingkatkemanisan300kalilebihmanisdaripadagula.Bahaninibiasanya
dijual dengan bentuk senyawa Na atau Ca. Pada konsentrasi tinggi, sakarin menimbulkan
aftertastepahit.Sakarintidakmemilikinilaikalorisehinggaseringdigunakansebagaipemanis
padabahanmakanandanminumandiet.(CahyoSaparintodanDianaHidayati,2006).Gula
yang digunakan harus memiliki kemurnian tinggi < 99,7%,abu < 0,02%, Sulfat < 15ppm,
kelembaban < 0,05%, timah hitam < 0,5ppm, dan arsen < 1ppm. Karakteristik gula yang
digunakanmengacupadastandardgulauntukminumanringanyangdapatdilihtapadatabel2.
Tabel2.Standargulauntukminumanringan
Karakteristik
Warna
Bau

Rasa
Kemurnian
Abu

Konsentrasi
<ICUMSA*unit
Bebasdaribauyangtidaknormal
jikapadakekentalan54Brix
diasamkandenganasamphospat
padapH15dandipanaskanpada
suhu50Cselama530menit.
Bebasdarirasayangtidaknormal
jika pada kekentalan 50 Brix
disimpanpadasuhukamar.
<99,7%
<0,02%

Sulfit(SO2)
Kelembaban
Flokulasi

Timahhitam
Aren
Mikroorganisme:
Bakterimesofilik
Ragi
Kapangdanjamur

<15ppm
0,05%
Bebas dari kekeruhan jika pada
larutan dengan kekentalan 54
BrixyangdiasamkanpadapH5,2
denganasamphospatdisimpan10
hari
<0,05ppm
<1ppm
Maksimal300selper10gr
Maksimal10selper10gr
Maksimal10selper10gr

Sumber:Green,1978.

II.24PemberianRasaAsam
Bertujuan untuk memberikan rasa asam pada minuman berkarbonasi, memodifikasikan
manisnya gula, berlaku sebagai pengawet, dan dapat mempercepat inversi gula dalam
sirup/minuman. Acidulant yang digunakan dalam minuman harus dari jenis asam yang dapat
dimakan(edible/foodgrade)antaralainasamsitrat,asamphospat,asammalat,asamfumarat,asam
tantrat,asamadipat,danlainlain.(Anonim,2001).
II.25PemberianAroma
Pemberianaromadisiapkanolehindustriberkaitandenganindustriminumandenganformula
khusus,kadangkadangtelahditambahdenganasamdanpewarna,dalambentuk:
a) Ekstrakalkoholik(penyaringbahankeringdenganlarutanalkoholik)
Misalnya:jahe,anggur,lemonlime.
b) Larutanalkoholik(melarutkanbahandalamlarutanairalkoholik)
Misalnya:strawberry,cherry,creamsoda.
c) Emulsi (mencampur essential oil dengan bahan pengemulsi) misalnya: vegetable
gum

Misalnya:citrusflavour,rootbeer,dancola
d) FruitJuice,misalnya:orange,grapefruit,lemonlimedangrape
e) Caffeine,sebagaipemberirasapahit(bukasebagaistimulant)
f) Ekstrakbijikola
g) Sintetikflavour,misalnya:ethylacetateatauamylbutyrateyangmemberikanaroma
grape.(Anonim,2001)
II.26Karbondioksida(CO2)
Penggunaankarbondioksidapadaminumanatauairbuahdenganmaksuduntukmendapatkan
suaturasayangdiinginkan.Karbonasimenghasilkanyaitudesisyangmenguatkankesegaranrasa
sertakilaudangelembungketikaminumantersebutdituangkandariwadahnya.(Anonim,2001).
Gas karbondioksida juga berpengaruh terhadap timbulnya efek ekstra sparkle, yang
membedakanminumanringanberkarbonasidengannonkarbonasi.
Ekstra sparkle adalah efek penampakan berkelipkelip pada minuman. Secara praktis CO2
adalah satusatunya gas yang cocok untuk memproduksi penampakan sparkle dalam minuman
ringanberkarbonasi.Karbondioksidadapatmeningkatkancitrarasapadaminumansehinggaorang
menikmati saat mengkonsumsinya. Pada saat larutan dalam air, CO2 memberikan rasa asam
sehinggadapatmenurunkanpHmenjadisekitar3,23,7.Rasaasamtersebutmerupakanrasakhas
sodayangmembuatpenikmatteringatterusakanrasanya.
Salahsatukeunggulanminumanberkarbonasiadalahamandarikontaminasibakteri,terutama
bakteriyangbersifatpatogen.Gaskarbondioksidayanglarutdalamair,bukanhanyamenghasilkan
rasayangspesifik,tetapijugadapatberfungsisebagaiantibakteriuntukmengawetkanminuman
secaraalami.(Anonim,2008).
II.27BahanbahanTambahan

Selainbahanbakuutamaminumanringanjugamengandungpulabahanpengawet(additif).
Bahan pengawetbahankimiayangdapatmempertahankanmakananterhadapserangan bakteri,
ragi, atau kapang. Bahan pengawet yang dapat dugunakan antara lain: natrium benzoat, asam
benzoat,asamsalisilat,asamsulfat,asamsitrat.Bahanpengawetpemberiannyaharusmemenuhi
dosisyangtepat,disesuaikandengantingkatkeasamanminuman.(Winarno.SrikandiFardiaz.Dedi
Fardiaz,1980).
II.3.PROSESPENGOLAHANMINUMANBERKARBONASI
Proses pengolahan minuman ringan terdiri dari beberapa tahap yaitu pengolahan air,
karbondioksida,prosespembuatansyrup,prosespencampuran,pemurnianCO2,pengemasandan
penyimpanan.
II.31PengolahanAir
Air merupakan bahan utama untuk pembuatan minuman berkarbonasi. Ada tahap dalam
pembuatanringan,antaralain:
c) pembersihanair:meliputitahappengendapan,penggumpalandanpenyaringan.
d) penghilanganmikroorganismemelaluiklorinasiataupenyaringanmikro.
e) penghilanganmineralterlarut,untukmenurunkankesadahanair.
f) pengontrolanterhadapkarat,bau,danrasasertawarnaair(Buckleetal,1987).
Tahap penyaringan bertujuan untuk menghilangkan padatan tersuspensi dalam air. Setelah
prosespenyaringanairdialirkankedalamsaringankarbonberisikanarangaktiflaludilewatkan
padasaringanmikron,sehinggaairyangkeluardapatdiminumlangsung.Airinilahyangdigunakan
sebagaibahandasardalampembuatanminumanringan.(Buckleetal,1987).
Pengoperasian pengolahan air dapat dijelaskan sebagai berikut: air dari sumber ditampung

dalam bak penampung air, kemudian dilakukan pengendapan dalam tangki pengendapan.
Selanjutnya, kedalam air ditambahkan bahan kimia pengendap seperti Ca(OH2) atau soda abu
(Na2CO2),alumuniumatauferrosulfatuntukmembentukkebebasanyangcukupdanmenghasilkan
flokulan.Hasilakhirnyaadalahpenggumpalandanpengendapansertaairmenjadijernih.Perlakuan
klorinasidapatmenghasilkanbau,rasadanwarnasehinggaairmenjadibebashama.Halinikarena
senyawaklorsangatefektifuntukmembunuhkapang,khamir,danbakteri.(Buckleetal,1987).
II.32ProsesPembuatanSirup
Airyangsudahmengalamiprosespemurniandicampurdengangulapasirsambildiadukaduk
dandipanasiuntukmendapatkanminumansirupsederhana.Suhuyangdigunakanuntukpemanasan
initidaklebihdari25C.Untukmendapatkansirupyangdiinginkan,selanjutnyadilakukan pre
coating denganmenggunakankarbonaktifuntukmenghilangkanwarnadanbauasingatautidak
sedap.Kemudiandisaringdenganmenggunakan filterpress dengansaringanyangberlapislapis.
Bahankimiayangdigunakanadalahfilteraid.Sirupyangkeluardariprosesinikemudiandicampur
dengankonsentrat.Sesuaidenganjenisminumanyangakandibuatolehpabrik.Sirupyangsudah
dicampurdengankonsentrat,telahsiapdigunakanpadatahaplebihlanjut,yaituprosescampuran
danhomogenisasidenganbahanlain.(Priatni,1991).
II.33ProsesPencampuran
Prosesinidilakukandenganmencampurkanairdansirupdilakukansesuaidenganbahanbaku
minumanyangtelahditetapkan.Airyangakandicampursebelumnyaperlularutansirupdiaturoleh
alatuntukmemperolehbahanbakuminumanyangdikehendaki.Prosespencampuraninidilakukan
padasuhuyangrendah,sehinggasuhuminumandiusahakanmencapai5C.Padasuhutersebutakan
memudahkanminumansaatdicampurdenganCO2.(Priatni,1991).

II.34PemurnianCO2
Padaproseskarbonasi,CO2yangakandicampurkansebelumnyaperludimurnikan.Padaproses
bahankimiasepertikaliumpermanganatdapatdipergunakan,demikianjugaarangaktif.CO2cair
atauCO2bekuuntukdapatdicampurperludiubahterlebihdahulukedalambentukgaspemurnian
CO2. Selanjutnyadilakukan denganmenggunakan penyaringkertas CO2 yangtelah dimurnikan
harussegeradicampurdengansiruppadasuhurendah.Padatekananatmosferdengansuhu72C,
airmampumenyerapvolume1karbonasi.Faktoryangpalingberperandalamprosesiniadalah
suhudantekanan.(Priatni,1982).
SistempemurnianCO2meliputi:
1. Sisteminimenjelaskansecaraterperincihalhalyangberhubungandenganprosespemurnian
CO2dimanadidalamgasCO2masihterkandunggaslainyangharusdihilangkansehinggatidak
akan mempengaruhi rasa(taste)dan odor(bau)dari minumanjikaCO2 tersebutdigunakan
dalamprosesproduksi.
2. SelamaprosespemurnianCO2 terdapatpengendaliandanpencegahanterhadapresikobahaya
seperti ledakan, kontak dengan bahan kimia, kontak dengan panas, terjatuh, terbentur,
kebisingandenganmenggunakanalatpelindungdiri.
3. Selama proses pemurnina CO2 terdapat pengendalian dan pencegahan terhadap aspekaspek
lingkunganseperticezranbahankimia,bahayaterhadapmanusia.
II.35PengemasandanPenyimpanan
Pengalengan dan pembotolan adalah salah satu cara pengawetan bahan makanan. Berbagai
variasi yangterdapatdalampengalengandanpembotolankarenaperbedaanfaktorfaktor antara
lain:macambahanyangdisiapkan,bentukdanstrukturbahan,bahanuntukwadah(container)baik

sebagaikaleng(can)maupungelas(bottle),peralatanpengalengandanpertimbanganekonomis
lainnya.(Makfoeld,1982)
Pertamatama bahan yang disiapkan harus tidak mengalami kerusakan dan bebas dari
mikroorganisme tertentu, demikian pula wadah (kaleng/botol) harus pula dalam keadaan bebas
mikroorganismeperusakdankemudiansetelahdiprosesdenganpengalengan/pemotonganbahan
danwadahtidakmengalamiperubahandanperusakan.(Makfoeld,1982).
II.4.SANITASIDANPENANGANANLIMBAH
II.41Sanitasi
Mutuhasilproduksipanganakansangattergantungdarisistemsanitasinya.Sanitasibertujuan
untuk menghindari terjadinya kontaminasi dan menjaga kesehatan pada umumnya. Sanitasi
dilakukan dengan jalan menghilangkan atau mengatur faktorfaktor lingkungan yang berkaitan
denganpemindahanpenyakittersebut.
Sanitasidalamindustripanganmeliputi:
g) kegiatanasaptikdalampersiapanbahan,pengolahandanpengemasanprodukserta
dalampenyimpanan;
h) sanitasipabrikdanlingkungankerja;
i) kesehatanpekerjaan.(Mahida,1984)
II.42PenangananLimbah
Bahan buangan dan bahan pencemaran (limbah), penanganan dilakukan dengan cara yang
berbedabeda. Pada tingkat pengolahan yangtinggi penanganan ini mencakup caracara seperti
pembuanganbahanpadat,oksidasibahanyangmengandungkarbonmenjadiCO2 dannitrifikasi.
Prosesprosespenangananlimbahsecaragarisbesardapatdikelompokkansebagaiberikut:

a) pengolahan mekanis yang terdiri dari penyaringan, pengambilan buih dan


pengembangansedimentasi
b) pembenahansecarakimiawimeliputipengentalan,penghilanganbau,dansterilisasi
c) pembenahansecarabiologisyangtergantungpadaaktivitas kelompokorganisme,
baikyanghidupdalamlingkunganalamiah(sepertidalambatangairataulapisan
tanah)ataudalamlingkunganyangdiciptakansecarabuatansepertidalamsaringan
antaratangkiseptisatautangkiinhoff,instalasipembenahanlumpuratausaringan
saringankecildanhalus.(Mahida,1984).
II.5.MANAGEMENTMUTU
Kualitas minuman ringan dipengaruhi oleh keberhasilan bahan baku, bahan tambahan, alat
pengolahandankemasanyangmungkinmembawamikroorganismedalamjumlahkecil.Standar
industri minuman berkarbonasi memberikan persyaratan sebagai berikut: gula yang digunakan
maksimalmengandung10selpergramkhamir,10selpergramkapang,dan200selpergram
bakteri.(Fardiaz,1989).
Kemasan dan botolbotol yang telah diisi, dibawa ke conveyer ke bagian pengujian untuk
melihat kemungkinanterdapatnyakemasanyangrusak,bocorataumenggelembungakibat CO2
yangnaikkepermukaan.Pengujianterhadapcampuranminumanyangakandikemasantaralain
padatantersuspensi,keasaman,stabilitasuap,danmikrobayangmasihmungkinterdapatdalam
minumanringan.(NelsondanTressler,1980)

BABIII
TATALAKSANAPERUSAHAAN

III.1TEMPATPELAKSANAANMAGANG
NamaPerusahaan:PT.CocaColaBottlingIndonesiaCentralJava.
AlamatPerusahaan:Jl.RayaSoekarnoHattakm.30,Ungaran,Semarang,JawaTengah,Indonesia.
Produksi:Coke,CocaCola,Sprite,Fanta,Frestea,danFresteaGreen.
III.2WAKTUPELAKSANAANMAGANG
KegiatanmagangdilakukandiPT.CocaColaBottlingIndonesiaCentralJavadandilaksanakan
tanggal1Maretsampai31Maret2009.
III.3CARAPELAKSANAANMAGANG
KegiatanmagangdilaksanakandiPT.CocaColaBottlingIndonesiaCentralJavakhususnyadi
DepartemenProsesProduksi.
PelaksanaanmagangdilaksanakanmenurutjamkerjayangberlakudiPT.CocaColaBottling
IndonesiaCentralJava.
Pelaksanaanmagangmeliputi:

3.1. Observasi

15

Observasidilakukandenganpengamatansecaralangsungdanmencatatdatahasilpengamatan
sehinggadiperolehgambaranyangjelasmengenaikeadaanselamaprosespembuatanminuman
berkarbonasi.

3.2.Wawancara
Wawancara dilaksanakan dengan komunikasi langsung dengan karyawan, Operator, dan
SupervisorPT.CocaColaBottlingIndonesiaCentralJava.Komunikasiberisitanyajawabseputar
prosesproduksidansemuahalyangberkaitandenganproduksi.
3.3.StudiPustaka
Studipustakadilakukanuntuk mencarireferensidanmempelajariliteraturyangberkaitan
dengan tema kegiatan magang di PT. Coca Cola Bottling Indonesia Central Java, Ungaran,
Semarang.
3.4.Pencatatan
Mencatat data sekunder dari sumbersumber yang dapat dipertanggungjawabkan dan
mendukungkegiatanprakteklapangan.Jenisdatasekunderantaralain:datamengenaikondisi
umumPT.CocaColaBottlingIndonesiaCentralJava,sejarahberdirinyaperusahaan,struktur
organisasiperusahaandandatalainnyayangberkaitandengantujuanprakteklapangan.

BABIV
TINJAUANUMUM
PT.COCACOLABOTTLINGINDONESIACENTRALJAVA
17
IV.1KEADAANUMUMPERUSAHAAN
IV.1.1SejarahPenemuanCocaCola
Pada bulan Mei 1886, John S. Pamberton, seorang ahli farmasi membuat sirup karamel
berwarna dalam sebah ketel kuningan di belakang kebun rumahnya. Dia pertama kali
mendistribusikanprodukbarunyadijalanmenujuJacobsPharmacy(RumahObatJacobs)dengan
menempatkan sirup tersebut ke dalam teko. Dengan harga 5 sen, konsumen dapat menikmati
segelasminumanbarutersebutditempatpenjualanitu.Entahkarenasengajadirencanakanatau
kebetulanairberkarbonasibercampurdengansirupkaramelbarutersebut,yangkemudiandikenal
sebagaiminumanyangNikmatdanMenyegarkandengannamaCocaCola.
RekankerjadanpenguruskeuanganbisnisDr.PambertonyaituFrankM.Robinson,kemudian
menyarankanuntukmemakainamadantulisanCocaColadenganhurufhurufmiringmengalir,
yang sekarangmenjaditerkenaldiseluruhdunia.Robinsonberpikirbahwaduahuruf C akan
terlihat bagus dalam iklan. Pada tahun pertama Dr. Pamberton menjual 25 galon sirup yang
diangkutdalamtongkayuberwarnamerahmenyala.Warnamerahkemudianmenjadiwarnakhusus
yangdihubungkandenganmerekminumannomorsatuini.Sebagaihasilusahanya,Dr.Pamberton
memperolehkeuntungankotor$50danmenghabiskan$73,96untukiklan.

Pada tahun 1891, seorang pengusaha Atlanta bernama Asa G. Chandler, mengambil alih
kepemimpinanpenuhatasbisnisCocaCola.Dalamempattahun,bakatdagangnyatelahberhasil
memperluaskonsumsiCocaColadisetiapnegarabagiandanwilayahAmerika.Padatahun1919,
TheCocaColaCompanydijualpadakelompokinvestordenganharga$25juta.RobertWoodruff
diangkatmenjadiPresidenTheCocaColaCompanypadatahun1923dankepemimpinanselama
lebihdarienamdecadetelahmembawabisnisCocaColamencapaisuksesdagangyangproduknya
terkenaldiseluruhdunia.
IV.1.2SejarahPerkembangandiIndonesia
CocaCola mulai diperdagangkan pada tahun 1923 oleh De Netherlands Indhische Mineral
WaterJakartadibawahmanajemenBernieVoningsdariIndonesia.Perusahaaninibergantinama
menjadiIndonesiaBeveragesLimited(IBL).Tahun1971,IBLbekerjasamadengantigaperusahaan
Jepang: Mitsui Toatsu Chemical Inc, Mitsui & Co. Ltd dan Makuni CocaCola Bottling Co,
membentukPT.DjayaBeveragesBottlingCompany(DBBC).
Padatanggal12Oktober1993,CocaColaAmatylLimited(CCA)sebuahperusahaanpublik
dari Australia yang merupakan pabrik dari pembotolan CocaCola terbesar di dunia untuk
pabrikasi, distribusi dan pemasaran produk The CocaCola Company telah mengambil alih
kepemilikanDBBCdanberubahnamanyamenjadiCocaColaAmatylIndonesia,diJakarta.
SampaisaatiniCCAdidukungoleh11pabrikpembotolandansekitar9000karyawan,melayani
lebih400.000pelanggandiseluruhNusantara.CocaColamerupakanperusahaanasingyangpaling
berhasilberoperasidiAsiakarenakeunikanprodukdansistempemasarannyasertapemahamannya
terhadappasar/budayalokal.
Tabel3.Kotakotapabrikpembotolan
Pulau/lokasi
Jawa

Bottler
Jakarta,Semarang,Bandung,Surabaya

Sumatra
Kalimantan
Bali
Sulawesi

BandarLampung,Medan,Padang
Banjarmasin
Denpasar
UjungPandang

IV.1.3PerkembangandanSejarahCocaColadiJawaTengah
PerusahaanCocaColadiJawaTengahpadaawalnyadirintisolehduaorangpengusahayaitu
BapakPortugiusHutabarat(almarhum)danBapakMugianto.NamayangdipakaipadaawalnyaPT.
Pan Java Bottling Company, yang resmi didirikan pada tanggal 1 Nopember 1974, akan tetapi
perusahaanbarumulaiberproduksipadatanggal5Desember1976.Karenaperusahaansemaking
berkembangbegitucepat,makapadabulanApril1992,PT.PanJavaBottlingCompanymelakukan
kerjasama(jointventure)denganCocaColaAmatylLimitedAustralia,sehinggasejakituPT.Pan
JavaBottlingCompanyberubahnamanyamenjadiPT.CocaColaAmatylIndonesiaCentralJava,
namun sejak tanggal 1 Juli 2002 berubah menjadi PT. CocaCola Bottling Indonesia (CCBI)
Central Java Operations, sedangkan untuk distributor bernama PT. CocaCola Distribution
Indonesia(CCDI).
IV.1.4SejarahPembotolandalamMinumanCocaCola
CocaCola pertama kali dikenal sebagai produk yang dijual di tempattempat penjualan
minuman dengan sistem fountain (mesin kran). Pemakaian botol dalam minuman CocaCola
dipeloporiolehJosephA.Biedenharn,seorangpedagangpermenyangberasaldariMississipi,pada
tahun1894,penyediaanminumanbotolCocaColainidinamakanBottler.
Padatahun1899prosespembotolanCocaColabesardimulaipemilikTheCocaColaCompany.
Asa G. Chandeler memberikan Hak Pembotolan Eksklusif kepada Joseph B. Whitehead dan
Benjamin F. Thomas dari Chatanooga, Tennessee. Kontrak ini menandai dimulainya sistem
pembotolan yang unik dan independen dari The CocaCola Company, dan merupakan dasar

pengoperasianperseroanminumanringantersebuthinggakini.KeberhasilanpemasaranCocaCola
telah membuatbanyakbotolsodalainyangmeniruCocaColasehinggakonsumentidak dapat
membedakan jika mereka tidak mencicipinya. Untuk memecahkan masalah ini dibuatlah botol
CocaColayangkhusus,denganbentukkonturbotolyangdikenalhinggasekarangdiseluruhdunia.
DesaininidibuatolehTheRootGlassCompanypadatahun1915.
Ini merupakan awal satu sistem dagang yang unik dalam sejarah perdagangan waralaba
(Franchisesystem),yaitukerjasamayangsalingmenguntungkanantaraduaperusahaan(dalamhal
ini The CocaCola Company dan pabrik minuman). Dua perusahaan ini mempunyai sistem
manajemendanmodalkepemilikanyangsamasekaliterpisah.Sistemwaralabainiberlakuuntuk
usaha CocaCola di seluruh dunia, yang meliputi hampir 200 negara dengan tingkat konsumsi
sebanyak900jutaporsiminumansetiapharinya.Padatahun1996,sebanyak13,7milyarkotak/peti
atau238milyarporsiprodukCocaColayangdikonsumsikanmasyarakatdunia.
IV.1.5VisidanMisiPerusahaan
Perusahaan mempunyai visi ingin menjadi perusahaan yang tumbuh terdepan dalam pasar
minuman,khususnyaminumanringantidakberalkohol(nonalcoholicreadytodrinkbeverages).
Saat ini CocaCola Bottling Indonesia merupakan perusahaan yang sukses dalam
mengembangkanbisnisminumandiIndonesia,agartetapmempertahankankesuksesanya,maka
CocaColaBottlingIndonesiamempunyaitigamisiyaitu:
1. memberikan nilai terbaik bagi pemegang saham dengan menjadikan perusahaan
yang tumbuh terdepan dalam pasar minuman. Hal ini dapat meningkatkan
pertumbuhanpenjualandankemampuanmenghasilkanlabasecaraefektif.
2. menghargaikaryawan,berbagaimerekdariTheCocaColaCompanydankaryawan
yangberdedikasisertaberdisiplinmemberikanCocaColaBottlingIndonesiasuatu

keunggulanbersaingsecaraberkesinambungan.
3. Mengembangkankemitraansejatidenganparapelangganuntukmemuaskanlebih
dari200jutakonsumenyangdahaga.
TigamisiPT.CocaColaBottlingIndonesiainimerupakansatukesatuanyangtidakdipisahkan.
Untukitumakadiperlukanpertumbuhanbisnisyangmenguntungkanbagipengusaha,manajemen,
karyawan,pelanggandankonsumenyaitusebagaiberikut:
1. Integritas
Denganmenghargaiperbedaanindividu,bersikapadil,memperlakukanoranglainsebagaimana
perusahaandiperlakukan.Contohnyamenjaganamabaik,melihatmasalahsecarakonstruktif
danmemberikanpekerjaanpadaorangsesuaidenganbidangnya.
2. Kejujuran
Sifatjujurmerupakansifatdasarmembangunkepercayaandanhubungankerjajangkapanjang.
3. KerjasamaKelompok
Bekerjasamadimaksudkanuntukmencapaitujuanbersama.Kerjasamaharusdilakukankarena
perusahaansadarbahwaadaberbagaiperbedaandaritiapindividu.
4. FokuspadaPelanggan
Dengan melampaui harapan pelanggan, maka dapat mencapai aspirasi masingmasing.
Contohnya memahami kebutuhan pelanggan, selalu mencari winwin solution dan
meningkatkanpelayananpadakonsumendaripelanggan.
5. Belajarsetiaphari
Denganbelajarsetiaphari,makaperusahaanakanterustumbuhdanmampumenghadapisetiap
tantangan.
6. Keuntungandalamtindakan

Denganmemilikidisiplinandiri,tekatpenuhdanhasratyangtinggipadapekerjaan,perusahaan
dapatmenerapkanpengetahuanmencapaiprestasiyangterbaik.
IV.1.6MaksuddanTujuanPerusahaan
PT. CocaColaBottlingIndonesiaCentralJavadenganmaksuduntukmemenuhikebutuhan
masyarakatakanminumanringanyangsegardansehat.SecarakhususmasyarakatJawaTengah
menjaditujuanutamadansecaraumumpendistribusiannyadisebarkankeseluruhIndonesia.Tujuan
yangingindicapaiantaralainadalah:
IV.1.6.1TujuanEkonomis
a. Meningkatkankeuntunganperusahaan
DenganadanyaPT.CocaColaBottlingIndonesiaCentralJavadaerahoperasiSemarang
ini, keuntungan perusahaan akan semakin dapat ditingkatkan. Hal ini disebabkan
pendistribusianminumantidakperludidatangkandaridaerahlain,cukupdaridaerahini
saja.
b. Meningkatkanlapangankerjadankesempatanberusaha
PelaksanaanpemasarandarihasilproduksiPT.CocaColaBottlingIndonesiaCentralJava
ini memberikan dampak yang baik bagi masyarakat sekitarnya. Masyarakat berusaha
menjadi penjual minuman hasil produksi dari perusahaan ini, baik sebagai pengecer
maupundistribusitidakresmi.
c. Penyerapantenagakerja
Dalamoperasinya,perusahaaninimembutuhkanbeberapatenagakerjayangterdidikdan
terlatih. Banyak dari anggota masyarakat yang bertempat tinggal di sekitar lokasi
perusahaanmenjadikaryawantetap,sehinggajumlahpenganggurandapatditekan.
d. Menambahdevisanegara

Keberadaan PT. CocaCola Bottling Indonesia Central Java di Semarang menambah


devisanegaradalambentukpajakdanbeacukaikhususnyadidaerahJawaTengah.
IV.1.6.2TujuanSosial
WalaupunPT.CocaColaBottlingIndonesiaCentralJavamenjadisuatubadanusaha
yangsifatnyamencarikeuntungan,namunperusahaaninitidakmenyampingkanmasalah
masalahsosialyangterjadidisekitarnya.Kerjasamadibidangsosialinitentunyaakan
menguntungkankeduabelahpihak,yaituPT.CocaColaBottlingIndonesiaCentralJava
denganmasyarakatsekitarnya.Bentukkerjasamituantaralain:
1. sebagaisponshordalamberbagaiacara,seperti:PekanOlahRaga,PentasSeni,dll.
2. sebagaiobyekpenelitianilmiahbagipelajar,mahasiswa,maupunorganisasiorganisasi
lain.
3. pemberiansumbangankepadabadansosialdiwilayahyangbersangkutan.
4. pemberianbeasiswabagiparapelajarberprestasidiwilayahyangbersangkutan.
IV.1.7JenisProduksi
PT.CocaColaBottlingIndonesiamemproduksimerekmerekintisepertiCocaCola,Sprite,
Fanta,danFresteadalampabrikpabriknyayangtersebardiseluruhIndonesia.Untukmenjagaagar
mutuminumanyangdihasilkansesuaidenganstandar,perusahaanmenerapkandenganketatproses
produksiyangdiakuisecarainternasional.
Pemberiankodekodepadasetiapprodukmerupakanbagianterpentingdarikeseluruhanproses.
Dengankodekodeituperusahaanmenjagaagarparapelangganmendapatkanminumandalamrasa
yangterbaik.
Setiapkodemenunjukkanketeranganketerangantertentutentangproduktersebut.Adakode
yangmenunjukkanketerangantentangtanggalpembuatan.Adakodeyanglebihrumitterdiriatas

hurufdanangkayangmenunjukkanhari,bulan,shift,danpabriktempatminumantersebutdibuat.
Adalagiyangtidaktampakpadakemasankarenatintayangdigunakanhanyadapatdibacadengan
teknologi khusus. Semua itu menunjukkan komitmen perusahaan untuk memastikan bahwa
teknologi,sumberdayamanusia,maupunmaterialyangperusahaanpergunakan,semuanyatertuju
untukkepuasanparapelanggandankonsumenkami.

COCACOLA
CocaColamerupakanmerekminumanringanterpopulerdanpalinglarisdalamsejarahhingga
saatini.DiciptakanpertamakalinyadiAtlanta,GeorgiaolehDr.JohnS.Pemberton.CocaCola
pertamadiperkenalkansebagaiminuman fountain denganmencampurkansiruprasacoladanair
berkarbonasi.
Pertamakaliterdaftarsebagaimerekdagangditahun1887.Ditahun1895CocaColatelah
terjualdiseluruhwilayahAmerikaSerikat.KiniCocaColatelahtersediadiseluruhdunia.
DIETCOKE
DietCokediluncurkanbulanjuli1882dandengancepatmenjadiminumanbebasgulanomor
satu di masyarakat Amerika yang peduli diet. Diet Coke adalah minuman bagi mereka yang
menginginkanminumantanpakaloritetapikayaakanrasa.
DiIndonesia,AmerikaSerikat,Kanada,Australia,danInggris,produkinilebihdikenaldengan
namaDietCoke,dandikenaldengannamaCocaColaLightdibeberapanegaralain.SaatiniDiet
Coketelahmenjadiminumannomortigadidunia.
SPRITE
Pertamakalidiperkenalkanpadatahun1960,Spriteadalahminumanringandenganaromarasa
lemonyangpalingdigemari.Spritedijualdi190negaradiduniadengandayapikatyangsangat

besar di kalangan generasi muda. Sprite disukai karena rasanya yang dingin menyejukkan dan
benarbenardapatmelepaskandahaga.Spritememilikicitarasakhasyangmembedakannyadari
minuman ringan lainnya. Produksi ini mendorong anda untuk menjadikan diri sendiri dan
memuaskanrasahausanda.
FANTA
Fanta merupakan merek dari The CocaCola Company untuk minuman ringan dengan rasa
buahbuahanyangsangatmenonjol.Dipasarkandi188negaradiseluruhduniadengankonsumen
terbesarremajaberusiaantara1219tahun.Diseluruhduniaadalebihdari70jenisrasa,dengan
rasa jeruk (orange)sebagaivolume terbesar.DiIndonesiaprodukFantamulaidipasarkan pada
tahun 1973 dan hingga kini memiliki 3 buah rasa buah yaitu strawberry, jeruk, dan nanas.
Konsumendiberbagaibelahandunia,terutamaremaja,mengasosiasikanFantadengankeceriaan
bersamatemandankeluarga.AsosiasipositifinisebenarnyadidorongolehcirikhasmerekFanta
yangmembawasukacita,denganwarnayangcerah,rasabuahdankarbonasiyangterasasangat
kuat.
FRESTEA
Frestea produk inovatif minuman siap saji (RTD) yang secara khusus dirancang untuk
memuaskanseluruhpancainderakonsumenIndonesia.Merekinidikembangkansecaralokaldan
merupakan bagian dari Beverage Partners Worldwide (BWP), yaitu perusahaan patungan hasil
kemitraanyangsuksesantaraTheCocaColaCompanydanNestle,AS.
ProporsiFresteadikembangkanuntukmenangkappengalamandalammenikmatiteh tubruk,
denganrasa,aroma,danwarnamenjadifaktorterpentingdimanakonsumendapatmembedakan
kualitassebuahproduk.Citarasatehnyayangsangatkhasdaninovatifterciptamelaluisajianaroma
melatiyangmenyenangkandanrasatehyangunggul.Botolnyayangunikmenonjolkankualitas

rasatehasli,denganteksturembossduaelemendaunyangsalingbersilang.
Frestea diproduksi dengan menggunakan standar kualitas tinggi The CocaCola Company,
menggunakan teknologi tinggi dan didukung oleh proses produksi higienis, demi memastikan
bahwasetiapbotolFresteamemilikikualitasyangsama.Untuktahapawal,peluncuranprodukini
difokuskandiJakartadanJawaBaratyangmerupakanpasarmayoritasdarikonsumsiprodikteh
siapminum.
ADES
Padaakhirtahun2000,perusahaanCocaColatelahmenjalinkemitraanjangkapanjangdengan
PT.AdesAlfindoPutrasetiaTbk.denganmengakuisisimerekdagangAdes.PeluncuranAdesbaru
dari The CocaCola Company ini menampilkan Ades sebagai air minum dalam kemasan yang
murni,aman,danterpercaya,yangdijaminolehTheCocaColaCompany.

Merek dan ukuran yang diproduksi oleh PT. CocaCola Bottling Indonesia daerah operasi
Semarang:
Tabel4.Merek,ukuranataukemasanproduksi
Merek
CocaCola

Ukuran/Kemasan
193ml/botol
295ml/botol
330ml/botol
1liter/botol
1,25liter/botol

DietCoke
Sprite

FantaNanas
FantaOranggo
FantaOrange
FantaStrawberry

330ml/botol
200ml/botol
295ml/botol
330ml/botol
500ml/botol
1liter/botol
200ml/botol
295ml/botol
1liter/botol
200ml/botol
295ml/botol
1liter/botol
200ml/botol
300ml/botol
220ml/botol
330ml/botol
1liter/botol

Jenisminumanyangdikemasdalambentukkalengmaupunbotolditanganisecaratelitidan
didukungfasilitaslaboratoriumyanglengkapdanmoderndengantenagaprofessionaldanterlatih.
IV.2MANAJEMENPERUSAHAAN
IV.2.1StrukturOrganisasi
Strukturorganisasipadahakekatnyasangatpentingpadasetiapkeorganisasiansuatuperusahaan
karena merupakan suatu kerangka yang menunjukkan bagian dari organisasi. Dengan struktur
organisasikitadapatmengetahuiadabeberapabagianataudepartemendarisuatuperusahaanatau
keorganisasian.
BentukorganisasiPT.CocaColaBottlingIndonesiaCentralJavaadalahorganisasigaris(line
organization).Organisasigarismempunyaimaksudbahwasetiapatasanmempunyaibawahanyang
tetapdansebaliknyasetiapbawahanmemilikisuatuatasanyangtetap.

SUPPLY
FINANCE
MANAGER
MANAGER

SECRETARY
INFORMATION
PUBLIC
COLDDRINK
GENERAL
FLEETWAREHOUSING
HUMAN
TECHNICAL
SYSTEM
RELATION
EQUIPMENT
GENERALSALESMANAGER
MANAGER
MANAGER
RESOURCES
OPERATION
MANAGER
MANAGER
MANAGER
MANAGER
MANAGER

27

28

Gambar1.StrukturOrganisasiPT.CocaColaBottlingIndonesiaCentralJava,2009

29

Adapun tugas dan wewenang personalia pada PT. CocaCola Bottling


IndonesiaCentralJavaadalah:
IV.2.1.1GeneralManager(ManagerUmum)
1) MengeloladanmemimpinkegiatanpadaPT.CocaColaBottling
IndonesiaCentralJavasecaraefektifdanefisien.
2) Membangunmatarantaibisnisdankomunitasyangterkait
3) Mengarahkantanggungjawabpersonaliadanmanajemensumber
dayamanusiasertakeseluruhanadministrasidalamperusahaan
untukmencapaitujuanperusahaan.
4) Mengambil keputusan manajemen berdasarkan keadaan fiskal
danmisimaupunprinsiporganisasionalperusahaan.
5) Pengawasaninternalmanajemendanfiskalsertapenyimpangan
anggaran.
6) Memimpin para staf dan bertindak sebagai wakil professional
daridewanredaksi.
IV.2.1.2Secretary(Sekretaris)
1) Bertindak sebagai seorang sekertaris, mendampingi dan
membantuGeneralManagerdalammenjalankantugasnya.
2) MembangunkerangkakomunikasiyangsinergisantaraGeneral
Managerdanpihakstafnyasertadengandepartemendepartemen
lain.

30

IV.2.1.3FinanceManager(ManagerKeuangan)
1) Bertanggungjawab atas kelancaran lalulintas keuangan
perusahaandankeseimbangan,penyusunantatabuku/akuntansi
perusahaandanlaporankeuangan.
2) Bertanggungjawab atas pengendalian internal keuangan
perusahaansesuaisistemyangtelahberlakudidalamnya.
3) Menganalisadanmembuatkesimpulansertasaransarankepada
GeneralManageratasapayangtelahdicapaiperusahaanserta
prediksikeuangandimasamendatang.
4) Mengevaluasi anggaran perusahaan yang ditujukan untuk
kegiatanperusahaan.
IV.2.1.4HumanResourceManager(ManagerSumberDayaManusia)
1)

Mengelola urusan kepegawaian, kesejahteraan pegawai, tata


administrasiperusahaandankearsipan

2)

Pembinaan kepegawaian dengan penyusunan program


pendidikan dan pelatihan untuk mempertahankan kinerja,
kualitassertaketrampilankepegawaian

3)

Melakukantugaspengaturansistematikarekruitmentpegawai

IV.2.1.5TechnicalOperationManager(ManagerTehnikOperasional)
1) Merencanakan,mengorganisasikan,mengarahkandanmengatur

31

kegiatanoperasionalperusahaansecaraefektifdanprofesional
2) Bertanggung jawab atas pelatihan, pembinaan, motivasi, dan
pengawasanpersonaliaoperasional
3) Mengarahkan produktivitas maksimum dan mempertahankan
lingkungankerjayangpositifdanprofesional
4) Memastikanadanyaproseduroperasionalyangsesuaidanproses
pengendalianresikoyangtepatdanefisien
IV.2.1.6GeneralSalesManager(ManagerPenjualanUmum)
1) Bertanggungjawab atas penjualan dan pemasaran produk
perusahaansertakelancarandistribusinya
2) Mengkoordinasikan pelaksanaan kegiatan penjualan dan
pemasaranyangberadadibawahtanggungjawabnya.
3) Memonitor volume penjualan dan mengantisipasi faktorfaktor
yangdapatmenghambatpenjualanprodukperusahaan.
4) Mengarahkankeseluruhanpenjualandanpemasaranprodukserta
programperencanaanstrategisnya
IV.2.1.7SupplyManager(ManagerPersediaan)
1) Bertanggung jawab atas jumlah kontinuitas persediaan bahan
bakudanbahanpenunjangoperasionalperusahaan
2) Menjalin relasi yang efisien dengan pihakpihak yang
berhubungan dengan penyediaan bahanbahan yang diperlukan
olehperusahaan

32

IV.2.1.8InformationSystemManager(ManagerSistemInformasi)
1) Membuat,mempertahankandanmerevisiproseduraldepartemen
yang dibutuhkan untuk pengendalian internal yang sesuai dan
operasionalyangefektif.
2) Merancangsistemlalulintasdatayangefektifdanefisien
3) Bertanggungjawab untuk melakukan, mempertahankan dan
mengembangkan software yang termasuk di dalamnya data
keuangan, penjualan dan pemasaran, penanganan konsumen,
tagihanrekeningdanpengumpulannya
4) Menyelenggarakandukunganteknologidansistemteknologidan
sisteminformasimeliputipengendalianpenerapanteknologidan
sistem informasi termasuk hardware dan software untuk
menunjanglayanansertamelaksanakankegiatanumum.
IV.2.1.9FleetandWarehousingManager(ManagerArmadadan
Pergudangan)
1) Mengatur dan mengelola sistem armada pengangkutan dan
distribusiprodukperusahaansecaratepatdanefisien
2) Mengadministrasikan

dan

mendayagunakan

sistem

penyimpanganproduksecaraefisiendanbertanggungjawabatas
segala pemeliharaan terhadap produk tersebut selama dalam
penyimpangan
IV.2.1.10PublicRelationsManager

33

1) Membangun relasi yang baik dengan pihakpihak yang


berhubungan dengan perusahaan serta internal perusahaan dan
berusahauntukmampumempertahankancitraperusahaan
2) Bertanggungjawabmenanganiataumeniadakankabarataudesas
desus mengenai cerita atau peristiwa yang dapat menurunkan
reputasiperusahaan.
3) Mewakili perusahaan untuk berhubungan dengan pihak luar
dalamperistiwayangberkaitandengankepentinganperusahaan.
IV.2.1.11ColdDrinkEquipmentManager(ManagerPeralatanDingin)
1) Bertanggungjawabataspemeliharaankualitassertaperlengkapan
peralatanpendinginan
Mengelolasistemperalatanproduksecaraefektifdanefisien

34

IV.2.2Ketenagakerjaan
Dibawah kepemimpinan yang handal, saat ini PT. Coca Cola Bottling
IndonesiaCentralJavamempekerjakan1200tenagakerjayangtelahmemiliki
Perjanjian Kerjasama bersama dengan Koperasi Kendali Harta sebagai
penunjanghubunganindustrialyangharmonis.Jumlahtenagakerjayangada
diPT.CocaCcolaBottlingIndonesiaCentralJavadapatdilihatpadatabel
berikut:
Tabel5.JumlahTenagaKerjaBerdasarkanTingkatanJabatan
No
1
2
3
4
5

Status/Jabatan
GeneralManager
Sekertaris
DepartementalManager
KaryawanTetap
KaryawanTidakTetap
TotalKaryawan

Jumlah
1
1
9
1169
20
1200

Sumber:PT.CocaColaBottlingIndonesiaCentralJava,2006

Tabel6.JumlahTenagaKerjaBerdasarkanTingkatPendidikan
No
1
2
3
4
5

Status/Jabatan
PascaSarjana
Sarjana
AhliMadya
SLTA
SLTP
TotalKaryawan

Jumlah
2
37
311
813
37
1200

Sumber:PT.CocaColaBottlingIndonesiaCentralJava,2006

JenispegawaiyangadadiPT.CocaColaBottlingIndonesiaCentralJava
adadua,yaitu:
a. PegawaiTetap

35

Adalah pekerja yang diterima bekerja selama jangka waktu yang telah
ditentukansesuaidengansuratkeputusanpengangkatandariperusahaan
(akhir masa jabatan ditentukan dalam surat keputusan pengangkatan
pegawai).
b. PegawaiTidakTetap
Pekerjayangterikatdalamsuatuhubungankerjadenganperusahaanyang
didasarkanatasjangkawaktutertentuatauselesainyapekerjaantertentu
sesuai dengan yang telah ditentukan. Pekerja tidak tetap dibedakan
menjadi 3 bagian yaitu pekerja kontrak, pekerja harian dan pekerja
borongan.
Tenaga kerja di PT. Coca Cola Bottling Indonesia Central Java terbagi
menjadi dua kelompok, yaitu karyawan kantor dan karyawan pabrik.
Karyawankantorbekerjasetiaphariseninsampaiharijumatdarijam08.00
16.30WIBsedangkankaryawanpabrikbekerjasetiapharidengansistemkerja
shift yang setiap satu minggu diadakan rolling (penggiliran jam kerja).
Pembagianshiftkerjapabrikadalahsebagaiberikut:
shiftpagi

:jam07.0014.30WIB.

shiftsiang :jam14.3022.00WIB.
shiftsiang :jam22.0007.00WIB.

IV.2.3KesejahteraanKaryawan
Kesejahteraan karywan perusahaan sangat diperhatikan oleh PT. Coca

36

Cola Bottling Indonesia Central Java. Hal ini dapat dilihat dari fasilitas
fasilitas dan tunjangantunjangan yang diberikan kepada masingmasing
pegawaisecaraberkala,misalnya:
c. Jaminan kesehatan dalam pelayanan
poliklinik
d. Biayatransportasikaryawan
e. Pemberiupahlembur
f. Sumbangan bagi karyawan yang
menikah
g. Pemberianasuransibagikaryawanyang
terkenakecelakaan/musibah
h. Biaya rekreasi bersama sekali dalam
setahun
i. Pendirian koperasi perusahaan dan
kantinuntukkaryawan
j. Pemberianpesangonbagikaryawanyang
pensiun
k. Pendirian tempat ibadah untuk sholat
berjamaah
l. Uangperumahanbagistaf
m. PemberianTunjanganHariRaya(THR)
IV.2.4Pemasaran

37

Pemasaran adalah proses perencanaan dan pelaksanaan penetapan dan


konsepsihargadandistribusibarangdanjasauntukmenghasilkanpertukaran
yangmemenuhisasaransasaranperoranganataupunorganisasi.Keberhasilan
memasarkan suatu produk tidaklah mudah, usaha memasarkan tidak hanya
menjualprodukkepadakonsumentetapijugaharusmemperhatikankehendak
danselerakonsumensehinggadiperolehkepuasankonsumenterhadapproduk
yangdibeli.
Keberhasilan dalammemasarkanprodukdapattercapaijikaperusahaan
mengetahui posisi produknya di pasaran dan pesaing yang memproduksi
barang yang sejenis. Pemerataan dalam memasarkan produk dapat dicapai
denganmendirikangudangpenyimpanan(WareHouse)dibeberapakotayang
memilikiposisiyangstrategis.
Pada awalnya daerah pemasaran perusahaan hanya meliputi Semarang,
Yogyakarta,danSurakarta.Dimulaidaritigadaerahtersebutberkembangke
daerah lainnya dengan mendirikan gudang penyimpanan di beberapa kota
lainnya.SaatinidalammemasarkanprodukPT.CocaColaBottlingIndonesia
CentralJavamemiliki17salescenter.
Strategipemasaranyangdigunakanuntukmencapaipenambahanjumlah
konsumen secara global yang didasarkan pada keyakinan bahwa konsumen
akan membeli produk adalah Strategi 4A, yaitu dimana produk yang
dihasilkan harus Avaibility (tersedia), Affordability (harga terjangkau),
Acceptability(dapatditerima),danAddaptability(berdayaadaptasi).

38

PT.CocaColaBottlingIndonesiaCentralJavamemilikibeberapaprogram
untukmendukungpenjualandanpemasaranprodukproduk.Programtersebut
bertujuanuntukmeningkatkankepuasankonsumen,yaitu:
a) KegiatanPromosi
Programpromosidilakukandenganberbagaimacamcarayangbertujuan
untukmeningkatkanpenjualandanpemasaran,tetapijugameningkatkan
loyalitas konsumen terhadap produknya. Misalnya sponsorship suatu
kegiatan,pemberianpotonganharga/discount.
b) LayananKonsumen
Di PT. Coca Cola Bottling Indonesia Central Java menyelenggarakan
Customer Service System (CSS), sistem pelayanan pelanggan didesain
untuk meningkatkan kepuasan dan loyalitas konsumen secara terus
menerus terhadap produkproduk CocaCola dengan menyediakan
pelayananyangoptimalkepadaseluruhpelangganberdasarkankebutuhan
mereka masingmasing yaitu dengan menyelenggarakan layanan prima
(ServiceExcelence)kepadasetiapkonsumenyaitudenganmemperlakukan
konsumendengansebaikbaiknya.
c) LayananPendinginProduk
Risetmembuktikanbahwa90%konsumenCocaColaBottlingIndonesia
Central Java lebih menyukai membeli produkproduk CocaCola dalam
keadaan dingin. Hal ini menunjukkan bahwa peranan Cold Drink
Equipment (peralatan pendingin) sangat penting dalam meningkatkan

39

penjualan.

BABV
PROSESPRODUKSI

V.1.BAHANBAKU
Bahan baku utama yang digunakan dalam proses produksi pembuatan
minumanyangdiproduksiolehPT.CocaColaBottlingIndonesiaCentralJava
adalah:
V.1.1.Air
Bahan baku air dapat diperoleh dengan mudah oleh PT. Coca Cola
Bottling Indonesia Central Java, karena letak pabrik yang dekat dengan
pegunungansehinggabahanbakuinimudahdidapatdarisumurtanahyang
dibor(deepwell)yangberkedalamanantara90sampai100meterdanyang
beroperasiberjumlah11.Kesebelassumurtersebutterbagidalamduadaerah,
yaitudidalamareapabrikdandiluarareapabrik.Sumuryangterdapatdiluar,
beradadipersawahandisekitarlokasiperusahaanyangberjumlah7buah,

40

42
sedangkansumurlainnyaberadadidalamperusahaanyangberjumlah4buah
yangletaknyadiluargedungproduksi
Berdasarkan kegunaannya, air yang digunakan untuk proses produksi
minumandiPT.CocaColaBottlingIndonesiaCentralJavadapatdigolongkan
sebagaiberikut:
1) Raw Water (air mentah) yaitu air yang digunakan untuk
keperluan diluar produksi, misalnya untuk membersihkan
lantai, membersihkan kaca, menyiram tanaman rumput, dan
bahanbakupengolahanairproduksidanlainlain.
2) Treated Water (air jadi) yaitu air yang sudah diolah dan
diproses yangsudahmemenuhistandaruntukdidistribusikan
ke proses produksi sebagai bahan baku utama pembuatan
minumandiPT.CocaColaBottlingIndonesiaCentralJava.
3) Soft Water (air lunak) merupakan air yang telah dilunakkan
sehinggasedikitsekalimengandungkalsiumkarbonat(CaCO3)
sebagai zat pembentuk kesadahan sementara yang akan
menguraibiladipanaskanuntukmengendapkankalsiumatau
magnesiumkarbonat.
4) Airlunakdibedakanmenjadiduamacamyaitu:
a. Chlorinated soft water, yaitu air
lunak yang telah ditambah klorin
[Ca(OCl)2].Airlunakdenganklorin

41

yang digunakan untuk pencucian


botol(washing).
b. Nonchlorinatedsoftwater yaituair
lunak yang tidak ditambah klorin.
Air lunak tanpa klorin yang
digunakan untuk pemanasan (steam
boiler).
Pemeriksaan yang dilakukan setiap 4 jam pada proses pengolahan air
meliputi:
1) FreeChlorinedanTotalChlorine
Pemeriksaan free chlorine dengan penambahan reagan DPD (diethylp
phenylenediamine)bertujuanuntukmengetahuikadarklorinpadaairyang
telahdiolahdenganditandaiwarnajernih.Apabilawarnanyatidakjernih
maka akan dilakukan pengolahan air kembali. Sedangkan untuk
pemeriksaan totalchlorine padaairyangbelumdiolahditandaidengan
adanya warna pink setelah penambahan reagan DPD (diethylp
phenylenediamine).
2) TotalHardness(kesadahantotal)
KesadahantotalyaitujumlahionionCa2+danMg2+yangdapatditentukan
melaluititrasidenganasam EtilenDiaminTetraAsetat (EDTA)sebagai
titran dan menggunakan indikator yang peka terhadap semua kation
tersebut.EriochromeBlackT(eriokromhitamT)adalahsejenisindikator

42

yangberwarnamerahmudabilaberadadalamlarutanyangmengandung
ionkalsiumdanionmagnesiumdenganpH0,1.PadapH10,larutan
akan berubah menjadi biru yaitu disaat jumlah molekul EDTA yang
ditambahkansebagaititransamadenganjumlahion.
3) Alkalinitas
MenurutAlaerts,GdanSantikaS.S.,(1987),alkalinitasadalahkapasitas
air untuk menetralkan tambahan asam tanpa penurunan pH larutan.
Alkalinitas dinyatakan dalam mek/ (cara kimiawi dan tepat) atau mg
CaCO3/ (cara kuno tetapi masih digunakan di Amerika). Alkalinitas
dalamairdisebabkanolehionionkarbonat(CO32),bikarbonat(HCO3),
hidroksida(OH),borat(BO33),fosfat(PO43)dansilikat(SiO44).
LogamlogamalkalinitastermasukunsurunsurgolonganIA(alkali)dan
golongan IIA (alkali tanah). Logam alkali dan alkali tanah adalah zat
pereduksiyangsangatkuatkarenabegitumudahkehilanganelektrondan
mudahbergabungdenganunsurnonlogam(VIIIA)helium,neon,argon,
krypton. Unsurunsur golongan IA meliputi Hidrogen (H), Litium (Li),
Natrium(Na),Kalium(K),Rubidium(Rb),Cesium(Cs)danFransium
(Fr). Sedangkan unsurunsur golongan IIA meliputi Berilium (Be),
Magnesium (Mg), Kalsium (Ca), Stronsium (Sr), Barium (Ba).
Pemeriksaaninibertujuanuntukmengetahuianalisakandunganalkalinitas
dalam air. Apabila kandungan alkali dalam air masih ada dapat
membahayakankesehatan.

43

4) Turbidity(kekeruhanair)
Pemeriksaaninibertujuanuntukmengatahuitingkatkekeruhandalamair.
Kekeruhanmerupakansifatoptisdarisuatularutan,yaituhamburandan
absorbsi cahaya yang melaluinya. Kekeruhan disebabkan oleh
adanya partikel-partikel kecil dan koloid yang berukuran 10
nm sampai 10 m. Partikel-partikel kecil dan koloid
tersebut adalah lempung, lumpur, sisa tanaman, plankton
dan ganggang (Alaerts, G dan Santika S. S., 1987).
5) pH(puissanceHydrogen)
pHmerupakanlogaritmanegatifdarikonsentrasiH+ dalamsuatularutan
pH=log[H+].JikapHair<7makaairbersifatasam,jikapH>7maka
air bersifat basa, sedangkan pH normal adalah 7. Pemeriksaan air ini
bertujuanuntukmemperolehnilaipHyangakurat(6,012,5).
6) Bau,rasadanpenampakan
Pemeriksaan ini bertujuan untuk mengetahu bau, rasa dan penampakan
normaldilakukandenganujiorganoleptikdaninderawi.
7) Chlorida
Pemeriksaaninibertujuanuntukmengetahuikadarchloridapadaair.Klor
dapat digunakan untuk membasmi bakteri dan mikroorganisme seperti
amubadanganggang.KlordapatmengoksidasiionionlogamsepertiFe2+,
Mn2+,menjadiFe3+,Mn4+,danmemecahmolekulorganiksepertiwarna.
Klorsendiridireduksisampaimenjadiklorida(Cl)yangtidakmempunyai

44

dayadisinfeksi(Alaerts,GdanSantikaS.S.,1987).
8) Iron(besi)
BesiyangadadidalamairdapatbersifatterlarutsebagaiFe2+(ferro)atau
Fe3+ (ferri),tergabungdenganzatorganisatauzatanorganis(tanahliat).
Pemeriksaaninibertujuanuntukmengetahuikadarbesipadaairyangjika
masihterkandungdalamairdapatmembahayakankesehatan.
V.1.2.GulaMurni
Bahandasarpembuatansirupadalahguladankonsentrat.Gulasebagai
pemberi rasa manis dan konsentrat sebagai penentu rasa minuman. Gula
diperolehdariluarnegeridandalamnegeriyaitudariDenmark,Inggrisdan
Lampung.Supplier(pemasokgula)yangmasihaktifadalahPT.AJM(Arindo
Jaya Mandiri), manufaktur dari Danisco Denmark. Pada pengolahan sirup,
gulayangdigunakanmemilikikualitasyangbaikdanmurni.Halinidapat
dilihatsecaravisualbahwakristalgulaberwarnaputihbersih.
Sebelum gula diterima, selalu dilakukan pemeriksaan dahulu apakah
sesuaistandar.Standaryangdigunakanmeliputikondisikemasanpadagula
(baikdanutuh),kenampakan(kristalputih/granular),kekeruhan,bebasdari
rasadanbauasing,warnamax35RBU/RangeBaseUnit.Gulaakandibeli
jika sesuai dengan standar dan kemudian disimpan dalam gudang yang
disusundalampalet(1palet=25sak).
V.1.3.Konsentrat
Proses pembuatan konsentrat dilakukan di CocaCola Indonesia (CCI)

45

Cilangkap,bahanbakudibuatdiAtlantadandisimpandalamgudangdengan
suhurendah(<5C).Konsentratmerupakanbahanpemberirasa,aroma,bau,
pewarna, dan pengawet pada minuman ringan. Konsentrat berbentuk
serbuk/powder (untuk pengawet), liquid (untuk pewarna dan aroma), dan
padatan (untuk teh kering khusus dalam produk Frestea). Konsentrat yang
digunakan dibedakan menjadi 3 macam yaitu: Part I berupa bubuk yang
memberikanwarnadanpengawet(PartIA,IBdanIC),PartIIberupaliquid
untukaroma/flavour (PartIIAdanIIB),PartIIIyaitutehkeringberupateh
hijaudantehhitam.
V.1.4.Karbondioksida(CO2)
Karbondioksida yang digunakan dalam proses pembuatan minuman
berkarbonasi dalam bentuk cair (liquid). Pada proses pembuatan minuman
berkarbonasi, CO2 berfungsi sebagai pengawet, penyegar, dan memperkuat
rasa. Karbondioksida dari supplier diantaranya dari PT. Malindo, PT. PAN
Gas,danPT.SAMATOR.

V.1.5.BahanPembantu
Selain bahan baku diatas, di PT. CocaCola Bottling Indonesia Central
Java juga menggunakan bahanbahan pengemas untuk menunjang atau
melengkapibahanbaku.Bahanpengemasyangdigunakanantaralain:

46

1. Bahan pelengkap dalam proses produksi,


seperti active carbon, filter aid, lime,
Ca(OCl)2,FeSO4,resin,garamdapur, sand
filter, KMnO4, Ferisol dan Divergard, dan
sodakaustik(NaOH).
Fungsibahanpelengkaptersebutadalah: Activecarbon berfungsiuntuk
menyerap rasa dan bau asing, menurunkan warna sehingga mempercepat
proses penjernihan, dan menetralkan zatzat yang bersifat racun. Filter aid
berfungsiuntukpembuatanporipadaelemendidalamfilterpressagartidak
mudahtersumbatolehkotorandanuntukmenyaringkotoransertakarbonyang
halus. Kaporit, lime, ferro sulfat, resin dan garam dapur berfungsi untuk
prosespengolahanairyaitumenghilangkanketidakmurnianlaritanair.Ferisol
dandivergardmerupakanbahanaktifyangdicampurkandalamsodakaustik
untukprosespencucianbotoldanmerupakanzataditifuntukpencucianyang
lebih sempurna, membersihkan karat dari leher botol serta jamur yang
menempel.
V.2.PEMBUATANFINISHSYRUP
Proses pembuatan syrup meliputi simple syrup, pre coating, filtrasi,
sterilisasidanfinishing.Diskripsinyasebagaiberikut:
V.2.1.PembuatanSimpleSyrup
a. Pengisian air hasil

47

olahan
Pengisian air hasil olahan kedalam tangki simple syrup. Kemudian
menambahkan gula ke dalam tangki yang telah berisi air. Penambahan
gula tergantung pada berapa volume air yang digunakan. Kemudian
melakukanpengadukanselamakirakira30menithinggagulalarut.
b. Pemeriksaan
Pemeriksaan simplesyrup dilakukanuntukmengetahuiapakahtelah
memenuhi standar atau belum. Setelah sesuai dengan standar dan gula
telah larut sempurna, simple syrup ditambahkan dengan filter aid dan
active carbon yang tujuannya utuk menyaring kotoran dan penyerapan
warna, bau dan rasa yang tidak dikehendaki. Pemeriksaan dilakukan
melaluipengambilansedikitlarutanmeliputipemeriksaanbrix(>58B),
warna (<35 RBU/Range Base Unit), bau dan rasa (normal). Brix
merupakan padatan terlarut yang dinyatakan dalam persen (berat/berat)
gulamurnidalamair.
V.2.2.PreCoating
Simple syrup dilewatkan saringan untuk menyaring kotoran kemudian
diteruskankedalamtank precoating (merupakanprosespelapisan filter aid
sebelum masuk ke filter press). Filter press digunakan untuk penyaringan
kotoranyangmemilikiukuransangatkecil. Simplesyrup akanterbebasdari
kotoransetelahpenyaringan(foreignmatter/FM).
Tahaptahapprecoating:

48

precoatingI
filteraidditambahkanuntukpelapisanplatpadafilterpresssehinggaseluruh
platterlapisisecaramerata.
PrecoatingII
penambahan filteraid dan activecarbon padalarutan simplesyrup setelah
gula larut sempurna. Filter aid yang sering digunakan adalah hyfo yang
berwarnaputihdanfilteraidstandaryangberwarnakemerahan.
V.2.3.Filtrasi
Merupakanproses penyaringanlarutanyangmerupakankelanjutandari
pre coating untuk memisahkan kotoran yang berukuran sangat kecil dari
simple syrup. Simple syrup yang telah dilewatkan filter press diharapkan
terbebasdariForeignMatter(FM)yangbiasanyaberupakoloid.Pemeriksaan
FM yang positif ditindaklanjuti dengan pengaliran simple syrup ke tangki
simplesyrup secaraberulangulang(sirkulasi)sampaididapat simplesyrup
yangterbebasdariFM.
V.2.4.Sterilisasi
SimplesyrupdialirkankeUVlampuntuksterilisasi.Tujuandaristerilisasi
adalahuntukmembunuhsemuamikroorganismeyangtumbuhdalam simple
syrup.
V.2.5.Finishing
Simple syrup yang telah dialirkan ke UV lamp, kemudian dialirkan ke

49

finishtankdansiapuntukprosesproduksiselanjutnyayaituuntukminuman
CSD(CarbonSoftDrink)atauminumanFresteaGreen.
V.3.PEMBUATANSIMPLESYRUP
V.3.1.Rencanaproduksi
Setelah rencana produksi (production schedule, QMSPRODF005.1)
diserahkankebagianolehDOP.Productionharusmelihatrencanatersebut
danmenjadwalkanuntukpelaksanaannya.
V.3.2.Penentuankebutuhanakanbahan(gula,air,activecarbon,filteraid)
Team syrup making membuat order (Bon pengambilan barang, QMS
LOGDF010.1)keinventory/rawmaterialsesuaijumlahunityangakan
diproduksi.
Untukpenentuanjumlahordernyadigunakanformulasebagaiberikut:
c. Misal A = jumlah unit yang akan
diproduksi
d. B=jumlahgulayangdibutuhkanper
unit
e. C=jumlahgulayangdiinginkan
f. MakaC=AxB
Untuk menentukan bobot (Kg) gula per unit menggunakan standar
kebutuhansyrupdalamprosesproduksi(QMSPRODS0301)
V.3.3.Penerimaanbahan
Bahanditerimadariinventorilaludilakukanverifikasiterhadapjumlah

50

danjenisnya.
V.3.4.Pelarutangula

memastikan semua tangki yang akan digunakan sudah


dalamkeadaanbersihyaitumelaluiprosessanitasi.Proses
sanitasitangkimengacupadaprosedurPlantCleaningand
Sanitasi(QMSPRODP037)

menampungtreatedwateruntukpelarutangula

menuanggulayangjumlahnyasesuaidengankebutuhanke
dalamtangkipelarutansambildiaduk

mixingsampaigulalarutsempurnadandilakukantestBrix,
volume,danwarna

V.3.5.PreCoating

memastikantangkidanlineyangakandipakaisudahbersih

menyiapkanfilteraiddanlarutangulauntukkeperluanprecoating

melakukanprecoatinguntukpembuatanlapisancakedifilterpress

V.3.6.PembuatanSimpleSyrup

menambahactivecarbondanfilteraidkedalamtangkipelarutan

mensirkulasi larutan gula dari tangki pelarutan gula


kemudiankefilterpresssampailarutangulatersebutjernih
sesuaidenganstandar

melakukanpengecekanwarna,taste,odor,appearance,dan
ForeignMatter(FM)sesuaidenganstandarolehQA

51

V.3.7.UVLamp
Langkahlangkahyangdilakukan:

menghidupkanUVLamp10menitsebelumsimplesyrup
dialirkan

mengalirkan simple syrup yang telah jernih (warna < 30


RBU, FM negatif dan taste odor, appearance normal)
tersebutmelaluiunitsterilisasiUVLamp

matriks warna simple syrup antara satuan RBU dengan


ICUMSA unit dapat dilihat pada matriks warna simple
syrup(QMSQASDS0251)

memasukkan ke tank final syrup setelah selesai


pemeriksaanolehQA.

OperasionalUVLampselamaprosesfiltrasidicatatpada formsyrup
mixing (QMSPRODF031.1) dan secara periodik dilakukan
pemeriksaan Hour Meter (operation UV Lamp sterilizer monitor,
QMSPRODF031.2) untuk mencegah UV Lamp melebihi life
timenya.PerawatandanpenggantianUVLampyangakanaktifdicatat
padaformmonitorsugarsterilisasi(QMSPRODF017.12)
V.3.8.TestBrix

mengambilcontohsimplesyrupdaritankfinalsyrup

melakukantestBrixpadacontohtersebutdenganmetode
yangadapadaTCCQS,testBrixinisebagaiacuanuntuk

52

pembuatanfinalsyrup
V.3.9.Pencatatansimplesyrup
Team Syrup Making harus mencatat informasi yang dibutuhkan pada
simplesyrupDailyReport(QMSPRODF030.1).
Halhalyangtermasukdalamlaporantersebutantaralain:
a. jumlahgulaterpakai
b. jumlahairterpakai
c. jumlahkarbonaktifterpakai
d. jumlahfilteraidterpakai
e. No Internal Batch/Lot gula, tanggal
penerimaangula,suppliergula
f. waktupenuangandanpelarutangula
g. mencantumkan No Batch pelarutan/simple
syrup

V.2.10.Periodepenyimpanansimplesyrup
Masa simpan untuk simple syrup Brix 5960B adalah 24 jam setelah
waktumixingselesai.
V.3.11.Tindakanpengendaliantahapresikobahandandampaklingkungan

selamaprosespembuatansimplesyrupterhadappengendali
tahap resiko bahaya yang ada seperti terjatuh, terbentur,
kontakdenganbahankimia

No

No

Persiapan
START
Nopengambilan bahan
Bon

jumlah Schedule
Production
identitas
guladalam
(supplier,No
tanggal penerimaan)
Kebutuhan
syrup
proses Batch,
produksi

53

selama proses pembuatan simple syrup terhadap


pengendalian dampak lingkungan yang ada pencegahan
ceceranbahankimia,penangananlimbahB3danlainlain

FlowchartPembuatanSimpleSyrup

Penampungan
gula
Penambahan
material
- air
Tank sizePemeriksaan
Pemeriksaan
Filtrasi
Ingredient
yes
Pelarutan
Strainer
100 simple
mesh
Rutin:
yesSyrup Penambahan
Pemeriksaan
Penampungan
air syrup Gula
finish
Pemeriksaan
Simple
ACKFA
Pre
coating
active
carbon
Tank- cleaness
Sterilisasi
UV
Lamp
STOP
Foreign
Persiapan
Matter
Available
Daily Report
Sumber:
tahun
- filter aid
Piping
conection
- Bau
Meters
accuracy
- Rasa
Tester
Caliberation
- Warna
<30 RBU
Mingguan:
- Morabiologi yeast

54

V.4.PROSESPRODUKSIMINUMANBERKARBONASI
V.4.1.Depalletizing
Proses penurunan Empties Can dari palet ke Line melalui mesin
Depalletizer, kemudian ditransfer ke filler melalui Empties Can Rope

55

Conveyer.
V.4.2.CartonRemoving
Proses pemisahan Carton Layer Empties Can secara otomatis dengan
mesinCartonRemoval.
V.4.3.PreSorter(EmptyCan)
Memisahkanemptycanyangrusak/penyok,jeniskemasanberbeda.
V.4.4.Rinsing
Mematikan mikroorganisme yang ada pada bagian dalam Empties Can
denganmenggunakansoftwateryangmengandungCl215(11nozzle).
V.4.5.Mixing/ProportionaldanCarbonating
Prosespencampuranairdanfinalsyrupsecaraproporsional,sedangkan
CO2diinjeksididalamtangkiCarbonCoolersesuaistandar.
V.4.6.Filling
Proses pengisian Beverage kedalam kemasan dimana sistem pengisian
yangdigunakansuatu CoolerFilling (pengisiandingin)padatemperatur4
10C tergantung dari jenis flavournya dengan proses pengujian dilakukan
secaraAutoMechanicalFillingValue.

V.4.7.UnderCoverGassing
Proses Spraying CO2 diatas permukaan Beverage yang berfungsi untuk
memisahkankandunganO2padaHeadSpacesebelumSeaming.

56

V.4.8.Seaming(penutup)
Proses penutupan kemasan kaleng dengan sistem Double Seam dimana
proses lipatan dua bagian antara Flange Can Body dengan Flange Cover
dilipatdalamsekaliprosesrollingganda(FirstRollandSecondRoll).
V.4.9.Twist1
Posisikalengdibalikdimanabagianataskaleng(topend)menjadipada
prosesbawah(twist)saatberadadiatasConveyer.
V.4.10.WaterShower
Penyimpananbodykalengdengan softwater untukmenghilangkansisa
minuman.
V.4.11Warming
Proses menaikkan temperatur produk dari temperatur 4 10C (saat
Filling) dengan temperatur 25C 2 supaya tidak terjadi pengembangan
didalampackingnyakarenadapatmerusakkartonpackitusendiri.
V.4.12.Blowing1
Menghilangkanairsetelahdariwarmer
V.4.13.FillingHeightDefaction
Deteksiketinggian isiminumanpada kemasankalengdilakukansecara
otomatis dengan menggunakan Sinar Americium 24 110 mci yang dapat
menembuskemasan.
V.4.14.AirKnife
DenganudarabersihuntukmendapatkanhasilDateCodeyangsempurna.

57

V.4.15.Coding
Proses penelusuran jika terjadi ketidaksesuaian saat penggudangan
maupundipasar.
V.4.16.Twist2
Posisikalengdibalikdimanabagianbawahkaleng(topend)menjadipada
posisiatas(twist)saatberadadiatasConveyer.
V.4.17.Blowing2
Untuk mendapatkan bagian atas kemasan kaleng bebas dari sisa air
sehinggasaatpenyimpananprodukjaditidakterjadikemasankartonbasah.
V.4.18.FullInspection
Pemeriksaanprodukjadidilakukanoleh inspector secaravisualmeliputi
kondisikemasantidakpenyok,DateCodingyangtidakjelasdandenas.
V.4.19.PackingdanSealing
Prosespengepakandansealingdilakukansecaramanual.
V.4.20.Palletizing
Proses menyusun produk jadi ke atas pallet dilakukan secara manual
denganjumlahtumpukan11layer.

DiagramAlirLaporanPembuatanSirup

Production
Schedule

ya

Melengkapikekurangan
FinalSyrup
Pembuatan
simple syrup, syrup mixing
tidak

58

MULAI

OperatorSyrupMaking
mengidentifikasisisafinalsyrup
denganmembacasightglass
tangkifinishsyrup

Bandingkandengan
rencanaproduksi

ApakahCocok?

Catatsemuajumlahsyrup

Datadipakaisebagai
perhitunganperformancedan
efisiensipembuatansyrup

Laporandatainidiberikan
keProductionManager

SELESAI

Sumber:tahun

59

V.5.PROSESPENGOLAHAN
Prosesproduksisecaragarisbesardapatdibagimenjadibeberapatahapan,
yakniprosespengolahanair,prosespemurnianCO2,prosespembuatansirup
danprosespembotolansertasanitasidanpengolahanlimbah.
V.5.1.ProsesPengolahanAir
Airsebagaibahanbakuutamapembuatanminumanberkarbonasiharus
diolahterlebihdahuluagarmemenuhistandarkualitasairyangditetapkanoleh
PT. Coca Cola Bottling Indonesia Central Java. Berdasarkan proses
pengolahandanfungsinya,diPT.CocaColaBottlingIndonesiaCentralJava
airdapatdigolongkanmenjadi5macamyaituRawwater,Treatedwater,Soft
treatedwater,SoftenerwaterdanGeneralusewater.
1) Rawwater
adalah air yang diambil dari sumur (deep well) dengan kedalaman
lebihdari100mdandigunakanuntuksanitasiruanganproduksi(lantai).
Sumuryangdigunakansebagaisumberairgunamemenuhikebutuhanair
untuk proses produksi berjumlah 11 sumur dengan jarak antar sumur
minimal100m.Pengoperasiansumurtergantungdaribesarnyaproduksi,
jikaproduksinyameningkatmakakemungkinansemuasumuryangada
dioperasikan.Syaratuntu rawwater berdasarkanstandaryangditetapkan
olehPT.CocaColaBottlingIndonesiaCentralJavaantaralainbaudan
penampakannormalsertakandunganklorinbebassekitar13ppm. Raw
water darisumurdipompake reservoirtank yangberkapasitas200m3,

60

kemudiandiolahmenjadi treatedwater, softtreatedwater dan softener


water.Penampungandalamreservoirtankbertujuanuntuk:
g. mengendapkankotorankotoranyang
terdapat pada air seperti pasir,
lumpur,kerikil,danlainlain
h. menjaga kestabilan aliran air untuk
prosesproduksi
i. proses

aerasi

bertujuan untuk

mengoksidasi besi yang terlarut


sehinggalebihmudahmengendap
2) Treatedwater
adalahrawwateryangsudahmengalamiberbagaimacamproses.Raw
water yangberasaldarisumurdialirkankedalam coolingtower,dalam
coolingtower airdilewatkanmelaluisaringansehinggamengalirdalam
bentuk titiktitik air. Terbentuknya titiktitik air akan mempermudah
terjadinya proses aerasi, yaitu proses pengikatan oksigen yang dapat
mengoksidasi besi yang terlarut dalam air sehingga lebih mudah
mengendap.Kemudianairdialirkankereservoirtank.
Air yang ada di reservoir tank kemudian dialirkan ke flocculator
dengan debit 30 m3 per jam. Dalam flocculator akan terjadi proses
pencampuranairdenganbahanbahankimiaseperti Lime [Ca(OH)2]8%,
Ferro sulfat (Fe2SO4) 20% dan Chlorine [Ca(OCl)2] 5%. Flocculator

61

dilengkapidenganmixeruntukmempercepatdanmeratakanpencampuran
bahanbahantersebut.
PenambahanLimeakanmengubahCa2+danMg2+ataugaramlainyang
terlarut dalam air menjadi kalsium karbonat dan magnesium karbonat
yang larut dan mengendap. Garamgaram tersebut akan meningkatkan
kesadahanair.
Ca(HCO3)2+[Ca(OH)2]

2CaCO3+2H2O

Mg(HCO3)2+[Ca(OH)2]

CaCO3+MgCO3+2H2O

Penambahanferrosulfatdalamairsadahdapatmempercepatterjadinya
penggumpalan.
FeSO4+Ca(HCO3)2

Fe(HCO3)2+CaSO4

Penambahan chlorine bertujuan untuk membunuh bakteri dan


mikroorganisme yang mungkin masih hidup dalam air (desinfektan).
Setelahmengalamiprosesdiflocculator,rawwaterdialirkankeclarifier
tank (settling tank), dalam clarifier terjadi proses pengendapan yang
bertujuanmenghilangkanpadatantaklarutdalamair.Bagianatasclarifier
terdiridarilamelalamelayangberfungsiuntukmemisahkan flocdengan
rawwater.Flocmempunyaiberatjenisyanglebihbesardariairsehingga
lamakelamaanflocyangsudahterbentukakanmengendap.Dalamsettling
tankakanterjadioverloadsehinggarawwatermengalirmelewatilamela
lamela,adanyalamelainimenyebabkanflocakantertahandalamsettling
tank. Air yang sudah bersih yang kemudian ditampung terlebih dahulu

62

dalam bright tank dengan tujuan untuk menjaga debit aliran air yang
mengalirkesandfilter.
Airdariclarifiertankkemudiandialirkankesandfilter,disandfilter
terjadi suatu proses yang bertujuan untuk mengurangi kotoran yang
mungkinmasihterdapatpadaair.Mediapenyaringpadasandfilteradalah
pasirsilikadanantrasit.Mediapenyaringmempunyaiukuranbutiranyang
kecil sehingga dapat menahan kotorankotoran yang terdapat dalam air.
Dari sandfilter,airdialirkanke storagetank yangberkapasitas110m3.
Storage tank berguna untuk menjaga debit air yang menuju ke carbon
filter tank stabil, sehingga air yang mengalir kedalam proses produksi
dapatstabil.
Dari storagetank airkemudiandialirkankedalam carbonfiltertank
yangberisiarangaktif,berupabubukyangberwarnahitamyangdapat
menyerapbau,danwarnayangtidakdiinginkan.Dari carbon filter,air
dilewatkan kedalam filter dengan ukuran 3m bertujuan untuk
menghilangkan karbon yang kemungkinan masih terlarut
dalam air. Air yang sudah melewati carbonfilterdisebuttreated
water yang kemudian akan dialirkan ke lineline produksi tetapi
sebelumnyamengalamiprosespenyaringanlagiditiapline.Padatiapline
terdapat micron filter yang terdiri atas saringan-saringan
dengan

ukuran

8m

bertujuan

untuk

menghilangkan

kotoran yang terbawa pada saat treatedwatermelaluipipapipa.

63

3) SoftTreatedWater
Khusus digunakan untuk pembuatan Frestea, dimana tingkat
kesadahanairnyasangatrendah,halinidimaksudkanagarprosesdengan
menggunakan suhu tinggi tidak akan menimbulkan kerak pada pipa.
Pembuatan sirup Frestea dilakukan pada suhu >90C dan mengalami
prosessterilisasipadasuhu139Cuntukitudibutuhkanairdengantingkat
kesadahan0.Haltersebutdimaksudkanuntukmenghindariterbentuknya
endapanpadaprodukakibatpemanasanyangberlebih.
Prosespengolahansofttreatedwaterpadaintinyasamadenganproses
pengolahan treated water, yang membedakan yaitu untuk soft treated
watersetelahtreatedwatermelaluicarbonfilterakandilewatkanlagipada
cation exchanger. Pada cation exchanger terdapat resin [R(alkil)Na]
berguna untuk mengikat ion Ca2+ dan Mg2+ yang menyebabkan
meningkatnya kesadahan air. Jika resin sudah tidak efektif untuk
menurunkankesadahanairatauresinsudahtidakdapatmengikationCa2+
danMg2+,makadilakukanproses regenerasi yaitudenganmenambahkan
larutangaram(NaCl),dimanaproses regenerasi dimaksudkanagarresin
dapataktifkembali.
RNa+Ca2+

RCa+Na+

RCa+NaCl

CaCl2+RNa

Setelah melewati cation exchanger, air dilewatkan lagi pada


saringan 1m untuk menyaring garam-garam yang belum

64

tersaring dalam cationexchanger.Dariprosesiniakandihasilkansoft


treatedwaterdengantingkatkesadahanmaksimal2ppm.
4) SoftenerWater
Merupakan air yang sudah mengalami proses pelunakan sehingga
tingkatkesadahannyarendah. Softenerwater terdiridariduajenisyaitu
softenerwaterchlorine dan softenerwaternonchlorine. Softener water
chlorine digunakan untuk final rinse pada proses pencucian botol,
sedangkansoftenerwaternonchlorinedigunakansebagaimediapemanas
boiler.
Airdarideepwelldialirkankecoolingtowerkemudianditampungdi
aeration tank yang berkapasitas 200 m3. Aerasi bertujuan mengurangi
kadarbesidalamair.Selainairdari deepwell,air inlet jugaberasaldari
recyclebackwashdanairhujan(stromwater)yangsebelumnyaditampung
dahuludalambakflokkemudiandialirkankesludgeholdingtank(SHT),
dalamSHTterjadipengendapanflok.Airkemudiandisaringmelaluisand
filterdancarbonfilterkemudianditampungdalamaerationtank.
Air recyclefinalrinse danairhujanditampungdalam cooling tower
dengantujuanuntukmenurunkansuhu, coolingtower dilengkapidengan
kipasagarsuhuaircepatturun.Daricoolingtower,airrecyclefinalrinse
dan air hujan dibawa ke accelerator tank. Dari aeration tank dan
acceleratortank,airakankembalidisaringmelalui sandfilter kemudian
dilewatkan melalui cation exchanger. Dalam cation exchanger terdapat

65

resin yangdapatmengikationionyangdapatmenyebabkanairmenjadi
sadah, sehingga tingkat kesadahan air akan menurun. Setelah melewati
cationexchangerairinidisebutsebagaisoftenerwater.
Softener water kemudian ditampung dalam soft water tank yang
berkapasitas 200 m3. Dalam soft water tank, diinjeksikan chlorine
sehinggasoftenerwaterdalamsoftwatertankmempunyaikadarchlorine
15ppm.Softenerwaterchlorinedigunakanpadaprosespencucianbotol
dan erate untuk tiap line produksi kecuali line VI. Untuk memperoleh
softener water non chlorine, maka softener water chlorine dilewatkan
carbonfilter dandihasilkan softenerwaternon chlorine yangdigunakan
untukboilerdanpendinginmesin.
5) GeneralUseWater
Merupakanairyangdigunakanuntukkeperluanpabrikseharihari.Air
ini berasal dari pencampuran antara air dari sumur dan air hasil
pengolahan limbah. Air hasil pengolahan limbah disebut reuse water,
yang sebelumnya ditampung dalam clarifier agar kotoran dalam air
mengendapkemudiandialirkankebuffertankdandisaringmelaluicarbon
filter. Setelah melalui carbon filter, reuse water kemudian dicampur
dengan air yang berasal dari deep well di blending tower. Air yang
dialirkandariblendingtowermerupakanairyangjernih,tidakberbaudan
tidakberasayangdisebutsebagaigeneralusewateryangbiasadigunakan
untukkeperluankamarmandidangardening.

66

V.5.2.PemurnianCO2
PemurnianCO2dilakukanagarCO2yangdigunakanuntukprosesproduksi
bebas dari pengotor, bau dan rasa yang kurang sedap serta mencegah
terjadinyakontaminasiprodukyangdiakibatkankarenamaterialselainCO2.
CO2 dan tangki penampung dialirkan kedalam rangkaian pemurnian yang
disebut CO2 purifier. Mulamula CO2 liquid dialirkan ke evaporator untuk
diubahmenjadigas,kemudiangasCO2dialirkankedalamtabungyangberisi
KMnO4.KMnO4 adalahsuatubahankimiayangakanmenyerapgasselain
CO2.KemudianCO2 dilewatkanketabungyangmengandung treatedwater
bertujuanuntukmengetahuiapakahmasihadaKMnO4 yangmasihterbawa
dalamCO2.Halinidapatdilihatbilatreatedwaterberwarnamerah,makaCO2
tersebut masih mengandung KMnO4, selanjutnya CO2 dipanaskan dengan
heatertank (dryer)tujuannyauntukmenguapkanairyangmungkinterbawa
dalamCO2.Setelahitu,CO2dilewatkandalamtabungyangberisikarbonaktif
yangbertujuanmenghilangkanbauasingyangmungkinadapadaCO2.CO2
murni diperoleh setelah CO2 dilewatkan dalam catridge filter paper. CO2
murnikemudiandialirkankemasingmasinglineyangada,gunadicampur
dengansirupdantreatedwaterdalamtangkiberkarbonasi.
V.5.3.PembuatanSirup
PadaprosespembuatanCSD,sirupmerupakankomponenyangpenting

67

dalam memberikan rasa, warna dan flavour pada minuman. Bahan dasar
pembuatan sirup adalah gula, air dan konsentrat. Proses pembuatan sirup
terdiriatasduamacam,yaitupembuatansimplesyrupdanfinishsyrup.
1) PembuatanSimpleSyrup
Simplesyrupdibuatdengancaramencampurkanguladenganairdalam
tangki simplesyrup,haltersebutdilakukansecaramanual.Pada simple
syrup kandungan gula atau brix untuk semua jenis produk yang akan
diproduksidibuatsamayaitulebihdari59brix.Campuranantaraguladan
air kemudian diaduk kurang lebih selama 2 jam sehingga gula larut
sempurna dalam air. Pada awal proses pencampuran juga ditambahkan
karbonaktifdanfilteraiddenganperbandingan2:5.Penambahankarbon
aktif bertujuan untuk menghilangkan rasa, bau, dan warna yang tidak
dikehendaki dalam simple syrup, sedangkan penambahan filter aid
bertujuanmembentukcakepadatangkifilterpressyangberfungsisebagai
penyaring.
Simple syrup kemudian dialirkan ke filter untuk menyaring kotoran
yangmungkinterbawa,misalnyapotongankantunggula.Kemudiansirup
dialirkan kedalam filter press, tetapi sebelumnya melewati tangki pre
coating dengantujuanlajualiranpada filterpress dapatstabil.Padasaat
awalproduksi,tangki precoating ditambahkanlagi filteraid jenis hyflo
yang memudahkan terbentuknya lapisan cake pada filter press. Untuk
membentuk lapisan awal pada tangki pre coating, sirup disirkulasikan

68

terussampai filteraid masukkedalam filterpress danmembentukcake.


Filteraidadalahtanahdiatomikhasilpertambanganyangberwarnaputih
dandapatmembentuklapisanelastisberpori.
Setelah melalui filter press, simple syrup dilewatkan ke UV Lamp
untukprosessterilisasi.UVLampberjumlah48buahyangterbagidalam6
tabung. UV Lamp memancarkan sinar ultraviolet dengan radiasi yang
cukup tinggi sehingga dapat mematikan mikroorganisme yang terdapat
pada simplesyrup.SetelahmelewatiUVLampdidapatkan simplefinish
syrup.
2) PembuatanFinishSyrup
SimplesyrupyangsudahmelewatiUVLampdialirkankedalamfinish
syruptanksesuaidengankebutuhanproduksi.Konsentratyangdigunakan
tergantungdariprodukyangakandibuat(CocaCola,Fanta,Sprite,dll).
Konsentrat ini dimasukkan kedalam tangki pencampuran dengan
ditambahkanairsecukupnya.Campurankonsentratinikemudiandialirkan
kedalam finish syrup tank yang sudah berisi simple syrup, kemudian
dilakukanpengadukanselama1jamsehinggakonsentratdapatbercampur
secarameratadalamsimplesyrup.Setelahtercampur,kemudiandilakukan
pengecekanBrix.JikasudahdidapatBrix sesuaidenganstandar,maka
finish syrup dapat dialirkan ke masingmasing line sesuai dengan
kebutuhanproduksi.
V.5.4.ProsesPencucianBotol

69

SebelumdiisidenganCSD,botolharusdicuciterlebihdahulusehingga
kualitas produk akan terjaga. Pada proses pencucian botol akan melalui
beberapatahapyaitu:tahappreinspectiondimanabotoldisortirdandiperiksa
kelayakannya secara fisik oleh inspector. Kriteria botol yang tidak layak
dipakaidiantaranyabotolbercat,botolisiplastik,botolscuffingdenganscuff
(karat) >5 mm, botol pecah, botol yang lebih besar dari ukurannya, botol
mulut sumbing, botol berlogo pudar dan botol kotor menengah. Tahap
selanjutnya botol dicuci secara otomatis dalam bottle washer. Pada proses
pencucianinidigunakankaustiksoda(NaOH)danzataditifberupa ferosol
untuklineVIIIdandevergarduntuklineIIIdanIV.Pencucianbotoldiakhiri
denganpostinspection(pantauanakhir).
RGB (Returnable Glass Bottle) dalam krat yang tersusun dalam palet
diambildarigudangpenyimpananmenggunakan forklift.Paletberisibotol
botol dalam krat diletakkan pada mesin depalletizer yang berfungsi
memisahkankratdaripalet.Paletdiletakkansebelum depalletizer,kemudian
krat diangkat dari palet diletakkan diatas roller. Dari roller, krat bergerak
menujuchainconveyorlalumenujumesinuncaser(unpacker).Botoldiangkat
darikratdengancaradijepitolehsejeniskaretbanpadaunituncaseryangdiisi
compresedair menggunakansistem electronic pneumatic.Sebelummenjepit
botol,karetbantersebutbelumterisi compresed air secaraotomatismengisi
karetbandanmenjepitbotolsatupersatudaridalamkratdandiangkatke
matchainconveyordiatascaseconveyormenujubottlewasher.Kemudiankrat

70

dibawakecasewasher.
Kratdibawasecarahorizontalmenujucaseconveyordiataschainconveyor
dandibawakeatasdalamposisinormal(tidakterbalik)menggunakanvertical
conveyor dengankemiringansekitar45.Padaujung verticalconveyor,krat
jatuh pada posisi terbalik menuju case washer. Dalam case washer, krat
disemprotdenganairwarmwaterIdaribottlewasherdengansuhu50C.Krat
keluardari casewasher dalamkeadaantidakterbalikkemudiankratmenuju
mesinpalletizerdenganchainconveyor.
Padaprosespencucianbotol,botolmasukkedalampocket(sarungbotol)
didorong oleh infeed cam. Didalam washer, botol akan disemprot dengan
softener water chlorine dengan konsentrasi 15 ppm melalui empat buah
nozzledenganmenggunakantekanan1barpadabagianluardandalambotol
padatahapinidisebutprerinse.Botolkemudiandibawadandirendamkurang
lebihselama3menitdalamkompartemenI.DalamkompartemenIterdapat
larutansodakaustikdengankonsentrasiminimal1,3%danferosol(khususline
VII),divergarddengankonsentrasi0,31%dengansuhularutanminimal55C.
Dari kompartemen I kemudian botol dibawa ke kompartemen II. Dalam
kompartemen II botol direndam kurang lebih 6 menit dalam larutan yang
mengandungsodakaustikdengankonsentrasiminimal2,5%danmengandung
ferrosol atau divergard dengan konsentrasi 0,31% dengan suhu lebih dari
60C.Kemudianbotolmelaluipostcaustic(removal)yaitudisemprotdengan
air bersuhu 60C oleh dua buah nozzle. Botol kemudian dibawa ke warm

71

water Ikemudiandisemprotlagidenganairbersuhu50Cdenganduabuah
nozzle,kemudianbotoldibawakewarmwaterII,disemprotdenganair40C
olehduabuahnozzle,kemudianbotoldibilasdenganairdifinalrinse.Total
waktuuntukprosespencucianbotolsekitar21menit.Larutankaustikdalam
kompatermen digunakan terus sampai jenuh. Setelah jenuh akan ditambah
lime dengan tujuan agar kotoran yang terkandung dalam larutan akan
mengendap.Setelahbotolkeluardari bottlewasher kemudianbotoldisortir
kembalisaatmelewatipostinspection.Olehinspectorbotolyangmasihkotor
diletakkan kembalipada chainconveyor kembalike infeed cam sedangkan
untukbotolyangpecahdipisahkanuntukdikumpulkan,yangkemudiandijual.
Inspeksi terakhir terhadap botol dilakukan dengan menggunakan
Electronic Bottle Inspector (EBI) yang terdiri dari tiga buah kamera yang
mendeteksileherbotol,penggiranbotoldanbagianbawahsertabibirbotol
dansatubuahkamerasensorliquid.Jikasensormenangkapadanyanodapada
botol itu dianggap sebagai foreign matter. Setelah botol melewati kamera
makasecaraotomatisdalamwaktuyangsangatsingkatadapendorongyang
menyingkirkanbotoltersebut,tepatdibawah pusher (pendorong)diletakkan
tong untuk menampung botol yang tidak lolos sensor. Kamera dapat
mendeteksi permukaan botol, sebab jika terdapat cacat pada pinggir botol
dapat menyebabkan pencemaran oleh bakteri karena proses penutupannya
tidaksempurna.
V.5.5.Pencampuran(Mixing)

72

Adalah proses pembuatan minuman berkarbonasi dengan cara


mencampurkan antara treated water, finish syrup dan CO2 yang telah
dimurnikan.Prosespencampuraniniterjadidimesin mixer yangterdiridari
tahapanprosesdeaerasidankarbonasiuntukmenghasilkanprodukminuman
berkarbonasi.
Proses deaerasi terjadi dalam deaerator tank, bertujuan untuk
mengeluarkanudaradalam treatedwater denganmenggunakantekanandan
kondisivacum.Prosesinipentingdilakukankarenaairyangtelahbebasdari
udara dapat segera menyerap gas CO2 dan dapat meminimalkan terjadinya
foaming. Air yang berasal dari deaerator tank kemudian dialirkan dalam
mixingtubeuntukdicampurkandenganfinalsyrupyangdipompadaribuffer
tank dengan perbandingan tertentu. Setelah bercampur, minuman ini
dilewatkanke Plat HeatExchanger (PHE)untukdidinginkan. Pendinginan
dilakukan dengan aliran yang berlawanan. PHE merupakan sistem
pendinginansecaratidaklangsungkarenaminumandidinginkanolehglikol
dan glikol didinginkan oleh NH3. Glikol mempunyai sifat yang lebih baik
daripadaamoniakantaralain:titikbekunyalebihrendah,lebihbersih,lebih
amanjikaterjadikebocoran,glikoltidakbercampurdenganbeverage.
Beverage dialirkan melalui pipa menuju carbonation tank, pada saat
melalui pipa ini beverage diinjeksi CO2 yang berasal dari CO2 purifier.
Temperaturbeverageyangkeluardaricarbonationtanksekitar48C.Proses
inidisebutkarbonasiyaitupelarutanCO2kedalambeverage.Daricarbonation

73

tank,carbonatsoftdrink(CSD)dialirkankefilleruntukfillingproses.
V.5.6.ProsesPengisian(FillingProcess)
V.5.6.1.KemasanBotol
Botolbotol yang telah lolos dari EBI akan menuju mesin filler yang
memiliki97fillingvalvedanmampumenghasilkan800botolpermenit.Tahap
selanjutnyaadalahpengisian,dimanapadaproses pengisianterdapatempat
langkahyaitucounterpressureyaitupemindahangasdarifillerbowlkedalam
botol agar tekanannya sama dengan tekanan dalam botol. Kemudian tahap
pengisian dengan produk yang sudah dikarbonasi. Tahap ketiga adalah
pengontrolantinggipermukaandalambotol.Danterakhiradalahsniftingyaitu
tahapmembuanggassecarabertahapdariruanganbotoldiatas permukaan
produkmelaluilubangkecildenganmaksuduntukmencegah foaming yang
berlebihanpadasaatbotoldilepasdarifillingvalve.
Penutupan botol (crowning) diselaraskan dengan gerak botol untuk
memastikansetiapbotoltertutupdenganbaik.Botolbotolyangtelahterisi
produkdantelahditutupkemudianberjalandiatasconveyormelewativideojet
datecoderdanfillheightdetector(FHD)untukmenuliskankodeproduksidan
untuk inspeksi ketinggian minuman dalam botol. Disini botolbotol akan
dimasukkandalamkratkratyangtelahdibersihkanolehcasewasher.Prinsip
kerja case washer serupa dengan unchaser, perbedaannya hanya pada
mengeluarkandanmemasukkanbotoldariataukedalamkrat.Setelahitu,krat
kratyangberisibotolakanmenujupalletizeruntukdisusundalampaletpalet

74

dansiapdisimpandalamgudangprodukjadi.
V.5.6.2.KemasanKaleng
KalengyangdigunakandalampengemasanCSDadalahberukuran250
ml dan 330 ml. kaleng kosong disusun diatas paletpalet. Melalui alat
depalletizer kalengkaleng ini diletakkan diatas conveyor berjalan menuju
ruangpengemasan.Sebelumpengisian,kalengdisemprotkanair finalrinse
yang mengandung klorin. Kemudian kaleng kosong ini diisikan beverage
denganmesin filler laluditutupdenganpenutupkalengmenggunakanmesin
seamer. Setelah itu melalui conveyor akan melewati mesin Filling Height
Detector (FHD).ApabilavolumeCSDdalamkalengdibawahstandaryang
telah ditentukan, maka secara otomatis kaleng tersebut akan disisihkan
(reject). Kaleng yang sudah memenuhi persyaratan akan menuju mesin
warmer karena proses pengisian dalam keadaan dingin maka kaleng perlu
dihangatkan dengan tujuan agar pada saat pencetakan kode produksi tinta
dapattercetakdenganbaik.Selainitu,karenapengemassekunderkalengini
berupa karton, maka penghangatan kaleng dapat mencegah terjadinya
pengembunan yang dapat menyebabkan karton menjadi basah dan rusak.
Setelah kaleng selesai melalui pencetakan kode produksi, maka kaleng ini
secaraotomatisakandikemasdalamkarton.Kartonyangterisikalengtersebut
akan melalui alat palletizer disusun menjadi paletpalet yang kemudian
diangkutkegudangmenggunakanforkliftdalamgudangpenyimpanan.
V.6.SANITASIDANPENANGANANLIMBAH

75

V.6.1.Sanitasi
Merupakan usaha untuk mencegah dan menghindari terjadinya dan
kontaminasisertamenjagakesehatanpekerjadankonsumensehinggadapat
menjamin mutu produk, melindungi produk dan pencemaran sehingga
mendukung standar mutu yang ditetapkan perusahaan. Sanitasi dilakukan
dengancaramenghilangkanataumengaturfaktorlingkunganyangberkaitan
denganrantaiperpindahanpenyakittersebut.
Produkminumanataumakananakantercemarjikatidakdiambillangkah
perlindungan produk dari kontaminasi. Kontaminasi dapat timbul dari
beberapa sumber termasuk bahanbahan bawaanorganik, mikroba di udara
dansekitar.
PT. Coca Cola Bottling Indonesia Centra Java telah melakukan sistem
sanitasiyangcukupbaik,haliniterbuktidenganadanyasertifikatISO14001
tentanglingkungan.Prosessanitasiyangdilakukanmeliputisanitasipekerja,
sanitasimesindanperalatansertasanitasilingkungan.
V.6.1.1.SanitasiPekerja
Kebersihan dan kesehatan pekerja yang langsung menangani proses
produksi harus dikontrol, hal ini dilakukan untuk mencegah terjadinya
kontaminasi pada produk. Sanitasi pekerja dilakukan dengan cara
penggunaan masker, earplug (penutup telinga), mencuci tangan dengan
menggunakansabundankemudiandikeringkan(handsanitizer)sebelum
memasuki processing area karena dengan kondisi yang saniter akan

76

mencegahterjadinyabahayakontaminasi.
V.6.1.2.SanitasiMesindanPeralatan
Alatalat yang berhubungan dengan proses produksi mempunyai
peranan penting dalam menentukan layak tidaknya produk yang
dihasilkan. Kondisi alat yang kurang baik dapat mengakibatkan
kontaminasi produk, sehingga kebersihan alat harus terjaga. Peralatan
produksiyangterpeliharadenganbaikakanmeningkatkanproduktifitas
kerjaselainitujugadapatmeningkatkankualitasprodukyangdihasilkan.
Sanitasimesindanperalatandilakukanselamaprosesproduksi.Proses
sanitasidilakukansetiapperubahanflavour,sebelumproduksidansesudah
produksi.Peralatanyagharusdisanitasiadalahtabungtabungdanpipa
pipa,pipasirupantaratangkisirupsampaitabung mixingtube.Sanitasi
peralatanproduksidilakukandengansistem3langkahdan5langkah.
Sanitasi3langkahdilakukanjikatidakterjadipergantianflavouryang
sangatberbedadanjikatidakterjadipergantian flavour,namunterdapat
jeda(maksimal3jam).Prosedursanitasi3langkahadalah:
a) pembilasandengantreatedwaterselama515menit
b) perendamandalamlarutanCaustikSodadengankonsentrasi
12%selama2030menit
c) pembilasan dengan treated water dengan suhu >85C
selama515menitsampaibebasdarikaustiksoda
Sanitasi5langkahdilakukanpadasaatawaldanakhirproduksiataupun

77

jikaterjadipergantianflavouryangsangatberbeda.Prosedursanitasi5
langkahadalah:
a) pembilasandengantreatedwaterselama515menit
b) perendaman dalam larutan Caustik Soda dengan konsentrasi 12%
selama2030menit
c) pembilasan dengan treated water dengan suhu >85C selama 515
menitsampaibebasdarikaustiksoda
d) rendamdenganlarutanklorindengankonsentrasi5070ppmselama
3050menit,
atau;
rendamdalamtreatedwaterdengansuhu>85Cselama3050menit
e) pembilasandengantreatedwaterselama515menitsampaibebasdari
klorin
Proses produksi berhenti selama kurang dari 12 jam perlu dilakukan
perendaman dalam larutan chlorine dengan konsentrasi 310 ppm,
kemudiandilakukanpembilasandengan treatedwaterjikaproduksiakan
dimulai lagi. Jika produksi berhenti lebih dari 12 jam, maka perlu
dilakukankembalisanitasi5langkah.Selainsanitasitersebutkhususpada
fillerperludilakukansteam(uapairpanas)padasaatawalproduksiyang
dihasilkanolehunitboilerdengansuhu85Cselama20menit.
BerikutMatrixCleaningdanSanitasiuntukCarbonatSoftDrinkdiPT.
CocaColaBottlingIndonesiaCentralJava.

78

Tabel7.MatrixCleaningdanSanitasi
Flavour
Coke
F.Stw
F.Cremy
Sprite
S.Lee
F.SW
F.Melon
F.Orange
F.Apel

Coke
TW
5
5
3

F.Stw
3
TW
5
3

F.Crm
3
5
TW
3

Spt
3
5
5
T

S.Ice
3
5
5
TW

F.SW
3
5
5
3

F.Mln
3
5
5
3

F.Org
3
5
5
3

F.Ap
3
5
5
3

W
T

TW

TW

TW

TW

TW

TW

5
3
5

5
3
5

TW
3
5

5
TW
5

5
3
TW

TW

TW

TW

W
T

5
3
5

5
3
5

5
3
5

W
5
3
5

Sumber:PT.CCBICentralJava,2007
Keterangan:3
=sanitasi3langkah
5
=sanitasi5langkah
TW
=bilasdengantreatedwater

V.6.1.3.SanitasiLingkungan
Dilakukanuntukmenjagalingkunganpabrikdansekitarpabrikselalu
bersih dan nyaman. Lantai ruang produksi dijaga untuk selalu dalam
keadaanbasahhalinidimaksudkanagarlarutangulayangtercecerdapat
terbawaairmengalirsehinggatidakmenjadihabitatmikrobia.Begitujuga
denganruanglaboratoriumyangselaluidipelminimal1jamsekali.Pada
tempattempatstrategidisediakansaranahygienesepertitempatsampah
sehinggakebersihannyaterjamin.

V.6.2.PengolahanLimbah

79

Limbahmerupakanhasildarisuatuaktifitasyangdilakukanmanusiayang
sudahtidakterpakailagidalamkegiatantersebut.Pengolahanlimbahyang
kurang baik dapat mengakibatkan terjadinya pencemaran lingkungan, oleh
karenaituperluadanyapenangananlimbahyangtepatsehinggalimbahyang
dihasilkan tidak merusak lingkungan. PT. Coca Cola Bottling Indonesia
Central Java merupakan perusahaan yang memproduksi minuman ringan,
limbahyangdihasilkandariaktifitasperusahaanberupalimbahpadat,limbah
cairdanlimbahgas.
V.6.2.1.Limbahpadat
Limbahpadatbiasanyaberupabotolbotolgelas,kaleng,karton,crowndan
kantonggula.Botolbotolbiasanyaberasaldaripecahanbotolselamaproses
produksidanbotolyangsudahtidakdapatdigunakanlagiuntukmengemas
produk carbonat soft drink (CSD). Kaleng biasanya berasal dari proses
produksi dimana produk yang dihasilkan tidak memenuhi standar (reject).
Kartonbiasanyaberasaldarisisapengemasyangrusak.Limbahpadatyang
dihasilkandikumpulkandijualuntukdidaurulangsehinggamenjaditambahan
pendapatanbagiperusahaan.
V.6.2.2.Limbahgas
Limbahgasberasaldariboiler,washer,forklift,dankendaraanperusahaan.
Untuk meminimalkan limbah gas yang dihasilkan dapat dilakukan dengan
menjaga kondisi forklift, boiler dan kendaraan perusahaan dengan baik,
sehingga pembakaran terjadi secara sempurna. Pembakaran yang sempurna

80

akanmenghasilkangaskarbondioksidayangtidakberacunsertadapatdidaur
ulangolehtumbuhansebagaibahanfotosintesis.Usahayangdilakukanuntuk
meminimalkanlimbahgasyaitudenganmemilihbahanbakardengankualitas
baik,membuattamandilingkunganperusahaansertaadanyaventilasiruangan
produksiyangbaik.
V.6.2.3.Limbahcair
Limbahcairberasaldariprosesproduksi,prosespencucianbotol,bahan
kimiasisapengujiandansanitasibaikruangproduksimaupunperalatan.Air
limbah mengandung berbagai macam zat anorganik dan organik. Zat
anorganikberupalogamberat,garam,oli,zatzatkimialainnya,sedangkanzat
organik berupa gula. Air limbah yang dihasilkan mengandung zatzat
berbahayasehinggajikadibuanglangsungkelingkungandapatmenyebabkan
terjadinyapencemaranlingkungan.Olehkarenaituperluadanyapenanganan
yang tepat sehingga air limbah dihasilkan tidak mencemari lingkungan.
Penanganan limbah kimia sisa hasil analisis dilakukan dengan cara
menampungnya dalam deerigen yang kemudian akan dibuang ketempat
pengolahan limbah kimia. Penanganan limbah cair dapat diuraikan sebagai
berikut:
a) Collectortank
Airlimbahyangdihasilkandaripabrikdialirkankecollector.Airlimbah
yang dihasilkan masih bercampur dengan bendabenda asing lainnya
seperti crown, lumpur, oli, dan bahanbahan lainnya yang dapat

81

mengganggu kelancaran proses berikutnya. Pada collector tank terjadi


prosespemisahanmaterialsoliddenganmenggunakansaringan,ataujuga
denganprosespengapungandanpengendapan.
b) OilSeparator
Berfungsiuntukmemisahkanoliyangmasihbercampurdenganairlimbah
yang berasal dari proses produksi (oli dan grease). Pada oli separator
effluent dialirkanmelaluilamelasaringan,dimanaoliyangmempunyai
beratjenisyanglebihkecildariair,makaolidapatdipisahkan.Oliharus
dipisahkankarenadapatmenggangguprosesaerasipadatangkiICEAS.
c) Equalizationtank
Tangki equalisasi berfungsi dalam menyeragamkan kualitas air limbah
sehingga tidak mempunyai fluktuasi kualitas dan dapat mempermudah
pengolahanpadatangkiICEAS. Effluent yangdihasilkanmasihbersifat
sangat basa yang diakibatkan oleh adanya sisa pencucian botol, oleh
karena itu perlu adanya penambahan asam sehingga pH akan turun
mendekatinetralyangmendukungaktivitasmikrobia.
d) ICEASTank(IntermittenCycleExtendedAerationSystem)
Pada tangki ICEAS, air limbah yang berasal dari equalisasi tank akan
mengalami3prosesyaituaerasi,settlingdandecantasi.
1) Aerasi
Proses ini bertujuan untuk menyuplai kebutuhan O2 yang akan
membantuaktivitasmikrobiaaerob.Tandatandaaktivitasbakteriatau

82

mikrobia,antaralaintidakadanyabaumenyengatpadainfluent,warna
sludge cenderung cerah atau kecoklatan, serta tidak muncul banyak
buihsebagaiakibattingginyakadar causticsoda.Kurangnyaproses
aerasi dapat memicu berkembangnya bakteri anaerob yang dalam
aktivitasnyamenghasilkangasamonia(NH3)yangdapatmembunuh
bakteriaerob.SuplaiO2 dilakukanoleh blower yangberbedatangki.
SelainsebagaisupplierO2, blower jugaberfungsisebagaipengaduk
massa lumpur yang bercampur dengan air buangan. Proses ini
berlangsungselama2jam.
2) Settling
Pada proses ini terjadi pengendapan sludge atau lumpur aktif yang
berasal dari hasil penguraian bahan oleh bakteri, sehingga dapat
dihasilkanfiltratyangbersih,prosessettlingberlangsungselama2jam.
Sludgeaktifdapatdigunakanlagidalampengolahanlimbah.BODatau
BiologicalOxygenDemand adalahparameteryangdigunakanuntuk
mengetahui jumlah O2 yang dibutuhkan oleh mikroorganisme untuk
mengoksidasisenyawasenyawaorganikyangadadidalamairsecara
aerob.
3) Decantasi
Bertujuanuntukmemudahkanairlimbahyangsudahmelaluiproses
pengendapan dengan lumpur aktif. Volume air yang dipindahkan
tergantungpadalamawaktudecantasi,tingkatdecantasi,danfrekuensi

83

siklus. Pada pengolahan limbah ini, air limbah pada ICEAS tank
terlihatjernihdanlumpuraktifsudahmengendapsehinggaairlimbah
siapdibuangmelaluidecantermenujueffluentpond.
4) Effluentpond
Setelehmelewati prosesdecantasi,airlimbahsudahdianggaplayak
untuk dibuang keluar. Maka sebelum dibuang, air limbah tersebut
dialirkan ke bak effluent yang kemudian akan dibuang ke saluran
pembuangandansebagiandapatdimanfaatkankembali.
5) Clarifier
Padaprosesiniairlimbahdarieffluentponddilewatkanmelaluifilter
yang dapat menyaring kotoran ataupun lumpur aktif yang masih
terbawa dari effluent pond. Sebelumnya juga dicampurkan larutan
chlorine 5% dalam inlet clarifier dengan tujuan untuk mengurangi
jumlahmikrobia.
6) SandFilterGrafity
Pada sandfiltergrafity,terjadiprosespenyaringanairlimbah. Sand
filter grafity ini terdiri atas media saring yang berupa pasir silika,
injuk,danbatusungai.Tujuannyaagar effluent darilimbahinidapat
memilikiappearanceyanglebihjernihdanterbebasdarikotoran.
7) Biopond
Bertujuan untuk mengetahui keadaan biologi air limbah, apakah
limbahtersebutmasihberacunatautidak.Padabiopondberupakolam

84

diletakkan sejumlah ikan. Jika ikanikan tersebut mati, maka


kemungkinaneffluentdariproseslimbahinimasihmengandungbahan
kimiayangberbahaya.

BABVI
KESIMPULANDANSARAN

VI.1.KESIMPULAN
VI.1.1.ProsesutamapembuatanminumanCarbonatadalah:
a. Proses pengolahan air (water
treatment):
1. Raw water

4.Softener
water
2. Treated water

5.
Generalu use
water
3. Soft treated
water

85

b. proses pengolahan sirup (syrup


manufacturing):
1. Pembuatansimplesyrup
2. Pembuatanfinishsyrup
c. prosespemurniankarbondioksida
(CO2)
d. proses pencampuran (mixer /
carboncooler)
e. prosespencucianbotoldankrat
f. prosespengisian(filling)
VI.1.2.Suhuyangdigunakanuntukmembuat simplesyrup (padatangki simple
syrup)adalah25C35C.Suhudijagatetapkonstanuntukmencapaibrix
58Bdanwarna35RBUsertauntukmenjagaagarbaudanrasanormal.
VI.1.3. Bahan baku yang digunakan dalam pembuatan minuman ringan telah
memenuhi standar yang telah ditetapkan oleh perusahaan. Hal ini
menandakan bahwa perusahaan berkomitmen untuk menghasilkan
minumanringandengankualitasyangbaik.
VI.2.SARAN
VI.2.1.Untukmenjagabau,rasanormaldanbrixtercapai(>58B),sebaiknyasuhu
yang digunakan pada saat proses pembuatan simple syrup dijaga tetap
konstan(25C30C).
VI.2.2. Mengingat pentingnya pengolahan air untuk kegiatan proses produksi,

86

membutuhkan perawatan pada water treatment yang teratur dan


penangananyangcepat,tepatdancermat.
VI.2.3. Perlu diupayakan melakukan peremajaan terhadap mesin dan peralatan
yangdigunakansehinggadapatmengurangimasalahyangadadandapat
meningkatkanefektivitasproduksi.
VI.2.4.Perluadanyapengurangantenagakerjakontraksecarabertahapmenjadi
tenagakerjatetap
VI.2.5.Perluadanyapeningkatankualitassumberdayamanusiayangada,salah
satunyadengancaramelakukanpelatihanpelatihanyanglebihintensif.

DAFTARPUSTAKA

Anonim. 2000.
Industri Minuman Ringan. http://www.coca
colabottling.co.id/ina/ourcompany.html.Diakses4Desember2006.
Anonim.2001.KajianTerhadapMinumanRinganSebagaiBarangkenaCukai.

87

http://www.beacukai.go.id/sisdur/softdrink.html. Diakses 4 Desember


2006.
Anonim.2002. TataLaksanadanProsedurCukaiatauBarangKenaCukai.
http://beacukai.go.id/sisdur/cukai/cukai.html.Diakses4Desember2006.
Anonim. 2008. Proses Pengolahan Minuman Bersoda hingga Penyimpanan
dan Distribusinya. http://www.snwidyastari.blogspor.com. Diakses 26
Februari2008.
Buckle,RA.Edward,G.H.Fleet,danM.Wootan.1987.IlmuPangan.UIPress.
Jakarta.
CahyoSaparintodanDianaHidayati.2006.BahanTambahanPangan.Penerbit:
Kanisius,Yogyakarta.
Mahida,U.N.1984.PemanfaatanLimbahIndustri.RajawaliPress.Jakarta.
Makfoeld, D. 1982. Deskripsi Pengolahan Hasil Nabati. Penerbit: Agritech.
Yogyakarta.
Nelson, W.N, and Donald K Tressler. 1980. Fruit and Vegetable Juice
ProccessingTechnology.AVIPublishingCompanyWestport.Conecticut.
Priatni, Sri. 1991. Laporan Kerja Praktik di PT. Pan Java Company Bawen
SemarangLaporanKerjaPraktikFakultasTeknikUniversitasPasundan
Bandung.(tidakdipublikasikan)
Thorner,N.EandR.J.,Herzberg.1978. NonAlcoholicFoodServiceBeverage
Handbook2ndEdition.AVIPublishingCompanyWestport.Conecticut.
Winarno, F.E. Srikandi Fardiaz. Dedi Fardia, E. 1980. Pengantar Teknologi
Pangan.PTGramedia.Jakarta.

88