Anda di halaman 1dari 3

LauwTjunNji(/)

Beranda(/)

(http://www.linkedin.com/p
contactme: (mailto:lauw_tjunnji@yahoo.co

Engineering(/engineering.html)

Standar(/standar.html)

Brosur(/brosur.html)

Sipil&Konstruksi(/sipilkonstruksi.html)
Jokes(/jokes.html)

ManajemenProyek(/manajemenproyek.html)

AboutMe(/aboutme.html)

PermukaanTerkelupas
Salahsatupemeriksaan
sederhanamenentukanwaktu
mulainyaprosestrowelling:
jikapermukaanbetonmasih
dapatdigosokdenganibujari
dantertutupdenganbaik
tanpamelembabkan
permukaandenganair,maka
prosestrowellingsebaiknya
ditundadulu
Pengecekansederhanajika
permukaansudahterlihat
kering/kerasdansiapuntuk
difinish:
tempatkandrumkosongatau
emberberisiairdipermukaan
beton,
diamkanselama5menit,
laludiangkat
jikamasihadaair
naik/bleeding
dibawahdrumatauember
setelahdiangkat,maka
prosesbleedingdan
pelepasanudarabelum
selesai

(Delamination)
Delaminationadalahterkelupasnyalapisantipispermukaan(sampaisekitar5mm)daristrukturplat
beton.
Delaminationbisaterdeteksijikaterdengarsuaraakibatcelahyangmunculpadapemisahanlapis
tipispermukaandanbadanstrukturplatbetonjikadilewati(orang,kendaraan)ataudiketuk.

FaktorPenyebabDelaminationdanPencegahannya
Dibagianiniakandibahasbeberapapenyebabterjadinyapengelupasanpermukaan(delamination)
padaplatbeton.
Selainmengetahuisebabdanmenghindarinyauntukmencegahterjadinyadelamination,perlu
diperhatikanpulateknikpelaksanaanpembentukanpermukaandanfinishingdengantrowellingyang
baikuntukmendapathasiloptimal.

Finishing(Trowelling)TerlaluAwal/Cepat
Prosesfinishingpermukaandenganmenggosokdanmemadatkanatautrowelling(manualmaupun
mekanis)padapermukaanbeton(baikdenganmaterialtambahanatautidak),ditujukanuntuk
membentuklapispermukaanyanglebihpadatdankuatdengandemikianmengurangi
permeabilitaslapisanpermukaanbeton.
Jikaprosesinidilakukanpadasaatbetonmasihdalamkondisiplastis,dimanakelebihanairdan
udarabelumsepenuhnyanaikkepermukaanbeton(yangterjadiselamakondisibetonmasihdalam
faseplastis),makalapisfinishingyangterbentukakanmenghalangijalurkeluarairdanudara,
sehinggaakanterjebakdibawahlapisantipispermukaan.
Kelebihanairdanudarayangterjebakakanmencarijalursecarahorisontalkarenatidakdapat
menembuslapispermukaanyangsudahdipadatkandengantrowel,sehinggamemisahkanlapis
finishingpermukaandenganbadanstrukturbeton.
Jikaterjadibleedingyangberlebihandaribetonselamafaseplastisdanfinishingsudahdilakukan,
haliniakanmemperparahpotensidanakibatdelaminationyangakanmenjadisemakinluas(tentang
bleedingakandiuraikantersendiri).
Olehkarenaituuntukmenghindaridelamination,diperlukanpemahamandankemampuan
pelaksanafinishingdalammelihatkapanprosesfinishingbisadimulai,denganmengenali
berakhirnyafaseplastisdandimulainyafasehardening.
Awalpelaksanaanfinishingpermukaanbetonyangideal:
segerasetelahinitialsettingterjadi
padasaatbetonmasuktahaphardening,dan
diselesaikansebelumwaktufinalsettingtercapai

ProsesFinishing(Trowelling)YangTerlambat
Prosesfinishingyangterlambatdankemudianpelaksanafinishingmemberikanlapisanpastasemenataumenabursemendan
menambahkanair,setelahbetonyangdifinishmengalamifinalsetting,jugadapatmengakibatkandelaminationkarenapastasemen
akanmembentuklapiskeraktipisyanglemahkarenatidakmenyatudenganplatbetonyangdifinish.

Jikaterjadiketerlambatanfinishing,makaperapihanpermukaanbetonharusdilakukandenganmaterialkhususfinishingatau
repairpermukaanbetonyangmempunyaidayalekatbaikdipermukaanbetonyangsudahmengeras.

KehilanganKelembabanPermukaanyangTerlaluCepat
Delaminasijugaberpotensiterjadijikaterjadikehilangankelembabanpermukaanyangterlalucepat,yangmengakibatkanpermukaan
betonyangdikerjakannampaksepertisudahsiapuntukdifinish,padahaldibagiandalamnyabetonmasihdalamkondisiplastisyang
mengakibatkanpelaksanafinishingmengirabahwabetonsudahsiapuntukdifinishataudigosok/ditrowel.
Kondisiiniakandiperparahjikalapisandasarplatbetondilapisplastikatauwaterproofingatauvaporbarrier,yangmemaksa
seluruhkelebihanairdanudarauntukmencarijalankeluarmelaluipermukaanbeton.
Untukituperludihindaripelaksanaanpengecoranpadacuacayangdapatmengakibatkankehilangankelembabanpermukaan
yangterlalucepat,ataumemberikanpengkondisianlingkunganpengecoransupayatidakterjadikehilangankelembaban
permukaanyangterlalucepat.

PemberianLapisVaporBarrier
Jikadibawahplatbetonyangdikerjakandipasangvapor
barrier,makaseluruhkelebihanairdanudarayangada
dalamadukanbetonsegarakandipaksauntukhanya
mempunyaijalurkepermukaanbeton,sehinggaproses
bleedingdanpelepasangelembungudaradaribeton
segarmenjadilebihlambat.
Jikakondisivaporbarrierdiperlukanataudisyaratkan
untukdipasang,makaperlusangatdiperhatikanwaktu
mulaidanpelaksanaanfinishingtrowellingyaitu
menunggusetelahseluruhprosesbleedingdan
naiknyaudaradalambetonselesaisepenuhnya.

Pastikanproses
bleedingdannaiknyagelembungudara
dalambetonsegar
sudahselesaisepenuhnya
sebelummemulaiprosesfinishingpermukaanbeton

Pembentukanpermukaanharusdilakukandenganbaikselamabeton
masihdalamkondisiplastistermasukmemastikantidakadalubang
yangharusditutupdenganmenambahbetonataumortarsetelah
initialsettingterjadi

PenambahanRetarderatauFlyAsh
Penambahanbahanpozolanic,misalretarderatauflyashdalam
campuranbetonsegar,berpotensimemperlambatprosesbleedingdan
naiknyaudaradalamadukanbetonsegar,danjugamembuat
permukaanbetoncenderunglebihlengket.
Penambahanbahantersebutjugamembuatwaktuinitialsettingtertunda,
yangpadaumumnyatidakdapatdiperkirakandenganpastikarena
variabelyangmempengaruhiinitialsettingpadapenambahanbahanfly
ashmembuattidakseragamnyawaktusettingpadabagianbagian
beton.
Olehkarenaitusebaiknyadihindaripemakaianflyashpadabetonyang
difinishpermukaannyadengansistemtrowelling
Jikaflyashdiperlukanuntukmemperolehbetondengankarakteristik
tertentu(ketahananabrasi,sulfat,kekedapanyanglebihbaik,dsb)maka
pastikanseluruhprosesbleedingdannaiknyaudaradalambeton

PengecoranTidakSeragamDalam
SatuBidang
Potensiterjadinyadelaminationdapatpuladisebabkan
pengecoranyangtidakseragamdalamsatubidang,
yangdisebabkanolehtidakkontinuatau
berkelanjutannyapengecoransebagaiakibatpengaturan
intervalpengirimanbeton.
Apabilapelaksanafinishingtidakmemperhatikan
perbedaanwaktusettingdalamsatubidangplatbeton
yangdikerjakan,makaakanberpotensiterjadi
delaminationpadabagianyanglebihbarupenempatan
betonsegarnya.
Jikaterpaksaterjadimasalahdalamintervalpengiriman
betonyangmengakibatkandiskontinuitaspengecoran,
makausahakanpenyambunganpengecorandalam
satugarislurus,yangjikaterpaksaakandapat
ditambahkancontractionjointdanpelaksanafinishing
harusdiberiinformasimengenaihalini,supayadapat
mengaturdimulainyafinishingpadasegmenbeton
yangberbedacukuplamawaktusettingnya

segarselesaisepenuhnyasebelummemulaifinishingpermukaan
dengantrowelling.

PemadatanYangTerlaluSingkatataupun
Berlebihan
Jikapemadatanterlalusingkat,makaprosesnaiknyagelembungudara
dalamadukanbetonsegarmenjaditerhambat,sehinggaketikabeton
dalamprosessetting,masihterdapatgelembungudarayang
terperangkap.
Dalamprosesfinisingyangmemadatkanpermukaanbeton,terjadi
tekananyangakanmembuatudarayangmasihterperangkapakannaik
danmembentuklapisandibawahlapistipisfinishingpermukaan
danmenimbulkandelaminasi.
Jikaterjadipemadatanyangberlebihan,makaterjadisegregasiyaitu
agregathalusdanpastasemenakannaikdanmembentuklapisanyang
terpisahdenganlapisdibawahnya.
Kondisiiniakanmembuatprosessettingplatbetonakanberbedaantara
bagianatasdanbawah,yangakanmengakibatkanpotensiterjadinya
delamination.

Perludiperhatikandandiaturarahdanurutan
(sequence)pengecoransupayaprosesfinishingdapat

Untukituperludiperhatikanpemadatanbetonsegar/vibration
janganterlalusingkatatauberlebihan.

mengikutialuryangteraturpula

Janganmenggunakan
bahanpembentuk

PerbaikanPermukaanBetonYangTerkelupas

gelembungudarauntuk

Perbaikanpermukaanbetonyangterkelupasdapat
dilakukandenganmaterialkhususuntukrepair

platlantaiyangdifinish
dengantrowelling

permukaanbeton,namunjikaareayangterkelupas

Karat/korosipadatulanganjugamemicu
delaminationperhatikanselimutbeton
minimumdansegeraatasiretakanyang
munculuntukmenghindarimasuknyaair
yangmenyebabkankaratpadatulangan

cukupbesar,padaumumnyapembobokandan
pengecoranulanglebihekonomisuntukdilakukan

FREE WEBSITE (HTTP://WWW.WEEBLY.COM/?UTM_SOURCE=INTERNAL&UTM_MEDIUM=FOOTER&UTM_CAMPAIGN=3)

POWERED BY (HTTP:
UTM_S