Anda di halaman 1dari 2

ID AAF87594; SV 1; linear; mRNA; STD; PRO; 1860 BP.

XX
PA AF286062.1
XX
DE Pseudomonas brassicacearum LipA
XX
OS Pseudomonas brassicacearum
OC Bacteria; Proteobacteria; Gammaproteobacteria; Pseudomonadales;
OC Pseudomonadaceae; Pseudomonas.
OX NCBI_TaxID=86264;
XX
FH Key Location/Qualifiers
FH
FT source 1..1860
FT /organism="Pseudomonas brassicacearum"
FT /strain="NFM421"
FT /mol_type="mRNA"
FT CDS AF286062.1:10192..12051
FT /codon_start=1
FT /transl_table=11
FT /gene="lipA"
FT /product="LipA"
FT /db_xref="GOA:Q9KGS2"
FT /db_xref="InterPro:IPR002921"
FT /db_xref="InterPro:IPR011049"
FT /db_xref="InterPro:IPR018512"
FT /db_xref="UniProtKB/TrEMBL:Q9KGS2"
FT /protein_id="AAF87594.1"
FT /translation="MGIYDYKNLGTTESKALVSDAMAIMLYSYHNLDNGFAAGYQHNGF
FT GAGLPATLVTALLGGTDSQGVIPGVPWNPDSEKLALEAVQKAGWTPISADQLGYAGKVD
FT GRGTFFGEKAGYTTAQVEILGKYDAEGHLQEIGVSFRGTSGPRENLIGDSIGDVINDLM
FT AALGPKDYRKNYVGEAFGNLLGDVAKFAQAHGLTGNDVLVSGHSLGGLAVNSLADLSAS
FT KWSGFYSSANYIAYASPTQSSTDKVLNIGYENDPVFRALDGSTFNLASVGVHDGQQESA
FT TNNIVSFNDHYASTAWNVLPFSILNIPTWISHLPTGYGDGMGRIMGSAFYDLTEKDFTI
FT IVANLSDPARANTWVQDLNRNAETHTGSTFIIGSDSNDLIQGGQGNDYLEGRAGNDTFR
FT DGGGYNVILGGQGSNSLQLQQSVKDFSFAHDGAGTLYMRDAHGAISITRDIGTLVSKES
FT GLFWGLLKDEVSHSVTANGLVAGANLTAYASSIKGSAANDTLVAGAKGDWLFGQDGNDV
FT LVGGAGNDTFVGGAGNDQMQAGGGSDTFLFNGAFGHDRISGYDAGDKLVFLGVPGAGAG
FT HDYSQYLSQVGNDTLLKVGDSSVTLVGVGLGQVGGEGIAFALI"
XX
SQ Sequence 1860 BP; 382 A; 557 C; 597 G; 324 T; 0 other; 2100665173 CRC32;
atgggtatct acgactacaa gaacctcggc actaccgagt ccaaggcact ggtcagcgac 60
gcaatggcga tcatgctgta ttcctaccac aacctcgaca acggctttgc cgccggttac 120
cagcacaacg gcttcggtgc cggcctgccg gcgaccctgg tgactgcgct gctgggcggc 180
accgattccc aaggggtgat tcccggcgtg ccgtggaatc ccgactcgga aaaactggcc 240
ctggaggcgg tacagaaggc cggctggacg cccatcagcg ccgatcaact gggttacgcc 300
ggcaaggtgg atggccgcgg gacgtttttt ggtgaaaagg ccggctacac caccgcgcag 360
gtagagatcc tcggcaagta cgacgccgag ggtcacttgc aggaaatcgg cgtgtcgttt 420
cgcggcacca gtggccctag ggaaaacctg attggcgatt ccatcggcga cgtgatcaac 480
gacctgatgg ccgcgctggg gcccaaggac tataggaaaa actacgtcgg cgaagccttt 540
gggaacctgc tgggggacgt cgcgaagttt gcccaggccc atggcctgac gggcaacgac 600
gtgctggtca gcggccacag cctgggtggg ctggcggtca acagcctggc ggacttgagc 660
gcgagcaaat ggtcagggtt ctactccagt gccaactaca tcgcctacgc ctcgccaacc 720
cagagcagta ccgacaaggt cttgaacatc ggctacgaga acgatccggt gttccgcgcc 780
ctggacggct cgacgttcaa cctcgcgtcg gtgggtgtgc acgatgggca acaggaatcg 840
gccactaaca atatcgtcag cttcaacgac cactacgctt cgacggcatg gaacgtgttg 900
ccgttttcca ttctcaacat ccccacctgg atttcccacc tgcctaccgg ctatggcgat 960
ggcatgggcc ggatcatggg ctcggcgttc tacgacctca ccgaaaaaga cttcaccatc 1020
atcgtcgcca acctgtcgga ccctgcgcgc gccaatacct gggtgcaaga cctcaaccgc 1080
aatgctgaaa cccacaccgg cagcacgttc atcatcggca gcgacagcaa tgacctgatc 1140
cagggcggcc agggcaacga ctacctggaa ggccgcgccg gcaacgacac ctttcgcgat 1200
ggcggtggct acaacgtgat cctgggcggg caggggagca acagcctgca actgcagcag 1260
tcggtgaagg atttcagttt cgcccacgac ggggccggga cgctatatat gcgcgacgcc 1320
catggcgcga tcagcatcac ccgcgacatc ggcacgttgg tcagtaagga gtccgggttg 1380
ttctgggggc tgctcaagga tgaagtgagc cacagtgtca ccgccaatgg cctggtggcc 1440
ggtgccaacc tgacggcgta tgcctcttcg atcaagggca gcgcggccaa cgacaccttg 1500
gtggcgggag cgaagggtga ctggctgttc ggccaggacg gcaacgatgt gctggtgggc 1560
ggcgcgggta acgacacctt cgtaggtggt gcaggcaatg accagatgca agcgggaggc 1620
ggcagtgaca ctttcctctt caacggcgcc ttcggccacg accggatcag cggctacgac 1680
gcgggggaca agctggtgtt cctcggcgta ccaggtgccg gggcaggtca tgactacagc 1740
cagtacctgt cacaagtggg caatgacacg ctgctcaagg tgggcgacag ttccgtgacc 1800
ctggtgggcg taggtctcgg tcaggtgggg ggcgaaggga tcgcgttcgc cctgatatag 1860
//