Anda di halaman 1dari 38

BABI

PENDAHULUAN
BABII
TINJAUANPUSTAKA

2.1FATIGUE
Fatigue atau kelelahan adalah salah satu gejala yang paling umum di dalam
kedokteran klinis. Fatigue adalah manifestasi yang timbul dari penyakit sistemik,
neurologi,psikiatriksindrom,meskipunpenyebabpastitidakdiidentifikasikandalam
beberapapasien.Kelelahanmengacupadapengalamanmanusiasecarasubjektifdari
kelelahan fisikdanmental.Dalamkontekskedokteranklinis,fatiguedidefinisikan
sebagaikesulitandalammemulaiataumempertahankanaktivitas mentaldanfisik.
Hampirsemuaorangyangpernahmenderitapenyakitselflimitingtelahmengalami
gejala yang universal dan fatigue biasanya menjadi pusat perhatian medis bila
penyebabnyatidakdiketahuiatautidakjelasataukeparahanyangtidaksesuaidengan
pemicunya.
Kelelahanharusdibedakandarikelemahanotot,penurunankekuatanneuromuskuler;
sebagianbesarpasienmengeluhkelelahan tidakmengelami kelemahanototketika
kekuatanototdiperiksa.Menurutdefinisi,kelelahanjugaberbedadarisomnolendan
dispneu saat aktifitas, meskipun pasien dapat menggunakan kata fatigue untuk
mendeskripsikankeduagejalatersebut.Tugasyangdihadapiolehparadokterklinis
ketika pasien dengan gejala fatigue adalah untuk mengidentifikasi penyebab yang
mendasarinyadanuntukmengembangkanaliansiterapi.
EPIDEMIOLOGI
Variabilitasdalamdefinisikelelahandaninstrumentalsurveidigunakandalamstudi
yangberbedamembuatnyasulituntuksampaipadaangkayangtepattentangbeban
globaldarikelelahan.Prevalensikelelahanadalah6,7%danprevalensiseumurhidup
adalah25%daripopulasiumumASmelaluiNationalInstituteKesehatanMental
survei.DiklinikperawatanprimerdiEropadanAmerikaSerikat,antara10dan25%
daripasienyangdisurveididapatkangejalaprolongedfatigue(>1bulan)ataukronis
1

fatigue (> 6 bulan ),tetapi hanya sebagian kecil pasien yang mendapat perhatian
medisuntukmencaripenyebabutamadarifatigue.Dalamsebuahsurveikomunitas
perempuan di India , 12 % dilaporkan mengalami kelelahan kronis. Sebaliknya,
prevalensisindromkelelahankronis,sepertiyangdidefinisikanolehPusatASuntuk
PengendaliandanPencegahanPenyakit,tergolongrendah.
DIAGNOSADIFERENSIAL
-

Psikiatrik
Kelelahan merupakan manifestasi somatik umum dari banyak sindrom
psikiatrik, termasuk depresi, kecemasan, dan gangguan somatoform. Fejala
kejiwaandilaporkanlebihdaritigaperempatpasiendengankelelahankronis
yangtidakdapatdijelaskan.Bahkanpadapasiendengansindromsistemikatau
neurologisyangsecaraindependenmenjelaskanfatiguesebagaimanifestasi
daripenyakit,gejalakejiwaanmasihmungkinmenjadisumberpentingdari
interaksi.

Neurologi
Pasienmengeluhkelelahanseringmengatakanmerasalemah,tetapisetelah
pemeriksaandenganseksama,kelemahanototsecaraobjektifjarangdilihat.
Jikaditemukankelemahanototkemudianharusditentukanletakkelainannya:
sistemsarafpusat,sistemsarafperifer,neuromuskulerjunction,atauototdan
dilakukanpemeriksaantindaklanjutyangsesuai.Fatigabilitasdarikekuatan
ototmerupakanmanifestasikardinaldaribeberapagangguanneuromuskuler
seperti myasthenia gravis dan dapat dibedakan dari kelelahan dengan
menemukanpenurunanklinisyangjelasdarijumlahgayayangmenghasilkan
ototpadakontraksiberulang.
Kelelahan adalah salah satu gejala yang paling umum dilaporkan pada
penyakit multiple sclerosis (MS), yang mempengaruhi hampir 90% dari
pasien. Kelelahan pada MS dapat bertahan antara serangan MS dan tidak
selalu berkorelasi dengan aktivitas penyakit pada pemeriksaan magnetic
resonanceimaging(MRI).
Kelelahanjugadapatdiidentifikasipadabeberapapenyakitneurodegenerative
lainnya,termasukpenyakitParkinson,dysautonomiaspusat,danamyotrophic
lateral sclerosis. Pasca stroke kelelahan dapat dijelaskan tetapi kurang

dipahamidenganprevalensisangatberagam.Kelelahanepisodikjugadapat
menjadigejalapertandamigrain.Kelelahanjugamerupakanhasildaricedera
otaktraumatis,seringterjadidalamhubungandengandepresidangangguan
tidur.
-

Sleepdisorder
Sleepapneuobstruktifmerupakanpenyebabpentingdarirasangantuksiang
hari yang berlebihan yang berkaitan dengan kelelahan dan harus di tindak
lanjutin menggunakan polysomnography sepanjang malam. Terutama pada
pasien yang mendengkur, obesitas, atau prediktor lainnya dari sleep apneu
obstruktif.

Penyakitendokrin
Kelelahan ,kadangkadang berkaitan dengan kelemahan otot, bisamenjadi
gejala dari hipotiroidisme, terutama dalam konteks rambut rontok, kulit
kering, intoleransi udara dingin, sembelit, dan berat badan meningkat.
Kelelahandalamhubungandenganintoleransipanas,berkeringat,danjantung
berdebar khas dari hipertiroidisme. Insufisiensi adrenal juga bisa terwujud
dengan kelelahan yang tidak dapat dijelaskan sebagai gejala primer atau
menonjol, dalam hubungannya dengan anoreksia, penurunan berat badan,
mual,mialgia,danartralgia.Hiponatremiadanhiperkalemiadapatmuncul
padasaatdiagnosis.Hiperkalsemiaringandapatmenyebabkankelelahan,yang
mungkin relatif jelas , sedangkan hiperkalsemia yang parah dapat
menyebabkan letargi, stupor dan koma. Kedua hipoglikemia dan
hiperglikemiadapatmenyebabkanletargi,seringberkaitandenganconfusion;
diabetes kronis, terutama diabetes tipe 1 , juga terkait dengan kelelahan
independen kadarglukosa.Kelelahanjuga bisamenyertai Cushingdisease,
hypoaldosteronism,danhipogonadisme.

Penyakithatidanginjal
Gagalginjalkronisdangagalhatikronisdapatmenyebabkankelelahan.Lebih
dari80%pasienhemodialisamengeluhkelelahan.

Malnutrisi

Meskipunkelelahanjugamerupakanmanifestasidarimalnutrisi,tetapistatus
gizijugadapatmenjadikomorbiditaspentingdancontributorpadakelelahan
padapenyakitkronislainnya,termasukkankeryangterkaitfatigue.
-

Kardiovaskulardanpulmo
Kelelahanjugadapatditemukanpadapasiendengangagaljantungkongestif
dan penyakit paru obstruksi kronik dan menyebabkan kualitas hidup yang
buruk

Obatobatan
Penggunaannarkoba,drugwithdrawal,danpenggunaanalkoholkronis
semuadapatmenyebabkankelelahan.Obatobatanyanglebihmungkinuntuk
menjadipenyebabdalamkonteksinitermasukantidepresan,antipsikotik,
anxiolytics,opiat,agenantispasticity,agenantikejang,danbetablockers.

Malignancy
Kelelahan yang berkaitan dengan penurunan berat badan yang tidak
diinginkan dantidakdapatdijelaskan,dapatmenjaditandadarikeganasan.
Tetapi ini jarang diidentifikasi sebagai penyebab pada pasien dengan
kelelahankronisyangtidakdapatdijelaskandengantidakadanyatandatanda
maupungejalakanker.Canceryangterkaitdengankeganasandialamioleh40
% dari pasien pada saat diagnosis dan lebih besar dari 80 % dari pasien
kemudiandalamperjalananpenyakit.

Kehamilan
Kelelahanbiasadialamiolehwanitayangsedanghamilataupostpartum

Hematologi
Anemia kronis atau progresif mungkin hadir dengan kelelahan , kadang
kadangberkaitandengantakikardiasaataktivitasdansesaknapas.Anemia
jugadapatberkontribusiuntukterjadikelelahanpadapenyakitkronis.Rendah
feritin dalam serum dengan tidak adanya anemia juga dapat menyebabkan
kelelahanyangreversibeldenganpenggantianbesi.

Inflamasisistemik/penyakitrhematik
Kelelahanadalahkeluhanyangmenonjoldalambanyakgangguaninflamasi
kronis, termasuk lupus eritematosus sistemik, polymyalgia rheumatica,

rheumatoid arthritis, inflamatory bowel disease, antineutrophil sitoplasma


antibodi(ANCA)terkaitvaskulitis,sarcoidosis,dansindromSjgren
-

Infeksi
Kedua infeksi akut dan kronis umumnya menyebabkan kelelahan sebagai
bagian dari infeksi yang meluas. Evaluasi untuk infeksi yang tidak
terdiagnosis sebagai penyebab kelelahan yang tidak dapat dijelaskan dan
terutama berkepanjangan atau kronis, harus dipandu oleh riwayat pasien,
pemeriksaan fisik, dan faktor risiko infeksi, dengan perhatian khusus pada
risikountukTB,HIV,hepatitis BdanC,danendokarditis.Mononukleosis
jugadapatmenyebabkankelelahanberkepanjanganyangberlangsungselama
minggusampaibulansetelahpenyakitakut,tetapiinfeksivirusEpsteinBarr
sangatjarangmenjadipenyebabkelelahankronisyangtidakdapatdijelaskan

Obesitas

Disorderdenganpenyebabyangtidakjelas
Sindromkelelahankronisdanfibromyalgiamenggabungkankelelahankronis
sebagai bagian dari definisi sindrom dengan sejumlah kriteria inklusi dan
eksklusi lainnya. Patofisiologi masingmasing tidak diketahui. Kelelahan
kronisidiopatikdigunakanuntukmenggambarkansindromkelelahankronis
yangtidakdapatdijelaskandengantidakadanyagambaranklinistambahan
untukmemenuhikriteriadiagnostiksindromkelelahankronis.

2.2MULTIPELSKLEROSIS
DEFINISI
Multiple sklerosis adalah suatu penyakit autoimun kronik yang menyerang
myelinotakdanmedullaspinalis.Penyakitinimenyebabkankerusakanmyelindan
jugaaksonyangmengakibatkangangguantransmisikonduksisaraf.Peradanganyang
terjadidiotakdansumsumtulangbelakangyangmenyerangdaerahsubstansiaalba
danmerupakanpenyebabutamakecacatanpadadewasamuda.Penyebabnyadapat
disebabkan oleh banyak faktor, terutama proses autoimun. Focal lymphocytic
infiltration atau sel T bermigrasi keluar dari lymph node ke dalam sirkulasi
menembus sawar darah otak (blood brain barrier) secara terusmenerus menuju

lokasi dan melakukan penyerangan pada antigen myelin pada sistem saraf pusat
sepertiyangumumterjadipadasetiapinfeksi.Halinidapatmengakibatkanterjadinya
inflamasi, kerusakanpadamyelin (demyelinisasi), neuroaxonal injury,astrogliosis,
danprosesdegenerative. Akibat demyelinasi neuron menjadi kurangefisiendalam
potensialaksi.Transmisiimpulsyangdisampaikanolehneuronyangterdemyelinisasi
akan menjadi buruk. Akibat 'kebocoran' impuls tersebut, terjadi kelemahan dan
kesulitandalammengendalikanototataukegiatansensoriktertentudiberbagaibagian
tubuh.
EPIDEMIOLOGI
DiIndonesiapenyakitinitergolongjarangdibandingkanpenyakitneurologis
lainnya.MSlebihseringmenyerangperempuandibandingkanlakilakidenganrasio
2:1.Umumnyapenyakitinidideritamerekayangberusia2050tahun.MSbersifat
progresif dan dapat mengakibatkan kecacatan. Sekitar 50% penderita MS akan
membutuhkanbantuanuntukberjalandalam15tahunsetelahonsetpenyakit.
ETIOLOGI
Etiologidarikelainantersebutmasihbelumjelas. Adabeberapamekanisme
pentingyangmenjadipenyebabtimbulnyaMSyaituautoimun,(molecularmimikri),
infeksi,herediter,paparansinarmatahari.Meskipunbuktiyangmeyakinkankurang,
faktor makanan dan paparan toksin telah dilaporkan ikut berkontribusi juga.
Mekanisme ini tidak saling berdiri sendiri melainkan merupakan gabungan dari
berbagaifaktor.
1. Virus :EBV
2. Defisiensi vitamin D: vitamin D berfungsi untuk mengatur respon imun.
Vitamin D mengurangi produksi dari sitokin pro inflamatori dan
meningkatkanproduksisitokinantiinflamatori.
3. Genetika:penurunankontrolresponimmune
KLASIFIKASI
Berdasarkanperbedaanklinisdangejala,terdapatbeberapatipeMS:
a. RelapsingremittingMS(RRMS)

Tipeiniditandaidenganepisoderelapsataueksaserbasiyangdiikutidengan
episoderemisi(perbaikan).Sekitar85%pasienMSmemilikitipeRRMS,65
% diantaranya akan berkembang menjadi tipe secondary progressive MS
(SPMS)
b. SecondaryprogressiveMS(SPMS)
BanyakpakaryangmenganggapSPMSmerupakanbentuklanjutdariRRMS
yangberkembangprogresif.Padatipeiniepisoderemisimakinberkurangdan
gejalamenjadimakinprogresif
c. PrimaryprogressiveMS(PPMS)
PPMSdideritaoleh1015%pasienMSdenganrasioperempuan:lakilaki=
1:1.Gejalayangtimbultidakpernahmengalamifaseremisi
d. PrimaryrelapsingMS(PRMS)
BentukPRMSadalahyangpalingjarang.Pasienterusmengalamiperburukan
denganbeberapaepisodeeksaserbasidiantaranya.Tidakadafaseremisiatau
bebasdarigejala.

PATOFISIOLOGI
Mekanismeautoimundidugaterjadimelaluipenurunanaktifitas limfositT
supresorpadasirkulasipasienpenderitaMSsertaadanya molecularmimicry antara
antigendanMBP(myelinbasicprotein)yangmengaktifkanklonselTyangspesifik
terhadap MBP (MBP specific Tcell clone). Limfosit T4menjadi autoreaktif pada
paparanantigenasingyangstrukturalnyamiripdenganMBP.Tidakhanyabeberapa

virusdanpeptidabakterisajayangmemilikikesamaanstrukturaldenganMBP,tetapi
beberapadarimikroorganismetersebutdapatmengaktifkanMBPspesifikTselklon
padapasienMS.
Beberapa infeksi virus diketahui menyebabkan demyelinasi pada manusia
diantaranya progressive multifocal leukoencephalopathy yang disebabkan oleh
polyomavirusJC, subakut sclerosing panencephalitis oleh virus campak.PadaMS
studiserologisawalsulitditafsirkan.Namun,banyakpasienMSterdapatelevasititer
CSFterhadapviruscampakdanherpessimpleks(HSV),tetapiinijugatidakspesifik.
Secara patologi, lesi MS akan memperlihatkan plak yang merupakan lesi
demielinisasi.PlakinimerupakangambaranpatognomikMS.Padafaseakuttampak
sebukan sel radang, hilangnya myelin, dan pembengkakan parenkim. Pada fase
kronik,kehilanganmyelinmenjadilebihjelas,denganselselmakrofagdisekitarnya
disertaikerusakanaksondanapoptosisoligodendrosit.
MANIFESTASIKLINIS

Gambaran klinis yang muncul sesuai dengan daerah lesi yang terkena.

TerdapatbeberapagejaladantandayangtimbulpadaMS:
1.
2.
3.
4.

Kehilanganfungsisensorik(paresthesia):gejalaawal
Neuritisoptik:gejalaawal
Gejalapadacordaspinalis(motorik):crampingakibatspastisitas
Gejala pada corda spinalis (otonom): gangguan BAB dan BAK,

disfungsiseksual
5. Cerebellarsymptom:triadcharcot(disartia,tremor,ataksia)
6. Trigeminalneuralgia
7. Facialmyokymia
8. Diplopiaakibatophtalmoplegiainternukleardannistagmus
9. Heatintolerance
10. Mudahlelah(70%kasus)
11. Nyeri
12. Menurunnyafungsikognitif
13. Depresi
14. Bipolar,dementia
15. Tandalhermitte(Sensasilistrikdarileherkebawahyangdirasakanpada
fleksileher):PadaMSyangmenyerangmedulaspinalis

Gejala neurologis yang sering timbul pertama kali pada multipel sklerosis
adalah neuritis optik pada 1423 % pasien dan lebih dari 50% pasien pernah
mengalaminya.Gejalayangdialamiadalahpenglihatankabur,padaorangkulitputih
biasanyamengenaisatumata,sedangkanpadaorangasialebihseringpadakedua
mata. Pada pemeriksaan fisik ditemukan refleks pupil yang menurun, penurunan
visus, gangguan persepsi warna dan skotoma sentral. Funduskopi pada fase akut
menunjukkan papil yang hiperemis tetapi dapat normal pada neuritis optika
posterior/retrobulbar.Sedangkanpadafasekronisdapatterlihatatrofipapil.Selainitu
padaneuritisoptikaumumnyapasienmengeluhnyeripadaorbitayangdapattimbul
spontan terusmenerus atau pada pergerakan bola mata. Selain itu terdapat suatu
fenomenayangunikyangdisebutfenomenaUhthofffdimanagejalapenurunanvisus
(bersifat temporal) dieksaserbasi oleh suhupanas atau latihan fisik. Diplopia juga
dapatmunculpadaMSmeskipunlebihjarangdibandingkanneuritisoptika.
Gangguansensorikmerupakanmanifestasiklinisawalyangjugaseringdialami
oleh2155%pasienMS.Umumnyagejalayangtimbulberuparasabaal(hipestesi),
kesemutan(parestesi),rasaterbakar(disestesi)maupunhiperestesi.Kelainantersebut
dapattimbulpadasatuekstremitasataulebih,danpadatubuhatauwajah.Selainitu
proprioseptif,rasavibrasi,dandiskriminasiduatitikjugadapatterganggusehingga
menimbulkankesulitanmenulis,mengetikataumengancingbaju.Gejalaproprioseptif
iniumumnyatimbulbilateraldanbilaterdapatlesididaerahlemniskusgangguan
proprioseptif tersebut hanya mengenai lengan yang dinamakan useless hand
syndrome.Gejalatersebutumumnyamengalamiremisidalambeberapabulan.Tanda
yang sering terjadi pada penderita MS meskipun tidak karakteristik adalah tanda
Lhermitte; bila kepala difleksikan secara pasif, timbul parestesi sepanjang bahu,
punggung dan lengan. Hal ini mungkin disebabkan akson yang mengalami
demyelinisasisensitivitasnyameningkatterhadaptekanankespinalyangdiakibatkan
fleksikepala.
Gangguan serebelum juga sering terjadi pada MS meskipun jarang menjadi
gejalautama.Manifestasiklinisnyaataksiaserebelaris,baikyangmengenaigerakan
motorikhalus(dismetria,disdiadokokinesia,intentiontremor),gait,maupunartikulasi
(scanningspeech,disartria).Selainitudapattimbulpulanistagmus,terutamayang
horizontaldanvertikal.
9

HemiparesisyangdiakibatkanlesikortikospinaldapatterjadipadaMSmeski
frekuensinyalebihkecil.Demikianjugalesidimedulaspinalisdapatmenyebabkan
sindroma BrownSequard atau mielitis transversa yang mengakibatkan paraplegi
(umumnya tidak simetris), level sensorik dan gangguan miksidefekasi. Refleks
patologis dan/atau hiperrefleksia bilateral dengan atau tanpa kelemahan motorik
merupakan manifestasi yang lebih sering dan merupakan tanda lesi kortikospinal
bilateral. Yang karakteristik, meskipun kelemahan hanya pada satu sisi, refleks
patologisselalubilateral.Spastisitasdapatmenyebabkangejalakramototpadapasien
MS. Kelelahan/fatigue merupakan gejala non spesifik pada MS dan terjadi pada
hampir 90% pasien MS. Kelelahan dapat merupakan kelelahan fisik pada waktu
exercise berlebihan ataupun pada temperatur panas maupun kelelahan/kelambatan
mental.
GangguanmemoridapatterjadipadapasienMS.MenurutpenelitianThornton
dkkmemorijangkapendek,workingmemoridanmemorijangkapanjangumumnya
terganggupadapasienMS.Selainitujugadidapatkangangguanatensi.Gangguan
emosiberupairitabilitasdanafekpseudobulbarberupa forcedlaughing atau forced
cryingumumterjadipadapasienMSdisebabkanlesihemisferbilateral.
Gejalalainnyayanglebihjarangmeliputineuralgiatrigeminal(bilateral),gangguan
lain pada batang otak berupa paresis n. facialis perifer (bilateral), gangguan
pendengaran, tinitus, vrtigo, dan sangat jarang penurunan kesadaran (stupor dan
koma)
DIAGNOSIS
TidakadasatutespunyangdapatmemastikandiagnosisMS.Multiple
sclerosisditegakkanberdasarkangejalaklinis.Penegakandiagnosismempergunakan
kriteria diagnostik seperti Kriteria McDonald. Saat ini yang dipergunakan adalah
kriteria McDonald revisi 2010. Diagnosis MS perlu dipikirkan apabila didapatkan
gejalagejalaneurologisdenganepisoderemisidaneksaserbasiataupunprogresifdan
tidakditemukansebablainyangdapatmenjelaskangejalatersebut.

10

11

Dengan demikian, untuk menegakkan diagnosis MS, perlu dilakukan


pemeriksaan untuk mengeksklusi diagnosis diferensial, seperti tumor otak, infeksi
otak,stroke,traumakepalamaupungangguanmetabolik.
Pemeriksaan pungsi lumbal harus dilakukan bukan untuk menegakkan
diagnosis,tetapimenyingkirkankemungkinaninfeksiotak.Pemeriksaanoligoclonal
band tidaklagi menjadi standaremas penegakandiagnosis MS,kecuali padatipe
PPMSperan oligoclonalband menjadilebihbesar.PadapemeriksaanMRIkepala
dapatditemukanlesihiperintensdiperiventrikular,jukstakortikal,infratentorial,dan
medullaspinalis.GambaranyangcukupkhaspadalesiMSadalah ovoidlesion dan
dawsonfinger.
Multiplesclerosis jugadapatmenyerangmedulaspinalisdanmengakibatkan
gejala, seperti mielitis. Multiple sclerosis yang mengenai medula spinalis perlu
dibedakandenganneuromielitisoptika(NMO)atau Devicsdisease.NMOawalnya
dikategorikansebagaivariandariMS.Akantetapi,saatinitelahdiketahui bahwa
NMOadalahsuatupenyakitautoimunyangberbedadenganMS.MembedakanMS
dan NMO menjadipenting karena pengobatan kedua penyakit ini berbeda.
SebagaimanaMS,NMOyangmerupakanpenyakitautoimundapatmemperlihatkan
gejaladenganepisoderemisidaneksaserbasi.
Gejala utamanya adalah gangguan penglihatan yang umumnya lebih berat
dibandingkanMSdangejalamielitis.GambaranMRIkepalaNMObisanormalatau
apabiladitemukanlesi,lesitersebutharuslahtidakmemenuhikriteriaMS.Sedangkan
gambaran lesi myelitis pada MRI memperlihatkan lesi hiperintens yang mengenai
medula spinalis sepanjang lebih dari 3 segmen vertebra (longitudinally extensive
spinal cord lesion). Diagnosis NMO ditegakkan dengan menggunakan kriteria
Wingerchuck.

12

Lumbalpungsi
Lumbal pungsi dilakukan jika tidak ada MRI. Pada pemeriksaan ditemukan
oligoclonalbanddanproduksiIGGintratekal.

DIAGNOSABANDING
Diagnosa banding utama untuk menjadi pertimbangan tergantung pada
manifestasineurologisdalamkasus:
Defisitsarafkranialmungkinsajaberhubungandenganberbagaijenislesifokal,
sepertisebuahtumordermoidbasiskranii,suatutumordariserebelopontineangel,
suatutumordiforamenmagnum,suatuoptikgliomaatausphenoidwingmeningioma
13

denganatrofisarafoptik,suatubrainstemastrocytoma,brainstemencephalitis,dan
lainlain.
Suatuhemiplegiamungkinsajaberhubungandengansuatutumorotakataustroke
Kejang paraparesis mungkin saja berhubungan dengan suatu tumor saraf tulang
belakangataucervicalspondyloticmyelopathy.
Paraparesisberulangmungkinsajaberhubungandengansuatumalformasivaskular
padasaraftulangbelakang.
Gejaladariserebellardantraktuspiramidal,danmungkinjugagejaladaribatang
otak,mungkinsajaberhubungandengansuatumassaataubentukmalformasibatang
otak atau craniocervical junction. Beberapa gejala sering misdiagnosed sebagai
multipelsklerosis.Bentukmalformasivaskulerbatangotak,jugadapatmenyebabkan
gejalaneurologisyangberubahubahdenganonsetusiapertengahanatauusiatua.
Keterlibatandariberbagaiareadarisistemsarafpusatmungkinsajaberhubungan
denganpenyakitsistemiksepertisistemiklupuserythematosus,sarcoidosis,penyakit
vaskuler,toxicencephalomyelopathy,hypothyroidism,ataufunicularmyelosis.
Keterlibatanmatadansistemsarafpusatmungkinsajaberhubungandengansuatu
vaskulitis atau intoksikasi. Uveitis ditemukan bersamasama dengan kelainan
neurologisdalamuveoencephalomyelitis(VogtKoyanagiHaradasyndrom),suatuhal
yang jarang, kiranya adalah sindrom virus dimana terjadi uveitis, gangguan gaya
berjalan, leukodermia, munculnya uban, encephalitis, dan tanda meningeal yang
berubahubah.
Behcets disease dapat menyebabkan apththous ulcer, manifestasi okular, dan
manifestasisarafpusat,terutamabrainstemencephalitis.
PENATALAKSANAAN
TERAPISIMPTOMATIK
Selain primary care, terapi simptomatik juga harus dipertimbangkan diantaranya
adalah:
1. Spasticity, spastisitas ringan dapat dikurangi dengan peregangan dan program
exercisesepertiyoga,terapifisik,atauterapilainnya.Medikasidiberikanketika

14

adakekakuan,spasme,atauklonussaatberaktivitasataukondisitidur.Baclofen,
tizanidine,gabapentin,danbenzodiazepineefektifsebagaiagenantispastik.
2. Paroxysmal disorder. Pada berbagai kasus, penggunaan carbamazepin
memberikan respon yang baik pada spasme distonik. Nyeri paroxysmal dapat
diberikanantikonvulsanatauamitriptilin.
3. Bladderdysfunction.Urinalisisdankulturharusdipertimbangkandanpemberian
terapiinfeksijikadibutuhkan.Langkahpertamayangdilakukanadamendeteksi
problemapakahkegagalandalammengosongkanbladderataumenyimpanurin.
ObatantikolinergikOxybutinindanTolterodineefektifuntukkegagalandalam
menyimpanurindiluaradanyainfeksi.
4. Bowel symptom. Konstipasi merupakan masalah umum pada pasien MS dan
harus diterapi sesegera mungkin untuk menghindari komplikasi. Inkontinensia
fekalcukupjarang.Namunbilaada,penambahanseratdapatmemperkerastinja
sehinggadapatmembantuspingteryanginkompetendalammenahanpergerakan
usus.Penggunaanantikolinergikatauantidiarecukupefektifpadainkontinensia
dandiareyangterjadibersamaan.
5. Sexual symptom. Masalah seksual yang muncul antara lain penurunan libido,
gangguan disfungsi ereksi, penurunan lubrikan, peningkatan spastisitas, rasa
sensasipanasdapatterjadi.PadabeberapapasienMS,gangguandisfungsiereksi
dapatdiatasidengansildenafil.
6. Neurobehavior manifestation. Depresi terjadi lebih dari separuh dari pasien
denganMS.Pasiendengandepresiringandantransiendapatdilakukanterapi
suportif. Pasien dengan depresi berat sebaiknya diberikan Selective Serotonin
Reuptake Inhibitors (SSRIs) yang memiliki efek sedative yang lebih kecil
disbanding antidepresan lain. Amitriptilin dapat digunakan bagi pasien yang
memilikikesulitantidurataumemilikisakitkepala.
7. Fatigue. Kelelahan dapat diatasi dengan istirahat cukup atau penggunaan
medikasi.Amantadine100mgduakaliperharicukupefektif.Modafinil,obat
narcolepsyyangbekerjasebagaistimulantSSPtelahditemukanmemilikiefek
yangbaguspadapasienMS.Obatdiberikandengandosis200mgsatukalisehari
pada pagi hari. SSRIs juga dapat menghilangkan kelelahan pada pasien MS.
Amantadine memiliki efek anti influenza A dan baik diberikan pada Oktober
hinggaMaret.
TERAPIRELAPS
15

Pengobatan relaps dilakukan dengan pemberian metilprednisolon 5001000


mgIVselama35hari.Metilprednisolondiberikansekalipadapagiharidalamsaline
normal selama 60 menit. Pemberian metilprednisolon lebih dari 5 hari tidak
memberikanhasilyanglebihbaik.
PadapasiendenganMS,fisoterapiharusselaludilakukanuntukmeningkatkan
fungsidankualitas hidupdariketergantungan obat therapy. Perawatanpendukung
berupa konseling, terapi okupasi, saran dari sosial, masukan dari perawat, dan
partisipasidalam patientsupportgroup merupakan bagiandari perawatankesehatan
denganpendekatantimdalampengelolaanMS.
DISEASEMODIFYINGTHERAPIES
Interferonbeta
Berdasarkan guideline NICE,pasienRRMSdirekomendasikan untukmendapatkan
terapiInterferonBeta,baikjenisInterferonBeta1amaupun1b.Betainterferondapat
mengurangijumlahlesiinflamasi5080%yangterlihatpadaMRI.TipeSPMSjuga
direkomendasikanuntukmendapatkanterapiInterferonBeta.
Glatiramerasetat
Obat ini didesain untuk berkompetisi dengan myelin basic protein. Pemberian
Glatiramer Asetat 20mg/hari subkutan dapat menurunkan frekuensi relaps pada
RRMS.
Fingolimod
Obat ini merupakan satusatunya obat MS dalam sediaan oral. Fingolimod
diindikasikanuntuktipeaktifRRMS.Ataudapatmenjadipilihanberikutnyaapabila
pengobatanRRMSdenganInterferonbetatidakmemberikanhasilyangmemuaskan.
Natalizumab
Merupakan suatu antibodi monoklonal yang diberikan pada kasuskasus MS yang
agresif.PadakasusRRMSyangtidakmemberikanhasiloptimaldenganInterferon
Beta,GAmaupunFingolimodmakaterapidapatdialihkankeNatalizumab,ataupada

16

kasuskasus yang intoleran terhadap obatobat sebelumya. Natalizumab tergolong


dalamobatlinikeduadalamterapiMS.
Mitoxantrone
Obat antikanker ini dapatmenurunkan frekuensi relaps dan menahan progresifitas
MS.MitoxantronedirekomendasikanpadaRRMSyangsangataktifatauSPMSyang
sangatprogresif.Mitoxantronetergolongdalamobatlinike3dalamterapiMS. Untuk
tipe PPMS hingga saat ini tidak ada terapi yang direkomedasikan. Terapi hanya
bersifatsimptomatis.
Fenitoin
Fenitoin yang merupakan obat antiepileptic. Dalam uji coba nya fenitoin bersifat
neuroprotectiveterhadapdegenerasiserabutsarafretinapadapasienneuritisoptic.
Fenitoinyangbekerjasebagaisodiumchannelblocker.Padadaerahinflamasi,akson
akandipenuhiolehsodiumdanmenyebabkanmasuknyacalciumkedalamselyang
menyebabkan kematian sel. Dengan pemberian fenitoin sebagai sodium channel
blocker maka dapat mencegah kematian sel. Dosis yang dipergunakan dalam
penelitian15mg/kgbbselama3haridandilanjutkan4mg/kgbbdalam13minggu.
Hasilpenelitianmenunjukkanpasienneuritisopticyangdiberikanfenitoindalam3
bulandapatmencegah30%lebihbaikdibandingdenganpemberianplacebo.
KOMPLIKASI
1. Depresi
2. Kesulitandalammenelan
3. Kesulitanberppikirdanberkonsentrasi
4. Hilangdanmenurunnyakemampuanmerawatdirisendiri
5. Membutuhkankateter
6. Osteoporosis
7. Infeksisalurankemih
PROGNOSIS
Jikatidakdiobati,lebihdari30%pasiendenganMSakanmemilikicacat
fisikyangsignifikandalamwaktu2025tahunsetelahonset.Kurangdari510%
17

daripasienmemilikifenotipeMSklinisringan,dimanatidakadacacatfisikyang
signifikanterakumulasimeskipunberlalubeberapadekadesetelahonset(kadang
kadangterlepasdarilesibaruyangterlihatpadaMRI).Pemeriksaanrincidalam
banyakkasus,mengungkapkanbeberapatingkatkerusakankognitif.
PasienlakilakidenganMSprogresifprimermemilikiprognosisterburuk,
dengan respon yang kurang menguntungkan untuk pengobatan dan cepat
menimbulkan kecacatan. Insiden yang lebih tinggi dari lesi sumsum tulang
belakangdiMSprogresifprimerjugamerupakanfaktordalamperkembanganpesat
darikecacatan.
Harapan hidup dipersingkat hanya sedikit pada orang dengan MS, dan tingkat
kelangsungan hidup terkait dengan kecacatan. Kematian biasanya terjadi akibat
komplikasisekunder(5066%),sepertipenyebabparuatauginjal,tetapijugadapat
disebabkanolehkomplikasiutama,bunuhdiri,danmenyebabkantidakberhubungan
denganMS.MarburgvariandariMSadalahbentukakutdanklinisfulminanpenyakit
yangdapatmenyebabkankomaataukematiandalambeberapahari.

2.3FIBROMIALGIA
DEFINISI
Fibromialgia adalah sindrom kelelahan kronik yang menyebabkan nyeri,
kekakuan dan kepekaan dari otototot, tendontendon, dan sendisendi. Seseorang
denganfibromialgiamemilikitenderpointspadatubuhnya.Tenderpointsadalahtitik
nyeri yang biasanya ada pada daerah leher, bahu, punggung, pinggul, lengan dan
telapakkaki.Jikatitiktersebutditekanmakaakanterasakesakitan.
Fibromialgiatidaktermasukdalamartritiskarenatidakmenyebabkanreaksi
peradanganataupunmenyebabkankerusakansendi,ototataujaringanyanglainnya.
EPIDEMIOLOGI
Berdasarkan data di Amerika Serikat, kirakira 20% pasien klinik
rheumatologiadalahpasienfibromyalgia,yangkebanyakanberusia3050tahun.Dari
data tersebut dapat dikatakan 1 dari 5 pasien yang berobat adalah

18

fibromialgia.Thompson melaporkan fibromialgia sebagai penyakit terbanyak kedua


yangditemuidalampraktekrheumatologis. Fibromyalgialebihbanyakmenyerang
perempuandibandingkanlakilaki,denganrasio9:1.Fibromialgiajugalebihsering
ditemukanpadaperempuandiatas50tahun.
Prevalensi fibromyalgia meningkat pada orang dengan BMI yang tinggi,
merokok,tingkatpendidikanyangrendah,pengangguran,orangdengantingkatstress
yangtinggi.
ETIOLOGI
Hinggakini,penyebabpastifibromialgiabelumdapatditemukannamuntelah
diketahuibahwafibromialgiadapatdipicuolehstresemosional,infeksi,pembedahan,
hipotiroidisme, dan trauma. Fibromialgia juga telah ditemukan pada pasien yang
terinfeksi hepatitis C, HIV, parvovirus B19, dan lyme disease. Pendapat lain
menyebutkankurangnyalatihan,penggunaanototsecaraberlebihan,danperubahan
metabolismeototsebagaikemungkinanpenyebabfibromialgia.
GangguanmekanismenyeripadaSSPdiperkirakansebagaifaktorpenyebab
sindromini. Pasiendenganfibromialgiamemilikiambangnyeriyanglebihrendah
dari pada mereka yang tidak memiliki kelainan ini. Teori lain juga termasuk
defisiensi hormon pertumbuhan, abnormalitas axis hypothalamicpituitaryadrenal,
dan abnormalitas aktivasi respon stress simpatetik. Faktor genetik diduga kuat
sebagai penyebab dari sindrom ini karena first degree realatives memiliki risiko
terkenaFMS8kalilebihbesar.
PATOGENESIS
Meskipun penyebab pasti fibromialgia masih menjadi misteri, secara
umumparaahlisepakatmengenaiadanyamekanismepengolahaninputyangtidak
normal, khususnya input nyeri (nosiseptif), pada sistem saraf pusat. Pada studi
dolorimetri dan pemberian stimuli seperti panas, dingin dan elektrik, ditemukan
ambang rangsang yang rendah pada pasien fibromialgia. Pasien fibromialgia
mempersepsikanstimulinonnosiseptifsebagaistimulinosiseptifsertakurangmampu
mentoleransinyeriyangseharusnyadapatditoleransiolehorangnormal.
Beberapakelainanfisiologikdanbiokimiatelahditemukanpadasusunan

19

sarafpusatpasienfibromialgiasehinggafibromialgiatidaklagidapatdisebutsebagai
keluhan subjektif. Kelainan tersebutadalah kadarserotoninyangrendah disfungsi
poroshipotalamushipofisis,kadarhormonpertumbuhanyangrendah,kadarsubstansi
Pyangmeningkatdanfaktorpertumbuhansarafyangmeningkat.
KadarSerotoninyangRendah
Serotonin merupakan neurotransmiter yang berperan dalam tidur, nyeri
danperubahanmood.Serotoninyangdisekresikanolehujungseratneuronrafe,dapat
menyebabkanperangsangandaerahtertentudariotakyangkemudianmenyebabkan
tidur.Serotoninyangdisekresiolehradiksdorsalismedulaspinalisdapatmerangsang
sekresi enkefalin yang menimbulkan hambatan presinaptik dan postsinaptik pada
serabutnyeri.Kadarserotoninyangrendahdidugamemilikiperandalampatogenesis
fibromialgia yaitu dengan menurunkan efek hambatan pada serabut nyeri. Hal
tersebut diperkuat dengan penemuan bahwa pasien fibromialgia ternyata memiliki
kadar serotonin yang rendah di cairan serebrospinalnya. Bukti lain menunjukkan
bahwaobatyangmempengaruhiserotoninternyatatidakmenunjukkanefekdramatis
padafibromialgia.
DisfungsiPorosHipotalamusHipofisis
Poros hipotalamus hipofisis berperan penting dalam respons adaptasi
terhadap stres. Pada sistem yang berfungsi normal, hipotalamus mensekresi
corticotropinreleasinghormone(CRH)yangkemudianmerangsangsekresiadreno
corticotropichormone(ACTH)olehhipofisis.ACTHkemudianmerangsangkorteks
adrenal mensekresiglukokortikoid yangberperandalam respons adaptasiterhadap
stres.
Regulasi sirkadian sistem poros hipotalamus hipofisis sebagian
dipengaruhi metabolisme serotonin. Disfungsi sistem poros hipotalamus hipofisis
diperkirakan sebagai akibat dari rendahnya kadar serotonin. Sebaliknya, disfungsi
sistem poros hipotalamus hipofisis juga diperkirakan memperburuk abnormalitas
kadarserotonindisistemsarafpusat.
Beberapa kelainan yang dapat ditemukan berkaitan dengan disfungsi
sistem poros hipotalamus hipofisis adalah kadar kortisol 24 jam yang rendah,
hilangnyaritmesirkadiandenganpeningkatankadarkortisolsorehari,hipoglikemia
yang diinduksi insulin berkaitan dengan produksi ACTH yang berlebihan, kadar

20

hormonpertumbuhanyangrendahdansekresiglukokortikoidyangrendah.Selainitu
ditemukan juga kadar kortisol bebas pada urin yang rendah, serta berkurangnya
responskortisolterhadapcorticotropinreleasinghormonepadapasienfibromialgia.
KadarGrowthHormoneyangRendah
Growth hormone (GH) adalah suatu hormon yang berperan dalam
pertumbuhan karena sifatnya yang meningkatkan sintesis protein, meningkatkan
penggunaanlemakuntukenergi,menurunkanpemakaianglukosauntukenergi,dan
merangsangpertumbuhantulang.Hormontersebutsecaranormaldisekresipadatahap
daritidur,sehinggagangguantidurdidugadapatmenurunkansekresinya.
PadapasienfibromialgiaditemukanpenurunankadarGHyangpenting
untukprosesrepairototdankekuatan,yangdidugadiakibatkanolehgangguantidur.
HalitudidukungolehbuktiadanyahasilEEGyangmenunjukkangangguantahap
dari tidur normal (nonREM) dan gangguan gelombang yang berulang pada
pasienfibromialgia.
KadarSubstansiPyangMeningkat
Substansi P adalah neurotransmiter yang dilepaskan bila akson
distimulasi.PeningkatankadarsubstansiPmeningkatkansensitivitassarafterhadap
nyeri. Kadar substansi P yangtinggi menyebabkan stimulus normal dipersepsikan
sebagaistimulusnosiseptifolehpenderitafibromialgia.
Kadar substansi P yang meningkat di cairan serebrospinal pasien
fibromialgia juga mungkin berperan dalam menyebarkan nyeri otot. Peneliti pada
studi yang independen melaporkan kadar substansi P pada pasien fibromialgia
meningkatsampai23kalikadarpadaindividunormal.
Selain halhal di atas ditemukan juga abnormalitas lain seperti
berkurangnyaalirandarahketalamus,nukleuskaudatus,sertatektumpontine,yang
merupakanarea signaling,integrasi,danmodulasinyeri.Disfungsisarafotonom
didugajugaberperandalamfibromialgia,denganditemukannyahipotensiortostatik
setelahujitilttabledanpeningkatanfrekuensidenyutjantungistirahatterlentang.
Penelitian dalam bidang genetik memperkirakan adanya peran polimorfisme gen
sebagaietiologifibromialgia.Genyangdiperkirakanmengalamiabnormalitasadalah
genyangmengatursistemserotonergik,katekolaminergikdandopaminergik.

21

DIAGNOSIS
Anamnesis
Gejalayangbiasaditemukanpadapasienfibromialgiaantaralainnyeri
muskuloskeletal yang menyebar, kekakuan, dan kelelahan. Gejala lain juga dapat
muncul,diantaranyaparestesi,gangguantidur,titiknyeri,danlainlain.
Padafibromialgia,nyeribersifatmenyebardandirasakanselamaminimal
3bulan,diatasdanbawahpinggangpadakeduasisitubuh,bersamaandengannyeri
aksial.Nyeripunggungbawah(berasaldaribawahpinggang)dapatmenyebarhingga
kebokongdantungkai.Nyerilaindapatmeliputinyerileher,bahuatasbelakang,dan
nyerisendi.Nyeritersebuttimbulsetelaholahragaringan,dandirasakansepertinyeri
terbakaryangpersistendanmengganggu,ataunyeritumpulyangkonstan.
Pada7590%penderitafibromialgia,ditemukankekakuanyangbiasanya
terjadidipagiharikemudianmembaikdisianghariataubertahansepanjanghari.
Gejala lain yang mungkin ditemukan adalah kelelahan, mati rasa pada kaki dan
tangan,seringterbangundimalamharidansulittidurkembali,bangunpagidengan
rasa letih, merasa lebih kedinginan daripada orangorang di sekitarnya, fenomena
RaynaudataugejalamiripfenomenaRaynaud,gangguankognitifdengankesulitan
berpikir dankehilangan ingatan jangka pendek (loss of shortterm memory),sakit
kepalatipemigrain,pusing,cemas,dandepresi.Gejalatersebutdiperparaholehstres
atau cemas,kedinginan, cuaca lembab, dankerja terlalu keras.Sebaliknya, pasien
merasalebihbaiksaatcuacahangatdanliburan.
PemeriksaanFisik
KriteriaDiagnostik
Padatahun1990kriteriadiagnostikresmiuntukFMdidirikanolehAmericanCollege
ofReumatologi(ACR).

Riwayatnyeriyangmeluas:kronis,luas,nyerimuskuloskeletalberlangsung

lama lebih dari tiga bulan di keempat kuadran tubuh ("Nyeri yang meluas"
didefinisikansebagainyeridiatasdandibawahpinggangpadakeduasisitubuhjuga
padadaerahcervical,dadaanterior,tulangdada,ataupunggungbawah)harusada.

Nyeripada11tempatdari18PointTenderSitedenganPalpasi: Ada

delapanbelastenderpointyangdoktercaridalammembuatdiagnosisfibromyalgia.

22

MenurutACRyangtermasukpersyaratan,yaitupasienharusmemiliki11dari18
pointenderuntukdidiagnosadenganfibromyalgia.Sekitarempatkilogramtekanan
(atausekitar9lbs.)Harusditerapkanketitiktender,danpasienharusmenunjukkan
bahwalokasitenderpointterasasakit.
Delapanbelastenderpointsite:
1&2,tengkuk:bilateral,padainsersiototsuboccipital.
3&4,cervicalbawah:bilateral,padaaspekanteriordariruangintertransversedi
C5C7.
5&6,trapezius:bilateral,padatitiktengahbatasatas.
7&8,supraspinatus:bilateral,diatastulangbelakangskapuladekatperbatasan
medial.
9&10,Keduatulangiga:bilateral,dipersimpangankostokondralkedua,hanya
lateralpersimpanganpadapermukaanatas.
11&12,lateralepikondilus:bilateral,cm2distalkeepicondyles.
13&14,glutealis:bilateral,dalamkuadranatasluarpantatdilipatananteriorotot.
15&16,Greatertrokanter:bilateral,posteriorketrokanterikaprominens.
17&18,Lutut:bilateral,dilapisanlemakproksimalmedial.
Diagnosis fibromyalgia dapat ditegakkan apabila pasien memenuhi kedua kriteria
ACR1990,yaituriwayatnyerimuskuloskeletalyangmenyebarminimal3bulandan
nyeri yang signifikan pada minimal 11 dari 18 tender points (Gambar 1) jika
dilakukanpalpasidenganjari. KriteriaACRsangatbermanfaatdalammenegakkan
diagnosis,meskipunbeberapapasienmemilikijumlahtendersitesyanglebihsedikit
dan nyeri regional yang lebih, sehingga didiagnosis fibromyalgia. Pemeriksaan
neurologismuskuloskeletaldanlaboratoriumtetapnormalpadafibromyalgia.

23

Gambar.LokasiTenderPointsdiagnosisFibromialgia
PemeriksaanPenunjang
TidakadatesdarahsederhanaatauXraydapatmemberitahubahwaseseorang
memilikifibromialgia.Diagnosisdibuathanyadenganmelakukanpemeriksaanfisik.
Pemeriksaan tes darah atau Xray untuk menyingkirkan penyakityang mirip
denganfibromialgia.Kondisikondisiinitermasuk:

tingkathormontiroidyangrendah(hypothyroidism),

penyakitparatiroid(menyebabkantingkatkalsiumdarahyangmeninggi),

penyakitpenyakitototyangmenyebabkannyeriotot(sepertipolymyositis),

penyakitpenyakit tulang yang menyebabkan nyeri tulang (seperti penyakit


Paget),

kalsiumdarahyangmeninggi(hypercalcemia),

penyakitpenyakitinfeksius(sepertihepatitis,EpsteinBarrvirus,AIDS),dan

kanker

24

Meskipuntidakadatesdarahuntukfibromialgia,testesdarahadalahpenting
untukmengeluarkankondisikondisimedislain.Olehkarenanya,hormontiroiddan
tingkattingkat kalsium darah diperoleh untuk mengeluarkan hypercalcemia,
hyperparathyroidism,danhypothyroidism.Tingkatalkalinephosphatase(suatuenzim
tulang) seringkali naik pada pasienpasien dengan penyakit tulang Paget. Tingkat
CPK (suatu enzim otot) seringkali naik pada pasienpasien dengan polymyositis,
penyakitdenganperadanganototyangtersebar.Olehkarenanya,memperolehtingkat
tingkat darah alkaline phosphatase dan CPK dapat membantu dokter memutuskan
apakahpenyakitPagetdanpolymyositisadalahpenyebabdarinyerinyeritulangdan
otot. Testes jumlah darah komplit atau complete blood count (CBC) dan hati
membantudalamdiagnosisdarihepatitisdaninfeksiinfeksilain.
Fibromialgia dapat terjadi sendirian atau dalam hubungan dengan kondisi
kondisi rhematik sistemik lain. Kondisikondisi rhematik sistemik merujuk pada
penyakitpenyakityangdapatmenyebabkanperadangandankerusakanpadabanyak
jaringanjaringandanorganorganyangberbedaditubuh.Kondisikondisirhematik
sistemik yang berhubungan dengan fibromyalgia termasuk systemic lupus
erythematosus,rheumatoidarthritis,polymyositis,danpolymyalgiarheumatica.Tes
tes darah yang sangat membantu dalam mengevaluasi penyakitpenyakit ini
termasukerythrocyte sedimentation rate (ESR),serum protein electrophoresis
(SPEP),antinuclearantibody(ANA),danrheumatoidfactor(RF).Padapasienpasien
dengan fibromialgia tanpa penyakitpenyakit sistemik yang berhubungan, testes
darahESR,SPEP,ANA,danRFbiasanyaadalahnormal.
DIAGNOSISBANDING
1. Hipotiroid
Menurunnyaproduksihormontiroidpadakelenjartiroid.Kelenjartiroid
sendiribertugasmelepashormontiroidkeseluruhtubuhlewatpembuluh
darah.Padakasushipotiroid,pelepasaninitidakbisaterlaksanadengan
baiksehinggaberbagaiaktivitasfisikdanmentalakanikutterganggu.
2. Myastheniagravis
Penyakitkronisdenganremisidanrelaps,danditandaiolehkelemahan
dan cepatnya otototot volunter menjadi lelah sesudah suatu kegiatan,
diikuti oleh pulihnya kekuatan sesudah istrahat selama beberapa menit
25

sampai beberapa jam. Ini disebabkan oleh gangguan konduksi pada


myoneuraljunction.
3. MultipleSclerosis
Penyakit demyelinating yang mengenal serebelum, saraf optikus dan
medulaspinalis(terutamamengenaitraktuskortikospinalisdankolumna
posterior), secara patologi memberi gambaran plak multipel di susunan
sarafpusatkhususnyaperiventrikulersubtansiaalba. GejalaKliniaMS;
kelemahanumum,gangguansensoris,nyeri,gangguanblader,gangguan
serebelum,gangguanbatangotakdangangguanfungsiluhur.
PENATALAKSANAAN
Secarakeseluruhantimmultidisiplindiperlukanuntuktatalaksanafibromialgia
secara optimal. Tim multidisiplin tersebut terdiri atas spesialis rehabilitasi medik,
psikiater, terapis fisik, dan ahli lainnya. Tatalaksana fibromialgia dapat dibagi
menjaditatalaksanamedikamentosadannonmedikamentosa.
NonMedikamentosa
Tatalaksana nonmedikamentosa, selain untuk mengurangi nyeri, gangguan
tidursertadepresijugadigunakanuntukmengatasikelelahanotot.
a.

Edukasipasien

Edukasipasienmerupakansalahsatutatalaksanafibromialgiayangpalingpenting.
Edukasipasienharusdilakukansebagailangkahpertamadalam tatalaksana pasien
fibromialgia. Pasien perlu diinformasikan mengenai penyakit yang sedang
dialaminya.Pasienjugaperludiinformasikanbahwafibromyalgiatidakmenyebabkan
kelumpuhandantidakbersifatdegeneratif,sertaterdapatpengobatanuntukpenyakit
ini.
b.

Mengurangistress

Konsultasipsikiatrikmemilikiperanyangsangatpentingdalamtatalaksanadepresi
dancemaspadapasienfibromialgia.Stresdalamkehidupanharusdiidentifikasidan
didiskusikan dengan pasien, dan pasien harus diberikan pertolongan mengenai
bagaimanamenghadapistres.

26

c.

Latihan
Untukmenguranginyeri,dapatdilakukanaplikasipanasdandinginkeotot

secarabergantianmasingmasing1520menitdiselingiwaktuuntukkembalikesuhu
normal.Pelatihanbiofeedbackyangintens(misalnyaduakalisehariuntukseminggu)
seringkali penting untuk nyeri otot yang kronik dan menyebar. Teknik tersebut
terutama berguna untuk otototot postural yang biasanya berfungsi tanpa disadari.
Elektroda permukaan ditempelkan ke atas otot untuk mendeteksi aktivitasnya.
Pelatihan biofeedback dilakukan untuk menolong pasien mengembalikan otot ke
keadaanistirahatnormalsetelahkontraksi.
Teknik lain untuk mengurangi nyeri ialah spray and stretch. Vapocoolant
spray disemprotkandenganpolamenyapusearahseratototuntukmelemaskanotot,
sambildilakukanpereganganototsecarapasifolehpasienatauklinisi.Peregangan
adalah elemen kunci dari pengurangan nyeri, meskipun mekanismenya belum
diketahui.
Hallainyangperludiatasipadapasienfibromialgiaadalahgangguanyang
terjadi pada otot. Untuk itu, olahraga dapat menjadi solusi dan penting untuk
disarankan. Selain meregangkan dan memperkuat otot, olahraga juga dapat
meningkatkan kebugaran kardiovaskular Hal tersebut selanjutnya dapat
menyebabkandepresi,menurunnyarasapercayadiri,danstresyangmemicunyeri
lebih lanjut. Olahraga aerobik juga baik untuk pasien dan dimulai setelah terjadi
perbaikantidursertaberkurangnyanyerisertakelelahan.Olahragadilakukanmula
mula pada level rendah dan pasien sebaiknya berolahraga 2030 menit, 34 hari
seminggu.
Terapilaindapatmembantudenganderajatyangberbedabeda,misalnya
injeksi,modifikasiperilaku,hipnoterapi,kompresiiskemik,olahragadanpengaturan
stressnamun,yangtidakbolehdilupakanialahperbaikanposturdanmekanikatubuh
Medikamentosa
Tatalaksanamedikamentosadapatdigunakanuntukmengatasinyeri,gangguan
tidur serta depresi dan kecemasan. Berikut adalah beberapa kategori yang paling
umumdigunakanobatuntukfibromialgia.

27

a.

Analgesik
Analgesik adalah obat penghilang rasa sakit.Mereka berkisar dari overthe
counter acetaminophen untuk obat resep, seperti tramadol dan persiapan
narkotikabahkanlebihkuat.Untuksubsetdariorangdenganfibromialgia,obat
narkotikayangdiresepkanuntuknyeriototyangparah.

b. AntiinflamasinonsteroidObat(NSAIDs)
Seperti namanya, obat antiinflammatory drugs, termasuk aspirin, ibuprofen
(Advil, Motrin), naproxen dan sodium (Anaprox, Aleve), digunakan untuk
mengobati peradangan. Meskipun peradangan bukan merupakan gejala
fibromyalgia, NSAIDjugamengurangi rasasakit.Obatobatanbekerjadengan
menghambatsubstansidalamtubuhyangdisebutprostaglandin,yangmemainkan
peran dalam rasa sakit dan peradangan.Obatobat ini dapat membantu
meringankannyeriototfibromyalgiadandapatmeredakankrammenstruasidan
sakitkepalaseringdikaitkandenganfibromialgia.
c.

Antidepresan
Obatinibekerjasamadenganbaikpadapasienfibromialgiadenganatautanpa
depresi,karenaantidepresanmeningkatkantingkatbahankimiatertentudiotak
(termasukserotonindannorepinefrin)yangtidakhanyaterkaitdengandepresi,
tetapijugadenganrasasakitdankelelahan.Meningkatkantingkatbahankimia
inidapatmengurangirasasakitpadaorangyangmemilikifibromialgia.Beberapa
jenisantidepresanuntukorangdenganfibromialgia,dijelaskandibawahini.
a. Antidepresantrisiklik.
Antidepresan trisiklik dapat membantu mempromosikan tidur restoratif pada
orang dengan fibromialgia.Obat ini juga dapat mengendurkan otototot
menyakitkan dan meningkatkan efek alami tubuh sakitmembunuh zat yang
disebut endorfin.Beberapa contoh obat trisiklik digunakan untuk mengobati
fibromialgiatermasukamitriptilinhidroklorida(Elavil,Endep),cyclobenzaprine
(Cycloflex,Flexeril,Flexiban),doksepin(Adapin,Sinequan),dannortriptyline
(Aventyl, Pamelor). Kedua amitriptilin dan cyclobenzaprine telah terbukti
bergunauntukpengobatanfibromyalgia.
b. Selectiveserotoninreuptakeinhibitor.

28

Jikaantidepresantrisiklikgagaldigunakanantidepresanjenisselectiveserotonin
reuptakeinhibitor(SSRI).Sepertidengantrisiklik,digunakanuntukorangorang
denganfibromyalgiadalamdosislebihrendahdaripadayangdigunakanuntuk
mengobati depresi.Dengan pelepasan serotonin, obat ini dapat mengurangi
kelelahandanbeberapagejalalainyangterkaitdenganfibromialgia.Kelompok
SSRItermasukfluoxetine(Prozac),paroxetine(Paxil),dansertraline(Zoloft).
c. SSRI
Dapat digunakan bersama dengan antidepresan trisiklik.Penelitian telah
menunjukkan bahwa terapi kombinasi dari trisiklik amitriptilin dan fluoxetine
SSRImenghasilkan peningkatan lebihbesarpadagejala fibromialgiadaripada
salahsatunyasaja.
d. Campuranreuptakeinhibitor
Beberapaantidepresanbarumeningkatkankadarserotonindannorepinefrinbaik
dan karena itu dicampur reuptake inhibitor.Contohcontoh dari obatobat ini
termasuk venlafaxine (Effexor), duloxetine (Cymbalta), dan (Savella).Secara
umum,obatinibekerjalebihbaikuntuksakitdaripadaSSRI,mungkinkarena
merekajugameningkatkannorepinefrin,yangmungkinmemainkanperanlebih
besardalamtransmisinyeridariserotonin.
e. Benzodiazepin
Benzodiazepin kadangkadang dapat membantu orang dengan fibromialgia
dengantegang,ototototyangmenyakitkan danmenstabilkan gelombang otak
tidakmenentuyangdapatmengganggutidurnyenyak.Benzodiazepinjugadapat
meringankangejalasindromnyerikaki,gangguanneurologisyanglebihumumdi
antara orang dengan fibromialgia.Kelainan ini ditandai oleh sensasi tidak
menyenangkandikakidandorongantakterkendaliuntukmenggerakkankaki,
terutamaketikaberistirahat. Benzodiazepinbiasanyahanyauntukorangorang
yang tidak respon dengan terapi lain karena potensi untuk kecanduan.
Benzodiazepintermasukclonazepam(Klonopin)dandiazepam(Valium).
f. Obattidur
Untukmemperbaikikualitastidur,digunakantrisikliksepertiamitriptilin(1050
mg), nortriptilin (1075 mg), dan doksepin (1025 mg) atau obat lain seperti
siklobenzaprin (1040 mg), 12 jam sebelum tidur. Pemberian obat tersebut

29

dimaksudkan untuk memperbaiki tahap 4 dari tidur pasien, sehingga terjadi


perbaikanklinis.Pengobatandiberikanmulaidaridosisrendah,danditingkatkan
bila perlu. Efek samping seperti konstipasi, mulut kering, peningkatan berat
badan,dankesulitanberpikirjugaperludipertimbangkan.Selainobatdiatas,
trazodonatauzolpidemjugadapatmemperbaikikualitastidur.
PROGNOSIS
Fibromialgia adalahgangguanjangka panjang.Kadangkadang,gejala
membaik.Terkadang,rasasakitmungkinbertambahburukdanterusselamaberbulan
bulanatau tahun. Pasien yang tidak melakukan pengobatan akan mengakibatkan
kondisisemakinmemburuk.Denganpengobatan,gejalapenyakitiniakanberkurang.
Sangatpentingbahwasetiappasienberpartisipasidalam/perawatansendiri.

2.4SINDROMKELELAHANKRONIS
Sindrom kelelahan kronis adalah gangguan yang ditandai dengan keadaan
kelelahankronisyangberlangsunglebihdari6bulan,tidakmemilikipenyebabyang
jelas dan disertai dengan kesulitan kognitif. Sindrom ini sering disertai dengan
myalgia, sakit kepala, faringitis, demam ringan, keluhan kognitif, gejala
gastrointestinal,dankelenjargetahbeningyangmelunak.Pencarianmasihberlanjut
untuk penyebab infeksi kelelahan kronis karena tingginya persentase pasien yang
melaporkanonsetmendadaksetelahpenyakitsepertifluberat.
Sindrom kelelahan kronis awalnya disebut encephalomyalgia atau
encephalomyelitis myalgiakarenadokterdiInggrismencatatbahwaklinispenting
dari sindromkelelahan kronis termasuk baikkomponen ensefalitis (bermanifestasi
sebagai kesulitan kognitif) dan komponen otot skeletal (bermanifestasi sebagai
kelelahankronis).Beberapawaktuini,institutdiUnitedStateInstituteofMedicine
(IOM) mengusulkan bahwa kondisi berganti nama menjadi systemic exertion
intolerancedisease(SEID)untuklebihmencerminkancirikhasgejalapostexertional
malaise.
Berbagai penyakit infeksi yang tidak terkait (misalnya pneumonia, infeksi
virus Epstein Barr (EBV), diare, infeksi saluran pernapasan atas) tampaknya
menyebabkankeadaankelelahanberkepanjanganpadabeberapaorang.Secaraumum,
30

jikakondisiinidisertaidengankesulitankognitif,itudisebutjugasebagaisindrom
kelelahankronis.
Penyebab sindrom kelelahan kronis tidak diketahui tetapi gangguan ini
mungkin merupakan penyakit infeksi dengan manifestasi imunologi. EBV telah
dikecualikansebagaipenyebabCFS,meskipuninfeksiEBVadalahsalahsatudari
banyak penyebab yang dapat menyebabkan keadaan kelelahan kronis. Sindrom
kelelahankronistidakidentikdenganinfeksiEBVkronisatauinfeksimononucleosis
kronis.
Karenatidakadatessecaralangsungdalammendiagnosissindromkelelahan
kronis,diagnosisadalahsalahsatupengecualiantetapiyangmemenuhikriteriaklinis
tertentu, yang selanjutnya didukung oleh tes spesifik tertentu. Diagnosis sindrom
kelelahan kronis juga bersandar pada definisi kelelahan yang tidak diketahui
penyebabnya selama lebih dari 6 bulan disertai dengan gangguan kognitif. Tidak
adanya disfungsikognitif harus mengecualikan sindrom kelelahan kronis sebagian
potensialdiagnosis.Karenatidakadapenyebabsindromkelelahankronisyangpasti,
makatidakadaterapiyangefektifuntuksindromkelelahankronis.

KRITERIADIAGNOSIS
KriteriamendiagnosisCFS,revisitahun1994,bertujuanuntukmendefinisikan
CFSsebagaikelelahanmentaldanfisikyangparah,bukansomnolenataudisebabkan
oleh kekurangan motivasi melakukan aktivitas dan tidak disebabkan oleh kondisi
medisyangterdiagnosis.
A. KriteriamendiagnosisCFStermasuklah
a. Kelelahankronisseharusnyadievaluasiklinissebagaiunexplained,persisten
dankambuhdenganonsetyangbaruataujelas.
b. Tidakdisebabkanolehaktivitasfisikataubertambahbaikdenganistirahat
c. Penurunanproduktivitasataupenghasilanadalahkriteriautama.
2.Adanya4ataulebihgejalasekarang
a. Gangguan memory jangka pendek atau perhatian yang cukup parah yang
b.
c.
d.
e.

dilaporkanpasienyangmenyebabkanpenurunanaktivitasyangbermakna
Sakittenggorokan
Kelenjargetahbeningservikalatauaxilayangmelunak
Myalgia
Nyerisenditanpabengkakdankemerahan
31

f.
g.
h.
i.

Nyerikepaladenganpoladankeparahanyangtidakpernahdirasakanpasien
Merasatidakbermayasaatbangundaritidur
Malaisepostexertionallebihdari24jamistirahat
Gejalaberlangsungatauberulangselama6ataulebihbulanberturutturut

3.Idiopathicchronicfatigue
a. Dievaluasisecaraklinis,kelelahankronisyangtidakmemenuhikriteriaCFS
b. Sebabtidakmemenuhikriteriajelas
4.Psychiatricexclusions
1. Sekarangatau2tahunsebelumnyamempunyairiwayat;depresidengangejala
psikotik, gangguan bipolar, schizophrenia, gangguan waham, anorexia
nervosa,bulimia,penyalahgunaanzat(dalam2tahunsebelumonsetkelelahan
kronis)
5. Adanya gangguan cemas atau depresi nonmelancholic tidak menyingkirkan
diagnosis fibromyalgia kondisi yang tumpang tindih yang dikarakterkan oleh
kelelahan/fatigue, disfungsitidur, danmyalgia. Kriteria fibromyalgia yangdirevisi
menurutWolfe
1. Riwayatnyerimusculoskeletalyangdifustidakkurangdari3bulan
2. KelunakanyangditemukandenganpalpasidiSembilantriggerpointbilateral
Gangguan somatisasi dicirikan dengan gejalagejala somatic yang banyak
yang tidak dapat dijelaskan berdasarkan pemeriksaan fisik maupun
laboratorium.Keluhanyangdiutarakanpasiensangatmelimpadanmeliputi
berbagi system organ seperti gastrointesitinal, seksual saraf danbercamour
dengankeluhannyeri.Gangguaninibersifatkronis,berkaitandenganstressor
psikologiyangbermaknanmenimbukanhendayadibidangsocialdanokupasi
sertaadanyaperilaku mencariperotlonganmedisyangberlebihan.Dikenal
jugasebagaibriquetssyndrome.
3. Prevalensisepanjanghidup0.22%padawanitadan0.2%padapria.Wanita
lebihbanyakmenderitagangguansomatisasidibandingkanpridedenganrasio
3:1.Awitangangguninisebelumusia30tahundanbiasanyadimulaiketika
usiaremaja.
ETIOLOGI

32

Penyebabgangguaninitidakdiketahui.Diagnosisdapatdibuathanyasetelah
semua penyebab medis dan psikiatris lain penyakit kronis yang menyebabkan
kelelahan telah dikeluarkan. Penelitian ilmiah telah divalidasi ada tandatanda
patognomonikatautesdiagnostikuntukkondisiini.
Para pengkaji telah mencoba untuk melibatkan virus EpsteinBarr (EBV)
sebagaiagenetiologisindromkelelahankronis.InfeksiEBV,bagaimanapun,adalah
terkait dengan antibodi spesifik dan limfositosis atipikal, yang tidak hadir dalam
sindrom kelelahan kronis. Hasil tes untuk agen virus lainnya, seperti enterovirus,
herpes, dan retrovirus, juga negatif. Beberapa peneliti telah menemukan penanda
nonspesifik kelainan kekebalan pada pasien dengan sindrom kelelahan kronis;
misalnya,mengurangiresponproliferasilimfositdarahperifer,namuntanggapanini
miripdenganyangterdeteksipadabeberapapasiendengandepresiberat.
Beberapa laporantelah menunjukkangangguanpadahipotalamushipofisis
axis(HPA)padapasiendengansindromkelelahankronis,denganhypocortisolism
ringan. Karena itu, kortisol eksogen telah digunakan untuk mengurangi kelelahan
tetapidenganhasilyangsamarsamar.
Sindromkelelahankronismungkinbersifatgenetic.Dalamsebuahpenelitian,
hubungandalampasangankembaruntukkembarmonozigotlebihdari2,5kalilebih
besardarikorelasiuntukkembardizigot.Penelitianlebihlanjutdiperlukan,namun.

DIAGNOSISDANGEJALAKLINIS
Karena sindrom kelelahan kronis tidak memiliki penanda patognomonik,
diagnosisnyasulituntukditegakkan.Dokterharusberusahauntukmenggambarkan
semuatandatandadangejalayangmungkinuntukmemfasilitasiproses.Meskipun
kelelahan kronis adalah keluhan yang paling umum, kebanyakan pasien memiliki
banyak gejala lain. Semakin keluhan pasien dikeluarkan, dokter cenderung
memikirkan berbagai keadaan penyakit yang disebabkanoleh kelainan neurologis,
metabolik,ataugangguankejiwaan.Dalamkebanyakankasus,bagaimanapun,tidak
adagambarangangguanyangjelasmunculdarihanyadarianamnesis.
Pemeriksaanfisikjugamerupakansumberyangtidakdapatdiandalkanuntuk
menegakkandiagnosis.Selainkelelahankronis,pasienjugamungkinmengeluhkan
merasa hangat atau menggigil dengan suhu tubuh normal, dan mungkin juga

33

mengeluh nyerikelenjar getahbeningtanpa adanya pembesaran. Temuan samar


samarinidanlainnyatidakmengkonfirmasiataumenyingkirkangangguan.
Kriteria diagnostik CDC untuk sindrom kelelahan kronis, yang tercantum
dalam termasuklahkelelahanminimal6bulan,gangguanmemoriataukonsentrasi,
sakittenggorokan,kelenjargetahbeningyangmelunakataumembesar,nyeriotot,
arthralgia, sakit kepala, gangguan tidur, dan malaise postexertional (selesai
beraktivitas).Kelelahan,yangmerupakangejalayangpalingjelas,ditandaidengan
kelelahanmentaldanfisikyangparah,yangcukupuntukmenyebabkanpenurunan
50%dalamaktivitaspasien.Onsetbiasanyabertahap,tetapibeberapapasienmemiliki
onset akut yang menyerupai penyakit seperti flu. Dalam beberapa kasus, terdapat
korelasiyangnyataadaantaraCFSdanhipotensineural,bagiandaridisfungsisistem
sarafotonom.

DIAGNOSADIFERENSIAL
Kelelahan kronis harus dibedakan dari gangguan endokrin (misalnya,
hipotiroidisme),gangguansaraf(misalnya,multiplesclerosis[MS]),gangguaninfeksi
(misalnya,diperolehsindromdefisiensiimun[AIDS],mononucleosismenular),dan
gangguankejiwaan(misalnya,gangguandepresi).
Sampaidengan80persenpasiendengansindromkelelahankronismemenuhi
kriteriadiagnostikuntukdepresiberat.Korelasisangattinggisehinggabanyakdokter
percaya bahwa semua kasus sindrom ini adalah gangguan depresi, namun pasien
dengan sindrom kelelahan kronis jarang melaporkan perasaan bersalah, keinginan
bunuhdiri,atauanhedoniadanmenunjukkansedikitatautidakadapenurunanberat
badan.Juga,biasanyatidakadariwayatkeluargadepresiataubebangenetiklainnya
untuk gangguan kejiwaan ditemukan dan sedikit, jika ada, peristiwa stres terjadi
dalamkehidupanpasienyangmungkinmemicuatauaccountuntukpenyakitdepresi.
Selainitu,meskipunbeberapapasienmerespondenganterapiantidepresan,banyak
pasienyangakhirnyamenjadirefrakterterhadapsemuaagenpsychopharmacology.

PENATALAKSANAAN
Pengobatansindromkelelahankronisterutamabersifatsupportif.Dokterharus
terlebih dahulu menjalin hubungan baikdan tidak mengabaikan keluhan pasien
34

sebagaitanpadasar.Keluhanyangdihadappasientidakimajiner.Pemeriksaanmedis
denganhatihatidiperlukan,danevaluasistatusmentalharusdilakukan,baikyang
diarahkanuntukmenyingkirkanpenyebablainuntukgejala.
Tidak ada pengobatan yang efektif yang diketahui. Antivirus dan
kortikosteroid tidak berguna, meskipun beberapa pasien telah menunjukkan
berkurangnyakelelahandenganobatantiviralamantadine(Symmetrel).Pengobatan
simtomatik(misalnya,analgesikuntukarthralgiadannyeriotot)adalahpendekatan
yangbiasa,tetapiobatantiinflammatorydrugs(NSAID)tidakefektif.Pasienharus
didorong untuk melanjutkan kegiatan seharihari dan melawan kelelahan mereka
sebanyak mungkin. Mengurangi beban kerja yang jauh lebih baik daripada tidak
bekerjasama.Beberapapenelitiantelahmelaporkanefekpositifdariterapilatihan
bergradasi(GET).
Perawatan psikiatris yang diindikasikan, terutama ketika adanya depresi.
Dalambanyakkasus,gejalamembaiknyataketikapasiendalampsikoterapi.Terapi
kognitifperilaku ini sangat berguna. Terapi ditujukan untuk membantu pasien
mengatasi dan memperbaiki keyakinan yang keliru, seperti takut bahwa setiap
kegiatanyangmenyebabkankelelahanmemperburukgangguan.Agenfarmakologis,
terutama antidepresan dengan kualitas nonsedasi, seperti bupropion (Wellbutrin),
mungkindapatmembantu.Nefazodone(Serzone)dilaporkanuntukmengurangirasa
sakitdanmeningkatkankualitastidurdanmemoripadabeberapapasien.Analeptics
(misalnya,amfetaminataumethylphenidate[Ritalin])dapatmembantumengurangi
kelelahan.

35

BABIII
KESIMPULAN
Fatigue adalah manifestasi yang timbul dari penyakit sistemik, neurologi,
psikiatriksindrom,meskipunpenyebabpastitidakdiidentifikasikandalambeberapa
pasien.Kelelahanmengacupadapengalamanmanusiasecarasubjektifdarikelelahan
fisikdanmental.Diferensialdiagnosisfatigueyaitumeliputipenyakitneuromuscular,
psikiatrik,penyakitsistemik(hematologi,imunologi,kardiovaskular,paru,penyakit
endokrin,dsb),sertaidiopatik.
Salahsatupenyebabfatigueadalahmultipelsclerosisyangmerupakansuatu
autoimunkronikyangmenyerangmyelinotakdanmedullaspinalis.Kelelahanadalah
salahsatugejalayangpalingumumdilaporkanpadapenyakitmultiplesclerosis(MS),
yangmempengaruhihampir90%daripasien.
Penyakit lainnya adalah fibromialgia dan sindrom kelelahan kronik yang
menyebabkangejalafatiguedenganetiologiyangtidakjelas.
Anamnesa, pemeriksaan fisik dan pemeriksaan penunjang harus dilakukan
untukmenyingkirkandanmengetahuietiologidarifatigue.Penatalaksanaanfatigue
disesuaikan dengan etiologinya, meliputi non medikamentosa dan medikamentosa.
Nonmedikamentosameliputiedukasipasiendanterapiyangsesuaidengankebutuhan
pasien.

36

DAFTARPUSTAKA

1. Estiasari R. Sclerosis multiple. Departemen neurologi, fakultas kedokteran


universitasIndonesiaRSCM.Jakarta.2014
2. AllanH.Ropper,MartinA.Adams&VictorsPrinciplesofNeurology,9th
Edition.Boston.2009.
3. Munger.K, Levin L, Holis B, Howard M, Ascherio A. Serum 25
Hidroksivitamin D Levels and Risk of Multiple Sclerosis. Report: JAMA
2006:296:28322838
4. SimonR.MotorDeficit.ClinicalNeurology.7th.McGrawHill.USA.2009.
5. About MS. 2012. Bayer HealthCare Pharmaceuticals. Available from:
http://www.multiplesclerosis.com/global/about_ms.php was accessed on
Februari11th,2016
6. Multiple sclerosis. 2012. Medscape References. Available from:
http://emedicine.medscape.com/article/1146199overview was accessed on
Februari11th,2016
7. Multiple Sclerosis. Pubmed Health Medicine. Available from:
http://www.ncbi.nlm.nih.gov/pubmedhealth/PMH0001747/ was accessed on
Februari11th,2016

37

8. Phenythoin Neuroprotection in MS.2015.MedscapeReferences. Available


from: http://www.medscape.com/viewarticle/843393#vp_1 was accessed on
Februari12th,2016
9. SamuelJO,FeriusS,SitiAN,SalehaS,MajelisKedoktIndonesia;Diagnosis
danTataLaksanaFibromialgia.FakultasKedokteranUniversitasIndonesia.
Volum:58,Nomor:5,Mei2008
10. dr.GeorgeD,dr.WitaJS,dr.BudiR,dr.YudaT;PanduanPraktisDiagnosis
danTatalaksanaPenyakitSyaraf.FakultasKedokteranUnikaAtmajaya.Hal
132136,2009
11. Winfield J. Fibromyalgia [Online]. 2007 Aug 15 [cited 2007 Dec 26];
Availablefrom:URL:http://www.emedicine.com/med/topic790.htm3.
12. Chronic

Fatigue

Syndrome.

2007.

Diunduh

welfare.ie/en/downloads/protocol5.pdf. Diunduh tanggal 29 Juni 2015


13. Fatigue a rational approach to investigation. Diunduh

dari
dari

racgp.org.au//fatigue/. Diunduh tanggal 29 Juni 2015


14. Sadock BJ. Sadock VA. Kaplan & Sadocks Synopsis of Psychiatry 10 th ed.
Lippincott Williams and Wilkins: Philadelphia. 2007.
15. Richard M. Michael S. Alan C. ABC of Psychological Medicine. BMJ
publishing group: London. 2003.

38