Anda di halaman 1dari 33

BAB I

PENDAHULUAN
1.1 Pendahuluan
Asma merupakan penyakit respiratorik kronis yang paling sering dijumpai pada anak.
Prevalensi asma meningkat dari waktu ke waktu baik di negara maju maupun negara sedang
berkembang. Peningkatan tersebut diduga berkaitan dengan pola hidup yang berubah dan
peran faktor lingkungan terutama polusi baik indoormaupun outdoor.
Saat ini diseluruh dunia terjadi peningkatan angka kejadian dan derajat asma terutama
pada anak-anak, baik di negara maju maupun di negara berkembang. Walaupun pengetahuan
tentang patologi, patofisiologi, dan imunologi asma berkembang sangat pesat, khususnya
pada orang dewasa dan anak besar, pada anak kecil dan bayi mekanisme dasar perkembangan
penyakit ini belum diketahui pasti, lagi pula banyak bayi dan batita sering mengalami mengi
pada saat terkena infeksi saluran napas akut dan jarang menjadi asma di kemudian hari.
Prevalenstotalasmadiduniadiperkirakan7,2%(6%padadewasadan10%padaanak).
Prevalenstersebutsangatbervariasi.Terdapatperbedaanprevalensantarnegaradanbahkan
perbedaanjugadidapatantardaerahdidalamsuatunegara.Masalahepidemiologiyanglain
saatiniadalahmorbiditasdanmortalitasasmavangrelatiftinggi.WHOmemperkirakansaat
initerdp.pat250.000kematianakibatasma.Beberapawaktuyanglalu,penyakitasmabukan
penyebabkematianyangberarti.Namun,belakanganiniberbagainegaramelaporkanbahwa
terjadipeningkatankematianakibatpenyakitasma,termasukpadaanak.
Serangan asma bervariasi mulai dari ringan sampai berat dan mengancam kehidupan.
Berbagaifaktordapatmenjadipencetustimbulnyaseranganasma,antaralainadalaholahraga
(exercise),alergen,infeksi,perubahansuhuudarayangmendadak,ataupajananterhadap
iritan respiratorik seperti asap rokok, dan lainlain. Selain itu, berbagai faktor turut
mempengaruhi tinggi rendahnya prevalens asma di suatu tempat, misalnya usia, jenis
kelamin, ras, sosioekonomi, dan faktor lingkungan. Faktorfaktor tersebut dapat
mempengaruhi prevalens asma, derajat penyakit asma, terjadinya serangan asma, berat
ringannyaserangandankematianakibatpenyakitasma.13

BABII
ISI
2.1Definisi
Dari waktu ke waktu, definisi asma mengalami beberapa kali perubahan akibat
berkembangnyaimunologi,dangeneticasma.Akantetapi,mekanismeyangmendasari
penyakitinimasihbelumdiketahuisecarakeseluruhan,khususnyapadaanak.3
GlobalInitiativeforAsthma (GINA)padatahun2006mendefinisikanasmasebagai
gangguan inflamasi kronik saluran napas yang disertai oleh peranan berbagai sel,
khususnyaselmast,eosinophil,danlimfosit.PedomanNasionalAsmaAnak(PNAA)
2004menurutdefinisitersebut,asmaadalahmengiberulangdan/ataubatukpersisten
dengan kharakteristik sebagai berikut: timbul secara episodik, cenderung pada
malam/dinihari(nocturnal),musiman,setelahaktivitasfisik,sertaterdapatriwayatasma
atauatopilainpadapasiendan/ataukeluarganya.2,3
Batukmerupakangejalayangbiasamenyertaiinfeksisalurannafasatasolehvirus.
Walaupunbeberapahasilpenelitianmenunjukkanbahwafrekuensibatuklebihsering
dari biasanya, hubungan antara batuk yang sering tersebut dengan asma masih
diperdebatkan.2,3
2.2Epidemiologi
Asmadapattimbulpadasegalaumur,30%penderitabergejalapadaumur1tahun,
sedang 8090% anak asma mempunyai gejala pertamanya sebelum umur 45 tahun.
Perhalanandankeparahanasmasukardirawal.Sebagianbesaranakyangterkenakadang
kadang hanya mendapat seangan ringan sampai sedang, relatif mudah ditangani.
Prognosisuntukanakmudaasmabiasanyabaik.4
Survei mengenai prevalens asma di Eropa telah dilakukan di 7 negara (Asthma
Insights&RealityinEurope, AIRE),mencakup73.880rumahtangga,denganjumlah
orang 213.158. Hasil penelitian menunjukkan bahwa populasi current asthma adalah
2,7%(AIRE,2003).1
Penelitian asma di Indonesia telah dilakukan di beberapa sentra, tetapi belum
semuanvamenggunakankuesionerstandar.PadaTabel1dapatdilihatbeberapahasil
surveiprevalensasmaanakdiIndonesia.1

Sebenarnya, selama ini asma tidak termasuk kelompok penyakit yang mematikan
(fatal),tetapiakhirakhirinidilaporkanadanyapeningkatankematianakibatpenyakit
asma. Kematian pada anak akibat penyakit asma jarang. Pada tahun yang sama,
didapatkan kematian 223 anak usia 017 tahun atau 0.5kematian per100.000 anak.
Kematianpalingbanyakadalahpadanonhispanikkulithitam;jumlahkematianpada
kulithitamadalah200%lebihtinggidaripadakulitputihdan160%lebihtinggidaripada
kelompokHispanik.Selainitu,kematianpadawanita40%lebihtinggidaripadalaki
laki.1
Tabel 1. Prevalensi Asma di Indonesia.1

AsmamerupakansepuluhbesarpenyebabkesakitandankematiandiIndonesia,halitu
tergambardaridatastudisurveikesehatanrumahtangga(SKRT)diberbagaipropinsidi
Indonesia.Surveikesehatanrumahtangga(SKRT)1986menunjukkanasmamenduduki
urutanke5dari10penyebabkesakitan(morbiditi)bersamasamadenganbronkitiskronik
danemfisema.PadaSKRT1992,asma,bronkitiskronikdanemfisemasebagaipenyebab
kematian(mortaliti)ke4diIndonesiaatausebesar5,6%.Tahun1995,prevalensiasmadi
seluruhIndonesiasebesar13/1000,dibandingkanbronkitiskronik11/1000danobstruksi
paru2/1000.5
2.2FaktorRisiko
Berbagaifaktordapatmempengaruhiterjadinyaseranganasma,kejadianasma,berat
ringannyapenyakit,sertakematianakibatpenyakitasma.Faktortaktottersebutantara
lainadalahjeniskelamin,usia,sosioekonomi,alergen,infeksi,atopi,lingkungan,dan
lainlain.1

2.2.1JenisKelamin
Menurut laporan dan beberapa penelitian didapatkan bahwa prevalens asma pada
anak laki-laki sampai usia 10 tahun adalah 1,5 sampai 2 kali lipat anak perempuan.
Namun, dari benua Amerika dilaporkan bahwa belakangan ini ndak ada perbedaan
prevalens asma antara anak laki-laki (51,1 per 1000) dan perempuan (56.2 per 1000).
Pada orang dewasa, rasio ini berubah menjadi sebanding antara laki-laki dan
perempuan pada usia 10 tahun.1
2.2.2Usia
Umumnya,padakebanyakankasusasmapersisten,gejalasepertiasmapertamakali
timbulpadausiamuda,yaitupadabeberapatahunpertamakehidupan.DariMelbourne
(Australia), dilaporkan bahwa 25% anak dengan asma persisten mendapat serangan
mengipadausia<6bulan,dan75%mendapatseranganmengipertamasebelumusia5
tahun.Hanya5%anakdenganasmapersistenterbebasdarigejalaasmapadausia2855
tahun,60%tetapmenunjukkangejalasepertisaatanakanak,dansisanyamasihsering
mendapatseranganmeskipunlebihringandaripadasaatmasakanak.1
2.2.3RiwayatAtopi
Adanya atopi berhubungan dengan meningkatnya risiko asma persisten dan beratnya
asma. Menurut laporan dari Inggris, pada anak usia 16 tahun dengan riwayat asma atau
mengi, akan terjadi serangan mengi dua kali lipat lebih banyak. Terdapat juga laporan
bahwa anak dengan mengi persisten dalam kurun waktu 6 tahun pertama kehidupan
mempunyai kadar IgE lebih tinggi daripada anak yang tidak pernah mengalami mengi
pada usia 9 bulan. Beberapa laporan menunjukkan bahwa sensitisasi alergi terhadap
alergen inhalan, susu, telur, atau kacang pada tahun pertama kehidupan, merupakan
prediktor timbulnya asma.1
2.2.4Lingkungan
Adanya alergen di lingkungan hidup anak meningkatkan risiko penyakit asma.
Alergen yang sering mencetuskan penyakit asma antara iain adalah serpihan kulit
binatang piaraan, tungau debu rumah, jamur, dan kecoa.1
2.2.5Ras
Menurut laporan dari Amerika Serikat didapatkan bahwa prevalens asma dan
kejadianseranganasmapadaraskulithitamlebihtinggidaripadakulitputih.Tingginya
prevalenstersebuttidakdipengaruhiolehpendapatanmaupunpendidikan.1

2.2.6AsapRokok
Prevalens asma pada anak yang terpajan asap rokok lebih tinggi daripada anak yang
tidak terpajan asap rokok. Risiko terhadap asap rokok sudah dimulai sejak janin dalam
kandungan, umumnya berlangsuing terus setelah anak dilahirkan, dan menyebabkan
meningkatnya risiko. Pada anak yang terpajan asap rokok, kejadian eksaserbasi lebih
tinggi, anak lebih sering tidak masuk sekolah, dan umumnya fungsi faal parunya lebih
buruk daripada anak yang tidak terpajan.1
2.2.7Outdoorairpollution
Beberapa partikel halus di udara seperti debu jalan raya, nitrat dioksida, karbon
monoksida, atau S02, diduga berperan pada penyakit asma, meningkatkan gejala asma,
tetapi belum didapatkan bukti yang disepakati.1
2.2.8Infeksirespiratorik
Beberapapenelitianmendapatkanadanyahubunganterbalikantaraatopi(termasuk
asma) dengan infeksi respiratorik. Sebenarnya hubungan antara infeksi respiratorik
denganprevalensasmamasihmerupakankontroversi.Namun,halinitidakberlaku
padainfeksirespiratorysyncytialvirus(RSV)diusiadiniyangmengakibatkaninfeksi
saluranpernapasanbawah.InfeksiRSVmerupakantaktorrisikoyangbermaknauntuk
terjadinyamengidiusia6tahun.1
2.3Patogenesis
Hingga saat ini, konsep patogenesis asma terus berkembang (evolving concept).
Dahuluasmadianggapsematamatakarenabronkospasmeyangdisertaihipersekresi
lendirdanedemadindingbronkussehinggamenyebabkanobstruksi.Akantetapi,pada
tahun1960,diperkenalkankonsephiperreaktivitasbronkuspadapatogenesisasma.1
GlobalImtiativeforAsthma(GINA)denganjelasmenggambarkankonsepinflamasi
kronis dalam definisinya tentang asma. Konsep tersebut menyatakan bahwa asma
adalah suatu proses inflamasi kronis yang khas, melibatkan dinding saluran
respiratorik,danmenyebabkanterbatasnyaaliranudarasertameningkatnyareaktivitas
saluranrespiratori.1
Hiperreaktivitas ini merupakan predisposisi terjadinya penyempitan saluran
respiratorisebagairesponsterhadapberbagaimacamrangsang.Pencetusseranganasma
dapat disebabkan oleh sejumlah faktor antara lain alergen, virus, iritan yang dapat
menginduksiresponsinflamasiakutyangterdiriatasreaksiasmatipecepatdanpada

sejumlahkasusdiikutireaksiasmatipelambat.AlergenakanterikatpadaIgEyang
menempelpadaselmastdanterjadidegranulasiselmasttersebut.Degranulasitersebut
mengeluarkan preformed mediator seperti histamin, protease dan newly generated
mediator sepertileukotrin,prostaglandindanPAFyangmenyebabkankontraksiotot
polosbronkus,sekresimukusdanvasodilatasi.1,4,5
Sejalan dengan proses inflamasi kronis, perlukaan epitel bronkus merangsang proses
reparasi/perbaikan saluran respiratori yang menghasilkan perubahan struktural dan
fungsional yang menyimpang pada saluran respiratori. Perubahan ini dikenal dengan
istilah remodeling saluran respiratori (airway remodeling; AR). Tidak ada keraguan
bahwa faktor genetik memegang peranan penting dalam etiologi, patogenesis dan
tatalaksana asma. Asma merupakan "complex genetic disorders" yang dipengaruhi oleh
banyak gen, sehingga tidak mengikuti pola pewarisan Mendelian.1,4,5
Konsep Epithelial-Mesenchymal Trophic Unit (EMTU) diperkenalkan oleh Holgate,
yaitu epitel saluran respiratori dan jaringan mesenkim di bawahnya yang bertindak
sebagai "trophic unit" yang saling berkomunikasi. Selama embriogenesis, EMTU
berperan dalam remodeling fisiologis saluran respiratorik untuk meregulasi
pertumbuhan dan percabangan saluran respiratorik. Caranya adalah dengan mengatur
keseimbangan epithelial growth factor (EGF), fibroblast growth factoi (FGF), dan
transforming growth factor (TGF-).1,5
Komunikasi antar sel dalam EMTU, dan interaksinya dengan Th2 sitokin
proinflamasidalampatogenesisasmaberprosesdalamtigatahap,denganhasilakhirnya
adalah inflamasi dan AR yang berfungsi secara paralel. Tahap pertama (inisiasi)
dimulai dengan adanya kepekaan epitel bronkus terhadap inhalan lingkungan. Pada
keadaannormal,epitelmelepaszatzatyangmenekanselselmesenkimsepertiPGE2
dan 25hydroxyeicotetraenoic acid (25HETE). Pada asma, epitel yang rusak atau
cedera mengalami penurunan PGE2 dan HETE. Hal ini mengakibatkan aktivasi
fibroblasdanmiofibroblasdibawahlapisanepitel.Aktivasitersebutdiatutolehfaktor
faktorpertumbuhanyangdilepasolehepitel(tahappropagasi).1,5
Pada tahap amplifikasi, aktivasi miofibroblas akan melepaskan growth factor (GF)
yang menyebabkan proliferasi miofibroblas dan ASM serta deposisi ECM dengan hasil
akhir terjadinya AR. Aktivasi miofibroblas juga menyebabkan pelepasan sitokin dan
kemokin yang menyebabkan inflamasi saluran respiratori. Pada setiap tahap inisiasi,
propagasi, dan amplifikasi dalam EMTU, terjadi juga proses inflamasi yang diatur oleh

limtosit T. Sitokin yang dihasilkan (tetutama IL-4 Jan 1L-13) akan berinteraksi dengan
EMTU dan memperberat proses remodeling. Secara keseluruhan. EMTU yang
teraktivasi dan interaksinya dengan sitokin Th2 akan menyebabkan inflamasi dan AR
yang prosesnya berlangsung parallel.1,4

Gambar1.Komunikasi sel-ke-sel dalam EMTU, model paralel untuk patogenesis asma.4


Padaasmaterdapatsalingketergantunganantaraprosesinflamasidanremodeling.
Infiltrasiselselinflamasiterlibatdalamproses remodeling,jugakomponenlainnya
sepertimatriksekstraselular,membranretikularbasal,matriksinterstisial,fibrogenik
growthfactor,proteasedaninhibitornya,pembuluhdarah,ototpolos,kelenjarmukus.
Perubahanstrukturyangterjadi:

Hipertrofidanhiperplasiaototpolosjalannapas

Hipertrofidanhiperplasiakelenjarmukus

Penebalanmembranretikularbasal

Pembuluhdarahmeningkat

Matriksekstraselularfungsinyameningkat

Perubahanstrukturparenkim

Peningkatanfibrogenicgrowthfactormenjadikanfibrosis1,4

Gambar2.Perubahanstrukturpadaairwayremodelingdankonsekuensiklinis
2.4Patofisiologi
Inflamasi saluran napas yang ditemukan pada pasien asma diyakini merupakan hal
yang mendasari gangguan fungsi. Respon terhadap inflamasi pada mukosa saluran napas
pasien asma ini menyebabkan hiperreaktifitas bronkus yang merupakan tanda utama
asma. Pada saat terjadi hiperreaktivitas saluran napas sejumlah pemicu dapat memulai
gejala asma. Pemicu ini meliputi respon hipersensitivitas tipe 1 (dimedisi 1gE) terhadap
alergen debu rumah dan serbuk sari yang tersensitisasi, iritan seperti udara dingin,
polutan atau asap rokok, infeksi virus, dan aktivitas fisik/olahraga.
Manifestasi penymbatan jalan napas pada asma disebabkan oleh bronkokonstriksi,
hipersekresi mukus, edema mukosa, infiltrasi seluler, dan deskuamasi sel epitel serta sel
radang. Berbagai rasangsan alergi dan rangsan nonspesifik, akan adanya jalan napas yang
hipereaktif, mencetuskan respons bronkokonstroksi dan radang, Rangsangan ini meliputi
alergen yang dihirup (tungau debu, tepung sari, sari kedelai, protein minyak), protein

sayuran lainnya, infeksi virus, asap rokok, polutan udara, bau busuk, obat obatab, udara
dingin dan obat obatan.
Hiperreaktivitas saluran napas akan menyebabkan obstruksi saluran napas
menyebabkan hambatan aliran udara yang dapat kembali secara spontan atau setelah
pengobatan. Proses patologis utama yang mendukung obstruksi saluran napas adalah
edema mukosa, kontraksi otot polos dan produksi mukus. Obstruksi terjadi selama
ekspirasi ketika saluran napas mengalami volume penutupan dan menyebabkan gas di
saluran napas terperangkap. Bahkan, pada asma yang berat dapat mengurangi aliran
udara selama inspirasi.
Pada asma berat, patofisiologinya adalah bronkokonstriksi, hipertrofi otot polos
bronkus, hipertrofi kelenjar mukosa, edema mukosa, infiltrasi sel radang (eosinophil.
Neutrophil, basophil, makrofag) dan deskuamasi. Tanda patognomonis adalah kristal
Charcot-Leyden (lisofosfolipase membrane eosinophil), spiral Cursch-mann (silinder
mukosa bronkial), dan benda-benda Creola (sel epitel terkelupas).
Ketidakseimbangan
bertambahnya

kerja

ventilasi
pernapasan

dengan

perfusi,

menyebabkan

hipoventilasi

pepruban

pada

alveolar,
gas-gas

dan
darah.

Hiperbentilasi beberapa daerah paru pada mulanya mengkompensasi tekanan


karbondioksaida yang lebih tinggi dalam darah yang memperfusi daerah yang terventilasi
jele. Namun, hiperventilasi ini tidak dapat mengkompensasi hipoksemaia saat bernapas
dengan udara kamar karena ketidakmampuan penderita menaikkan tekanan oksigen dan
saturasi oksihemoglobin parsial. Progresivitas penymbatan jalan napas lebih lanjut
menyebabkan hipoventilasi alveolar yang lebih banyak, dan hiperkapnea dapat terjadi
mendadak. Hipoksia menganggu perubahan asma laktat menjadi karbondioksida dan air,
menimbulkan asidosis metabolik. Hiperkapnia menaikkan asam karbonat, yang
berdisosiasi menjadi ion hydrogen dan ion bikarbonat, menimbulkan asidosis
respiratorik.

Gambar 3. Airway remodeling pada anak dan dewasa.


Sejumlah karakteristik anatomi dan fisiologi memberi kecenderungan bayi dan anak
kecil terhadap peningkatan risiko obstruksi saluran napas antara lain ukuran saluran
napas yang lebih kecil, recoil elastic paru yang lebih lemah, kurangnya bantuan otot
polos saluran napas kecil, hiperplasia kelenjar mukosa relatif dan kurangnya saluran
ventilasi kolateral (pori cohn) antar alveolus.1,5
2.5 Manifestasi Klinis dan Diagnosis
Penelitian oleh Castro Rodriguez dkk. (2000) mengemukakan 2 (dua) indeks klinis
untuk menggolongkan anak dengan risiko asma pada usia sekolah, yaitu stringent index
dan loose index. Stringent index adalah jika seorang anak merupakan early frequent
wheezer pada 3 tahun pertama kehidupan dan memenuhi paling sedikit 1 dari 2 kriteria
mayor atau 2 dari 3 kriteria minor. Loose index adalah jika seorang anak merupakan
early wheezer pada 3 tahun pertama kehidupan dan memenuhi paling sedikit 1 dari 2
kriteria mayor atau 2 dari 3 kriteria minor.
Tabel 1. Loose index.1
Kriteria Mayor
Kriteria Minor
1
Asma pada orang tua (didiagnosis oleh 1. Rhinitis alergi yang didiagnosis oleh
. dokter)
dokter
2 Eksema pada anak (didiagnosis oleh 2. Mengi diluar selesma (common cold)
. dokter)
3. Eosinofilia ( 4 % dari jumlah leukosit)

Berdasarkan International consensus on (ICON) pediatric asthma adanya episode


wheezing yangberulangpadaanakmerupakansalahsatupoinawaldalamdiagnosis
asmapadaanak.Jumlahdariepisodeyangberulangtidakspesifik,walaupunjumlah
minimal adalah >3 episode wheezing. Gejala klinis yang tipikal juga penting dalam
penegakkandiagnosisyaituadanyaepisodebatukyangberulang,mengi,sesaknafas,
rasadadatertekan,batuk,dicetuskandaribeberbagaimacamstimulusbahanbahaniritan
(asap rokok), alergen (pollens), infeksi saluran pernafasan, olahraga, menangis atau
tertawa,khususnyapadamalamataudinihari.Adanyariwayatatopi(rhinitisalergiatau
alergi terhadap makanan) dan riwayat keluarga yang memiliki riwayat asma yang
memperkuatdiagnosis.2,6
Perjalananpenyakitasmadapatmenunjukkanberbagaimacammanifestasiklinisyang
tidakspesifikdanheterogen,baikdiantarabeberapaindividumaupunpadaindividu
yangsama.Berarti,terdapatberbagaifenotipsepertiasma(asthmalikephenotypes)pada
berbagaiusiayangmungkindapatmenerangkanperubahankliniskhasasmaselamausia
anak. Karena keadaan tersebut, seringkah terjadi underdiagnosis atau bahkan
overdiagnosisdengankonsekuensiterjadinya undertreatment atauovertreatmentdalam
penatalaksanaan.1
Akhirakhirinibanyakyangberpendapatbahwauntukmenegakkandiagnosisasma
padaanakdibawahlimatahunsebaiknyaberhatihatiapabilatidakpernahdijumpai
adanya wheezing. Hal itu disebabkan pada usia tersebut kemungkinan batuk yang
berulang hanyalah akibat infeksi respiratorik saja. Demikian pula apabila dijumpai
wheezing pada usia di bawah tiga tahun (batita) hendaknya berhatihati dalam
mendiagnosisasma.Wheezingyangdijumpaipertamakalibelumtentumerupakangejala
asma.Biladijumpaikeadaanbatukkronisdan/atauberulangdengan/atautanpawheezing
dengankarakteristiksepertidiatas,tetapperludipertimbangkandiagnosisasma.2,6
Batuk merupakan gejala yang biasa menyertai infeksi saluran nafas atas oleh virus.
Walaupun beberapa hasil penelitian menunjukkan bahwa frekuensi batuk lebih sering
dari biasanya, hubungan antara batuk yang sering tersebut dengan asma masih
diperdebatkan.1-4

Diagram1.Alurdiagnosisasmapadaanak.2

OlehNationalAsthmaEducationandpreventionprogram(NAEPP)telahbanyakdi
kembangkan berbagai macam jenis cara dan kuisioner untuk pemeriksaan kesehatan
yangberkaitandengankualitashidupanakdenganasmadankontrolterhadapasmanya.
Terdapat2jeniskuisioneryaituuntukanakanakyangmasihbelumdapatmembacadan
untukanakyangsudahdapatmembacaataudenganusia12tahunataulebih.Kuisioner
tersebutdapatbanyakmembantudalamhalpemantauanterapipadaanakdenganasma.8

Gambar4.Kuisionerkontrolterhadapanakdenganasma.9

2.6Klasifikasi

GINA 2006 asma diklasifikasikan berdasarkan etiologi, derajat penyakit asma, serta
pola obstruksi aliran udara di saluran napas. GINA membagi asma menjadi 4

klasifikasi yaitu asma intermiten, asma persisten ringan, asma persisten sedang,
dan asma persisten berat. Berbeda dengan GINA, PNAA membagi asma menjadi
3 yaitu asma episodik ringan, asma episodik sedang, dan asma persisten. Dasar
pembagian ini karena pada asma anak kejadian episodik lebih sering dibanding
persisten. Dasar pembagian atau klasifikasi asma pada anak adalah frekuensi
serangan, lamanya serangan, aktivitas diluar serangan dan beberapa pemeriksaan
penunjang.1,2
Tabel 2. Klasifikasi Derajat Penyakit Asma pada Anak berdasarkan PNAA. 1-3

Frekuensiserangan

Asmaepisodik
jarang
<1x/bulan

Asmaepisodik
sering
1x/bulan

Lamaserangan

<1minggu

>1minggu

Hampirsepanjang
tahun,hampirtidak
adaremisi

Intensitasserangan

Biasanyaringan

Biasanyasedang

Biasanyaberat

Diantaraserangan

Tanpagejala

Seringadagejala

Gejalasiangdan
malam

Tidurdanaktivitas

Tidakterganggu

Seringterganggu

Sangatterganggu

Pemeriksaanfisik
diluarserangan

Normal(tidak
ditemukankelainan)

Mungkinterganggu
(ditemukankelainan)

Tidakpernahnormal

Obatpengendali
antiinflamasi

Tidakperlu

Perlu,steroid

Perlu,steroid

UjifaalParu

PEF/FEV1
>80%

PEF/FEV1
6080%

Variabilitasfaal
paru

Variabilitas>15%

Variabilitas>30%

PEF/FEV1
<60%variabilitas20
30%
Variabilitas>50%

Asmapersisten
Sering

Tabel3.KlasifikasiDerajatSeranganAsma.1,3
Parameter klinis,
fungsi paru,
laboratorium

Ringan

Sedang

Sesak

Berjalan, bayi:
menangis keras

Berbicara,
Bayi: tangis pendek
dan lemah,
kesulitan menyusu
atau makan
Lebih suka duduk

Posisi

Bisa berbaring

Bicara
Kesadaran
Sianosis
Mengi

kalimat
Mungkin irritable
Tidak ada
Sedang, sering
hanya pada akhir
ekspirasi

Penggal kalimat
Biasanya irritable
Tidak ada
Nyaring, sepanjang
ekspirasi nspirasi

Penggunaan otot
bantu respiratorik
Retraksi

Biasanya tidak

Biasanya ya

Tanpa ancaman
henti nafas
Istirahat
Bayi: tidak mau
minum/ makan

Berat
Dengan ancaman
henti nafas

Duduk bertopang
lengan
Kata-kata
Biasanya irritable
Ada
Sangat nyaring,
terdengan tanpa
stetoskop sepanjang
ekspirasi dan
inspirasi
Ya

Dangkal, retraksi
Sedang ditambah
Dalam, ditambah
interkostal
retraksi suprasternal nafas cuping hidung
Frekuensi nafas
Takipnea
Takipnea
Takipnea
Pedoman nilai baku laju napas pada anak sadar:
Usia
frekuensi nafas normal
< 2 bulan
<60 x/ menit
2-12 bulan
<50 x/ menit
1-5 tahun
<40 x/menit
6-8 tahun
<30 x/menit
Frekuensi nadi
Normal
Takikardi
Takikardi
Pedoman nilai baku frekuensi nadi pada anak
Usia
laju nadi normal
2-12 bulan
<160 x/menit
1-2 tahun
<120 x/menit
3-8 tahun
<110 x/ menit
Pulsus paradoksus Tidak ada
Ada
Ada
<10 mmHg
10-20 mmHg
>20 mmHg
PEFR atau FEV1
(% nilai prediksi
terbaik)
Pra-bonkodilator
>60%
40-60%
<40%
Pasca>80 %
60-80%
<60 %, respon < 2
brokodilator
jam
Sa O2
>95%
91-95%
90%
Pa O2
Normal (biasanya >60 mmHg
<60 mmHg
tidak
perlu
diperiksa)
Pa CO2
< 45 mmHg
<45 mmHg
>45 mmHg

Kebingungan
Nyata
Sulit/tidak
terdengar

Gerakan paradox
torako-abdominal
Dangkal/ hilang
Bradipnea

Bradikardi

Tidak ada, tanda


kelelahan otot nafas

Tabel4.KlasifikasiDerajatPenyakitAsmamenurutGINA.1,3

Derajat 1
Intermiten
Derajat 2
Persisten ringan

Derajat 3
Persisten sedang
Derajat 4
Persisten berat

Gejala/hari

Gejala/malam

< 1x/minggu,
asimtomatik dan nilai
PEF normal diantara
serangan
>1 kali perminggu, <
1 kali perhari,
serangan
mengganggu
aktivitas
Sehari sekali,
serangan
mengganggu
aktivitas
Terus menerus
sepanjang hari,
aktivitas fisik
terbatas

2 kali sebulan

PEF atau FEV1


PEF variability
80%
< 20 %

> 2 kali sebulan

80%
20%-30%

>1 kali perminggu

60-80%
>30%

Sering

60%
>30%

2.7PemeriksaanPenunjang
Evaluasi pada fungsi paruparu meurpakan salah satu yang paling penting untuk
diagnosisdanmonitorperkembanganasma.Walaupun,pemeriksaanparunormaltidak
dapat di abaikan dalam diagnosis asma ringan atau episodic jarang. Oleh karena itu
pemeriksaan yang dilakukan bersifat suportif untuk penegakkan diagnosis. Apabila
dilakukan pemeriksaan pada saat anak sedang mengalami gejala maka akan
meningkatkansensitivitaspemeriksaannya.1
Salah satu dari pemeriksaan tersebut adalah spirometri. Spirometri merupakan
rekomendasi untuk menilai volume paru pada anak, karena anak dapat melakukan
pemeriksaaninidengancukupbaik.Biasanyaspirometriinidilakukanpadaanakusia5
7tahun.Hasilpemeriksaanakanbermaknaapabila: FEV1:80%dariyangdiperkirakan,
yang reversivel setelah bronkodilatasi dengan 12%, 200 ml, atau 10% dari yang
diperkirakan.Padaanakdenganusiadibawa5tahun,pemeriksaanfungsiparuparuyangterbaru
sudah digunakan seperti oscillometry atau specific airway resistance, dan pemeriksaan ini
biasanyahanyatersediapadabeberapatempatsaja. 17

Pemeriksaan terhadap airway hyperresponsive dan inflamasi jalan nafas dapat


dilakukan dengan memprovokasi dengan mengunakan inhalan berupa methacholine,
histamine, manitol, salin hipertonik atau udara dingin sudah banyak dilakukan pada
orangdewasauntukmenegakkandiagnosisasma.Penggunaanmetodepadaanaktidak
terlaluakurat,karenadosisinhalantidakdisesuaikandenganbesarnyapasien.Olahraga
jugadapatmenjadisalahsatupemeriksaanpada airwayhyperresponsive,akantetapi
standar dari pemeriksaan ini masih belum jelas untuk anak di setiap usia. Sehingga
metodepemeriksaantersebutlebihbanyakdilakukanuntukpenelitiandaripadauntuk
praktisklinis.6
MenuruthasilpenelitandenganpengukuranFractionalexhalednitricoxide(FENO),
dapat sangat membantu dalam diagnosis. Interpretasi dari FENO dapat mendeteksi
adanyainflamasijalannapasyangdisebabkanoleheosinophil,dansebagaipertimbangan
untukpemberiankortikosteroid,memantauinflamasijalannapassebagaihasildariterapi
kortikosteroid.Akantetapi,FENOmasihtidaktersediapadabanyaknegara.6
Pemeriksaan sputum untuk eosinophil walaupun menjanjikan, namun masih tidak
dapatdigunakan sebagai parameteryang cukupmembantusehingga saatinitidak di
rekomendasikanuntukdiagnosisataupemantauanasmapadaanak.6
Penilaianstatusatopipadaanakharusdievaluasipadasaatmunculsuatukecurigaan
pada anak dengan kemungkinan asma. Mengidentifikasikan alergen spesifik dapat
membantu diagnosis asma, mengetahui faktor pencetusnya dan dapat memberikan
prognosispadaasma.Baikpemeriksaaninvivo(skinpricktest)daninvitro(specificIgE
antibodi)dapatdilakukan,denganpertimbanganpadapelaksanaan,biaya,akurasidan
parameterlainnya.6
2.8DiagnosisBanding
Terdapatbanyakkondisidengangejaladantandayangmiripdenganasma.Selain
asma,penyebabumumlaindarigejalabatukberulangpadaasmameliputirhinosinusitis
dan gastroesophageal reflux (GER). GER merupakan silentdisease pada anak,
sedangkanpadaanakdengansinusitiskroniktidakmemilikigejalayangkhasseperti
dewasa dengan adanya nyeri tekan local pada daerah sinus yangterkena. Selain itu,
kedua penyakit ini merupakan penyakit komorbid yang sering pada asma, sehingga
membuatterapispesifikpadaasmatidakdiberikandengantepat.3,10
Padamasamasaawalkehidupan,batukkronisdanmengidapatterjadipadakeadaan

aspirasi,tracheobronchomalacia,abnormalitasjalannapascongenital,fibrosiskistikdan
displasia bronkopulmoner. Pada anak usia 3 bulan, mengi biasanya ditemukan pada
keadaaninfeksi,malformasiparudankelainanjantungdangastrointestinal.Padabayi
dan batita, bronkiolitis yang disebabkan oleh respiratory syncitial virus merupakan
penyebabmengiyangumum.padaanakyanglebihbesar,mengiberulangdapatterjadi
pada disfungsi pita suara. Selain itu, batuk berulang jug dapat ditemukan pada
tuberculosisterutamapadadaerahdenganpenyebarantinggiTuberculosis.3,10
Gambar5.Alurdiagnosisasmapadaanak.1

Tabel5.Diagnosisbandingasmapadaanak.6

2.9Penatalaksanaan
Gambar6.Perkiraankeparahaneksaserbasiakutasmapadaanak.6

2.9.1Tahapantatalaksanaseranganasma
GINAmembagitatalaksanseranganasmamenjadidua,yaitutatalaksanadirumah
dandiRumahSakit.Tatalksandirumahdilakukanolehpasienatauorangtuanyasendiri
dirumah. Pada panduan pengobatan di rumah, disebutkan bahwa terapi awal adalah
inhalasiagoniskerjacepatsebanyak2kalidenganselangwaktu20menit.Bilabelum
adaperbaikanharussegeramencaripertolonganedokteratausaranakesehatan.
PasienasmayangdatangdalamkeadaanserangankeUnitGawatDarurat(UGD)
langsungdinilaiserangannya.Tatalaksanaawalterhadappasienadalahpemberian 2
agonis kerjacepatdenganpenambahangaramfisiologissecaranebulisasi.Nebulisasi
serupadapatdiulangduakalidenganselangwaktu20menit.Padapemberianketiga,
dapatditambahkanantikolinergik.Tatalaksanaawalinisekaligussebagaipenapis,yaitu
untuk penentuan derajat serangan, karena penilaian derajat secara klinis tidak dapat
selaludilakukandengancepatdanjelas.
2.9.1.1Seranganasmaringan
jikadengansekalinebulisasipasienmenunjukkanresponsyangbaikberartiderajat
serangannyaringan.Pasiendiobservasiselama12jam,jikaresponstersebutbertahan,
pasien dapat dipulangkan. Pasien dibekali obat agonis (hirupan atau oral) yang
diberikantiap46jam.Jikapenyebabserangannyaadalahinfeksivirusdapatdiberikan
steroid oral jangka pendek (35 hari). Pasien kemudian dianjurkan untuk kontrol ke
poliklinik dalam waktu 2448 jam untuk reevaluasi tatalaksana. Apabila sebelum
seranganpasientelahmendapatkanobatpengendali,obattersebutditeruskanhinggare
evaluasidilakukandiklinikrawatjalan.Namun,jikasetelahdiobservasi2jamgejala
timbulkembali,pasienmerupakanasmasedang.
2.9.1.2Seranganasmasedang
Jikadenganpemberiannebulisasiduakalipasienhanyamenunjukkanresponsparsial,
kemungkinanderajatserangannyasedang.Untukitu,derajatseranganharusdinilaiulang
sesuaidenganpedoman.Jikaserangannyamemangtermasukserangansedang,inhalasi
langsung dengan 2agonis dan ipratropium bromide (antikolinergik), pasien perlu
dilakukanobservasidanditanganidiruangrawatsehari(RRS).Padaseranganasmasedag
dapat diberikan kortikosteroid oral metilprednisolon dengan dosis 0,51mg/kgBB/hari
selama35hari.
PadaruangrawatseharipemberianoksigensejakdiUGDdilanjutkan.SetelahUGD

menjalaninebulisasi2kalidalam1jamdenganresponsparsial,diruangrawatdieteruskan
pemberian nebulisasi agonis + antikolinergik bila perlu setiap 2 jam. Kemudian,
diberikan steroid sistemik oral (metilprednisolon, prednisone, atau triamsinolon).
Pemberiankortikosteroiddilanjutkansampai35hari.Jikadalam812jamkeadaanklinis
pasien tetap baik, pasien dapat dipulangkan dan dibekali obat seperti pasien sernagan
ringanyangdibulangkandariklinik/IGD.Biladalam12jamresponsnyatetaptidakbaik,
pasiendialihdirawatkeruangrawatinapdenganindikasiasmaberat.
2.9.1.3Seranganasmaberat
Apabiladengan3kalinebulisasiberturutturutpasientidakmenunjukkanrespons(poor
response),yaitu,gejaladantandaseranganmasihada,pasienharusdirawatdiruangrawat
inap.Bilapasiendiduga/diperkirakanseranganberatmakalangsungdiberikannebulisasi
dengan2agonisdanantikolinergik.Oksigen4L/menitdiberikansejalawaltermasuksaat
nebulisasi.Kemudiandipasangjalurparenteraldandilakukanfototoraks.
Di ruang rawat inap, pemberian oksigen pada pasien tetap diteruskan. Jika pasien
menunjukan adanya dehidrasi dan asidosis, atasi dehidrasi dengan pemberian carian
intravenadanlakukankoreksiterhadapasidosis.Steroidintravenadiberikansecarabolus
tiap68jamdengandosis0,51mg/kgBB/hari.Nebulisasi 2agonis+antikolinergik
denganoksigendilanjutkantiap12jam.Jikadengan46kalipemberianmulaiterjadi
perbaikanklinis,jarakpemberiandapatdiperlebarmenjaditiap46jam.
Aminofilindiberikansecaraintravenadenganketentuan,jikapasienbelummendapat
aminofilinsebelumnya,diberikanaminofilindosis awal (inisial) sebesar68mg/kgBB
dilarutkandalamdekstrosaataugaramfisiologissebanyak20ml,diberikandalam2030
menit.Apabilapasientelahmendapataminofilinsebelumnya(kurangdari4jam),dosis
yang diberikan adalah setengah dosis inisial. Sebaiknya kadar aminofilin dalam darah
diukurdandipertahankansebesar1020g/ml.Setelahempatjampemberianaminofilin
dosisrumatansebesar0,51mg/kgBB/jam.
Apabilasudahadaperbaikanklinis,nebulisasiditeruskansetiap6jam,sampaidengan
24 jam. Steroid dan aminofilin digantin dengan pemberian peroral.jika dalam 24 jam
pasientetapstabil,pasiendapatdipulangkandengandibekaliobatagonisyangdiberikan
46jamselama2448jam.Selainitu,steroidoraldilanjutkanhinggapsienkontrolke
klinikrawatjalandalam2448jamuntukreevaluasitatalaksana.
2.9.1.4Seranganasmasangatberatancamanantinapas.

Bilapasienmenunjukkangejaladantandaanamanhentinapaspasienharuslangsung
dirawatdiruang rawatintensif.Padapasien dneganserangan berat danancamanhenti
napas,fotothoraxharuslangsungdibuatuntukmendeteksikomplikasipneumothoraksdan
atau penumomediastinum. Kriteria pasien yang memerlukan perawatan di ICU adalah
tidakadarespons samasekaliterhadaptatalaksanaawaldiUGDdan/atauoerburukan
serangan asma yang cepat. Adanya penurunan kesadan dan tanda lain ancaman henti
napas.Tidakadanyaperbaikandiruangrawatinap.Hipoksemiatetapterjadiwalaupun
sudahdiberoksigen(kadarPaO2<60mmHgdan/atauPaCO2>45mmHg.
Pasiendenganindikasipemakaianventilatoradalahadanyapulsus paradoksus yang
cepatmeningkat,penurunanpulsusparadoksuspadapasienyangkelelahan,perburukan
statusmental,aritmiajantungatauhentijantung,hentinapas,tidakbisabicara,asidosis
laktatyangtidakbisamembaik,diaphoresispadaposisiberbaring,silientchestwalaupun
sudahterjadiusahanapasyanghebat.Indikasirelatifuntukpemasanganventilatoradalah
hipoksemia (PaO2 <60mgHg) tidak membaik dengan oksigen 100%, serta PaCO2
>60mgHgdanmeningkatlebihdari5mmHg/jam.
2.9.2Tatalaksanajangkapanjangasmapadaanak
2.9.2.1AsmaEpisodikJarang
Asmaepisodikjarangcukupdiobatidenganbronkodilatorbetaagonishirupankerja
pendekbilaperlusaja,yaitujikaadagejala/serangan.Pemakaianobatinhalan(metered
doseinhaler)memerlukanpelatihanyangbenar(untukanakbesar),danmembutuhkan
alatbantu(untukanakkecil/bayi).Bilaobathirupantidakada/tidakdapatdigunakan,
maka agonisdiberikanperoral.Penggunaanteofilinsebagaibronkodilatorsemakin
kurangberperandalamtatalaksanaasmakarenabatas keamanannyasempit.Namun
mengingatdiIndonesiaobat agonisoralpuntidakselaluadamakadapatdigunakan
teofilindenganmemperhatikankemungkinantimbulnyaefeksamping.Disampingitu
penggunaan agonis oral tunggal dengan dosis besar seringkali menimbulkan efek
samping berupa palpitasi, dan hal ini dapat dikurangi dengan mengurangi dosisnya
sertadikombinasikandenganteofilin.1,5
Konsensus Internasional III dan juga pedoman Nasional Asma Anak tidak
menganjurkan pemberian anti inflamasi sebagai obat pengendali untuk asma episodik
ringan. Hal ini juga sesuai dengan GINA yang belum perlu memberikan obat untuk

mengontrol pada Asma Intermiten, dan baru memberikannya pada Asma Persisten
Ringan (derajat 2 dari 4) berupa anti-inflamasi yaitu steroid inhalan dosis rendah, atau
kromoglikat inhalan. Jika dengan pemakaian 2-agonis inhalan lebih dari 3x/minggu
(tanpa menghitung penggunaan pra-aktivitas fisik) atau serangn sedang/berat muncul
>1x/bulan atau pengobatan yang diberikan sudah adekuat dalam waktu 4-6 minggu,
namun tidak menunjukkan respon yang baik maka tatalaksananya berpindah ke asma
episodik sering.1,3
2.9.2.2 Asma Episodik Sering
Jika penggunaan 2-agonis hirupan sudah lebih dari 3x perminggu (tanpa
menghitung penggunaan praaktivitas fisis) atau serangan sedang/berat terjadi lebih dari
sekali dalam sebulan, maka penggunaan anti-inflamasi sebagai pengendali sudah
terindikasi.Tahap pertama obat pengendali pada asma episodic sering adalah pemberian
steroid hirupan dosis rendah. Obat steroid hirupan yang sudah sering digunakan pada
anak adalah budesonid, sehingga digunakan sebagai standar. Dosis rendah steroid
hirupan adalah setara dengan 100-200 g/hari budesonid (50-100 u/hari flutikason)
untuk anak berusia kurang dari 12 tahun, dan 200-400 g/hari budesonid (100-200
g/hari flutikason) untuk anak berusia di atas 12 tahun. Dalam penggunaan
beklometason atau budesonid dengan dosis 100-200 g/hari, atau setara flutikason 50100 g belum pernah dilaporkan adanya efek samping jangka panjang. 1,3
Sesuai dengan mekanisme dasar asma yaitu inflamasi kronik, obat pengendali
berupa anti-inflamasi membutuhkan waktu untuk menimbulkan efek terapi. Oleh
karena itu penilaian efek terapi dilakukan setelah 6-8 minggu, yaitu waktu yang
diperlukan untuk mengendalikan inflamasinya. Jika setelah pengobatan selama 6-8
minggu dengan steroid hirupan dosis rendah tidak menunjukkan respons (masih
terdapat gejala asma atau atau gangguan tidur atau aktivitas sehari-hari), maka
dilanjutkan dengan tahap kedua yaitu menaikkan dosis steroid hirupan sampai dengan
400 ug/hari yang termasuk dalam tatalaksana Asma Persisten. 1,3
Jika tatalaksana dalam suatu derajat penyakit asma sudah adekuat namun responsnya
tetap tidak baik dalam 6-8 minggu, maka derajat tatalaksanya berpindah ke yang lebih
berat (step-up). Sebaliknya jika asmanya terkendali dalam 6-8 minggu, maka derajatnya
beralih ke yang lebih ringan (step-down). Bila memungkinkan steroid hirupan
dihentikan penggunaannya.1,3

Sebelum melakukan step-up, perlu dievaluasi pelaksanaan penghindaran pencetus,


cara penggunaan obat, faktor komorbid yang mempersulit pengendalian asma seperti
rintis dan sinusitis.dan dengan penatalaksanaan rinitis dan sinusitis secara optimal dapat
memperbaiki asma yang terjadi secara bersamaan.
2.9.2.3 Asma persisten
Pada penatalaksanaan asma persisten terdapat dua alternative yaitu dengan
menggunakan steroid hirupan dosis medium dengan memberikan budenoside 200-400
g/hari budesonid (100-200 g/hari flutikason) untuk anak berusia kurang dari 12
tahun, 400-600 g/hari budesonid (200-300 g/hari flutikason) untuk anak berusia di
atas 12 tahun. Selain itu, dapat digunakan alternatif pengganti dengan menggunakan
steroid hirupan dosis rendah ditambah dengan LABA (Long Acting -2 Agonist) atau
ditambahkan Theophylline Slow Release (TSR) atau ditambahkan Anti-Leukotriane
Receptor (ALTR.).1,3
Apabila dengan pengobatan tersebut selama 6-8 minggu tetap terdapat gejala asma,
maka dapat diberikan alternatif lapis ketiga yaitu dapat meningkatkan dosis
kortikosteroid sampai dengan dosis tinggi pada pemberian >400 g/hari budesonid
(>200 g/hari flutikason) untuk anak berusia kurang dari 12 tahun, dan >600 g/hari
budesonid (>300 g/hari flutikason) untuk anak berusia di atas 12 tahun atau tetap dosis
medium ditambahkan dengan LABA, atau TSR, atau ALTR. Penambahan LABA pada
steroid hirupan telah banyak dibuktikan keberhasilannya yaitu dapat memperbaiki
FEVI, menurunkan gejala asmanya, dan memperbaiki kualitas hidupnya.1,3,10
Apabila dosis steroid hirupan sudah mencapai >800 g/hari namun tetap tidak
mempunyai respons, maka baru digunakan steroid oral (sistemik). Jadi penggunaan
kortikosteroid oral sebagai controller (pengendali) adalah jalan terakhir setelah
penggunaan steroid hirupan atau alternatif di atas telah dijalankan. Langkah ini diambil
hanya bila bahaya dari asmanya lebih besar daripada bahaya efek samping obat. Untuk
steroid oral sebagai dosis awal dapat diberikan 1-2 mg/kgBB/hari. Dosis kemudian
diturunkan sampai dosis terkecil yang diberikan selang hari pada pagi hari. Penggunaan
steroid secara sistemik harus berhati-hati karena mempunyai efek samping yang cukup
berat.3
Pada pemberian antileukotrien (zafirlukas) pernah dilaporkan adanya peningkatan
enzim hati, oleh sebab itu kelainan hati merupakan kontraindikasi. Mengenai
pemantauan uji fungsi hati pada pemberian antileukotrien belum ada rekomendasi. 3

Mengenai obat antihistamin generasi baru non-sedatif (misalnya ketotifen dan


setirizin), penggunaannya dapat dipertimbangkan pada anak dengan asma tipe rinitis,
hanya untuk menanggulangi rinitisnya. Pada saat ini penggunaan kototifen sebagai obat
pengendali (controller) pada asma anak tidak lagi digunakan karena tidak mempunyai
manfaat yang berarti.3
Apabila dengan pemberian steroid hirupan dicapai fungsi paru yang optimal atau
perbaikan klinis yang mantap selama 6-8 minggu, maka dosis steroid dapat dikurangi
bertahap hingga dicapai dosis terkecil yang masih bisa mengendalikan asmanya.
Sementara itu penggunaan -agonis sebagai obat pereda tetap diteruskan. 3
Cara pemberian obat asma harus disesuaikan dengan umur anak karena perbedaan
kemampuan menggunanakan alat inhalasi. Demikian juga kemauan anak perlu
dipertimbangkan. Lebih dari 50% anak asma tidak dapat memakai alat hirupan biasa
(Metered Dose Inhaler). Perlu dilakukan pelatihan yang benar dan berulang kali.
Berikut tabel anjuran pemakaian alat inhalasi disesuakan dengan usia. 1,3
Tabel 5. Tatalaksana asma jangka panjang.3
Derajat asma
Persisten berat

Pengendali (controller)
Terapi harian:

Pereda (reliever)
Bronkodilator kerja cepat:

Anti inflamasi: kortikosteroid inhalasi (dosis tinggi)

dan bronkodilator kerja panjang 2-agonis

Intensitas terapi tergantung

inhalasi/tablet kerja panjang, teofilin sustained

pada seringnya eksaserbasi

-agonis agonis inhalasi

release atau kortikosteroid/prednisone


2mg/kgBB/hari (max 60mg perhari)
Anti inflamasi: kortikosteroid inhalasi (dosis rendah
Persisten sedang

Episodik ringan

atau dosis tinggi)


Terapi harian:

Bronkodilator kerja cepat:

Anti inflamasi: salah satu dari kortikosteroid

inhalasi (dosis rendah) atau cromolyn atau

mengatasi gejala.

endokromil (anak-anak biasanya dimuali dari

Meski demikian, penggunaan

kromolin atau nedokromil).

2-agonis lebih dari 3-4 kali

Dan jika diperlukan: bronkodilator jangka panjang :

perhari atau penggunaan

salah satu dari 2-agonis inhalasi atau tablet kerja

teratur setiap hari

panjang. Teofilin sustained release atau leukotriene

mengindikasikan perlunya

receptor antagonist (LRA)


Tidak diperlukan terapi harian

pengobatan tambahan.
Bronkodilator kerja cepat:

-agonis inhalasi untuk

-agonis inhalasi untuk

mengatasi gejala.
Intensitas terapi tergantung
pada seringnya eksaserbasi

-agonis inhalasi , cromolyn

sebelum olahraga

2.9.3 Non-medika mentosa


Yang paling penting pada penatalaksanaan asma adalah edukasi pada penderita
maupun orangtuanya mengenai penyakit, pilihan pengobatan, identifikasi dan
penghindaranallergen,perngertiantentangkegunaanobatyangdipakai,ketaatandan
pemantauan,danyangpalingutamaadalahmenguasaicarapenggunaanobathirupan.
Edukasimengenal5Ryangpentinguntukdiketahui:
Reachagreementongoals
Sepakati tujuan penatalaksanaan: tailored treatment yang sederhana, membuat
prioritas,bertindaksegeramengatasikekambuhan.Buatrencanapenatalaksanaandi
manarencanatatalaksanahariandapatberupadiarycardyangmemberikanpanduan
padaanakmengenaipemantauandenganPFM(PeakFlowMeter),penggunaanobat,
dan laporan gejala. Rencana tindakan kegawatan (emergency action plan) dapat
membantumengenaliseranganakutdanmemberipetunjuktindakanapaynagharus
dilakukan. Semua rencana ini harus dibuat dan dibicarakan saat pertemuan awal

dengananakdanorangtuanya,dandiberikansecaratertulis.
Rehearseasthmamanagementskills
Latih keterampilan pengelolaan asma: penggunaan obatobatan, memantau gejala,
PFR,dan membuat keputusan. Pastikan pasien menguasai teknik penggunaan alat

inhalasiyangbenar.
Repeatmessages
Ulangpesanyangpentingbeberapakaligunamenigkatkanpengertianpenderitadan

keluarganya.
Reinforceappropriatebehavior
Memuji penatalaksanaan yang benar, memberi hadiah kecil, atau dengan
menghubungidanmendiskusikanperkembanganpenyakitnya.Sertakanorangyang

pentingbagianakuntukmemberikandukungan.
Reviewresults
Tinjau kembali penatalaksanaannya guna menilai tercapainya tujuan
penatalaksanaan.11

2.10 Preparat Terapi


2.10.1 Beta adrenergic kerja pendek (short acting)
Golongan obat ini terdiri dari epinefrin/adrenalin dan b2 agonis selektif.

Epinefrin/adrenalin
Digunakan jika tidak terdapat obat b2-agonis selektif. Epinefrin terutama diberikan
jika ada reaksi anafilaksis atau angioudem. Obat ini dapat diberikan secara subkutan
atau dengan inhalasi aerosol. Pemberian subkutan adalah sebagai berikut: larutan
epinefrin 1:1000 (1mg/ml) dengan dosis 0,01 ml/kgbb (maksimum 0,3 ml), dapat
diberikan 3 kali dengan selang waktu 20 menit. 1-3

2-agonis selektif
Obat yang sering dipakai adalah salbutamol, terbutalin, fenoterol. Dosis salbutamol
oral adalah 0,1-0,15 mg/kgBB/kali diberikan setiap 6 jam, dosis terbutalin oral adalah
0,05-0,1 mg/kgBB/kali diberikan setiap 6 jam. Pemberian secara peroral akan
memberikan efek bronkodilatasi setelah 30 menit, efek puncak dalam 2-4 jam dan
lama kerjanya adalah 5 jam. 1-3
Pemberian secara non-invasive (inhalasi) lebih disukai daripada pemebrian
subkutan/intravena karena dapat mengurangi rasa nyeri dan kegelisahan pasien. Untuk
serangan ringan dapat diberikan metered dosed inhaler (MDI) 2-4 semprotan tiap 3-4
jam, serangan sedang diberikan 6-10 semprotan tiap 1-2 jam sedangkan serangan
berat diberikan 10 semprotan. Pemberian MDI lebih dari 6 semprotan harus dibawah
pengawasan dokter. 1-3
Salbutamol dapat diberikan dengan nebulizer dengan dosis 0,1-0,15 mg/kgBB
(dosis maksimum 5 mg/kali), dengan interval 20 menit atau nebulisasi secara kontiniu
dengan dosis 0,3-0,5 mg/kgBB/jam (dosis maksimum 15 mg/jam). Nebulisasi
terbutalin dapat diberikan dengan dosis 2,5 mg atau 1 respules/nebulisasi. 1-3
Pemberian intravena dapat dipertimbangkan jika pasien tidak berespon dengan
nebulisasi 2-agonis, kortikosteroid IV, dan teofilin serta ipratropium bromide.
Salbutamol iv dapat diberikan dengan dosis mulai dari 0,2 mcg/kgBB/menit dan
dinaikkan 0,1mcg/kgBB setiap 15 menit dengan dosis maksimal 4mcg/kgBB/menit.
Terbutalin IV dapat diberikan dengan dosis 10mcg/kgBB melalui infuse selama 10
menit, dilanjutkan dengan 0,1-4 g/kgBB/jam dengan infuse kontiniu. 1-3

2.10.2 Methyl xanthine (teofilin kerja cepat)


Untuk memperoleh fungsi paru yang baik, diperlukan konsentras aminofilin dalam
darah antara 5-15 g/mldanefeksampingyangdapatterjadiapabilakadaraminofilin
dalam darah berada diatas 20 gg. Pemberian aminofilin intravena pada serangan
berat/statusasmatikusdipertimbangkan.Biladenganobatobatstandardiatasbelumada

perbaikan, berikan loading dose 45 mg/kgBB, diencerkan dengan NaCl 0,9% dan
diberikanperlahanlahandalamwaktu10menit,dilanjutkandengandosisrumatan0,7
0,9mg/kgBB/jamatau56mg/kgBB/8jam.Efeksampingyangseringdijumpaiadalah
iritasi lambung, insomnia, palpitasi dan pada dosis yang berlebihan dapat terjadi
konvulsi. 1-3
2.10.2 LABA (long acting 2-agonis)
Ada 2 preparat inhalasi yaitu salmeterol dan formoterol, dan 1 obat oral yaitu
procaterol. Tersedia kombinasi steroid hirupan dengan LABA, yaitu kombinasi
fluticasone propionate dan salmeterol menjadi seretide, kombinasi budesonide dan
formoterol menjadi Symbicort. Seretide dalam MDI (Metered Dosed Inhaler) sedangkan
Symbicort dalam DPI(Dry Powder Inhaler). 1-3
2.10.3 Antikolinergik
Ipratropium bromide
Dosis yang dianjurkan adalah 0,1 ml/kgBB, nebulisasi setiap 4 jam. Dapat juga
diberikan dalam larutan 0,025% dengan dosis sebagai berikut: untuk anak usia>6 tahun:
8-20 tetes; usia < 6 tahun: 4-10 tetes. Efek sampingnya adalah kekeringan minimal atau
rasa tidak enak di mulut (dosis oral 0,6-8mg/kgBB pada orang dewasa) secara umum
tidak ada efek samping yang berarti.1-3
2.10.4 Kortikosteroid
Preparat oral yang dipakai adalah prednisone, prednisolon atau triamsinolon dengan
dosis 1-2 mg/kgBB/hari diberikan 2-3 kali sehari selama 3-5 hari. Kortikosteroid IV
diberikan pada kasus asma yang dirawat di rumah sakit. Metilprednisolon merupakan
pilihan yang utama karena memiliki kemampuan penetrasi ke jaringan paru yang lebih
baik, efek antiinflamasi yang lebih besar, serta efek mineralokortikoid minimal. Dosis
yang dianjurkan adalah 1 mg/kgBB, diberikan tiap 4-6 jam. Deksametason diberikan
secara bolus intravena, dengan dosis 0,5-1 mg/kgBB, dilanjutkan 1 mg/kgBB/hari ,
diberikan setiap 6-8 jam. 1-3
2.10.5 Antileukotrien (Leukotriene receptor antagonist, LRA)

Montelukast
Preparat ini belum ada di Indonesia dan harganya mahal. Obat ini dapat diberikan
sejak usia 2 tahun. Dosis peroral hanya 1 kali sehari sehingga memudahkan

penggunaan dan meningkatkan ketaatan pemakaian obat.


Zafirlukast

Preparat ini terdapat di Indonesia (Accolate, Astra Zeneca), digunakan untuk anak > 7
tahun.bekerja dengan menekan produksi cystenil leukotriene yang setara dengan
montelucast. Sayangnya obat ini dapat mengganggu fungsi hati (meningkatkan
tranaminase), sehingga pada bulan-bulan pertama penggunaannya diperlukan
pemeantauan terhadap fusngsi hati. Dosis dibagi menjadi 2 kali dalam sehari,
2.11

diberikan saat perut kosong. 1-3


Komplikasi
Kebanyakaneksaserbasiasmadapatditanganidirumah.Denganadanyaasmaakut,
komplikasi kebanyakan sekitar hipoxemia dan asidosis dan dapat juga seizure
generalisata.Status asmatikus adalaheksaserbasiakutasmayangtidakmenunjukkan
respon adekuat terhadap terapi dan mungkin memerlukan perawatan di rumah sakit.
Eksaserbasidapatberlangsungdalambeberapaharidandalamtingkatanringanhingga
membahayakannyawa.Statusasmatikusdapatmenyebabkanpneumomediastinumatau
pneumothorax.Asmaanakyangtergantungkortikosteroiddapatmenyebabkanhambatan
pertumbuhannamuntinggimaksimumsaatdewasanampaknyatidakdipengaruhi.3,8

2.12

Pencegahan
Pengendalian lingkungan sejak dalam kandungan dan juga setelah lahir serta
pemberianASIminimal4bulansangatdianjurkan.Pengendalianlingkunganterutama
dilakukan bagi asma balita yang diduga akibat alergi, yaitu dengan penghindaran
terhadapasaprokok,tidakmemeliharabinatangberbuludirumah,perbaikanventilasi
ruangandanpenghindarankelembapankamar.5
Selainitu,diperlukanjugapendidikandankemitraandalampenanggulanganasma
terhadappasiendankeluarganyasertatenagakesehatan.Edukasiyangberhasilmeliputi
edukasimengenaidasardariasma,perananterapi,danmeningkatkanpengetahuanpasien
akan cara penggunaan alat spacer untuk metered doseinhaler dan PFM.Monitoring
PFMbergunauntukanakusia>5tahun,dimananomortertingginyaadalahPFR.Ujiini
dilakukan3kaligunamemperolehhasilyangterbaik.NilaiPFRterbaikadalahnilai
stabil yang diperoleh dalam waktu 2 minggu, di mana berdasarkan nilai tsb akan
ditentukanrencanatertulisyangdibagimenjadi3zona:
o Zona hijau: PFR 80%100%. Anak asimtomatik dan harus melanjutkan
pengobatannyasepertibiasa.
o Zonakuning:PFR50%80%.Anakmemilikigejalaasma.Tambahkanterapi
resusitasisepertialbuteroldanhubungitenagamedisbilaPEFRtidakkembali

kezonahijaudalam2448jamataujikagejalaasma
o Zonamerah:PFRdibawah50%danmerupakansuatukedaruratan.Medikasi
darurat perlu dilaksanakan segera dan apabila PEFR tetap di zona merah
berartianakmemilikigangguanjalannafasyangsignifikan.Hubungitenaga
medis.3
Tindakan dini pada asma anak berdasarkan pendapat bahwa keterlambatan
penghindaranpencetusdanpemberianobatpengendaliakanberakibatperubahanjalan
nafasyangireversibel(airwayremodeling).3,5
Pesankunciuntukkeluargadengananakyangasmaadalahbahwaanaktersebutharus
dibawamengunjungitenagamedisbukanhanyaketikaterlihatsakitnamunjugasaat
kondisinyasedangsehat.Kunjunganregularakanmempermudahtenagamedis untuk
meninjau ulang tingkat kepentingan dari pengobatan guna menentukan penyesuaian
pengobatan.3,5
2.13

Prognosis
Bagibeberapaanak,gejalamengidenganinfeksipernafaasanakanmenghilangsaat
mencapai usia prasekolah, sementara anak lainnya memiliki gejala asma yang lebih
persisten.Anakdenganasmaepisodikyangjarangakanberhentimengipadaawalmasa
dewasa,hanya20%darimerekadenganepisodeasmayangseringdankurangdari5%
darimerekadenganasmapersistenakanbebasmengipadasaatdewasa.Namun,dengan
terapiyangbenardanbaik,asmadapatdikendalikan. Faktorprediktoradanyamengi
yangberlanjuthinggapersistenadalahadanyaatopi.Indikatorprognostikuntukanak
usiakurangdari3tahunyangberesikoasmaadalahadanyaeksema,asmapadaorangtua,
atauduadari:rhinitisalergi,mengidengandemam,ataueosinofilia>4%.3,8

BAB III
PENUTUP
3.1Kesimpulan
Asma adalah suatu gangguan inflamasi kronis saluran nafas dengan banyak sel
berperan, khususnya sel mast, eosinofil, dan limfosit T. Batuk dan/atau mengi yang
berulang (episodik), nokturnal, musiman, setelah melakukan aktivitas, dan adanya
riwayat atopi pada penderita maupun keluarganya merupakan gejala atau tanda yang
patut diduga suatu asma. Gejala tersebut timbul karena adanya proses inflamasi kronis
pada saluran nafas yang menyebabkan adanya bronkonstriksi, edema mukosa saluran
nafas, hipersekresi bronkus dan proses remodeling pada mukosa. Seluruh proses tersebut
menimbulkan ketidak padupadanan antara ventilasi dan perfusi.
Asma dapat diklasifikasikan berdasarkan gejala dan serangan menjadi asma dengan
gejala intermiten, persisten ringan, sedang dan berat. Berdasarkan derajat serangannya
yaitu asma serangan ringan, sedang, berat dan sangat berat. Derajat penyakit asma
berhubungan dengan inflamsi kronik yang terjadi. Derajat serangan berhungan dengan
proses akut perburukan dari penyakit asma itu sendiri.
Penilaian derajat serangan dan penyakit asma penting untuk penatalaksaan asma.
Dengan pentalaksanaan yang adekuat diharapkan dapat memperbaiki tumbuh kembang
dan kualitas hidup anak. Selain terapi dengan obat-obatan standar untuk asma,
diperlukan peran aktif keluarga dan pasien untuk menghindari factor pencetus. Yang
tidak kalah pentingnya dalam penatalaksanaan asma ialah kerjasama antara pasienkeluarga dan dokter.

DAFTAR PUSTAKA
1. Rahajoe N, Supriyatno B, Setyanto DB. Buku ajar respirologi anak. Edisi
pertama. Jakarta: ikatan dokter anak Indonesia; 2012. 71- 158.
2. Supriyanto, B. Diagnosis dan penatalaksanaan terkini asma pada anak.
Majalah Kedokteran Indonesia, Volume: 55, Nomor: 3, Maret 2005. FKUI
3. Marcdante KJ, Kliegman RM, Jenson HB, Behrhman RE. Nelson ilmu
kesehatan anak esensial edisi 15. Jakarta: EGC; 2012 (1). 775-9
4. Akib AAP, Munasir Z, Kurniati N. Buku ajar alergi imunologi anak. edisi
kedua. Jakarta: ikatan dokter anak Indonesia;2008.h. 252-66
5. Pedoman Pengendalian Penyakit Asma. Dapertemen Kesehatan RI. 2009.
6. Papadopoulos NG, Arakawa H, Carlsen KH, Custovic A, Gern J, etc.
International consensus on (ICON) pediatric asthma. Athens: European
JournalofAllergyandclinicalimmunology.Published30may2012.P.976
77.
7. Konsensus Nasional asma anak. Jakarta: Pulmonologi Ikatan dokter anak
Indonesia. 2000 (2):1. H. 50-66
8. HayWW,LevinMJ,SondheimerJM,DeterdingRR,editor.Currentdiagnosis
&treatmentinpediatrics.18th ed.US:TheMCGrawHillcompanies;2007.
P.5068,5213,104950.
9. Childhood astma control test. Published: December 2014.Acsesced: 4
september2015.Source:www.asthma.com
10. HendartoA,TrihonoP,OswariH,GunardiH.Stateofart:commonproblems
inhospitalizedchildren.Jakarta:IkatandokteranakIndonesiacabangDKI
Jakarta;2011.329.
11. Sidhartani M. Peran penatalaksanaan asma pada anak. Disampaikan pada
UpacaPenerimaanJabatanGuruBesarIlmuKesehatanAnakFKUniversitas
Diponegoro,Semarang,28Juli2007.H.128,245

Beri Nilai