Anda di halaman 1dari 54

REFERAT NEUROLOGI

TUMOR OTAK

Disusun oleh :
Fadia Ghaisani Danniswara
22010115210115

BAGIAN ILMU PENYAKIT SARAF


FAKULTAS KEDOKTERAN UNIVERSITAS
DIPONEGORO
RSUP Dr. KARIADI
SEMARANG
2016

PENDAHULUAN

Tumor otak adalah suatu lesi ekspansif yang dapat bersifat jinak atau
benigna maupun ganas atau maligna, yang membentuk massa di intracranial.
Tumor pada jaringan otak dan selaputnya dapat berupa tumor primer maupun
tumor sekunder atau metastase. Apabila sel-sel tumor berasal dari jaringan otak itu
sendiri maka disebut tumor primer, namun bila sel tumor berasal dari organ-organ
lain seperti paru, mammae, ginjal, dan lain-lain maka disebut tumor otak
sekunder.1
Kasus tumor otak masih banyak ditemukan baik di negara maju maupun
negara berkembang. Pada tahun 2002, insidensi di negara maju 3,7 per 100.000
penduduk laki-laki dan 2,6 per 100.000 penduduk wanita. Untuk negara
berkembang, insidensinya 5,8 per 100.000 penduduk laki-laki dan 4,1 per
100.0000 penduduk wanita. Pada tahun 2008, insidensinya meningkat menjadi 3,8
per 100.000 penduduk laki-laki dan 3,1 per 100.000 penduduk wanita di negara
maju. Peningkatan juga terjadi di negara berkembang menjadi 5,9 per 100.000
penduduk laki-laki dan 4,4 per 100.000 penduduk wanita. Insidensi ini masih
terus meningkat hingga saat ini.2
Menurut The Central Brain Tumor Registry of the United States
(CBTRUS), tumor otak primer adalah termasuk dalam 10 besar penyebab
kematian terkait kanker. Diperkirakan sekitar 13.000 orang di Amerika Serikat
meninggal dunia akibat tumor ini setiap tahunnya. Di Eropa ratarata survival rate
pasien tumor otak maligna dewasa adalah 18,7%. Prognosis penderita tumor otak
primer beragam, pada tumor otak primer yang maligna median survivalnya 12
bulan. Pada penelitian lain yang mengukur survival rate pasien brain tumor
didapatkan survival rate dalam 5 tahun pasien tumor otak yang terburuk adalah
glioblastoma sebesar 3% sedangkan yang tertinggi adalah ependimoma yaitu
74%.3

Hingga saat ini etiologi dari tumor otak sendiri belum jelas diketahui.
Namun secara teori terdapat faktor-faktor resiko yang mungkin perlu ditinjau
seperti : faktor herediter, sisa jaringan embrional yang mengalami degenerasi
perubahan neuroplastik, radiasi, virus, zat-zat karsinogenik, serta faktor gaya
hidup.4
Diagnosa tumor otak ditegakkan berdasarkan pemeriksaan klinis dan
pemeriksaan penunjang yaitu pemeriksaan radiologi dan patologi anatomi.
Dengan pemeriksaan klinis kadang sulit menegakkan diagnosa tumor otak apalagi
membedakan yang benigna dan yang maligna, karena gejala klinis yang
ditemukan tergantung dari lokasi tumor, kecepatan pertumbuhan masa tumor dan
cepatnya timbul gejala tekanan tinggi intrakranial serta efek dari masa tumor
kejaringan otak yang dapat menyebabkan kompresi, infasi dan destruksi dari
jaringan otak. Walaupun demikian ada bebrapa jenis tumor yang mempunyai
predileksi lokasi sehingga memberikan gejala yang spesifik dari tumor otak.
Dengan pemeriksaan radiologi dan patologi anatomi hampir pasti dapat dibedakan
tumor benigna dan maligna.

TINJAUAN PUSTAKA

1. ANATOMI
Sistem saraf adalah sistem koordinasi (pengaturan tubuh) berupa
penghantaran impuls saraf ke susunan saraf pusat, pemrosesan impul saraf
dan perintah untuk memberi tanggapan rangsangan. Unit terkecil
pelaksanaan kerja sistem saraf adalah sel saraf atau neuron.5
Sistem persarafan dibagi 2, yaitu sistem saraf pusat dan sistem
saraf perifer. Sistem saraf pusat meliputi otak dan sumsum tulang
belakang. Keduanya merupakan organ yang sangat lunak, dengan fungsi
yang sangat penting maka perlu perlindungan.5
1.1 Otak
Otak terdiri dari serebrum, serebelum, dan batang otak yang
dibentuk oleh mesensefalon, pons, dan medulla oblongata. Bila kalvaria
dan dura mater disingkirkan, di bawah lapisan arachnoid mater kranialis
dan pia mater kranialis terlihat gyrus, sulkus, dan fisura korteks serebri.
Sulkus dan fisura korteks serebri membagi hemisfer serebri menjadi
daerah lebih kecil yang disebut lobus.

Gambar 1. Lapisan Meninges6


Sesuai gambar di atas, otak dilindungi oleh tengkorak dan 3 lapisan
selaput meninges7, yaitu:
1) Piamater, lapisan terdalam yang mempunyai bentuk disesuaikan dengan
lipatan-lipatan permukaan otak.
2) Arachnoidea mater, disebut demikian karena bentuknya seperti sarang
laba-laba. Di dalamnya terdapat cairan yang disebut liquor cerebrospinalis
(LCS) yang mengisi sela-sela membran araknoid. Fungsi selaput
arachnoidea adalah sebagai bantalan untuk melindungi otak dari bahaya
kerusakan mekanik.
3) Durameter, terdiri dari dua lapisan, yang terluar bersatu dengan
tengkorak sebagai endostium, dan lapisan lain sebagai duramater yang
mudah dilepaskan dari tulang kepala. Di antara tulang kepala dengan
duramater terdapat rongga epidural.

Gambar 2. Bagian-bagian Otak7


Seperti terlihat pada gambar di atas, otak terdiri dari tiga bagian 7,
yaitu:
1. Serebrum (Otak Besar)

Serebrum adalah bagian terbesar dari otak yang terdiri dari dua
hemisfer. Hemisfer kanan berfungsi untuk mengontrol bagian
tubuh sebelah kiri dan hemisfer kiri berfungsi untuk mengontrol
bagian tubuh sebelah kanan. Masing-masing hemisfer terdiri dari
empat lobus. Bagian lobus yang menonjol disebut gyrus dan bagian
lekukan yang menyerupai parit disebut sulkus. Keempat lobus
tersebut masing-masing adalah lobus frontal, lobus parietal, lobus
oksipital dan lobus temporal.
a. Lobus parietal merupakan lobus yang berada di bagian tengah
serebrum. Lobus parietal bagian depan dibatasi oleh sulkus
sentralis dan bagian belakang oleh garis yang ditarik dari sulkus
parieto-oksipital ke ujung posterior sulkus lateralis (Sylvian).
Daerah ini berfungsi untuk menerima impuls dari serabut saraf
sensorik thalamus yang berkaitan dengan segala bentuk sensasi dan
mengenali segala jenis rangsangan somatik
b. Lobus frontal merupakan bagian lobus yang ada di bagian paling
depan dari serebrum. Lobus ini mencakup semua korteks anterior
sulkus sentral dari Rolando. Pada daerah ini terdapat area motorik
untuk mengontrol gerakan otot-otot, gerakan bola mata; area broca
sebagai pusat bicara; dan area prefrontal (area asosiasi) yang
mengontrol aktivitas intelektual
c. Lobus temporal berada di bagian bawah dan dipisahkan dari
lobus oksipital oleh garis yang ditarik secara vertikal ke bawah dari
ujung atas sulkus lateral. Lobus temporal berperan penting dalam
kemampuan 10 pendengaran, pemaknaan informasi dan bahasa
dalam bentuk suara
d. Lobus oksipital berada di belakang lobus parietal dan lobus
temporal. Lobus ini berhubungan dengan rangsangan visual yang
memungkinkan manusia mampu melakukan interpretasi terhadap
objek yang ditangkap oleh retina mata
2. Serebelum (Otak Kecil)

Serebelum atau otak kecil adalah komponen terbesar kedua otak.


Serebelum terletak di bagian bawah belakang kepala, berada di
belakang 11 batang otak dan di bawah lobus oksipital, dekat
dengan ujung leher bagian atas. Serebelum adalah pusat tubuh
dalam mengontrol kualitas gerakan. Serebelum juga mengontrol
banyak fungsi otomatis otak, diantaranya: mengatur sikap atau
posisi tubuh, mengontrol keseimbangan, koordinasi otot dan
gerakan tubuh. Selain itu, serebelum berfungsi menyimpan dan
melaksanakan serangkaian gerakan otomatis yang dipelajari seperti
gerakan mengendarai mobil, gerakan tangan saat menulis, gerakan
mengunci pintu dan sebagainya.

3. Batang Otak
Batang otak berada di dalam tulang tengkorak atau rongga
kepala bagian dasar dan memanjang sampai medulla spinalis.
Batang otak bertugas untuk mengontrol tekanan darah, denyut
jantung, pernafasan, kesadaran, serta pola makan dan tidur. Bila
terdapat massa pada batang otak maka gejala yang sering timbul
berupa muntah, kelemahan otat wajah baik satu maupun dua sisi,
kesulitan menelan, diplopia, dan sakit kepala ketika bangun.
Batang otak terdiri dari tiga bagian8, yaitu:
a. Mesensefalon atau otak tengah (disebut juga mid brain) adalah
bagian teratas dari batang otak yang menghubungkan serebrum dan
serebelum. Saraf kranial III dan IV diasosiasikan dengan otak
tengah. Otak tengah berfungsi dalam hal mengontrol respon
penglihatan, gerakan mata, 12 pembesaran pupil mata, mengatur
gerakan tubuh dan pendengaran
b. Pons merupakan bagian dari batang otak yang berada diantara
midbrain dan medulla oblongata. Pons terletak di fossa kranial
posterior. Saraf Kranial (CN) V diasosiasikan dengan pons.
c. Medulla oblongata adalah bagian paling bawah belakang dari
batang otak yang akan berlanjut menjadi medulla spinalis. Medulla

oblongata terletak juga di fossa kranial posterior. CN IX, X, dan


XII disosiasikan dengan medulla, sedangkan CN VI dan VIII
berada pada perhubungan dari pons dan medulla.
1.2 Jaringan Saraf
Terdiri dari Neuroglia dan sel Schwann (sel sel penyokong) serta Neuron
(sel sel saraf). Kedua jenis sel tersebut demikian erat berkaitan dan
terintegrasi satu sama lainnya sehingga bersama sama berfungsi sebagai
satu unit.9
1.2.1 Neuroglia
Neuroglia ( berasal dari nerve glue ) mengandung berbagai macam
sel yang secara keseluruhan menyokong, melindungi dan sumber nutrisi
sel saraf (Neuron) pada otak dan Medulla spinalis, sedangkan sel Schwann
merupakan pelindung dan penyokong neuron neuron di luar system saraf
pusat. Neuroglia menyusun 40 % volume otak dan medulla spinalis.
Neuroglia jumlahnya lebih banyak dari sel sel neuron dengan
perbandingan sekitar sepuluh banding satu. Ada empat sel Neuroglia yang
berhasil diidentifikasi yaitu : Oligodendroglia, Ependima, Astroglia dan
Microglia. Masing masing mempunyai fungsi yang khusus. 9,10
1.2.2 Oligodendroglia
Merupakan sel glia yang bertanggungjawab menghasilkan myelin
dalam susunan saraf pusat. Sel ini mempunyai lapisan dengan substansi
lemak mengelilingi penonjolan atau sepanjang sel saraf sehingga terbentuk
selubung mielin. Mielin pada susunan saraf tepi dibentuk oleh sel
Schwann.9,10
Sel Schwann membentuk myelin maupun neurolemma saraf tepi. Tidak
semua neuron susunan saraf tepi bermielin.
1.2.3 Neurolema
Neurolema adalah membran sitoplasma halus yang dibentuk oleh
sel sel Schwann yang membungkus semua neuron SST ( bermielin atau
tidak bermielin ). Neurolema merupakan struktur penyokong dan
pelindung bagi tonjolan saraf. 9
1.2.4 Mielin

Mielin merupakan suatu kompleks protein lemak bewarna putih


yang mengisolasi tonjolan saraf. Mielin menghalangi aliran ion Natrium
dan Kalium melintasi membran neuronal dengan hampir sempurna.
Selubung myelin tidak kontinu di sepanjang tonjolan saraf, dan terdapat
celah celah yang tidak memiliki myelin, dinamakan nodus Ranvier.
Tonjolan saraf pada susunan saraf pusat dan tepi dapat bermielin atau tidak
bermielin. Serabut saraf yang mempunyai selubung myelin dinamakan
serabut bermielin, dan dalam SSP dinamakan massa putih (Substansia
Alba). Serabut serabut yang tak bermielin dinamakan serabut tak
bermielin dan terdapat dalam massa kelabu (Substansia Grisea) SSP.
Transmisi impuls saraf di sepanjang serabut bermielin lebih cepat dari
transmisi di sepanjang serabut tak bermielin, karena impuls berjalan
dengan cara melompat dari nodus ke nodus yang lain di sepanjang
selubung myelin. Cara transmisi seperti ini dinamakan konduksi
saltatorik.9,10
Hal terpenting dari peran myelin pada proses transmisi di serabut
saraf dapat terlihat dengan mengamati hal yang terjadi jika tidak lagi
terdapat myelin disana. Pada orang orang dengan Multiple Sclerosis,
lapisan myelin yang mengelilingi serabut saraf menjadi hilang. Sejalan
dengan hal itu orang tersebut mulai kehilangan kemampuan untuk
mengontrol otot ototnya dan akhirnya menjadi tidak mampu sama
sekali.9
1.2.5 Ependima
Ependima berperan dalam produksi Cerebro Spinal Fluid.
Ependima adalah neuroglia yang membatasi system ventrikel SSP. Sel sel inilah yang merupakan epithel dari Plexus Coroideus ventrikel otak.9
1.2.6 Microglia
Mikroglia mempunyai sifat - sifat phagocyte yang menyingkirkan
debris debris yang dapat berasal dari sel sel otak yang mati, bakteri dan
lain lain. Sel jenis ini ditemukan di seluruh SSP dan dianggap
berperanan penting dalam proses melawan infeksi.9,10
1.2.7 Astrocytes atau Astroglia

Astrosit berfungsi sebagai sel pemberi makan bagi neuron yang


halus. Badan sel Astroglia berbentuk bintang dengan banyak tonjolan
dan kebanyakan berakhir pada pembuluh darah sebagai kaki perivaskular
atau foot processes . Bagian ini juga membentuk dinding perintang
antara aliran kapiler darah dengan neuron, sekaligus mengadakan
pertukaran zat diantara keduanya. Dengan kata lain membantu neuron
mempertahankan potensial bioelektris yang sesuai untuk konduksi impuls
dan transmisi sinaptik. Dengan cara ini pula sel sel saraf terlindungi dari
substansi yang berbahaya yang mungkin saja terlarut dalam darah. Tetapi
fungsinya sebagai sawar darah otak tersebut masih memerlukan pemastian
lebih lanjut, karena diduga celah endothel kapiler darahlah yang lebih
berperan sebagai sawar darah otak.9,10
Walaupun Neuroglia secara struktur menyerupai neuron, tetapi tidak dapat
menghantarkan impuls saraf, suatu fungsi yang merupakan bagian yang
paling berkembang pada neuron. Perbedaan lain yang penting adalah
neuroglia tidak pernah kehilangan kemampuan untuk membelah dimana
tidak dipunyai oleh neuron. Karena alasan inilah kebanyakan tumor
tumor otak adalah Gliomas atau tumor yang berasal dari sel sel glia.10

10

Gambar 3. Neuroglia

2. KLASIFIKASI TUMOR OTAK

11

Tabel 1. Klasifikasi Tumor Sistem Saraf Pusat menurut WHO (2007)11

12

13

Tabel 2. Klasifikasi Grading Tumor Otak Menurut WHO (World


Health Organization Classification of Tumors of the Nervous System,
2007)11
I
Astrocytic
Subependymal giant cell Astrocytoma
Pilocytic astrocytoma
Pilomyxoid astrocytoma
Diffuse astrocytoma
Pleomorphic xanthoastrocytoma
Anaplastic astrocytoma
Glioblastoma
Giant cell glioblastoma
Gliosarcoma

II

Oligoastrocytic
Oligoastrocytoma
Anaplastic oligoastrocytoma

Other neuroepithelial
Angiocentric glioma

Choroid plexus
Choroid plexus papilloma
Atypical choroid plexus papilloma
Choroid plexus carcinoma

IV

Oligodendroglial tumors
Oligodendroglioma
Anaplastic oligodendroglioma

Ependymal
Subependymoma
Myxopapillary ependymoma
Ependymoma
Anaplastic ependymoma

III

14

Chordoid glioma of the third ventricle


Neuronal and mixed neuronal-glial
tumor
Gangliocytoma
Ganglioglioma
Anaplastic ganglioglioma
Desmoplastic infantile astrocytoma and
ganglioglioma
Dysembryoplastic neuroepithelial tumor
Central neurocytoma
Extraventricular neurocytoma
Cerebellar liponeurocytoma
Paraganglioma of the spinal cord
Papillary glioneuronal tumor
Rosette-forming glioneural tumor of the
fourth ventricle
Pineal tumors
Pineocytoma
Pineal parenchymal tumor of
intermediate differentiation
Pineoblastoma
Papillary tumor of the pineal region

Embryonal tumors
Medulloblastoma
CNS primitive neuroectodermal tumor
(PNET)
Atypical teratoid/rhabdoid tumor
Tumors of the cranial and paraspinal
nerves
Schwannoma
Neurofibroma
Perineurioma
Malignant peripheral nerve sheath tumor
(MPNST)
Meningeal tumors
Meningioma
Atypical meningioma
Anaplastic/malignant meningioma

15

Hemangiopericytoma
Anaplastic hemangiopericytoma
Hemangioblastoma

Tumors of the sellar region


Craniopharyngioma
Granular cell tumor of the
neurohypophysis
Pituicytoma
Spindle cell

oncocytoma
of the
adenohypoph
ysis

3. GAMBARAN HISTOPATOLOGI
Menurut American Brain Tumor Association (2014), karakteristik
beberapa tumor otak secara umum menurut gambaran histopatologi adalah
sebagai berikut:
a. Astrositoma
Tipe gambaran histopatologi astrositoma antara lain astrositoma
pilositik, astrositoma welldifferentiated atau astrositoma fibrillary,
dan astrositoma anaplastik. Astrositoma pilositik seringkali bersifat
kistik, dan jika padat, biasanya berbatas tegas. Tumor ini terdiri dari
sel-sel bipolar dengan prosesus-prosesus yang panjang dan tipis.
Rosenthal fibers, badan-badan granul eosinofilik, mikrokista sering
dijumpai,

sedangkan

nekrosis

dan

mitosis

jarang

dijumpai.

Astrositoma welldifferentiated dicirikan oleh peningkatan jumlah


nukleus sel glia yang ringan sampai sedang, pleomorfisme nukleus
yang bervariasi, dan prosesus-prosesus sel astrosit yang memberikan
penampilan seperti fibril. Astrositoma anaplastik menunjukkan
kelompok sel-sel yang lebih padat, pleomorfisme nukleus yang lebih
berat, dan dijumpai mitosis.12

16

Gambaran histopatologik Astrositoma Pilositik (grade I)13

17

Gambaran histopatologik Astrositoma Fibrillary (grade II)14

Gambaran histopatologik Anaplastic Astrocytoma (grade III)15


b. Glioblastoma Multiforme
Glioblastoma dapat timbul cepat secara de novo, tanpa lesi prekursor
yang sering disebut glioblastoma primer. Sedangkan glioblastoma
sekunder berkembang secara perlahan dari difus astrositoma (WHO
grade II) atau anaplastik astrositoma (WHO grade III). Tumor ini
biasanya mengandung campuran dari berbagai jenis sel, mineral kistik,
deposit kalsium, dan pembuluh-pembuluh darah.13 Glioblastoma

18

multiforme memiliki tampilan histopatologis yang sama dengan


astrositoma anaplastik, disertai nekrosis dengan nukleus yang
pseudopalisading atau proliferasi pembuluh darah.

Gambaran histopatologik Glioblastoma Multiforme16


c. Ependimoma
Ependimoma adalah tumor yang lembek dan berwarna keabu-abuan
atau merah yang mungkin mengandung kista atau kalsifikasi mineral.17
Secara histologi, ependimoma didominasi oleh sel panjang dengan
prosesus

menyebar

disekitar

pembuluh

darah

(perivaskuler

pseudorosette) atau lumen (ependimal rosette), ependimal rosette


merupakan rekapitulasi struktur ependim normal. Sel-sel ependimoma
terdiri dari sel-sel dengan nukleus yang bulat hingga oval, reguler, dan
penebalan kromatin granular. Di antara nukleus-nukleus terdapat latar
belakang fibrilaris yang padat. Ependimoma anaplastik menunjukkan
peningkatan kepadatan sel, laju mitosis yang tinggi, nekrosis, dan
diferensiasi sel-sel ependimal yang kurang jelas.12

19

Gambaran histopatologik Ependimoma12


d. Oligodendroglioma
Pada pemeriksaan mikroskopis, terdapat sel-sel tumor yang tersusun
reguler dengan nukleus berbentuk sferis yang berisi kromatin-kromatin
granular, dikelilingi oleh sitoplasma jernih berbentuk halo. Sel
neoplastik cenderung berkumpul disekitar neuron asli menjadi suatu
fenomena yang sering disebut sebagai satelitosis.11 Tumor ini biasanya
memiliki jaringan anastomosis kapiler yang halus. Kalsifikasi yang
dijumpai pada tumor beragam ukurannya mulai dari fokus-fokus
mikroskopis hingga deposisi yang masif, dan aktivitas mitosis
biasanya sulit dideteksi. Oligodendroglioma anaplastik adalah subtipe
tumor yang lebih agresif dengan kepadatan sel, anaplasia nukleus, dan
aktivitas mitosis yang lebih tinggi.12

Gambaran histopatologik Oligodendriglioma12

20

e. Meningioma
Massa tumor terdiri dari sel-sel bentuk oval sampai lonjong, tumbuh
hiperplastis membentuk struktur kisaran dan pada bagian tengah
tampak pembentukan psammoma bodies (massa kalsifikasi konsentris)
diantara kelompok-kelompokan sel-sel tumor dibatasi jaringan ikat dan
proliferasi pembuluh darah.
Menurut Riemenscheider18, meningioma diklasifikasikan menjadi tiga
tipe, yaitu benigna (WHO grade I), atipikal (WHO grade II), dan
anaplastik (WHO grade III). Menurut Kumar 12, pola-pola histopatologi
meningioma yang sering dijumpai adalah:
i. Meningioma sinsitial (meningotelial), berupa kluster sel-sel
yang whorling tanpa terlihat adanya membran sel yang tersusun
ii.

rapat.
Meningioma fibroblastik, dengan sel-sel yang elongasi dan

iii.

deposisi kolagen yang melimpah di antara sel-sel tersebut.


Meningioma transitional, yang memiliki tampilan berupa

iv.

campuran dari meningioma sinsitial dan fibroblastik.


Meningioma psammomatosa, berupa sel-sel dengan psammoma

v.

bodies yang jumlahnya banyak.


Meningioma sekretori, dengan sekresi eosinofilik seperti

vi.

kelenjar yang disebut pseudopsammoma bodies.


Meningioma atipikal dicirikan dengan nukleolus

yang

mencolok, selularitas yang meningkat, pertumbuhan yang tak


berpola, dan laju mitosis yang lebih tinggi. Tumor ini lebih
vii.

agresif dan tingkat rekurensinya lebih tinggi.


Meningioma anaplastik adalah tumor yang sangat agresif yang
menyerupai sarkoma atau karsinoma high-grade, meskipun
dapat

terlihat

adanya

asal

histopatologis.

21

sel

meningotelial

secara

Gambaran histopatologi berbagai varian meningioma WHO grade I:


meningioma meningotelial (A), fibroblastik (B), transisional (C),
psammomatosa (D), angiomatosa (E), mikrokistik (F), sekretori (G),
limfoplasmasit (H), dan metaplastik (I)18
f. Ganglioglioma
Tumor biphasic ini paling sering terletak di lobus temporal dan
sebagian besar terjadi pada anak-anak dan dewasa muda. Ini adalah
tumor bervariasi dibatasi dengan campuran intim neuron yang rusak
dan displastik dan sel glial neoplastik dari berbagai proporsi. Sel-sel
ganglion ditandai dengan disorientasi bentuk sel dengan lokalisasi subkortikal, agregasi abnormal dan membentuk cluster. Secara morfologis,
neuron menunjukkan bentuk abnormal dengan bentuk sel yang
membesar, bilateral dan multinukleasi, nukleolus menonjol, dan perimembran yang terkondensasi dengan substansi Nissl.19 Komponen glial
dapat bervariasi juga dari pilocytic berdifusi astrocytoma untuk
oligodendroglioma. Ini adalah komponen proliferatif yang pada
akhirnya menentukan perilaku biologis ganglioglioma. Tumor terdiri
terutama dari sel ganglion tanpa komponen glial yang disebut
gangliocytomas. Kalsifikasi displastik (gelembung-gelembung atau
inkrustasi), granule bodies yang eosinofilik dan peningkatan reticulin
meshwork dapat dilihat di bagian belakangnya. Didapatkan juga
limfosit perivaskular dan tersebar sel parenkim plasma. Sebuah

22

ganglioglioma atipikal atau anaplastik jarang ditemui dan dapat timbul


baik

novo

de

ganglioglioma.20

atau

kambuh

Kehadiran

dari

atypia

sebelumnya

seluler

dan

didiagnosis

pleomorfisme,

proliferasi mikrovaskuler, nekrosis dan peningkatan MIB-1 indeks


pelabelan

mendukung

diagnosis

ganglioglioma

anaplastik.

Gemistocytes yang teridentifikasi dalam beberapa tumor mungkin


dapat menjadi gambaran tambahan dari anaplasia.20

Gambaran histopatologik Ganglioglioma19,20


g. Neurositoma sentral
Tumor ini biasanya menempati ventrikel lateral atau kadang di
ventrikel ketiga pada orang dewasa muda tanpa invasi yang signifikan
ke dalam jaringan otak yang berdekatan. Hal ini ditandai dengan
proliferasi sel bulat uniform, tertanam dalam dan dipisahkan oleh latar
fibrillary, dimana terdapat neuropil yang memberikan gambaran
monoton secara keseluruhan.21

23

Gambaran histopatologik Neurositoma sentral21


h. Tumor Plexus Koroid
a. Koroid pleksus papiloma (CPP)
Ini adalah jenis tumor plexus koroid yang paling sering dan
ditandai oleh papila yang dilapisi satu lapisan berbentuk cuboidal
hingga sel epitel seperti columnar dengan sitoplasma acidophilic, basal
hambar, bulat untuk inti oval.11 Angka mitosis langka, infiltrasi
mikroskopis ke dalam otak yang berdekatan tetapi tidak nekrosis dapat
dilihat. Perubahan oncocytic, deposisi melanin, kalsifikasi, pengerasan,
dan perubahan xanthogranulomatous terkadang ditemui.22
b. Atypical koroid pleksus papiloma (atipikal CPP)
Jenis baru ini ditandai dengan bentuk arsitektur papiler yang mirip
dengan papilloma, tetapi dengan peningkatan aktivitas mitosis 2
mitosis per 10 bidang daya tinggi.11 Kehadirantambahanminimal2
fiturberikutmenjamindiagnosisatipikalCPPtermasukpeningkatan
cellularity,pleomorfismenuklir,pertumbuhanyangsoliddannekrosis.

24

Gambaran histopatologik Atypical Choroid Plexus


Papilloma23
c. pleksuskarsinomakoroid
Tipetumoriniadalahyangpalingagresifdansecaramikroskopis
ditandaidengangambaranpapillayangkaburdandenganpeningkatan
cellularity serta pleomorfisme terhadap fitur keganasan frank yang
termasuk mitosis cepat dari >5 MF / 10HPFs, dan nekrosis. Invasi
menyebarkeparenkimotakseringterlihat.11
4. DIAGNOSIS
Menurut Sobirin24, tidak selalu mudah untuk menduga dan
membuat
suatu diagnosis tumor otak karena gejala klinis yang dihasilkan dapat
bervariasi tergantung pada histopatologi dan lokasinya. Misalnya, glioma
tahap dini, yaitu astrositoma grade I dan II, dapat mendekam di otak tanpa
menimbulkan manifestasi klinis apapun. Selain itu, gejala klinisnya sukar
dibedakan dengan penyakit-penyakit lainnya, sehingga dugaan yang
mengarah ke tumor otak sering terlewatkan. Padahal, tumor otak

25

merupakan penyakit yang serius dan kesuksesan pengobatannya


bergantung pada diagnosis yang lebih dini. Diagnosis tumor otak
ditegakkan berdasarkan pemeriksaan klinis dan penunjang, di antaranya
pemeriksaan EEG, CT scan, arteriografi, dan patologi anatomi.
Menurut Deangelis dan Rosenfeld25, pemeriksaan pencitraan yang
dapat dilakukan untuk mengidentifikasi adanya massa intrakranial antara
lain:
1. Magnetic Resonance Imaging (MRI)
MRI merupakan pilihan utama dalam mengevaluasi tumor
intrakranial. MRI lebih sensitif daripada CT scan untuk
menggambarkan detail anatomis dan tumor-tumor di fossa
posterior. Functional MRI (fMRI) dapat menunjukkan hubungan
tumor dengan struktur intrakranial yang lain seperti pusat motorik
atau berbicara sehingga dokter bedah dapat memastikan keamanan
reseksi komplit sebelum pasien dibawa ke ruang operasi.
2. Computed tomography scan (CT scan)
CT scan berguna dalam mendeteksi erosi tulang pada tumor
metastasis atau hiperostosis pada meningioma, namun kurang
sensitif untuk tumor yang terletak di fossa posterior. Administrasi
kontras pada CT scan dan MRI dapat mendeteksi defek pada sawar
darah-otak dan tumor ekstraaksial. Baik CT scan maupun MRI
dapat menvisualisasikan perdarahan (hemorrhage) pada suatu
tumor.
3. Positron-emission tomography (PET)
PET dengan 18F-fluoro-deoxyglucose (FDG) digunakan
untuk mengukur metabolisme tumor dan membedakan tumor dari
nekrosis radiasi.
4. Single-photon emission computed tomography (SPECT)
SPECT melibatkan administrasi zat radioaktif

dan

digunakan untuk fungsi yang sama dengan FDG-PET


5. Elektroensefalografi (EEG)
EEG hampir tidak berguna untuk mendiagnosis tumor otak,
namun dapat bermanfaat apabila pasien tidak responsif dan
dicurigai menderita status epileptikus nonkonvulsif.
6. Angiografi

26

Angiografi

digunakan

untuk

menetapkan

anatomi

pembuluh darah sebelum pembedahan seperti menggambarkan


patensi sinus venosus, dan untuk embolisasi preoperatif untuk
mengurangi vaskularitas tumor sebelum reseksi, seperti pada tumor
glomus jugularis
7. Analisis cairan serebrospinalis
Analisis cairan serebrospinalis umumnya tidak diperlukan
untuk kebanyakan neoplasma intrakranial. Tes ini bermanfaat
hanya untuk staging neurologis yang dibutuhkan dalam diagnosis
limfoma

SSP

primer,

tumor

germ

cell

intrakranial,

meduloblastoma, atau pineoblastoma.


5. GEJALA KLINIS
Secara umum pasien tumor otak bisa memiliki gejala seperti perubahan
perilaku contohnya, pasien mungkin mudah lelah atau kurang konsentrasi.
Selain itu, gejala hipertensi intracranial seperti sakit kepala, mual, vertigo.
Serangan epilepsi juga sering dijumpai pada pasien tumor otak. Gejala-gejala
dibawah ini spesifik sesuai dengan lokasi tumor26 :
1. Lobus frontal
Menimbulkan gejala perubahan kepribadian seperti depresi.
Menimbulkan masalah psychiatric.
Bila jaras motorik ditekan oleh tumor hemiparese kontra lateral,
kejang fokal dapat timbul. Gejala kejang biasanya ditemukan pada
stadium lanjut
Bila menekan permukaan media dapat menyebabkan inkontinentia.
Pada lobus dominan menimbulkan gejala afasia.
2. Lobus temporal
Dapat menimbulkan gejala hemianopsia.
Gejala neuropsychiatric seperti amnesia, hypergraphia dan Dj vu
juga dapat timbul.
Lesi pada lopus yang dominan bisa menyebabkan aphasia.
3. Lobus parietalis
Akan menimbulkan gangguan sensori dan motor yang kontralateral.
Gejala homonymous hemianopia juga bisa timbul.

27

Bila ada lesi pada lobus yang dominant gejala disfasia.


Lesi yang tidak dominan bisa menimbulkan geographic agnosia dan
dressing apraxia.
4. Lobus oksipital
Menimbulkan homonymous hemianopia yang kontralateral
Gangguan penglihatan yang berkembang menjadi object agnosia.
5. Tumor di cerebello pontin angle
Tersering berasal dari N VIII yaitu acustic neurinoma.
Dapat dibedakan karena gejala awalnya berupa gangguan fungsi
pendengaran.
6. Glioma batang otak
Biasanya menimbulkan neuropati cranial dengan gejala-gejala seperti
diplopia, facial weakness dan dysarthria.
7. Tumor di cerebelum
Didapati gangguan berjalan dan gejala tekanan intrakranial yang
tinggi seperti mual, muntah dan nyeri kepala. Hal ini juga disebabkan
oleh odem yang terbentuk.
Nyeri kepala khas didaerah oksipital yang menjalar ke leher dan
spasme dari otot-otot servikal
Glioma merupakan tumor otak primer paling banyak dijumpai (50%) yang
pada orang dewasa letaknya berada di supratentorial dan berasal dari korteks dan
hemisfer otak. Pada anak-anak 70% terletak di infratentorial yang berasal dari
serebelum, batang otak, dan mesensefalon. Rasio antara penderita pria dan wanita
adalah 55:45. Dibawah ini akan dijelaskan mengenai tiap jenis tumor otak dan
gejala klinis masing-masing yang dapat terjadi :
1. Astrositoma
Astrositoma adalah sekelompok neoplasma heterogen yang
berkisar dari lesi berbatas tegas tumbuh lambat seperti astrositoma
pilositik hingga neoplasma infiltratif yang sangat ganas seperti
glioblastoma multiforme. Tumor Astrositik dapat dibagi menjadi

28

astrositik fibriler (infiltratif), astrositoma pilositik dan beberapa


varian yang jarang.12 Tumor astrositoma merupakan tipe tumor SSP
yang

paling

banyak

(38,6%)

dan

berlokasi

di

korteks

frontoparietal.27 Astrositoma merupakan tumor tersering pada anak


dengan insidensi puncak usia 59 tahun pada laki-laki dan 1014
tahun untuk wanita.
a. Neoplasma Astrositik Difus
Neoplasma astrositik difus merupakan tumor yang biasa terjadi
pada dewasa muda dan ditandai dengan tingkat diferensiasi
seluler yang tinggi dan pertumbuhan yang lambat. Astrositoma
difus dapat terjadi di seluruh SSP namun biasanya terletak
supratentorial dan memiliki kecenderungan intrinsik untuk
berkembang menjadi astrositoma anaplastik dan akhirnya
menjadi glioblastoma. Astrositoma difus dapat menempati
setiap wilayah di SSP, tetapi kebanyakan sering berkembang di
area supratentorial, lobus frontal dan lobus temporal baik pada
anak-anak maupun orang dewasa. Batang otak dan tulang
belakang adalah lokasi tersering berikutnya. Astrositoma difus
ini paling jarang berlokasi di otak kecil. Kejang adalah gejala
yang umum, meskipun dalam studi retrospeksi kelainan halus
seperti kesulitan berbicara, perubahan sensasi, visi, atau
beberapa perubahan motorik mungkin telah hadir sebelumnya.
Tumor yang berlokasi di lobus frontal dapat menyebabkan
perubahan perilaku atau kepribadian. Setiap perubahan tersebut
mungkin telah hadir selama berbulan-bulan sebelum diagnosis,
tetapi gejala mungkin juga berupa onset yang mendadak.11
b. Astrositoma Pilositik
Astrositoma pilositik merupakan tumor WHO grade I yang
timbul lambat dan berbatas tegas. Astrositoma pilositik
memiliki 5 years survival 96,4% pada anak usia 0 19 tahun. 28
Astrositoma pilositik terdiri sekitar 5 6% dari semua glioma.
Astrositoma pilositik muncul di sepanjang neuraxis, namun

29

pada pediatrik populasi tumor lebih muncul dalam daerah


infratentorial. Lokasi tumor ini meliputi saraf optik (glioma
saraf optik), chiasma optikum, talamus dan ganglia basal,
hemisfer, serebelum, dan batang otak. Pada anak-anak, lokasi
paling umum di supratentorial. Astrositoma pilositik yang
terjadi di sumsum tulang belakang kurang sering, namun tidak
jarang, dan pada anak-anak mewakili sekitar 11% dari tumor
tulang belakang.11 Astrositoma pilositik menghasilkan defisit
neurologis fokal atau tanda-tanda non-lokalisasi, misalnya
makrosefali, sakit kepala, endokrinopati, atau peningkatan
tekanan intrakranial. Kejang jarang terjadi karena lesi jarang
melibatkan korteks serebral.11
c. Glioblastoma Multiforme
Glioblastoma multiforme merupakan tumor otak primer
kelompok neuroepitel tersering dan neoplasma yang paling
ganas.11,28 Tumor ini biasanya menyerang orang dewasa dan
terutama berlokasi di hemisferium. Karena sifatnya yang
invasif, glioblastoma tidak dapat sepenuhnya direseksi dan
meskipun mendapat radioterapi atau kemoterapi, kurang dari
setengah pasien yang dapat bertahan lebih dari satu tahun.
Bahkan berdasarkan registri kanker, 5 years survival untuk
penderita glioblastoma yang berusia 40 60 tahun hanya 5%.28
Prognosis lebih jelek pada pasien usia tua dibandingkan pasien
muda tidak dapat dihungkan dengan perifokal edema.29
Glioblastoma adalah tumor otak yang paling sering, terhitung
sekitar 12 15% dari semua neoplasma intrakranial dan 60
75% dari tumor astrositik. Di sebagian besar Eropa dan
Amerika Utara, terdapat 3 4 kasus baru per 100 000
penduduk per tahun. Glioblastoma dapat bermanifestasi pada
usia berapa pun, tetapi paling sering terdapat pada orang
dewasa, dengan puncak kejadian di antara usia 45 dan 75
tahun. Berdasarkan laporan kasus, pada 987 penderita

30

glioblastoma dari Rumah Sakit Universitas Zurich, lokasi yang


paling sering terkena adalah lobus temporal (31%), lobus
parietal (24%), lobus frontal (23%) dan lobus oksipital (16%).
Infiltrasi dari glioblastoma sering meluas ke korteks yang
berdekatan

dan

melalui

corpus

callosum

ke

belahan

kontralateral. Glioblastoma yang berlokasi ganglia basal dan


talamus

juga

tidak

jarang,

terutama

pada

anak-anak.

Glioblastoma dari batang otak jarang terjadi dan sering


menyerang anak-anak. Serebelum dan sumsum tulang belakang
merupakan lokasi yang paling jarang ditempati oleh neoplasma
ini.11 Gejala dan tanda-tanda yang umum dari glioblastoma
berupa gejala peningkatan tekanan intrakranial, seperti sakit
kepala, mual, muntah dengan disertai papil edema. Sepertiga
pasien dapat mengalami kejang epilepsi. Gejala neurologis
non-spesifik seperti sakit kepala dan perubahan kepribadian
juga dapat terjadi.11
2. Oligodendroglioma
Oligodendroglioma merupakan tumor grade II WHO yang
berkaitan dengan hilangnya heterozigositas di lengan panjang
kromosom 19 dan lengan pendek kromosom 1. Oligodendroglioma
diperkirakan 1,9% dari semua tumor otak primer dan 6,4% dari
semua glioma.3 Tingkat insiden tahunan di United States
diperkirakan berkisar 0,27 sampai 0,35 per 100 000 orang. Angka
kejadian oligodendroglioma meningkat secara signifikan selama
beberapa tahun terakhir. Mayoritas oligodendrogliomas timbul
pada orang dewasa, dengan insiden puncak antara 40 dan 45 tahun.
Oligodendroglioma jarang terjadi pada anak-anak. Hanya 1,1%
dari seluruh otak tumor pada pasien lebih muda dari 14 tahun. Pria
sedikit lebih sering daripada perempuan dengan rasio 1,1:1.11
Oligodendroglioma muncul terutama di korteks hemisfer otak.
Sekitar 50-65% dari pasien menderita oligodendroglioma di lobus

31

frontal, diikuti dengan penurunan frekuensi oleh lobus temporal,


parietal dan oksipital. Keterlibatan lebih dari satu lobus otak atau
tumor bilateral umum terjadi. Ada pula pasien yang dilaporkan
menderita oligodendroglioma dalam fossa posterior, ganglia basal,
batang otak atau sumsum tulang belakang. Terdapat tanda-tanda
peningkatan tekanan intrakranial (misal, nyeri kepala). Selain itu
bisa juga terdapat kelainan fokal yang berkaitan dengan lokasinya
(misal, kejang).12
3. Ependimoma
Ependimoma merupakan tumor yang tumbuh lambat dan
umumnya pada anak-anak dan dewasa muda, yang berasal dari
dinding ventrikel atau dari kanal tulang belakang dan terdiri dari
neoplastik sel ependimal.11 Di Amerika Serikat, WHO grade II III
ependimoma memiliki perkiraan kejadian 0,29 pada pria dan 0,22
per 100 000 orang per tahun pada wanita. Tampak terdapat
perbedaan angka kejadian berdasarkan ras dengan kejadian 0,35
pada ras kulit putih versus 0.14 untuk Afrika Amerika.
Ependimoma tercatat 2 9% dari semua tumor neuroepithel.
Meskipun dapat menyerang semua usia, namun ependimoma
merupakan 6 12% dari semua tumor intrakranial anak yang 30%
dari kasus tersebut terjadi pada anak yang kurang dari 3 tahun
(Louis et al., 2007). Tumor ini dapat terjadi dimanapun sepanjang
sistem ventrikel dan dalam kanal tulang belakang. Ependimoma
paling sering berkembang di ventrikel keempat dan sumsum tulang
belakang, diikuti oleh ventrikel lateral dan ventrikel ketiga. Pada
orang dewasa, ependimoma infratentorial dan tulang belakang
timbul

dengan

frekuensi

yang

hampir

sama,

sedangkan

ependimoma infratentorial jelas mendominasi anak dan dewasa


muda.11 Pada tumor intrakranial, ependeimoma lebih sering muncul
pada ventrikel keempat.12 Ependimoma biasanya menempati fossa

32

posterior (sudut cerebellopontine).30 Manifestasi klinis tumor ini


tergantung pada lokasi yang ditempatinya. Gejala utama berupa
mulipel defisit saraf kranial seperti palsi N.VI dan N.VIII,
penurunan

pendengaran,

dan

sulit

menelan.

Ependimoma

infratentorial mungkin hadir dengan tanda-tanda dan gejala


hidrosefalus dan peningkatan tekanan intrakranial, seperti sakit
kepala, mual, muntah dan pusing. Keterlibatan struktur fossa
posterior dapat menyebabkan ataksia serebelar, gangguan visual,
pusing dan paresis. Pasien dengan ependimoma supratentorial
menunjukkan fokus defisit neurologis, kejang dan gejala hipertensi
intrakranial. Pembesaran kepala dapat ditemui pada anak-anak di
bawah usia dua tahun.11,30
4. Medulloblastoma
Medulloblastoma adalah tumor embrional invasif di otak kecil
dengan manifestasi terutama pada anak-anak, yang dominan
diferensiasi saraf dan memiliki kecenderungan inheren untuk
bermetastasis

melalui

jalur

cairan

serebro

spinal

(CSS).

Peningkatan risiko medulloblastoma ditemukan pada anak yang


lahir prematur (rasio kejadian standar 3.1). Substitusi folat dalam
diet ibu hamil memiliki fungsi sebagai pelindung terhadap
pertumbuhan medulloblastoma pada anak-anak diklaim pada
penelitian sebelumnya, tapi tidak dikonfirmasi dalam studi yang
lebih baru.11 Kejadian tahunan diperkirakan sebesar 0,5 per
100.000 anak yang berusia kurang dari 15 tahun. Di Amerika
Serikat, ras kulit putih lebih sering terkena dibandingkan AfrikaAmerika. Puncak usia kejadian tumor ini adalah 7 tahun. Tujuh
puluh persen dari medulloblastoma terjadi pada individu yang
berusia kurang dari 16 tahun. Pada dewasa, 80% dari
medulloblastomas muncul di kelompok usia 21 40 tahun. Tumor
ini jarang terjadi melampaui dekade kelima kehidupan dan sekitar
65% pasien adalah laki-laki. Tumor medulloblastoma primer sering

33

terjadi pada laki-laki usia pertengahan 60 atau lebih dengan gejala


fokal. Median survival untuk penderita medulloblastoma sekitar
14,6 bulan dengan kemoradioterapi.31 Setidaknya 75% dari
medulloblastoma anak timbul di daerah vermis, dan terproyeksi ke
ventrikel keempat. Keterlibatan hemisfer serebelum meningkat
pada usia dewasa. Kebanyakan tumor terletak di belahan adalah
dari desmoplastik atau subtipe nodular. Manifestasi klinis yang
timbul termasuk ataksia trunkal, gangguan berjalan, hipertensi
intrakranial sekunder untuk gejala obstruksi aliran CSS dan lesu,
sakit kepala dan muntah pada pagi hari.11
5. Neoplasma Neuron
a. Tumor Sel Ganglion
Ganglioglioma merupakan tumor neuroepitel yang berdiferensiasi
baik dan tumbuh perlahan-lahan. Tumor ini terdiri dari sel
neoplastik, sel ganglion matang, baik hanya terdiri dari sel neuron
saja (gangliocytoma) atau kombinasi dengan sel glial neoplastik
(ganglioglioma). Perbedaan paling sering diamati pada pasien yang
mengalami epilepsi untuk waktu yang lama.11 Berdasarkan data
yang tersedia mengindikasikan bahwa gangliocytoma dan bersamasama ganglioglioma mewakili 0,4% dari semua tumor sistem saraf
pusat (SSP) dan merupakan 1,3% dari semua tumor otak. Usia
pasien berkisar dari 2 bulan hingga 70 tahun. Mean atau median
usia saat diagnosis adalah dari 8,5 25 tahun. Rasio antara lakilaki: perempuan bervariasi mulai dari 1,1:1 sampai 1.9:1. Dalam
survei neuropatologi Jerman di Reference Centre for Epilepsy
Surgery, rata-rata usia 124 anak dengan ganglioglioma adalah 10,3
tahun, dengan 44% terjadi pada pasien wanita. Tumor ini dapat
terjadi diseluruh SSP, termasuk serebrum, batang otak, serebelum,
sumsum tulang belakang, saraf optik, hipofisis dan kelenjar pineal.
Mayoritas dari ganglioglioma berlokasi di lobus temporal (>
70%).11 Gejala bervariasi sesuai dengan ukuran dan lokasi tumor.

34

Tumor di serebrum biasanya dikaitkan dengan riwayat kejang


dengan durasi mulai dari satu bulan sampai 50 tahun sebelum
diagnosis, dengan interval mean atau median durasi 625 tahun.
Untuk tumor yang melibatkan batang otak atau sumsum tulang
belakang, mean durasi gejala sebelum diagnosis secara berturutturut adalah 1,25 dan 1,4 tahun. Ganglioglioma maupun
glangliositoma merupakan tumor yang paling sering berkaitan
dengan epilepsi kronik lobus temporal.11
b. Tumor Neuroepitel Disembrioplastik (DNT)
Tumor neuroepitel disembrioplastik (DNT) merupakan tumor jinak.
Biasanya berupa neoplasma glialneuronal supratentorial yang
terjadi pada anak-anak atau dewasa muda. DNT biasanya
ditemukan di kortikal dan dengan kejang parsial yang resistan
terhadap obat. DNT terdiri atas campuran neuron matur, daerah
mirip oligodendroglioma dan astrosit.12 Dalam operasi epilepsi,
kejadian "khas" DNT adalah 12% pada orang dewasa dan 13,5% di
anak. Di antara semua neuroepithelial tumor yang didiagnosis pada
sebuah institusi tunggal, DNT diidentifikasi dalam 1,2% dari pasien
yang berusia dibawah 20 tahun dan hanya 0,2% dari mereka yang
berusia lebih dari 20 tahun. Usia pasien pada 30 timbulnya gejala
kriteria diagnostik sangat penting. Sekitar 90% dari kasus, kejang
pertama terjadi sebelum usia 20 tahun. Pasien sering terdiagnosis
pada dekade kedua atau ketiga kehidupan, tetapi deteksi dari DNT
dengan pencitraan pada anak-anak atau muda orang dewasa dengan
onset kejang menjadi lebih biasa. Pasien laki-laki lebih sering
terkena.

DNT

dapat

berlokasi

di

setiap

bagian

korteks

supratentorial, tetapi paling sering berada di lobus temporal,


terutama melibatkan struktur mesial. DNT juga dapat berada di
daerah ventrikel lateral, septum pelucidum, regio trigonoseptal,
otak tengah, serebelum dan batang otak. Pasien dengan DNT
supratentorial biasanya datang dengan keluhan kejang parsial yang
resistan terhadap obat, dengan atau tanpa generalisasi sekunder dan

35

tidak ada defisit neurologis. Lamanya durasi kejang sebelum bedah


intervensi dapat bervariasi dari hitungan minggu hingga dasawarsa,
yang menyebabkan variabilitas dalam usia dari pasien di diagnosis
patologis.11
6. Meningioma
Meningioma biasanya melekat pada bagian dalam permukaan dura
mater. Tumor ini berkaitan dengan hilangnya sebagian atau seluruh
kromosom 22 yang menyebabkan delesi gen NF2.12 Meningioma
mencapai sekitar 2430% tumor intrakranial primer yang terjadi di
Amerika Serikat dengan tingkat kejadian tahunan sampai 13 per
100 000. Di Skandinavia, insiden telah meningkat antara tahun
1968 dan 1997 yaitu 2,64,5 per 100.000 pada wanita, dan 1,41,9
pada pria. Pada otopsi, meningioma ditemukan kebetulan di 1,4 %
kasus. Meningioma multipel sering terjadi pada pasien dengan
neurofibromatosis tipe 2 (NF2) dan pada keluarga non-NF2 dengan
faktor predisposisi menderita meningioma herediter. Meningioma
terjadi paling umum pada pasien paruh baya dan lanjut usia,
dengan puncaknya pada dekade keenam dan ketujuh. Meningioma
paling sering tumbuh araknoid mater di kubah kranium
(supratentorial terutama didaerah parasagital dan infratentorial,
yaitu disamping medial os petosum dekat sudutserebelopontin) dan
medulla spinalis (biasanya terletak di bagian T.4 sampai T.8).
Meningioma umumnya tumbuh lambat dan menghasilkan tanda
dan gejala neurologis karena kompresi struktur yang berdekatan;
defisit neurologis yang spesifik tergantung pada lokasi tumor. Sakit
kepala

dan

kejang

sering

menggambarkan

munculnya

meningioma.11
6. PENANGANAN
Menurut National Cancer Institute 201432, penatalaksanaan tumor otak
bervariasi menurut histopatologi dan lokasi anatomis. Bahkan untuk tumor-tumor

36

seperti meningioma low-grade yang asimtomatis, observasi saja sudah cukup dan
terapi dilakukan apabila telah terdeteksi pertumbuhan tumor atau munculnya
gejala. Adapun pilihan penatalaksanaan tumor otak secara umum mencakup:

1. Pembedahan
Untuk sebagian besar tumor otak, usaha pembedahan komplit atau hampir
komplit umumnya direkomendasikan, apabila mungkin, dengan pemeliharaan
fungsi neurologis dan kesehatan pasien. Tujuan pembedahan adalah untuk
menegakkan diagnosis histopatologi dan mengurangi TIK.
2. Terapi radiasi
Pasien yang menjalani terapi radiasi pascaoperasi baik tumor low-grade
maupun high-grade dinilai dapat bertahan hidup lebih lama dibandingkan
dengan yang tidak menjalani terapi radiasi. Terapi radiasi yang berulang harus
diberikan dengan hati-hati karena adanya risiko defisit neurokognitif dan
nekrosis yang timbul akibat radiasi (National Cancer Institute, 2014).
3. Kemoterapi
Selama beberapa tahun, kemoterapi sistemik yang digunakan adalah
nitrosourea carmustine (BCNU) yang merupakan kemoterapi standar sekaligus
dengan pembedahan dan radiasi untuk glioma maligna. Namun saat ini,
temozolomide sudah menggantikan carmustine sebagai kemoterapi standar.
Kemoterapi bukan terapi utama bagi kebanyakan pasien, namun dapat
bermanfaat bagi pasien dengan metastasis tumor yang kemosensitif (National
Cancer Institute, 2014).
4. Kortikosteroid
Kortikosteroid dapat meredakan gejala tumor otak dengan cepat dengan
cara mengurangi edema di sekitar tumor dan mengurangi TIK. Obat standar
yang digunakan adalah deksametason. Deksametason dapat memperbaiki
sawar darah otak yang terganggu pada tumor otak yang ganas. Kortikosteroid
diindikasikan pada seluruh pasien tumor otak yang simtomatis, khususnya
pasien dengan edema peritumoral yang terlihat pada pencitraan, kecuali pada

37

pasien dengan limfoma SSP primer di mana kortikosteroid dapat meregresi


tumor sehingga menyulitkan penegakan diagnosis apabila diberikan sebelum
tumor dibiopsi. Meskipun bermanfaat, pemberian kortikosteroid jangka
panjang dapat mengakibatkan toksisitas klinis, sehingga apabila gejala yang
dialami pasien sudah terkontrol dan terapi yang spesifik untuk tumor telah
dilakukan, dosis kortikosteroid harus dikurangi.25

5. Antikonvulsan
Antikonvulsan diberikan pada seluruh pasien tumor otak yang mengalami
kejang. Namun, kebanyakan pasien tumor otak tidak mengalami kejang
sebagai gejala awal. Pemberian antikonvulsan profilaksis tidak dianjurkan bagi
pasien tumor otak yang belum mengalami kejang karena diteliti tidak
bermanfaat. Yang lebih penting, banyak antikonvulsan berinteraksi dengan
obat-obatan yang lain, misalnya dapat meningkatkan metabolisme agen
kemoterapi sehingga kadarnya menurun ke level subterapetik.25
Sedangkan untuk penanganan pada tiap penyakit secara lebih spesifik akan
dijelaskan di bawah ini :
1. astrositoma
Meskipun astrocytomas pilocytic biasa muncul dalam dua dekade pertama
kehidupan, akhir presentasi pada orang dewasa dilaporkan dan biasanya
memiliki hasil yang kurang menguntungkan.33 Jika ada tingkat kecurigaan
yang tinggi pada saat presentasi untuk astrocytoma pilocytic, pengambilan
keputusan harus mempertimbangkan hal berikut: mendapatkan diagnosis
jaringan, memulihkan aliran cairan serebrospinal dan dekompresi struktur
saraf yang berdekatan, dan alternatif non-bedah ketika prosedur invasif
menghalangi atau tidak lengkap. reseksi Total Gross dari astrocytomas
pilocytic memberikan hasil klinis terbesar.34 Ketika resiko pembedahan
terlalu tinggi atau jika reseksi total gross tidak dapat dilakukan,
pertimbangan untuk radio dan kemoterapi dapat diberikan. Risiko jangka

38

panjang dari radioterapi pada anak-anak menyarankan itu digunakan hanya


dalam kasus-kasus kekambuhan atau pilocytic astrocytomas dengan sifat
agresif. Sementara berbagai seri kasus telah ditemukan hidup lama setelah
terapi radiasi pada anak-anak,35-37 tingkat kekambuhan setelah 5 tahun
tetap tinggi. Dalam percobaan prospektif 10 tahun di mana praktisi merasa
iradiasi menimbulkan risiko tinggi cedera neurokognitif, sebuah
carboplatin
thioguanine,

dan

vincristine

prokarbazin,

(CV)

rejimen

Lomustin,

dan

dibandingkan

dengan

vincristine

(TPCV)

rejimen. Meskipun lima tahun kelangsungan hidup acara bebas muncul


lebih menguntungkan menggunakan TPCV, toksisitas diamati dengan baik
rejimen disajikan keterbatasan utama untuk efektivitas jangka panjang
pada kedua kelompok.38 Pendekatan multimodality terdiri dari reseksi
bedah, terapi radiasi, dan kemoterapi digunakan dalam pengobatan glioma
ganas. Bedah memainkan peran kunci dalam pengobatan glioma ganas
karena memungkinkan untuk kedua cytoreduction dan konfirmasi
diagnosis. Selain itu, ada bukti yang berkembang dalam literatur yang
mencapai reseksi total gross penting dalam memperpanjang kelangsungan
hidup.39,40 Sebagaimana dibahas dalam bagian pencitraan, kemajuan dalam
neuroimaging

dan

otak

pemetaan

telah

memungkinkan

untuk

meningkatkan total reseksi kotor.Terapi radiasi saat ini direkomendasikan


untuk semua pasien dengan kelas III dan IV glioma (astrositoma
anaplastik dan GBM, masing-masing). Hanya bayi, anak-anak yang
hampir mati, dan pasien menurun pengobatan mendukung perawatan
suportif tidak akan direkomendasikan untuk menerima beberapa bentuk
terapi radiasi tak lama setelah diagnosis. Terapi radiasi saja telah
ditunjukkan untuk meningkatkan kelangsungan hidup rata-rata 3-4 bulan
ke 9-12 bulan.41 Meskipun terapi radiasi telah menunjukkan peningkatan
yang jelas dalam hidup untuk pasien dengan GBMs primer, radioterapi
untuk GBMs berulang adalah kontroversial terutama disebabkan oleh
risiko serius terkait dengan reirradiation termasuk nekrosis jaringan otak
yang sehat.42 Meskipun risiko yang serius, studi menunjukkan mungkin

39

ada manfaat untuk terapi radiasi lebih terfokus melalui penggunaan


radiosurgery

stereotactic

atau

difraksinasi

reirradiation

stereotactic.44,45 Agen Alkylating adalah obat kemoterapi yang paling


sering

digunakan

dalam

mengobati

astrocytomas

anaplastik

dan

GBMs. Efek sitotoksik yang dimediasi terutama melalui DNA crosslinking, menyebabkan kematian sel oleh apoptosis. Carmustine (BCNU)
telah ditunjukkan untuk memperpanjang kelangsungan hidup pasien GBM
dalam

dua

uji

klinis.46,47

Namun,

karena

komplikasi

pasca-

operasi; penambahan BCNU protokol pengobatan pasien tidak jelas dan


akhirnya ditentukan oleh dokter yang merawat. Pada tahun 2005,
temozolomide ditunjukkan untuk meningkatkan kelangsungan hidup
median dan meningkatkan kemungkinan kelangsungan hidup jangka
panjang dengan GBM yang baru didiagnosis ketika diberikan bersamaan
dengan RT dan kemudian mengikuti RT.42 Sejak publikasi ini, protokol
Strupp, yang melibatkan operasi diikuti dengan radioterapi ditambah
bersamaan dan adjuvant temozolomide untuk pengobatan glioma ganas
adalah standar emas saat ini.42 Agen kemoterapi tambahan menargetkan
molekul tertentu yang saat ini digunakan dalam mengobati glioma ganas
termasuk inhibitor dari Epidermal Growth factor Receptor (EGFR),
trombosit-Derived Growth factor Receptor (PDGFR), Vascular endothelial
Growth factor (VEGFR), Sasaran mamalia dari rapamycin (mTOR),
Protein Kinase C (PKC), RAF-MEK-ERK jalur, dan integrin. 48 Dengan
agen kemoterapi baru yang sedang dikembangkan standar emas untuk
mengevaluasi agen ini tetap uji klinis acak. Baru-baru ini, sebuah
bevacizumab anti-VEGF antibodi monoklonal,, dievaluasi dalam dua acak
fase 3 uji klinis di mana ia menyimpulkan bahwa meskipun ada
ditingkatkan kelangsungan hidup bebas perkembangan, kelangsungan
hidup secara keseluruhan pada pasien tidak membaik. 49 Meskipun
kelangsungan hidup secara keseluruhan tidak membaik dalam studi ini,
kelangsungan hidup bebas perkembangan meningkat 3-4 bulan dan
bevacizumab mungkin masih menjanjikan sebagai pilihan untuk

40

mengobati

GBMs. Dengan

perkembangan

agen

kemoterapi

baru,

pendekatan multimodality gabungan termasuk baik kemoterapi dan


radioterapi diperlukan untuk mengatasi perlawanan tumor melalui
penggunaan strategi multi-target. Karena kelangsungan hidup pasien
dengan GBMs relatif singkat, mengidentifikasi indikator prognostik untuk
stratifikasi pasien menjadi resiko kelompok dapat memberikan berharga
dalam menentukan pendekatan terapi yang terbaik termasuk pendaftaran
ke uji klinis aktif. Lamborn dan rekannya meneliti 832 pasien GBM
terdaftar dalam uji klinis prospektif untuk mengidentifikasi kelompok
risiko potensial.50 Dari analisis mereka, mereka mengidentifikasi empat
kelompok risiko di mana dua kelompok risiko rendah termasuk pasien di
bawah usia 40 dengan kelompok risiko terendah secara keseluruhan
menjadi pasien muda dengan tumor lobus frontal. 50 Kelompok risiko
menengah termasuk pasien berusia 40-65 dengan KPS> 70 yang menjalani
reseksi subtotal atau total tumor. Akhirnya, kelompok risiko tertinggi
termasuk pasien yang berusia lebih dari 65 atau pasien berusia 40-65
dengan baik KPS <80 atau yang hanya menjalani biopsi. Selain usia pasien
dan skor KPS, parameter klinis lain melayani sebagai indikator prognostik
kelangsungan hidup jangka panjang. Ukuran tumor dan lokasi juga
indikator penting karena luasnya reseksi ditentukan tidak hanya oleh
ukuran tumor, tetapi juga oleh lokasi tumor. Akhirnya, kelas tumor
merupakan indikator penting dari kelangsungan hidup jangka panjang
sebagai tinggi kelas semakin ganas tumor, yang langsung menghasilkan
prognosis yang lebih buruk.
2. oligodendriglioma
Pembedahan terutama disediakan untuk ODGs kelas rendah, sedangkan
data bedah untuk ODGs kelas tinggi kurang meyakinkan. Terapi radiasi
untuk ODGs juga tidak jelas dengan satu studi retrospektif menunjukkan
tingkat kelangsungan hidup 10-tahun dari 56% pada pasien yang
menerima radiasi pasca operasi> 45 Gy,50 sedangkan dalam penelitian lain,
tidak ada perbedaan dalam ketahanan hidup 5 tahun adalah diamati pada
pasien dengan atau tanpa radiasi pasca operasi.50 Oleh karena kemoterapi

41

adalah modalitas utama untuk mengobati ODGs karena kebanyakan


menanggapi kemoterapi.54 Tingkat kelangsungan hidup 10-tahun untuk
ODGs adalah 10-30% dengan ODGs murni memiliki tingkat kelangsungan
hidup lebih tinggi dari ODGs campuran.50 Kehadiran kalsifikasi pada
pencitraan sebagai indikator prognostik dievaluasi dalam satu seri,
bagaimanapun, penelitian tambahan diperlukan sebelum kesimpulan yang
dapat diambil.50 Akhirnya, kromosom 1p dan 19q kerugian dikaitkan
dengan tingkat ketahanan hidup lebih lama.
3. Ependymoma
Sejak ependymomas sangat radiosensitif, pendekatan terbaik untuk
pengobatan ependymomas adalah reseksi total gross diikuti dengan terapi
radiasi. Peran kemoterapi untuk pengobatan ependymomas saat ini tidak
jelas.
4. Medulloblastoma
Medulloblastomas adalah salah satu tumor yang paling radiosensitif dari
sistem saraf pusat dan cukup kemosensitif. Oleh karena itu, pendekatan
terapi yang disarankan adalah debulking bedah diikuti dengan terapi
radiasi. 36 Gy untuk seluruh sumbu craniospinal dengan dorongan untuk
tidur tumor untuk total 55 Gy adalah dianjurkan terapi radiasi
dosis. Medulloblastomas yang cukup kemosensitif, dan dengan demikian,
kemoterapi sekarang merupakan bagian integral dari pengobatan tumor
ini, termasuk penyakit berulang. Beberapa agen kemoterapi digunakan
meliputi lomustin, cisplatin dan vincristine. Akhirnya, penempatan shunt
ventriculoperitoneal permanen diperlukan dalam 30-40% pasien setelah
reseksi tumor posterior fossa.50
5. Meningioma
Jika tumor tidak menyebabkan gejala, pertumbuhan tumor dapat
menyaksikan menggunakan MRI serial. Jika tidak, operasi adalah standar
perawatan untuk mengobati meningioma. Mirip dengan jenis tumor lain,
tingkat reseksi tumor bermanfaat untuk meminimalkan risiko kekambuhan
tumor. Akibatnya, pada tahun 1957, Simpson membentuk sistem
klasifikasi yang terdiri dari lima subdivisi untuk menilai sejauh mana

42

reseksi meningioma dan untuk mengkorelasikan tingkat kekambuhan


pasca operasi dengan tingkat reseksi. Dalam sistem penilaian nya,
Simpson kelas I didefinisikan sebagai reseksi tumor lengkap dengan eksisi
lampiran dural dan setiap tulang yang abnormal.Jika sinus vena yang
terlibat, reseksi lengkap sinus juga dilakukan. Simpson kelas II
didefinisikan sebagai reseksi tumor lengkap dengan koagulasi dari
lampiran dural. Simpson kelas III didefinisikan sebagai reseksi tumor
lengkap tanpa reseksi atau pembekuan lampiran dural.Simpson kelas IV
didefinisikan sebagai reseksi subtotal. Akhirnya Simpson kelas V
didefinisikan

sebagai

dekompresi

sederhana,

dengan

atau

tanpa

biopsi. Risiko kekambuhan tumor (minimal 6 bulan follow-up) untuk kelas


Simpson I, II, III, dan IV yang 9%, 16%, 29%, dan 39%, masingmasing.50 Dengan kemajuan teknik bedah dan pilihan pengobatan, seperti
terapi radiasi, hanya mengandalkan pada sistem penilaian Simpson dari
meningioma di era modern untuk memprediksi kekambuhan tidak
meyakinkan. Oleh karena itu, penanda proliferasi sel, seperti Ki-67 (MIB1 - antibodi monoklonal) sedang dievaluasi untuk melengkapi sistem
penilaian Simpson dalam memprediksi tumor kekambuhan.51 Dalam
penelitian yang dilakukan oleh Oya dan rekan, mereka memutuskan bahwa
indeks MIB-1 bisa membedakan meningioma dengan risiko tinggi
kekambuhan.51 Selanjutnya,

para

penulis

menyimpulkan

bahwa

menggunakan indeks MIB-1 dapat bermanfaat dalam perencanaan strategi


tindak lanjut yang optimal dengan pergeseran dari mencoba reseksi agresif
untuk menilai kualitas hidup pasien.51 Beberapa studi retrospektif telah
menunjukkan bahwa terapi radiasi ( misalnya, eksternal terapi radiasi sinar
dan radiosurgery stereotactic) dapat memberikan peningkatan dan tahan
lama kontrol lokal pada pasien tertentu dengan meningioma.52 Untuk WHO
Grade I atau kelas I meningioma dianggap, terapi radiasi mencapai kontrol
lokal jangka panjang dalam 68% sampai 100% dari kasus pada 5 sampai
10 tahun, termasuk pasien yang dirawat pasca operasi, terutama, atau
mengikuti tumor recurrence.169 Penggunaan radiosurgery stereotactic

43

dianggap paling efektif untuk pasien dengan meningioma kecil (biasanya


kurang dari 3 cm atau 10 cm3 volume), orang-orang dengan margin yang
berbeda, dan orang-orang di jarak yang cukup dari otak fungsional
penting, saraf, dan struktur penting lainnya untuk mengizinkan pengiriman
aman dosis yang cukup target.52 Untuk meningioma bermutu tinggi,
pendekatan multimodal menggunakan terapi radiasi dan / atau kemoterapi
biasanya diberikan. Mencapai reseksi maksimum dan radioterapi adjuvant
telah terbukti menjadi prediktor independen kelangsungan hidup pasien
dan kelangsungan hidup bebas penyakit dalam pengobatan meningioma
ganas. Mengevaluasi radiosurgery stereotactic dalam pengaturan reseksi
subtotal atau kekambuhan, melaporkan tingkat kontrol lokal (> 2 tahun)
berkisar dari 0% sampai 90%, dengan mayoritas jatuh dalam 50% sampai
80% untuk WHO grade II meningioma. Sementara beberapa studi telah
menyarankan

radiosurgery

stereotactic

tidak

diindikasikan

untuk

meningioma ganas53, yang lain telah menunjukkan peningkatan tingkat


kontrol lokal dari 17% pada 15 bulan.54 Akhirnya, untuk meningioma
atipikal atau anaplastik berulang tidak cocok untuk radiosurgery, reseksi
diikuti oleh brachytherapy permanen adalah terapi penyelamatan potensi
yang menjanjikan dalam pengaturan klinis. 55,56 Pada seri terbesar (n = 21)
sampai saat memeriksa brachytherapy untuk terapi untuk kekambuhan
meningioma atipikal dan anaplastik agresif, Ware et al. melaporkan hidup
rata-rata 1,6 tahun setelah implantasi untuk meningioma atipikal dan 2,4
tahun untuk meningioma anaplastik. Karena tingkat komplikasi yang
tinggi diamati termasuk nekrosis radiasi terjadi di 27% dalam satu studi,
teknik bedah teliti dan terapi medis untuk membantu penyembuhan luka
setelah operasi diperlukan. Untuk meningioma yang bisa dioperasi dan /
atau radiasi-tahan api, kemoterapi sering digunakan dengan sedikit tidak
berpengaruh. Sebagai hasil dari pendekatan kemoterapi gagal, beberapa
studi telah menyelidiki berbagai kemoterapi di mana semua telah
mengecewakan.57,58 Meskipun

ada

keterbatasan

data,

HU,

analog

somatostatin dan interferon- semuanya telah cukup sukses pada pasien

44

dengan meningioma berulang. Selanjutnya, muncul terapi bertarget


termasuk sunitinib, mungkin berguna dalam meningioma tahan api
6. Adenoma Hipofisis
MR pencitraan dengan kontras pada protokol hipofisis adalah standar
emas untuk mengevaluasi tumor hipofisis. Karena kelenjar pituitari yang
normal juga meningkatkan, waktu kontras penting dalam mencapai
gambar-spasial resolusi tinggi yang mampu membedakan jaringan
hipofisis yang normal dari makroadenoma.59 Pada pasien dengan nonmensekresi tumor dan tanpa neurologis defisit, adalah wajar untuk
mengikuti

pasien

dengan

MRI

serial

dan

pemeriksaan

bidang

visual. Pilihan pengobatan saat ini untuk adenoma hipofisis gejala


termasuk reseksi bedah, terapi radiasi dan terapi obat (baris pertama untuk
mengobati prolaktinoma). Tiga agonis dopamin secara rutin diberikan
untuk mengobati prolaktinoma dan termasuk bromocriptine, carbergoline,
dan pergolid. Bedah menggunakan pendekatan transsphenoidal biasanya
pengobatan

lini

pertama

untuk

subtipe

lain

dari

adenoma

hipofisis.60,61 Terapi medis juga digunakan untuk pasien dengan adenoma


somatotrophic dan termasuk agonis dopamin (misalnya, bromocriptine),
analog somatostatin (misalnya, octreotide), dan antagonis hormon
pertumbuhan

(misalnya,

thyrotropin-mensekresi

pegvisomant). Pengobatan

biasanya

melibatkan

analog

untuk

tumor

somatostatin

(misalnya, octreotide). Untuk pengobatan adenoma hipofisis, terapi radiasi


konvensional biasanya terdiri dari 40-50 Gy diberikan dalam 20-25 fraksi
selama 4-6 minggu. Meskipun efektif, komplikasi yang terkait dengan
terapi radiasi yang tinggi. Salah satu komplikasi pasca-radiasi utama
adalah hipopituitarisme, yang kedua dosis-dan tergantung waktu. Selain
itu, cedera pada saraf optik dan kiasma, lesu, gangguan memori,
kelumpuhan saraf kranial, dan nekrosis tumor dengan perdarahan dan
pitam juga dapat terjadi. Efek terapi radiasi pada adenoma somatotrophic
adalah kumulatif dengan waktu dan dapat mengambil 10 tahun untuk

45

mengurangi

kadar

berbagai. Sebaliknya,

hormon
untuk

pertumbuhan
penyakit

menjadi

Cushing,

"kuratif"

terapi

radiasi

mengembalikan tingkat ACTH ke kisaran normal antara 18 dan 42


bulan. Penggunaan radiosurgery untuk pengobatan tumor hipofisis masih
terbatas pada pusat-pusat tersier dan protokol yang tidak standar.
7. Tumor Metastasis
Pendekatan saat ini untuk pengelolaan metastase otak didorong oleh faktor
prognostik, termasuk Karnofsky Status Kinerja (KPS), histologi tumor,
jumlah metastasis, usia pasien, dan status penyakit sistemik.62 Pendekatan
ini meliputi operasi, Whole Brain Radioterapi (WBRT), Stereotactic
Radiosurgery (SRS), dan kemoterapi. Standar perawatan untuk mengobati
lesi ini biasanya adalah operasi dan / atau radiosurgery. Dalam kasus
beberapa lesi, WBRT mungkin menjadi pilihan yang layak. Sayangnya
untuk sebagian besar tumor otak metastatik, tidak ada pilihan kemoterapi
yang baik. Bedah Reseksi: Informed penilaian klinis sangat penting ketika
mempertimbangkan reseksi bedah MBT. Kandidat bedah yang tepat harus
bebas dari perkembangan kanker sistemik, telah dikendalikan penyakit
utama, dan fungsi independen seperti terlihat oleh KPS> 70. Selain itu,
pasien dengan lesi otak soliter umumnya manfaat lebih dari intervensi
bedah dibandingkan dengan beberapa lesi otak.63 Prediktor negatif
termasuk penyakit ekstrakranial luas dan skor kinerja Karnofsky rendah
(KPS

<70). Sebagai

bukti

dan

pengetahuan

penyakit

metastatik

mengembang, operasi sekarang sedang dianggap sebagai salah satu


pengobatan utama untuk metastase otak. Dengan demikian, praktik terbaik
untuk reseksi bedah sedang dievaluasi. Dalam dua studi banding
retrospektif dari MD Anderson, en bloc reseksi dibandingkan dengan
reseksi sedikit demi sedikit pada pasien dengan metastasis tunggal
supratentorial dan infratentorial. Studi ini menunjukkan bahwa ada
peningkatan yang signifikan dalam risiko leptomeningeal diseminasi pada
pasien yang menjalani sedikit demi sedikit reseksi tumor dibandingkan
dengan en bloc reseksi64 dan risiko yang lebih tinggi kekambuhan tumor

46

lokal dengan reseksi sedikit demi sedikit dibandingkan dengan en bloc


reseksi.65 Ketika dikombinasikan dengan WBRT pasca operasi, operasi
telah terbukti secara dramatis meningkatkan kelangsungan hidup, kontrol
lokal, dan durasi fungsi independen pada pasien tertentu dengan tumor
soliter. Membandingkan strategi pengobatan pada pasien dengan 1-3 MBT,
dikombinasikan operasi + WBRT (2 tahun tingkat kekambuhan 23%
-42%) telah mengungguli WBRT saja (tingkat kekambuhan pada <1 yr,
43%).66,67 Radiasi:Terapi radiasi umumnya digunakan untuk mengobati
metastasis otak. Penambahan WBRT meningkatkan kelangsungan hidup
pasien untuk 4 sampai 7 bulan. Beberapa penelitian telah menunjukkan
bahwa pengobatan radiasi focal selain WBRT dapat meningkatkan
kelangsungan hidup hingga 12 bulan. Sebuah percobaan Terapi Radiasi
Oncology Group (RTOG 9508) menyimpulkan beberapa aspek penting
dari terapi radiasi dalam pengobatan metastasis otak. Misalnya, dalam
kasus metastasis otak tunggal, SRS selain WBRT ditunjukkan untuk
meningkatkan kelangsungan hidup. Dalam kasus beberapa metastasis otak
(terbatas dalam hal ini untuk 1-3), The RTOG 95-08 percobaan
menyimpulkan bahwa SRS selain WBRT memberikan manfaat paliatif dan
harus digunakan untuk pasien yang memiliki KPS> 70. Untuk pasien
dengan

lebih

dari

metastasis

otak,

SRS

belum

terbukti

efektif. Kemoterapi: Beberapa agen kemoterapi telah dipelajari dalam


kombinasi dengan WBRT untuk pasien dengan metastase otak. Manfaat
jangka panjang dari mengobati MBT menggunakan kemoterapi belum
terlihat, meskipun, respon klinis positif dari agen anti-kanker dengan cepat
dirusak oleh toksisitas obat. Ini kualitas dampak negatif dari kehidupan
dan hasil dalam manfaat minimal untuk kelangsungan hidup secara
keseluruhan. Kebetulan, ada agen kemoterapi telah disetujui untuk
pengobatan MBT. Tantangan utama untuk sukses kemoterapi adalah
pemberian obat melintasi penghalang darah-otak (BBB). Agen kemoterapi
baru yang mampu melintasi BBB dapat mempromosikan kelangsungan
hidup dan pada akhirnya meningkatkan prospek suram yang ditimbulkan

47

oleh MBT. Data awal dari inhibitor topoisomerase I, topotecan, yang


melintasi BBB, telah terbukti efektif dalam mengobati metastase otak dari
paru-paru sel kecil dan kanker payudara.68 Agen alkylating disetujui untuk
pengobatan

glioma

ganas,

temozolomide

(TMZ),

juga

memiliki

kemampuan untuk menyeberangi BBB dan mungkin efektif terhadap otak


metastasis

sekunder

untuk

melanoma.69 Selain

itu,

TMZ

dapat

dikombinasikan dengan cisplatin untuk mengobati metastasis dari kanker


bukan sel kecil paru-paru, kanker payudara, dan melanoma. 70 Akhirnya,
suatu

senyawa

lipid-terkonjugasi

baru,

DM-Choc-PEN,

telah

menunjukkan hasil yang menjanjikan di Tahap I uji klinis . Setelah


melintasi BBB, DM-Choc-PEN adalah istimewa diambil oleh sel-sel
tumor,

sehingga

sitotoksisitas

melalui

pseudo-alkilasi

N7-guanin,

sementara hemat parenkim otak normal.

DAFTAR PUSTAKA
1. Sagar, S.M. and Israel, M.A., 2010. Primary and Metastatic Tumors of the
Nervous System. In: Hauser, S.L., ed. Harrisons Neurology in Clinical
Medicine. 2nd ed. United States of America: The McGraw-Hill
Companies, 408-422.
2. Soffieti R, Cornu P, Grant R, Graus F, Grisold W, et al. EFNS guideline on
diagnosis and treatment of brain metastases: report of an EFNS Task
Force. European Journal of neurology 2006; 13:674-81.
3. Central Brain Tumor Registry of the United States. "CBTRUS statistical
report: primary brain and central nervous system tumors diagnosed in the
United States in 2004-2006." (2010).
4. Mardjono, Mahar. Proses neoplasmatik di susunan saraf. Dalam: neurologi
klinis dasar. Jakarta: PT. Dian Rakyat; 2008.
5. Elias S. Neuroanatomia medica. 2nd ed. Jakarta: Penerbit Universitas
Indonesia. 1985. p. 63-119

48

6. National Library of Medicine. Medline Plus, Encyclopedia: Meninges of


the
brain.http://www.nlm.nih.gov/medlineplus/ency/imagepages/19080.htm
7. Aggarwal, R., H. Brough, and H. Ellis. "Medical student participation in
surface anatomy classes." Clinical Anatomy 19.7 (2006): 627-631.
8. Moore, Keith L., Arthur F. Dalley, and Anne MR Agur. Clinically oriented
anatomy. Lippincott Williams & Wilkins, 2013.
9. Price, A. Silvia; Wilson, M. Lorraine, Patofisiologi, Konsep Klinis Proses
proses Penyakit, 901 929, 1021 1022, EGC, Jakarta, 1995.
10. Marieb, Elaine N, PhD, Essentials of Human Anatomy & Fisiologi, Chap.
5 : 88 92, Chap.6 : 117 125, Second edition, Benjamin / Cumming
Publishing Co, California, 1988.
11. Louis, David N., et al. "The 2007 WHO classification of tumours of the
central nervous system." Acta neuropathologica 114.2 (2007): 97-109.
12. Kumar, V., Abbas, A.K., Aster, J.C., 2013. Robbins Basic Pathology. 9th
ed.
Philadelphia: Saunders Elsevier, 842-849.
13. Collins, V. P. "Brain tumours: classification and genes." Journal of
Neurology, Neurosurgery & Psychiatry 75.suppl 2 (2004): ii2-ii11.
14. Al-Hussaini, Maysa. Histology of primary brain tumors. INTECH Open
Access Publisher, 2013.
15. Fung, Kar-Ming, Zhongxin Yu, and Kalliopi Petropoulou. "Tumors of the
central nervous system." Pediatric Malignancies: Pathology and Imaging.
Springer New York, 2015. 151-201.
16. Wippold, F. J., et al. "Neuropathology for the neuroradiologist: palisades
and pseudopalisades." American journal of neuroradiology 27.10 (2006):
2037-2041.
17. American Brain Tumor Association, 2012. Ependymoma. Chicago:
American

Brain

Tumor

Association.

Tersedia

di:

http://www.abta.org/brain-tumorinformation/types-oftumors/ependymoma.html
18. Riemenschneider M. J., Perry A., Reifenberger G., 2006. Histological
classification and molecular genetics of meningiomas. Lancet Neurology.

49

5:

1045-1054.

Tersedia

di:

http://www.unilim.fr/campusneurochirurgie/IMG/pdf/LancetNe.pdf
[Diakses 20 November 2014]
19. Blumcke, I, & Wiestler, O. D. Gangliogliomas: an intriguing tumor entity
associated with focal epilepsies. J Neuropathol Exp Neurol, (2002). , 575584
20. Luyken, C, et al. Supratentorial gangliogliomas: histopathologic grading
and tumor recur rence in 184 patients with a median follow-up of 8 years.
Cancer, (2004). , 146-155.
21. Hassoun, J, et al. Central neurocytoma: a synopsis of clinical and
histological features. Brain Pathol, (1993). , 297-306.
22. Ikota, H, et al. Clinicopathological and immunohistochemical study of 20
choroid plexus tu mors: their histological diversity and the expression of
markers useful for differentiation from metastatic cancer. Brain Tumor
Pathol, (2011). , 215-221.
23. Jeibmann, A, et al. Prognostic implications of atypical histologic features
in choroid plexus papilloma. J Neuropathol Exp Neurol, (2006). , 10691073.
24. Sobirin, 2001. Hubungan Letak dan Ukuran Tumor Otak dengan
Abnormalitas Elektroensefalogram. Semarang: Universitas Diponegoro.
Tersedia di: eprints.undip.ac.id/12241/1/2001PPDS704.pdf
25. Deangelis, L.M. and Rosenfeld, S.S., 2010. Tumors:

General

Considerations. In: Rowland, L.P., Pedley, T.A., eds. Merritts Neurology.


12th ed. Philadelphia: Lippincott Williams & Wilkins
26. Rohkamm, Reinhard, and Suzyon O'Neal Wandrey. Color atlas of
neurology. Thieme, 2004.
27. Aryal, G. "Histopathological pattern of central nervous system tumor: a
three year retrospective study." Journal of Pathology of Nepal 1.1 (2011):
22-25.
28. Kohler, Betsy A., et al. "Annual report to the nation on the status of cancer,
19752007,

featuring

tumors

of

the

brain

and

other

nervous

system." Journal of the National Cancer Institute 103.9 (2011): 714-736.


29. Seidel, Clemens, et al. "Does age matter?-A MRI study on peritumoral
edema in newly diagnosed primary glioblastoma." BMC cancer 11.1
(2011): 1.

50

30. Van Vuurden, Dannis Gilbert, et al. "PARP inhibition sensitizes childhood
high

grade

glioma,

medulloblastoma

and

ependymoma

to

radiation." Oncotarget2.12 (2011): 984-996.


31. Omay, S. B., and M. A. Vogelbaum. "Current concepts and newer
developments in the treatment of malignant gliomas." Indian journal of
cancer46.2 (2009): 88.
32. National Cancer Institute, 2014. Adult Brain Tumors Treatment (PDQ):
Treatment Option Overview. United States of America: National Cancer
Institute.Tersedia

di:

http://www.cancer.gov/cancertopics/pdq/treatment/adultbrain/HealthProfes
sional/page3
33. Ye JM, Ye MJ2, Kranz S3, Lo P4 (2014) A 10 year retrospective study of
surgical outcomes of adult intracranial pilocytic astrocytoma. J Clin
Neurosci 21: 2160-2164.
34. Due-Tnnessen BJ, Helseth E, Scheie D, Skullerud K, Aamodt G, et al.
(2002) Long-Term Outcome after Resection of Benign Cerebellar
Astrocytomas in Children and Young Adults (019 Years): Report of 110
Consecutive Cases. Pediatr Neurosurg 37: 71-80.
35. Viano JC, Herrera EJ, Surez JC (2001) Cerebellar astrocytomas: a 24year experience. Childs Nerv Syst 17: 607-610.
36. Dirven CMF, Mooij JJA, Molenaar WM (1997) Cerebellar pilocytic
astrocytoma: a treatment protocol based upon analysis of 73 cases and a
review of the literature. Childs Nerv Syst 13: 17-23.
37. Hadjipanayis CG, Kondziolka D, Gardner P, Niranjan A, Dagam S, et al.
(2002) Stereotactic radiosurgery for pilocytic astrocytomas when
multimodal therapy is necessary. J Neurosurg 97: 56-64.
38. Ater JL, Zhou T, Holmes E, Mazewski CM, Booth TN, et al. (2012)
Randomized Study of Two Chemotherapy Regimens for Treatment of
Low-Grade Glioma in Young Children: A Report From the Children's
Oncology Group. J Clin Oncol 30: 2641-2647.
39. Kramm CM, Wagner S, Van Gool S, Schmid H, Strater R, et al. (2006)
Improved Survival after Gross Total Resection of Malignant Gliomas in
Pediatric Patients from the HIT-GBM Studies. Anticancer Research 26:
3773-3779.

51

40. Hentschel SJ, Sawaya R (2003) Optimizing outcomes with maximal


surgical resection of malignant gliomas. Cancer Control 10: 109-114.
41. Walker MD, Alexander E Jr, Hunt WE, MacCarty CS, Mahaley MS Jr, et
al. (1978) Evaluation of BCNU and/or radiotherapy in the treatment of
anaplastic gliomas. A cooperative clinical trial. J Neurosurg 49: 333-343.
42. Stupp R, Mason WP, van den Bent MJ, Weller M, Fisher B, et al. (2005)
Radiotherapy

plus

concomitant

and

adjuvant

temozolomide

for

glioblastoma. N Engl J Med 352: 987-996.


43. Butowski NA, Sneed PK, Chang SM (2006) Diagnosis and treatment of
recurrent high-grade astrocytoma. J Clin Oncol 24: 1273-1280.
44. Tsao M, Mehta M, Whelan T, Morris D, Hayman J, et al. (2005) e
American Society for erapeutic Radiology and Oncology (ASTRO)
evidence-based review of the role of radiosurgery for malignant glioma.
International journal of radiation oncology, biology, physics 63: 47-55.
45. Combs SE, ilmann C, Edler L, Debus J, Schulz-Ertner D (2005) Efficac\
of Fractionated Stereotactic Reirradiation in Recurrent Gliomas:
LongTerm Results in 172 Patients Treated in a Single Institution. J Clin
Oncol 23: 8863-8869.
46. Westphal M, Hilt DC, Bortey E, Delavault P, Olivares R, et al. (2003) A
phase 3 trial of local chemotherapy with biodegradable carmustine
(BCNU) wafers (Gliadel wafers) in patients with primary malignant
glioma. Neuro Oncol 5: 79-88.
47. Minniti G, Muni R, Lanzetta G, Marchetti P, Enrici RM (2009)
Chemotherapy for glioblastoma: current treatment and future perspectives
for cytotoxic and targeted agents. Anticancer Res 29: 5171-5184.
48. Gilbert MR, Dignam JJ, Armstrong TS, Wefel JS, Blumenthal DT, et al.
(2014) A randomized trial of bevacizumab for newly diagnosed
glioblastoma. N Engl J Med 370: 699-708.
49. Chinot OL, Wick W, Mason W, Henriksson R, Saran F, et al. (2014)
Bevacizumab plus radiotherapy-temozolomide for newly diagnosed
glioblastoma. N Engl J Med 370: 709-722.
50. Strong MJ, Garces J, Vera JC, Mathkour M, Emerson N, et al. (2015)
Brain Tumors: Epidemiology and Current Trends in Treatment. Brain
Tumors Neurooncol 1: 102.

52

51. Oya S, Kawai K, Nakatomi H, Saito N (2012) Significance of Simpson


grading system in modern meningioma surgery: integration of the grade
with MIB-1 labeling index as a key to predict the recurrence of WHO
Grade I meningiomas. J Neurosurg 117: 121-128.
52. Rogers L, Barani I, Chamberlain M, Kaley TJ, McDermott M, et al. (2015)
Meningiomas: knowledge base, treatment outcomes, and uncertainties. A
RANO review. J Neurosurg 122: 4-23.
53. Modha A, Gutin PH (2005) Diagnosis and treatment of atypical and
anaplastic meningiomas: a review. Neurosurgery 57: 538-550.
54. Kondziolka D, Mathieu D, Lunsford LD, Martin JJ, Madhok R, et al.
(2008)

Radiosurgery

as

definitive

management

of

intracranial

meningiomas. Neurosurgery 62: 53-58.


55. Ware ML, Larson DA, Sneed PK, Wara WW, McDermott MW (2004)
Surgical resection and permanent brachytherapy for recurrent atypical and
malignant meningioma. Neurosurgery 54: 55-63.
56. Walcott BP, Nahed BV, Brastianos PK, Loeffler JS (2013) Radiation
Treatment for WHO Grade II and III Meningiomas. Front Oncol 3: 227.
57. Chamberlain MC1 (2012) e role of chemotherapy and targeted therapy in
the treatment of intracranial meningioma. Curr Opin Oncol 24: 666-671.
58. Kaley TJ, Wen P, Schi D, Ligon K, Haidar S, et al. (2015) Phase II trial
of sunitinib for recurrent and progressive atypical and anaplastic
meningioma. Neuro Oncol 17: 116-121.
59. Chaudhary V, Bano S (2011) Imaging of the pituitary: Recent advances.
Indian J Endocrinol Metab 15 Suppl 3: S216-223.
60. Sanno N, Teramoto A, Osamura RY (2000) Long-term surgical outcome in
16 patients with thyrotropin pituitary adenoma. J Neurosurg 93: 194-200.
61. Melmed S1 (2006) Medical progress: Acromegaly. N Engl J Med 355:
2558-2573.
62. Eichler AF, Loeffler JS (2007) Multidisciplinary management of brain
metastases. Oncologist 12: 884-898.
63. Hazard LJ, Jensen RL, Shrieve DC (2005) Role of stereotactic
radiosurgery in the treatment of brain metastases. Am J Clin Oncol 28:
403-410.
64. Suki D, Hatiboglu MA, Patel AJ, Weinberg JS, Groves MD, et al. (2009)
Comparative risk of leptomeningeal dissemination of cancer after surgery

53

or stereotactic radiosurgery for a single supratentorial solid tumor


metastasis. Neurosurgery 64: 664-676.
65. Patel AJ, Suki D, Hatiboglu MA, Abouassi H, Shi W, et al. (2010) Factors
influencing the risk of local recurrence after resection of a single brain
metastasis. J Neurosurg 113: 181-189.
66. Andrews DW, Scott CB, Sperduto PW, Flanders AE, Gaspar LE, et al.
(2004) Whole brain radiation therapy with or without stereotactic
radiosurgery boost for patients with one to three brain metastases: phase
III results of the RTOG 9508 randomised trial. Lancet 363: 1665-1672.
67. Kocher M, Soffietti R, Abacioglu U, Vill S, Fauchon F, et al. (2011)
Adjuvant whole-brain radiotherapy versus observation after radiosurgery
or surgical resection of one to three cerebral metastases: results of the
EORTC 22952-26001 study. J Clin Oncol 29: 134-141.
68. Wong ET, Berkenblit A (2004) e role of topotecan in the treatment of
brain metastases. Oncologist 9: 68-79.
69. Agarwala SS, Kirkwood JM, Gore M, Dreno B, atcher N, et al. (2004)
Temozolomide for the treatment of brain metastases associated with
metastatic melanoma: a phase II study. J Clin Oncol 22: 2101-2107.
70. Christodoulou C, Bafaloukos D, Linardou H, Aravantinos G, Bamias A, et
al. (2005) Temozolomide (TMZ) combined with cisplatin (CDDP) in
patients with brain metastases from solid tumors: a Hellenic Cooperative
Oncology Group (HeCOG) Phase II study. J Neurooncol 71: 61-65.

54