Anda di halaman 1dari 23

Demokrasi dan Partisipasi Publik

PendahuluanDewasa ini istilah demokrasi sering muncul di media


massa Indonesia menjelang diadakannya pemilihan legilatif maupun
kepala daerah (PILKADA). Tidak berbeda dengan pemilihan yang akan
terjadi di lingkungan Rukun Tetangga (RT) 02 Rukun Warga (RW) 19
Dukuh Baturan Desa Trihanggo Gamping Sleman. Meskipun dalam
skala dan lingkup yang kecil, tapi pesta demokrasi adalah hak dari
warga negara untuk menentukan pimpinan di daerahnya yang dianggap
layak dan mampu memegang amanat masyarakat.

Secara terminologi, istilah demokrasi berasal dari bahasa Yunani kuno


yang terdiri dari kata demos yang artinya adalah rakyat dan
kratos/cratein yang berarti pemerintahan . Dalam bahasa Inggris,
democracy artinya adalah pemerintahan yang berasal dari rakyat.
Sehingga apabila makna dari kedua kata tersebut digabungkan maka
demokrasi berarti pemerintahan rakyat. Sedangkan secara umum
demokrasi didefinisikan sebagai pemerintahan yang berasal dari rakyat,
oleh rakyat, dan untuk rakyat. Pemerintahan dari rakyat artinya adalah
pemerintah yang memperoleh amanat merupakan anggota masyarakat
yang dipilih dan kemudian diberi amanat oleh rakyat. Oleh rakyat
artinya adalah pemerintahan yang dibentuk merupakan hasil dari
kesepakatan bersama oleh rakyat sehingga daerahnya memiliki struktur
pemerintahan sehingga menjadi teratur. Sedangkan untuk rakyat,
memiliki arti bahwa pemerintahan yang dibentuk kemudian bekerja
untuk mengabdi dan melayani rakyat tersebut sehingga masyarakat
menjadi sejahtera.

Inti DemokrasiKekuasaan tertinggi dalam demokrasi ada di tangan


rakyat. Rakyat memiliki kedaulatan melalui suara yang digunakan
dalam pemungutan suara dalam pemilihan umum. Dengan demikian
suara rakyat menjadi penentu dalam pengambilan keputusan pada
masyarakat tersebut. Pemilu memberikan kesempatan kepada rakyat
untuk memilih pemimpin yang dianggap paling layak dan mampu untuk
mengemban amanat. Kemudian pemimpin yang terpilih akan
memperoleh mandat dari rakyat untuk mengelola pemerintah melalui
lembaga perwakilan rakyat. Lembaga perwakilan berasal dari anggota
masyarakat yang bertugas untuk menjaga agar pelaksanaan
pemerintahan tidak mengalami pemyimpangan.

Lembaga perwakilan merupakan wadah bagi rakyat untuk menyalurkan


aspirasi sehingga suara rakyat tersalurkan pada pemerintah. Rakyat
juga bisa secara langsung memberikan masukan tidak hanya kepada
lembaga perwakilan tetapi juga kepada pemerintah. Tindakan ini
disebut dengan partisipasi publik (rakyat). Partisipasi adalah suatu
proses dimana sejumlah pelaku bermitra punya pengaruh dan membagi
wewenang di dalam prakarsa “pembangunan”, termasuk mengambil
keputusan atas sumberdaya . Sedangkan Partisipasi publik secara
sederhana diartikan sebagai keikutsertaan dan keterlibatan masyarakat
dalam aktivitas kenegaraan. Wujud partisipasi publik bisa beragam,
misalnya ikut pemilihan umum (pemilu), membayar pajak,
menyampaikan aspirasi, keluhan, mengontrol pemerintah, dan lain-lain.

Salah satu contoh nyata dari partisipasi publik adalah keikutsertaan


dalam pemilihan umum (pemilu). Istilah lain dari pemilu adalah pesta
demokrasi. Disebut demikian karena pemilu merupakan kegiatan besar
menyerupai perayaan/pesta dimana rakyat berhak dan menjadi penentu
dari perjalanan masyarakatnya. Pemilu pertama kali dilaksanakan pada
jama Yunani Kuno untuk memilih anggota senat polis yang memberikan
masukan kepada kaisar. Pada jaman tersebut pemilu dilaksanakan
secara langsung dengan cara memilih calon anggota senat yang ada.
Di samping itu, jumlah penduduk yang memiliki suara dalam suatu polis
masih sedikit sehingga pemilihan bisa dilakukan secara langsung.
Dewasa ini, jumlah rakyat di suatu negara sangatlah besar sehingga
pemilihan secara langsung sering kali memakan waktu sehingga
dikenal pemilihan tidak langsung. Rakyat memilih anggota lembaga
perwakilan dan lembaga perwakilanlah yang memilih kepada negara
tersebut. Namun hal ini mendapat banyak kritik karena lembaga
perwakilan seringkali tidak mewakili aspirasi dari rakyatnya sehingga
pemilihan langsung tetap digunakan untuk memilih pemimpin
masyarakat.

Pemilihan Presiden, Gubernur, Bupati/Walikota, dan Kepala Desa


dilakukan secara langsung. Demikian halnya dengan rencana pemilihan
Ketua RT 02 ini. Rakyat memiliki kedaulatan melalui suaranya untuk
memilih dan menentukan pemimpin yang paling dipercaya untuk
mengemban amanat. Ketika seseorang memilih calon pemimpin, yang
bersangkutan sebenarnya sama saja dengan mendelegasikan hak
untuk menjadi pemimpin dan mengelola daerahnya karena setiap
individu memiliki hak yang sama. Mengingat setiap individu memiliki
hak yang sama untuk memimpin. Ketika memilih seorang pemimpin
berarti merelakan hak tersebut dilakukan oleh orang lain. Namun
demikian hak tersebut tidak diserahkan hanya dipinjamkan dalam
bentuk amanat dan rakyat bisa meminta kembali bahkan mencabut
amanat/hak dipinjamkan kepada pemimpinnya apabila dianggap gagal
atau melakukan penyimpangan. Amanat dan kekuasaan yang dimiliki
oleh pemimpin adalah pemberian rakyat dan bersifat sementara dan
bisa dicabut. Pemimpin adalah individu yang diberi amanat untuk
menjalankan pemerintahan. Presiden, DPR, Bupati, Walikota, DPRD,
dan kepala desa adalah pemimpin. Oleh karena itu seorang pemimpin
harus bertanggung jawab kepada rakyatnya dan menjalankan tugasnya
untuk melayani rakyat. Hal ini juga berlaku kepada calon Ketua RT
yang akan dipilih.

Kepemimpinan dalam MasyarakatPemimpin adalah individu yang


bertugas sebagai kepala pemerintahan. Kepala pemerintahan memiliki
tugas untuk mengatur tatanan kehidupan masyarakat sehingga berjalan
dengan baik. Setiap individu dalam masyarakat memiliki kepentingan
yang berbeda-beda. Perbedaan kepentingan memungkinkan terjadinya
benturan antar anggota masyarakat dan berakibat pada timbulnya
perselisihan. Pemimpin dalam hal ini harus mengakomodasi
kepentingan rakyat banyak sehingga pemenuhan atas kebutuhan yang
menjadi hajat hidup orang banyak harus didahulukan. Masyarakat juga
harus mematuhi ketentuan pemerintah yang bertujuan untuk
kemakmuran masyarakatnya sehingga resiko terjadi konflik dapat
dikendalikan. Meskipun tidak memimpin sendiri, tapi dibantu oleh
perangkat organisasi lain, pemimpin haruslah memiliki visi yang baik
sehingga masyarakat yang dipimpinnya memiliki tujuan.

Pemenuhan kebutuhan membutuhkan sumber daya yang dimiliki oleh


daerah tersebut. Sumber daya tersebut harus dikelola dan dialokasikan
secara tepat sehingga sasaran yang dituju mengena dan tidak terjadi
pemborosan. Masyarakat juga harus secara aktif melakukan
pengawasan terkait pemanfaatan sumber daya daerahnya karena
kekayaan daerah pada hakikatnya adalah milik masyarakat dan
dipungut dari masyarakat oleh pemerintah meskipun pengelolaan
diserahkan pada pemerintahan setempat.

Masyarakat dalam menjalankan kehidupannya juga berhubungan dan


berdampingan dengan masyarakat lain. Komunikasi yang baik harus
berjalan sehingga menciptakan kedamaian antar wilayah. Seorang
pemimpin harus menjadi wakil masyarakatnya dalam berhubungan
dengan masyarakat yang lain. Pemimpin harus memiliki pengetahun
dan wawasan yang luas sehingga mampu mewakili masyarakatnya
untuk berkomunikasi dengan pihak lain.

Keseluruhan tugas yang dimiliki oleh pemimpin adalah amanat dari


masyarakatnya. Kekuasaan yang dimiliki merupakan tanggung jawab
yang berasal dari masyarakat. Masyarakat dengan sukarela telah
menyerahkan haknya menjadi pemimpin untuk dipimpin oleh orang lain.
Oleh karena itu, seorang pemimpin harus mempertanggungjawabkan
tugasnya kembali kepada masyarakat. Ini adalah wujud dari
akuntabilitas pemimpin kepada warganya. Akuntabilitas adalah
kewajiban untuk menyampaikan pertanggungjawaban atau untuk
menjawab dan menerangkan kinerja dan tindakan seseorang/badan
hukum/pimpinan kolektif suatu organisasi dalam penggunaan sumber
daya yang ada, dan apa saja yang telah dicapai dengan penggunaan
wewenang dan sumberdaya tersebut kepada pihak yang memiliki hak
atau kewenangan untuk meminta keterangan atau pertanggungjawaban
. Dengan demikian masyarakat sebagai pihak yang memiliki sumber
daya dan melimpahkannya pada pemimpin akan menilai keberhasilan
pelaksanaan tugas yang diamanatkan.

Masyarakat berhak untuk memilih pemimpin sesuai dengan hati nurani


yang dimiliki. Hati nurani yang baik seharusnya bisa mengantarkan
pemilihan pada seorang pemimpin yang terbaik di mata masyarakat.
Hal ini bertujuan agar tugas-tugas yang dibebankan pada seorang
pemimpin bisa berjalan dan berhasil. Oleh karena itu diperlukan kriteria
pemimpin yang ideal. Terdapat beberapa kriteria untuk memilih
pemimpin ideal, yaitu: 1) Terbuka (jujur): bisa berkomunikasi dengan
semua pihak, 2) Transparan (terpercaya): pengelolaan sumber daya
bisa diketahui oleh masyarakat, 3) Partisipasif: melibatkan masyarakat
dalam musyawarah, dan 4) Akuntabel (bertanggung jawab):
menjalankan kegiatan yang bermanfaat untuk masyarakat. Dengan
kriteria tersebut, calon pemimpin diharapkan bisa mengemban tugas
yang akan diletakkan di pundaknya.

Tugas masyarakat setelah seorang pemimpin berhasil dipilih adalah


mematuhi dan menjalankan kebijakan serta peraturan yang dibuat
untuk kepentingan masyarakat. Setiap warga juga wajib untuk
melibatkan diri dalam berbagai kegiatan yang diselenggarakan oleh
organisasi masyarakat di lingkungannya. Keterlibatan warga sangat
penting dan tidak hanya pada pelaksanaannya tapi juga dalam
perencanaan kegiatan. Dengan demikian kegiatan yang dilaksanakan
benar-benar dibutuhkan dan mampu dirasakan manfaatnya secara
luas. Selanjutnya, warga juga harus berpartisipasi secara aktif dalam
melakukan pengawasan dan kontrol atas kegiatan yang
diselenggarakan di wilayahnya. Ini adalah wujud dari tanggung jawab
moral warga terhadap pemimpin yang dipilihnya.

PenutupPemilihan Ketua RT 02 di Padukuhan Baturan merupakan


kegiatan dari warga, oleh warga, dan untuk warga. Dengan demikian
semua orang yang menjadi warga di lingkungan tersebut memiliki hak
yang sama. Hak tersebut adalah untuk memilih dan dipilih menjadi
Ketua RT berdasarkan kriteria yang telah disepakati. Oleh karena itu,
setiap individu harus siap menjadi ketua apabila dipilih oleh warga yang
lain. Yang bersangkutan harus legawa dan siap menjalankan tugas.
Sedangkan warga yang lain harus menerima, mematuhi, membantu,
dan mengawasi ketua baru demi RT 02 semakin maju di masa datang.
HUBUNGAN BIROKRASI DENGAN DEMOKRASI
Dra. DARA AISYAH, M.Si
Jurusan Ilmu Adminisrasi Negara Fakultas Ilmu Sosial dan Ilmu Politik
Universitas Sumatera Utara
Berbicara tentang birokrasi sering kali kita asumsikan dengan urusan yang berbelit-
belit, prosedur yang panjang dan memakan waktu yang lama, pokoknya selalu
mendapat “tanda” negatif dari pendengarnya. Hal ini akan menjadi lebih transparan
apabila kita memantau birokrasi yang berhubungan atau berurusan dengan organisasi
formal, islam maupun non islam, negeri maupun swasta. Pembahasan birokrasi selalu
menarik untuk dibicarakan baik sebagai bahan diskusi maupun sebagai bahan kajian
ilmiah untuk diperdebatkan dengan tujuan mencari solusinya.
Apalagi topik yang akan dikaji ada hubungannya dengan demokrasi sehingga
memerlukan suatu pemikiran yang serius untuk menelaah dan menilai akibat-akibat
yang terjadi dan yang ditimbulkan oleh aksi birokrat dalam konteks demokrasi yang
perlu diperbaiki.
Namun apakah sudah menjadi hal yang sulit direform bahwa birokrasi selalu
menghambat kemudahan, kemajuan dan perkembangan suatu sistem politik
khususnya memperkecil ruang gerak demokrasi. Tulisan ini mencoba menjabarkan
birokrasi berkaitan dengan demokrasi dan melihat posisi itu melalui Rekonstruksi.
Oleh karena itu lebih baik dijelaskan terlebih dahulu apa birokrasi dan demokrasi itu
Bagaimana kontribusinya terhadap demokrasi Bagaimana posisi birokrasi dengan
demokrasi melalui rekonstruksi bagaimana situasi problematik yang terjadi di
Indonesia dan strategi seperti apa yang dapat diterapkan di Indonesia sehingga
antara birokrasi dan demokrasi bisa direkonstruksi.
a. Konsep Birokrasi
Dalam kamus Akademi Perancis tahun 1798, Birokrasi
diartikan :"kekuasaan,pengaruh dan para kepala dan star biro pemerintahan.
Sedangkan menurut kamus bahasa Jerman edisi 1813, birokrasi di definisikan
sebagai:"wewenang atau kekuasaan dari berbagai departemen pemerintahan.”
Birokrasi sebagai suatu sistem organisasi formal dimunculkan pertama sekali oleh
Max Weber pada tahun 1947, menurutnya birokrasi merupakan tipe ideal bagi semua
organisasi formal. Ciri organisasi yang mengikuti sistem birokrasi ini ciri- cirinya
adalah pembagian kerja dan spesialisasi, orientasi impersonal, kekuasaan hirarkis,
peraturan-peraturan, karir yang panjang, dan efisiensi.
Cita-cita utama dari sistem birokrasi adalah mencapai efisiensi kerja yang seoptimal
mungkin. Menurut Weber organisasi birokrasi dapat digunakan sebagai pendekatan
efektif untuk mengontrol pekerjaan manusia sehingga sampai pada sasarannya,
karena organisasi birokrasi punya struktur yang jelas tentang kekuasaan clan orang
yang punya kekuasaan mempunyai pengaruh sehingga dapat memberi perintah untuk
mendistribusikan tugas kepada orang lain (Robert Denhard,
©2003 Digitized by USU digital library 11984 : 26,32). Organissasi mengopcrasikan
prinsip-prinsip dasar hirarki kantor dimana ada garis-garis yang jelas dari atasan dan
bawahan.
Menurut Herbert M.Levine, birokrasi kadang-kadang digunakan dalam suatu hal yang
diremehkan, boleh dikatakan artinya canggung, tidak imaginatif, kaku, dan para
administrator pemerintah yang tidak efisien (Herbert M.Levine, 1982 : 240).
Birokrasi memainkan peranan aktif di dalam proses politik di kebanyakan negara dan
birokrasi menggunakan banyak aktifitas-aktifitas, diantaranya usaha- usaha paling
penting berupa implementasi Undang-Undang, persiapan proposal legislatif, peraturan
ekonomi, lisensi dalam perekonomian dan masalah-masalah profesional, dan
membagi pelayanan kesejahteraan (Herbert M.Levine, 1.982: 241).
Masyarakat didominasi oleh para birokrat, ditulis oleh James Burnham tahun 1941
yang menekankan pentingnya kelompok manajerial di dalam perekonomian, dan tidak
ada pemisahan yang tajam antara kelompok manajerial clan pejabat politik (Martin
Albrow, 1989 : 100) Berdasarkan tulisan tersebut James memberi persamaan antara
kekuasaan kelas para manajer dengan kelas para birokrasi negara.
Masyarakat yang dibentuk dan diperintah oleh para birokrat akan menjadi
masyarakat -masyarakat birokratis yang nantinya masyarakat tersebut akan menjadi
birokrasi-birokrasi masyarakat yang patuh dan tunduk pada pengaruh sikap-sikap dan
nilai-nilai para birokrat, karena adanya perubahan sikap dari masyarakat akan
bergantung kepada pengaruh para birokrat. Hal ini akan cepat menjerat masyarakat
akan runtuhya nilai-nilai demokrasi sehingga ada suatu pertentangan dengan nilai-
nilai tersebut yang dianggap sebagai suatu problema yang memerlukan pemecahan.
b. Konsep Demokrasi
Pada tulisan ini perhatian kita tertuju pada masalah birokrasi dan hubungannya
dengan demokrasi. Selama masih ada tipe-tipe pejabat negara dan seperangkat nilai
yang dianggap sebagai bagian inheren dalam demokrasi yang sebenamya. maka
masalah birokrasi dan demokrasi tidak akan pernah berhenti.
Cara pandang tentang demokrasi dari waktu ke waktu mengalami perkembangan
sejalan dengan semakin kompleksnya hubungan antar warga. Kata demokrasi berasal
dari bahasa Yunani, menurut bahasa Yunani, definisi yang paling singkat tentang
demokrasi adalah apa yang diucapkan oleh Abraham Lincoln di Gettysburg,
Pensylvania, Arnerika Serikat tahun 1863 yaitu pemerintahan dari rakyat, oleh
rakyat, untuk rakyat Esensi dari demokrasi adalah bahwa rakyat memerintah atau
melakukan pemerintahan oleh dirinya (government by the people) (majalah Koridor,
1994: 3,4), demokrasi magandung dua dimensi kontes dan partisipasi yang menurut
Robert Dahl merupakan hal menentukan bagi demokrasi. Demokrasi juga
mengimplikasikan adanya kebebasan sipil dan politik yaitu kebebasan berbicara,
menerbitkan, berkumpul dan berorganisasi, yang dibutuhkan bagi perdebatan politik
dan pelaksanaan kampanye-kampanye pemilihan itu (Samuel P. Huntington, 1995 :
6).
Demokrasi berarti liberte, egalite, fraternite, dimana ada kontrol yang efektif. oleh
warga negara terhadap kebijakan pemerintah. David Held menyatakan ada 7 prinsip
utama penyelenggaraan negara berdasarkan demokrasi yaitu: 1. masyarakat harus
memerintah dalam arti semua harus terlibat dalam membuat
undang-undang, memutuskan kebijaksanaan umum dan melaksanakan hukum dan
administrasi pemerintahan.
©2003 Digitized by USU digital library 2
2. masyarakat secara perseorangan harus terlibat dalam pembuatan keputusan yang
penting dalam arti memutuskan hukum-hukum publik dan masalah- masalah
kebijaksanaan umum.
3. para penguasa berkewajiban untuk mempertanggungjawabkan tindakan-
tindakannya kepada masyarakat .
4. parapenguasaharusbertanggungjawabkepadaperwakilandarimasyarakat. 5.
parapenguasaharusdipiliholehmasyarakat. 6.
parapenguasadipilihmelaluirepresentatif/perwakilandarimasyarakatdan 7. para
penguasa harus bertindak sesuai dengan kepentingan masyarakat. (prisma
No.4 tahun XXI, 1992 : 32).
Kalau kita amati model demokrasi David Held diatas, maka untuk kasus negara
berkembang seperti Indonesia demokrasi yang muncul sangat bergantung kepada
perilaku elit politik dan struktur budaya, ekonomi dan ideologi yang menjadi anutan,
khususnya dalam cara pandang terhadap pembangunan politik. Demokrasi yang
dapat menghambat nilai-nilai kultural menurut seorang Indonesianist Benedict R.O'G
Anderson yaitu prinsip ajaran demokrasi pandangan Jawa yang sangat mempengaruhi
sistem politik dan proses demokratisasi Indonesia. Basis kultural dalam pemerintahan
Orde Baru di Indonesia itu dapat dilihat dari bagaimana hubungan antara elit politik
dengan warga negara sebagai hubungan antara kawulo dan gusti, antara
kekuasaan di kalangan "wong ghede dan wong cilik”.
Usaha demokratisasi masih memerlukan rentang waktu yang cukup panjang bagi
lembaga-lembaga politik, rezim yang memerintah, maupun nilai masyarakatnya
sendiri dalam memaksimalkan upaya yang ada menuju iklim demokratisasi yang
diidam-idamkan.
c. Kontribusi birokrasi dengan Demokrasi
Kebanyakan orang menganggap bahwa konsep birokrasi sebagai administrasi yang
tidak efisien dan rasional, mencakup aplikasi kriteria evaluatif dan spesifikasi sifat
nilai-nilai tersebut (Martin Albrow,1989 : 1 07). Konsep birokrasi cendrung dianggap
sebagai suatu aspek ancaman terhadap demokrasi, apalagi konsep birokrasi sebagai
kekuasaan yang dijalankan oleh pejabat, konsep ini diamati secara serius karena
mendiskusikan tentang pejabat-pejabat negara yang menjalankan tujuan-tujuan
demokrasi. Perlu dipertanyakan apakah tindakan tergantung pada bagaimana nilai-
nilai demokrasl Itu ditafsirkan dan mana diantara penafsiran itu yang dipandang
salah.
Friedrich dan Finer prihatin terhadap masalah kesesuaian praktek-praktek
administrasi negara modem dengan nilai-nilai demokrasi, karena mereka percaya
bahwa bukan kekuasaan yang dijalankan pejabat yang menimbulkan masalah tetap
cara menggunakan kekuasaan itulah yang menjadi masalahnya, untuk itu perlu dilihat
bagaimana masing-masing karakteristik antara birokrasi dan demokrasi digunakan
dalam usaha mendiagnosis dan menyembuhkan masalah yang terjadi.
Martin Albrow membedakan tiga posisi dasar tentang fungsi-fungsi pejabat di
negara demokrasi, yaitu
1. pejabat menuntut kekuasaan terlalu besar dan perlu dikembalikan pada fungsinya
semula.
2. pejabatbenar-benarmernilikikekuasaandantugasyangsemakinbesarsehingga
jabatan tersebut harus dijalankan secara bijaksana .
3. kekuaasaan perlu bagi para pejabat sehingga harus dicari metode-metode
pelayanan yang dapat disalurkan bersama-sama.
©2003 Digitized by USU digital library 3
Problema yang harus dipecahkan untuk dapat menumbuh kembangkan demokrasi
dengan menempatkan birokrasi secara konsisten di dalam sistem politik.
Dalam sistem politik demokrasi liberal yang berawal dari Maklumat Wakil Presiden
No.X tertanggal 3 November 1945. terwujud konfirmasi, dimana politik yang ikut
menentukan sosok administrasi pemerintah pada waktu itu. Posisi infrastruktur politlk
vis-a-vis suprastruktur politik secara relatif lebih kuat, menciptakan suatu sosok
sistem politik bureau-nomia (Moeljarto Tjokrowinoto, 1996: 159).
Menurut teori, agar dapat memahami birokratisasi dalam pembangunan nasional, di
Indonesia terlebih dahulu didekatkan melalui 2 konsep yaitu :
1. konsep masyarakat politik birokratik yang dikembangkan pertama sekali oleh Fred
Riggs (1966) dan digunakan oleh Karl D.Jackson (1978) dalam konteks Indonesia.
2. konsepkapitalismebirokratikyangdirumuskanolehWittfogel(1957).
Berdasarkan konsep Jackson tersebut maka ciri-ciri pokok masyarakat politik
birokratik adalah :
1. lembagapolitikyangdominanadalahaparatbirokrasi 2. lembaga–lembaga politik
lainnya, seperti parlamenter, partai politik, dan
kelompok kepentingan semuanya lemah dan tidak mampu melakukan kontrol
terhadap birokrasi. 3. masa diluar birokrasi secara politis dan ekonomis pasif,
sehingga menyebabkan
lemahnya peranan partai politik dan dampaknya semakin memperkuat peranan
birokrasi.
Bertitik tolak dari ciri-ciri tersebut maka dapat kita simpulkan bahwa birokrasi di
Indonesia cendrung mendekati ke tiga ciri tersebut, sehingga perlu dipertanyakan
kemampuan masyarakat politik birokratik ini untuk melaksanakan pembangunan
,terutama pembangunan yang mampu mengantisipasi dan menahan gejolak-gejolak
eksternal sehingga bisa mencapai tingkat pertumbuhan yang memadai, yang dapat
mendistribusikan secara merata hasil dari perjuangan masyarakat tersebut.
Ada tiga kecendrungan yang dialami oleh setiap birokrasi, yaitu pertama proses
weberisasi, yaitu suatu proses dimana suatu biroksasisemakin mendekati tipe ideal
sebagaimana dikemukakan oleh Max Weber.Kedua, proses parkinsonisasi yaitu
proses dimana birokrasi cendrung menuju kedalam keadaan patologis sebagaimana
pernah diduga kuat oleh C.Northcote Parkinson Ketiga, proses orwelisasi, yaitu
kecendrungan birokrasi semakin menguasai masyarakat, untuk birokrasi di Indonesia
agaknya cendrung ke arah parkinsonisasi dan orwelisasi ketimbang ke arah
weberisasi.(Muhadjir Effendy, dalam jurnal Bestari, januari-april 1995 : 27,28 ).
Menurut analisa Dr.Muhadjir Darwin yang menyimpulkan bahwa birokrasi di Indonesia
sedang “sakit” dengan titik tekanannya berdasarkan hukum Parkinson, sedangkan
parameter birokrasi “ sehat “ yang dijadikan sandaran adalah konsep birokrasi weber
tetapi pada kenyataanya selalu menimbulkan masalah, karena ciri- ciri organisasi
yang diharapkan terlalu ideal sehingga kadang kala belum tentu cocok dengan kondisi
atau situasi di suatu negara.
©2003 Digitized by USU digital library 4
d.Dampak Kekuasaan Birokrasi Terhadap Kondisi Demokrasi
kekuasaan birokrasi menimbulkan pertanyaan yang menyebabkan para ilmuan mulai
berpikir. Adil dan perlakuan yang sama bagi seluruh penduduk ternyata
membutuhkan seperangkat hukum yang kompleks da peraturan-peraturan
administratif, untuk dapat berfungsi, setidak-tidaknya masyarakat harus memberikan
pengertiannya karena pada kenyataannya jumlah polisi tidak cukup banyak di dalam
melakukan kontrol atas penerapan hukum, dengan demikian keadaan menjadi sulit
bila masyarakat cendrung tidak mematuhi hukum.
Dalam jangka pendek, tentu saja birokrasi dapat memerintah masyarakat tanpa
Menimbulkan perlawanan mereka Namun sebagaimana kita juga pemah belajar dari
masa lampau, kerelaan yang pertama-tama bersifat pasif pada akhimya
membangkitkan rasa ketidakberdayaan. Hal ini kemudian dicetuskan dalam bentuk
protes yang mengacaukan suasana. Apabila kita menunggu sampai suasana itu
benar-benar terjadi, inilah yang disebut antitesis demokrasi.
Sedikit kepatuhan sudah merupakan suatu kondisi bagi demokrasi. Bila pemerintah
harus memaksa kepatuhan yang sepenuhnya, hal ini berarti mengurangi
demokrasi.Kepatuhan tanpa syarat pada hakikatnya menghindari kritik dan
ketidaksepakatan yang menjadi inti demokrasi (Peter M.Blau. Marshall. dan
W..Meyer .1987: 202.203).
Bila kita lihat contoh di Indonesia, bahwa masyarakat wajib pajaknya sudah lelah
dengan seabrek peraturan yang harus dipatuhi. sehingga ada kesan terpaksa untuk
memenuhi kewajiban perpajakan, dan sulit menciptakan masyarakat yang sadar
pajak dalam sistem yang diterapkan untuk meningkatkan penerimaan negara. Pada
dasamya masyarakat lebih menginginkan terciptanya kesadaran daripada kepatuhan.
Ibarat seorang pencuri bertobat untuk tidak akan mengulangi perbuatannya karena
dia takut kepada Allah (sadar bahwa mencuri itu perbuatan dosa), daripada takut
karena adanya ganjaran hukuman yang menantinya, sehingga sulit untuk mencapai
tahap masyarakat yang "marginal detterence". kalau mentalnya masih mental
pencuri.
Nilai-nilai demokratis tidak saja berarti tujuan-tujuan masyarakat yang ditentukan
oleh keputusan mayoritas. tetapi juga bahwa tujuan-tujuan tadi diterapkan melalui
metode-metode efektif yang ada, yakni dengan memantapkan organisasi-organisasi
sifatnya yang lebih birokratis daripada berupa pengaturan secara demokratis.
Keberadaan birokrasi-birokrasi semacam itu tidak merusak nilai- nilai demokrasi.
Jika birokrasi berlebihan maka masyarakat dirugikan karena masyarakat punya
otonomi yang terbatas, karena freewill terbatas untuk masyarakat, karena belum
tentu yang dilakukan birokrat baik, baik juga untuk rnasyarakat. Birokrasi sulit untuk
direm karena ada dorongan dari dalam (birokrat itu sendiri) ataupun dari luar
seperti : 1. dorongan politik, yaitu : tuntutan dari rnasyarakat sehingga membuat
birokrasi
menjadi lebih besar peranannya, adanya tuntutan negara semakin berkembang terus,
yang meminta negara untuk menyelesaikannya dan meminta negara melayani hal
tersebut sebagai contoh yaitu negara yang demokratis.
2. doronganekonomi. 3. dorongan yang bersifat sosial, yaitu pemberian
tanggungjawab pada negara
untuk melakukan sesuatu pada masyarakat, ada pandangan bahwa negara
©2003 Digitized by USU digital library 5
sebagai penggerak pembanggunanan nasional dan negara diasumsikan sebagai fungsi
yang strategis...
Demokrasi dan birokrasi sesungguhnya sangat diperlukan dalam proses
pembangunan suatu negara , akan tetapi semakin kuat birokrasi dalam negara maka
akan semakin rendah demokrasi dan sebaliknya semakin lemah birokrasi maka akan
semakin tinggi demokrasi.
Gejala tumbuhnya birokrasi yang terlarnpau kuat diungkapkan oleh Fred W Rigg
ketika ia rnelakukan penelitiam modernisasi di Thailand yang kemudian muncul
dengan konsep "Bureaucratic Polity" yang menggambarkan betapa birokrasi di
Thailand telah memasuki suatu jaringan kehidupan politik dan ekonomi yang sangat
kuat yang dilakukan oleh negara terhadap kehidupan masyarakat, dalam konsep yang
sama Karl D.Jackson untuk studinya tentang birokrasi di Indonesia, yang
menempatkan birokrasi melalui pemasukan nilai budaya masyarakat yang dominan
sebagai suatu kekuatan tersendiri dalam mempengaruhi sistem politik dan perilaku
politik elit kekuasaan (Karl D.jackson. dalam Karl D.Jackson dan Lucian W.Pye,
1987:4).
Berdasarkan studi Guelermo O'Donnel bahwa negara telah muncul sebagai kekuatan
politik yang tidak hanya relatif mandiri berhadapan dengan faksi-faksi elit
pendukungnya serta masyaraklu sipil, tetapi ia telah menjadi kekuatan dominan yang
marnpu mengatasi keduanya. Otoritarian Birokratik memang diciptakan untuk
melakukan pengawasan yang kuat terhadap masyarakat sipil, terutama dalam upaya
mencegah massa rakyat di bawah keterlibatan politik yang terlampau aktif agar
proses akselerasi industrialisasi tidak tergangggu (Guelermo O'Donnel dalam
Muhammad AS Hikam, Jurnal IImu Politik No.8, AIPI LIPI Jakarta 1991: 68).
Studi Fred W Rigg tentang Bureaucratic Polity dan GuelermO'Donnel tentang
Bureaucratic Authoritarian nampaknya menggarisbawahi bahwa dalam masyarakat
tertentu posisi birokrasi sudah berada di bawah kontrol politik kekuasaan dalam
rangka mendapatkan sumber legitimasi politik melalui sarana birokrasi. Jika dalam
studi Rigg birokrasi. berkolaborasi dengan kekuasaan pemerintah, maka model
O'Donnell birokrasi itu tidak hanya berkolaborasi dengan kekuasan tetapi juga
melibatkan diri hampir di semua bidang kegiatan. Keterlibatan negara tidak hanya
dalam bidang poitik formal, namun menjalar sampai kepada kegiatan ekonomi sosial
budaya termasuk juga ideologi.
e.Rekonstruksi Birokrasi dan Demokrasi Melalui Beberapa Pendekatan.
Birokrasi dan Demokrasi melalui penjelasan tersebut ibarat dua sisi dari mata uang
yang sama, birokrasi dan demokrasi sangat diperlukan dalam kegiatan negara dan
masyarakat, akan tetapi keduanya justru menunjukkan tingkat perbedaan yang
mendasar dan kalaupun memungkinkan dapat dipertemukan satu sama lain melalui
rekonstruksi antara keduanya. Birokrasi merupakan salah satu sarana bagi kekuasaan
negara untuk memperkuat posisi politik dan merupakan sumber legitirnasi politiknya.
Sementara demokrasi merupakan keinginan dari sebagian besar rnasyarakat untuk
rnendapatkan keberdayaan sehingga proses tawar menawar antara state dan sipil
society dapat berkembang dengan baik khususnya dalam kerangka pengembalian
keputusan politik sebagaimana prinsip-prinsip dasar dari demokrasi itu sendiri.
©2003 Digitized by USU digital library 6
Modal kebijakan merupakan pendekatan yang akan dipakai dalam merekonstruksi
birokrasi dan demokrasi. Allison mendeskripsikan 4 model kebijakan yaitu : 1.
Synoptic Model, merupakan model yang ideal dengan melihat proses kebijakan
sebagai suatu proses yang sangat rasional dimana policy maker atau aktor-aktor
yang terlibat dalam proses kebijakan dianggap memiliki persepsi yang jelas tentang
tujuan yang akan dicapai (Charles H Levine, B.Guy Peters, Frank J. Thompson, 1990 :
82) .Para aktor politik bisa menilai konsekuensi-konsekuensi positif dan negatif,
contohnya : kebijakan pengentasan kemiskinan, adanya kesadaran para aktor dalam
birokrasi sehingga mengambil nilai tertentu yang siap dimaksimalkan pemerintah.
Dalam hal ini birokrasi tidak hanya penerima kebijakan dari pejabat-pejabat politik,
tetapi turut melakukan kebijakan berupa tindakan membela si miskin sebagai suatu
pertanda merekonstruksi demokrasi, hat ini menandakan bahwa birokrasi bukan
pemerintahan rakyat tetapi mengembalikan peran negara sebagai arbiter (perantara).
2. Model Incremental, merupakan kebijakan yang dimulai dengan melihat
kebijakan yang ada, apa yang menjadi tantangan masa depan, apa perlu kebijakan
direvisi atau direform. Proses kebijakannnya sering kali tidak dimulai dari titik nol
karena selalu dimulai dengan kebijakan yang ada sehingga standard operating
procedurenya terlalu kuat.
3. Model Garbage Can, merupakan kebijakan yang mencari tujuan yang pasti, akan
tetapi hubungan antara tujuan dan kebijakan-kebijakan utama tidak selalu jelas.
Pendekatan ini sering juga disebut organisasi anarki, menurut model ini hasil
pembuatan keputusan secara kebetulan dipengaruhi 4 komponen yaitu : para
partisipan, solusi, masalah-masalah dan kesempatan untuk memilih (Charles
H.evine,B.Guy Peters,Frank J. Thompson, 1990 :83,84)
4. Model Birokratik Politik, merupakan proses pengambilan keputusan dalam
melibatkan banyak aktor/kelompok-kelompok kepcntingan yang masing-masing
punya nilai atau kepentingan sendiri, punya agenda masing-masing, memperjungkan
atau membangun strategi-strategi sendiri dengan koalisi, bergaining atau kompromi
sesuai dengan tujuan yang ia miliki.(Charles H.Levine,B Guy Peters,Frank
J.Thompson,1990: 84).
Berdasarkan beberapa model yang ditawarkan, jika kita mengacu ke negeri sendiri
yaitu Indonesia, maka ada kecendrungan kita memakai model Incremental, dimana
terlalu banyak prosedur dan standard operating procedure terlalu dinomorsatukan
atau dijadikan sebagai salah satu instrumen yang digunakan oleh pemerintah pusat.
Pembuatan keputusan-keputusan poitik nasional amat didominasi oleh pemerintah
dan kesan seperti itu sukar dibantah.
f. Situasi Problematis yang teriadi di Indonesia.
Problema birokrasi yang melanda negara Indonesia dengan adanya pelaksanaan
peraturan dan juga yang semakin banyak, kurang mampu mendorong empowering
masyarakat karena birokrasi melihat masyarakat dari kaca mata bagaimana
masyarakat melaksanakan peraturan dan bukan melihat bagaimana inisiatif
masyarakat itu sendiri sehingga ada kesan pemaksaan yang dapat menimbulkan
benih-benih konflik yang mengakibatkan rakyat sebagai lawan dari birokrasi. Padahal
seharusnya birokrasi bekerja untuk rakyat, karena hidupnya dari gaji yang diperoleh
dari pajak rakyat dan bukan malah menjadi alat untuk menekan rakyat.
Pada waktu yang lalu, beberapa teknokrat dalam birokrasi mencoba mengadakan
upaya-upaya reformasi , seperti yang dilakukan oleh Emil Salim, J.
©2003 Digitized by USU digital library 7
Sumarlin dan Saleh Affif ketika beliau-beliau tersebut menjadi Menteri Penertiban
Aparatur Negara pada Kabinet Pembangunan I,II dan III. Menteri Emil Salim berhasil
mengadakan reformasi pada organisasi dan tala kerja departemen, Menteri Sumarlin
mengadakan reformasi pada sistem remunerasi pegawai negeri, dan Menteri Saleh
Affif mengadakan reformasi untuk menggairahkan kegiatan ekonorni melalui
serangkaian kebijakan deregulasi. Reformasi tersebut dapat dilaksanakan walaupun
pada kurun waktu tersebut birokrasi Indonesia secara umum masih konservatif dan
belum terbuka terhadap perubahan. Namun, reformasi tersebut belum mampu
menciptakan suatu snow ball reformasi administrasi yang terus sustainable dan
akhirnya mampu menciptakan sistem adrninistrasi yang handal dan dapat bargaining
mendukung pembangunan ekonomi politik (Sofian Effendi, dalam orasi ilmiah yang
disampaikan pada kuliah perdana program MAP UNT AG, 1994 :3).
Kurang berhasilnya reformasi administrasi di Indonesia selama kurun waktu PJPT-1 ini
nampaknya dipengaruhi paling tidak oleh 2 faktor : 1. kuatnya dominasi ekonomi
perencanaan pembangunan nasional, sehingga
reformasi administrasi tidak pernah menjadi fokus perhatian tetapi hanya sebagai
pendukung pembangunan ekonomi . 2. belum nampak adanya minat yang cukup
besar dikalangan para pimpinan
organisasi politik mengenai reformasi administrasi, aliansi yang kuat antara birokrasi
dan organisasi politik, terutama melalui pengaruh jalur-jalur A dan B di Golkar, telah
menimbulkan politisasi birokrasi yang berlebihan, yang menimbulkan dorongan yang
kuat pada birokrasi yang cendrung lebih mempertahankan status-Quo daripada
reformasi. Sepertinya mendengar kata reformasi, para birokrat agak alergi karena
daya inovasi kaum birokrat dipengaruhi oleh advokasi dari para pimpinan politik yang
harus diyakini melalui reformasi tersebut.
Reformasi administrasi perlu dilancarkan sebagai bagian dari pembangunan politik.
Bila aparatur administrasi mampu mendukung pembangunan nasional, maka dapat
tercipta sistem tersebut sehingga mampu mendukung demokratisasi politik,
liberalisasi dan industrialisasi ekonomi Indonesia.
g. Strategi Birokrasi yang Diterapkan Di Indonesia melalui Contoh kasus
Reformasi Perpajakan.
Posisi saling berhadapan antara birokrasi yang mewakili lembaga negara dengan civil
society yang berada pada posisi masyarakat, merupakan bagian yang tidak dapat
terpisahkan dari upaya mencari wilayah dinamika dari studi pembangunan politik
yang akan meningkatkan kehidupan politik ideal yang demokratis.
Melalui tulisan ini ada strategi positif yang dapat memperbaiki kelemahan birokrasi
menuju demokrasi di Indonesia dengan mengambil contoh yang pemah terjadi di
Indonesia yaitu Pelaksanaan Reformasi Perpajakan.
Pada dasarnya pemungutan pajak rnerupakan perwujudan atas kewajiban
kenegaraan dan partisipasi anggota masyarakat dalam memenuhi keperluan
pengelolaan negara dan pembangunan nasional, demi tercapainya keadilan sosial dan
kemakmuran yang merata.
Sebagai bahan kajian bahwa dalam perundang-undangan pajak lama terdapat
beberapa permasalahan dan sekaligus kelemahan yang perlu disoroti yaitu:
©2003 Digitized by USU digital library 8
Pertama. peraturan-peraturan pajak yang beraneka ragam, sehingga menimbulkan
kesan membingungkan dan bahkan terdapat pembebanan pajak berganda.Kedua
pelaksanaan kewajiban perpajakan sangat tergantung pada aparat perpajakan,
sehingga menimbulkan kecendrungan masyarakat wajib pajak kurang turut
bertanggung jawab dalam memikul beban negara yang pada hakikatnya untuk
kepentingannya sendiri dalarn bermasyarakat, bernegara dan berpemerintahan.
Ketiga. terdapat berbagai jenis pajak sehingga menimbulkan ketidakjelasan bagi
masyarakat dalam memenuhi kewajibannya.Keempat. terdapat bermacam-macam
tarif pajak baik untuk perorangan maupun untuk perseroan, Kelima. tingginya tarif-
tarif tersebut sehingga menimbulkan rangsangan untuk menghindari pajak mela1ui
berbagai cara. Keenam. tatacara pemungutan pajak yang berbelit-belit.
Dari keenam kelemahan yang terjadi pada sistem yang lama, maka dalam menyusun
sistem yang baru, diperhatikan saling keterkaitan antara tiga unsur pokok
pemungutan pajak. Ketiga unsur tersebut adalah kebijaksanaan, hukum perpajakan
dan administrasi perpajakan. Kebijaksanaan perpajakan merupakan pemilihan unsur-
unsur tertentu dari berbagai alternatif yang didasarkan atas sasaran yang ingin
dicapai. Pemilihan unsur-unsur tersebut berkenaan dengan subyek pajak, obyek
pajak, tarif pajak dan prosedur pajak..Hal yang kedua, adalah hukum pajak atau
hukum fiskal yaitu keseluruhan peraturan yang meliputi wewenang pemerintah untuk
mengambil kekayaan seseorang dan menyerahkannya kembali kepada masyarakat
melalui Kas Negara. Sedangkan administarsi perpajakan adalah cara- cara dan
prosedur pengenaan serta pemungutan pajak, dimana yang bertindak sebagai pelaku
administrasi pajak di Indonesia adalah Direktorat Jendral Pajak, Direktorat jendral
Bea dan Cukai serta Direktorat Jendral Moneter.
Pada sistem lama, sasaran perpajakan semata-mata untuk pemerintah penjajah
Belanda dengan berkedok pengisian kas negara tetapi nyata-nyata digunakan untuk
kepentingan kolonial..
Dari paparan di muka , tampaklah bahwa sesungguhnya pada masa lalupun telah ada
upaya-upaya untuk mengadakan pembaruan sistem perpajakan, hanya saja situasi
dan kondisinya belum memungkinkan, baik karena kemungkinan mendapat
tantangan dan antipati dari rakyat yang memang telah lama mengalami trauma dan
sindrome pajak pada masa penjajahan, maupun karena menyusun sistem yang barn
tidaklah mudah.
Dalam rangka memecahkan problematik yang terjadi pada waktu itu, maka para
pemikir ekonomi Indonesia pada tahun 1980-1981 sudah mengenal pokok- pokok dan
hasil dari misi-misi pembaruan perpajakan di beberapa negara. Pada awal tahun
1981, diarnbil Beberapa keputusan tingkat menteri dalam hal strategi dan teknik
untuk pembaharuan perpajakan Indonesia, yang dalam banyak hal, keputusan-
keputusan tersebut menggambarkan pemanfaatan hasil-hasil kegiatan yang sejenis di
negara-negara lain.Keputusan itu dikelompokkan dalam 8 langkah kebijakan sebagai
berikut : Langkah pertama, para menteri bidang Ekonomi Keuangan dan lndustri
(EKUIN) serta beberapa anggota lembaga perekonomian mempertimbangkan bahwa
rencana pembaruan perpajakan di Indonesia dengan menggunakan batasan tahunan
dan bukan bulanan. Langkah kedua, menuangkan kebijakan perpajakan ke dalam
suatu konsep dalam bentuk perundang-undangan yang ketat.. Langkah ketiga,
dibentuk Komite atau Panitia Pengarah dengan mengikutsertakan beberapa pejabat
dari jajaran Departemen Keuangan, termasuk beberapa
©2003 Digitized by USU digital library 9
diantaranya dari jajaran Direktorat Jenderal Pajak. Komisi tersebut berfungsi
mengarahkan, mengawasi dan berperanserta langsung dalam penelitian yang
dilakukan oleh tim tenaga ahli asing yang mungkin akan digunakan. Langkah
keempat, mengharuskan agar usaha persiapan ini dilakukan secara biasa saja tanpa
publikasi besar-besaran , namun tetap rnemperhatikan berbagai pendapat dari
kelompok-kelompok yang ada dalam masyarakat, baik kalangan pemerintahan,
swasta maupun para ilmuwan dari berbagai disiplin ilmu.
Langkah kelima, menyiapkan latihan dan pendidikan bagi para pejabat perpajakan,
baik itu pendidikan formal maupun pendidikan informal untuk memulai kaderisasi
pejabat pajak yang terlatih baik. Langkah keenam, kebijaksanaan untuk memulai
sistem perpajakanan yang baru secara keseluruhan tanpa sedikitpun mengambil
bagian-bagian dari sistem yang lama.
Langkah ketujuh, memperluas wawasan pembaharuan sistem perpajakan sehingga
mencaku bidang-bidang yang sebelumnya tidak merupakan obyek pajak. Langkah
kedelapan, menerapkan langsung hasil dari tiap-formulasi tanpa menunggu laporan
hasil keseluruhan paketnya.(Salamun A. T., 1990 :43,44,45).
Dalam rangka pengkajian masalah pembaruan sistem perpajakan di Indonesia, telah
diundang tenaga ahli dan tokoh-tokoh terkemuka yang sangat berpengalaman dan
bereputasi Intemasional dalam bidang perpajakan, baik dari luar maupun dalam
negeri untuk memberikan pengalamannya sekaligus menguji konsep pembaruan
sistem perpajakan di Indonesia.
Seperti telah dijelaskan, di samping tenaga ahli ekonomi dan hukum. Diperlukan juga
tenaga-tenaga ahli dalam bidang-bidang lain seperti ahli administrasi perpajakan
akuntan, dan ilmu teknologi komputer dalam pekerjaan studi pembaruan sistem
perpajakan di Indonesia. Keikutsertaan para ahli tersebut baik akademisi maupun
para profesional dan pejabat yang berwenang di dalam negeri dimaksudkan untuk
memperoleh proses dan pemecahan masalah dalam pengerjaannya, disamping tim
pengarah ada lagi tim yang dibentuk oleh Departemen Keuangan, Direktorat Jendral
Pajak dan Tim dari Luar Departemen Keuangan.
Setelah sampai rancangan tersebut ke DPR, selama proses pembahasan di DPR
banyak pihak dari berbagai disiplin ilmu. kalangan masyarakat dan berbagai sudut
pandang yang memberikan tanggapan, saran dan juga kritik tajam. Dari banyak
tanggapan spontan yang muncul pada hari-hari paertama pengajuan RUU ke DPR,
secara jujur harus diakui bahwa sebagian besar menekankan pentingnya mental
aparatur pajak mendapat perhatian pemerintah. Dari para anggota DPR yang pada
umumnya dikenal sebagai tokoh-tokoh masyarakat yang vokal, sehingga diharapkan
timbul kesadaran, pengertian dan pemahaman yang tulus, mengenai mana yang
benar dan mana yang salah. mana yang haq dan mana yang bathil.
Meskipun seringkali didengungkan masalah kebersamaan dan demokrasi di dalam
organisasi Direktorat Jendral Pajak tapi kenyataannya kekuasaan lebih ditentukan
oleh landasan rasional sehingga masalah organisasi harus didahulukan daripada
masalah pribadi.
Ambisi utama daripada sistem birokrasi adalah tercapainya efisiensi kerja yang
seoptimal mungkin tapi bukan malah mempolitisikan birokrasi dengan pilihan- pilihan
kebijakan yang memuaskan klien-klien tertentu, korupsi, melibatkan
©2003 Digitized by USU digital library 10
kepentingan pribadi di atas kesejahteraan umum, juga membuat kebijakan dan
mengimplementasikannya berat sebelah (LV .Carino,Bautista dkk, 1993 : 119 -140).
Berdasarkan pengalaman sejarah, telah terbukti bahwa usaha birokrasi untuk
merekonstruksi demokrasi tidak bisa lepas dari politik publik, ini tidak akan jadi
persoalan bila birokrasi tetap dipandang sebagai instrumen negara, sehingga
kekuasaan kepemimpinan politik mampu membuat birokrasi bertanggung jawab
terutama alas dasar kepentingan publik. Responsive terhadap tuntutan rakyat,
dimana kekuatan-kekuatan sosial dan negara mengarahkan birokrasi kesana,
sehingga mampu mendorong birokrasi untuk meningkatkan responsivitas mereka
terhadap keinginan rakyat .
ORMASI ADMINISTRASI DAN PARADOKS
DEMOKRASI

Ini menjelaskan tentang perselingkuhan antara birokrasi


dengan elit politik yang semakin inten. Melalui institusi Presiden dan
Wakil Presiden dengan Wakil Rakyat, DPR. Kebijakan yang dirumuskan
dianggap sah dan demokratis, hanya karena adanya keberadaan symbol
institusi dari demokrasi, yakni DPR. Di sisi berhadapan birokrat begitu
kuat menjaga motif nilai manajer departemen. Pada konteks organisasi
public, eksekutif melalui birokrasinya terbawa tuntutan reformasi
administrasi melalui paradigma pasar, sepert terwujudnya good
governance. Ini dilakukan untuk menghindari kegagalan implementasi
dan kritik keras terhadap birokrasi. Dilema yang muncul adalah
birokrasi harus professional dan responsive tapi, pada sisi lain
otonominya sebenarnya sedang ditekan oleh politisi melalui paradigma
baru. Dugaan bahwa dinamika komplek terpotret melalui bargaining
dalam sector public yang memungkunkan terjadi manipulasi dalam
pengelolaan sector public. Reformasi politik, telah dimanfaatkan oleh
kepentingan politik ditengah arus demokratisasi, karena reformasi
administrasi sering direduksi pada tatanan tehnis. Birokrasi sebenarnya
tidak akan bisa netral.

Birokrasi dan jebakan politik

Orde baru melalui bureaucratic polity, tekanan kekuasaan dan


dinamika dibangun sistematis di dalam menjalankan. Disini demokrasi
dikesampingkan. Dua hal penting model bureaucratic polity eksis:
1. bureaucratic polity tidad jauh beda dari bentuk pemerintahan olek
derajat untuk decision making nasional daerah kekuatan sosial dan
politik keluar pejabat tidak tinggi bagi modal kota.
2. daerah utama untuk kompetisi politik tidak di negara yang besar dan
kekuatan tidak dicapai terus memperbaiki bagi banyak gerakan.
Daripada kekuatan penuh dicapai meluli kompetisi interpersonal di
lingkaran elite di fisik yang tertutup dekat presiden.
tiga komponen dinamika politik terkait dengan birokrasi menggejala:

1. komponen political competition. Adanya dikotomi administrasi dan


politik dijelaskan dengan konteks yang spesifik. Decision making benar-
benar diperankan oleh arena inti proses kompetisi politik yang
dibangun diluar birokrasi sesungguhnya. Proses politik pada tingkat ini
bisa sangat kompleks, namun bersifat informal di sekitar presiden.
2. komponen actor. Struktur dikotomi dilihat dari sisi struktur formal,
para pejabat yang memiliki kewenangan formal. Actor inilah komponen
yang pertama.
Birokrasi sebagai komponen dari suatu pemerintah dari pusat sampai
dengan daerah politik. Dinamika interaksi politik dengan birokrasi pada
pemerintahan hasil pemilihan secara lansung. Namun, demokratisasi
yang diusung dan diyakini akan membawa perubahan yang besar di
Indonesia justru telah memanipulasi sektor publik melalui instrumen
reformai administrasi yang sedang populer. Birokrasi yang selalu
dituntut responsif sesungguhnya sedang mengalami tekanan elit politik.

Tulisan ini tidak menjelaskan jarak antara birokrasi dengan elit politik
dalam dinamika administrasi publik di Indonesia. Justru tulisan ini
akan menjelaskan adanya kedekatan elit politik dengan birokrasi.
Pertautan keduanya terjalin dengan bungkus rapi dibalik mekanisme
demokrasi.

Setiap kebijakan yang dirumuskan dianggap sah dan demokratis oleh


DPR yang dianggap simbol institusi dan demokrasi. Pada sisi yang lain,
Birokrasi melalui aparat negara begitu kuat menjaga nilai manajer yang
diinternalisasikan dari nilai politiknya pada kebijakan tersebut,tanpa
memperdulikan rakyat yang akan terkena dampak langsung. Sehingga
yang tersisa di mata rakyat hanyalah kekuasaan dari birokrasi.
Pada konteks organisasi publik, para ekskutif melalui birokrasinya
terbawa tuntutan reformasi administrasi seperti terwujudnya good
governance. Hal ini dilakukan agar terhindar dari kegagalan
implementasi dan nilai negatif birokrasi, termasuk tekanan global (IMF,
World bank).

Dilema yang terjadi adalah, bahwa pada sisi birokrasi dituntut untuk
selalu profesional dan responsif. Namun disisi lain, birokrasi ditekan
oleh politisi melalui nilai-nilai dari paradigma baru tersebut.Oleh
karena itu, setiap kebijakan yang dibuat selalu bias dengan kepentingan
politik.

Dinamika komplek tersebut terlihat melalui politik bargaining dalam


sektor publik yang memungkinkan terjadinya manipulasi dalam
pengelolaan publim sektor. Reformasi birokrasi dimanfaatkan oleh
kepentingan politik ditengah arus demokratisasi.

Sistem pemilu secara langsung yang diterapkan, memberikan


implikasi pada ricuhnya kebijakan publik. Hal tersebut dapat terjadi di
pusat maupun daerah (pemilihan kepala daerah secara langsung),
contoh konkritnya dapat dilihat dari Pilkada secara langsung,
perubahan dari partai attachment menjadi personal attachment dan
terjadinya transformasi kepentingan elit menjadi kepentingan publik
sehingga dapat menyebabkan pemerintah lamban dan tidak responsif,
sehingga kemungkinan adanya bargaining dan cheating ada meski
dalam era demokratisasi dan kampanye good-governance.

Birokrasi Pemerintahan (Bureaucratic Government)

Interaksi politik dan birokrasi terjadi begitu inten dalam dinamika


pemerintahan kita. Interaksi yang terjadi bukan saja politisi
memanfaatkan eksekutif, tapi eksekutif dan birokrasinya menghendaki
hal tersebut sebagai bagian dari balas jasa kampanye pemilihan
presiden langsung dan untuk mengamankan kekuasaannya dan hal
tersebut dianggap hal yang normal, padahal didalamya terdapat
manipulasi kepentingan rakyat yang berarti kepentingan demokrasi.
Menurut Carino, sesungguhnya pemerintahan yang demikian sedang
berusaha tampil secara demokratis, tetapi ada cara-cara yang tidak
demokratis yang berakibat pada implikasi pemerintahan yang otoriter.
Menurut kerangka yang dikembangkan Carino, pola interaksi tersebut
secara teoritis akan menempatkan siapa dimana/dominasi birokrasi
ataukah birokrasi sederajat dengan politisi, ada 2 bentuk model, yaitu:1.
Executive ascendancy seperti bentuk dikotomi politik administrasi yang
murni (Carino,1992:4), 2. Bureaucratic sublation of, or co-quality with
the executive. Posisi ini sama dengan yang pertama, ada kemungkinan
penyalahgunaan posisi,yang mengakibatkan birokrasi yang awalnya
sama akan ada posisi yang lebih tinggi sehingga perlu dikontrol,
sedangkan Peters dan Pierrs (2001:5) memahami pola interaksi politisi
dengan birokrasi lebih mendalam (intensitas terinternalisasinya nilai-
nilai demokrasi) dan terkesan overlapping (birokrasi dan politisi). Pada
sisi yang ekstrim, mereka memetakan interaksi kedunya dalam bentuk
tumpang tindih karena internalisasi nilai-nilai demokrasi, sehingga
negara yang sedang melakukan konsolidasi demokrasi memungkinkan
elit eksekutif memiliki akses dalam memainkan informasi dalam
birokrasi.

Model birokrasi yang berada pada posisi intermediate ada 2 kategori,


yaitu :

a. Kategori Village Life

Menjelaskan bahwa baik aparat atau elit politik memiliki latar belakang
sosial ekonomi, kepentingan, dan pengalaman yang sama. Value
normatif pada kategori ini adalah value yang memiliki orientasi pada
efektivitas dan produktivitas lembaga.

b. Kategori Functional Village

Dari perumusan kebijakan / policy sampai dengan implementasinya /


pelaksanaannya semuanya tertata rapi.
Model birokrasi yang dibahas disini adalah model Bureaucratic
Government. Dalam model ini terjadi kompleksitas politik yang cukup
tinggi pada tingkatan organisasi. Model ini juga sangat cocok dengan
model Birokrasi Indonesia saat ini,dimana birokrasi negara kita sedang
mengalami himpitan permainan elit politik. Para elit politik tersebut
mendapatkan ruang yang lebih luas dalam wilayah birokrasi. Hampir
semua pejabat di Indonesia dipilih berdasarkan politik. Sehingga
kesannya, para pejabat tersebut lebih mementingkan kepentingan
golongan atau partainya, daripada kepentingan rakyat. Karena model
birokrasi yang seperti itulah, mengapa banyak kebijakan publik di
Indonesia sekarang ini memiliki kecenderungan yang mungkin saja
berpotensi menyesengsarakan rakyat.

Reformasi administrasi terjadi melalui tahapan yang kompleks


dan melibabtkan banyak kepentingan, regulasi, dan aktivitas
operasional antar beberapa institusi. Reformasi akan merubah tatanan
yang telah ada sebelumnya dengan meredefinisi dan resistensi untuk
menuju keberhasialn.

Ide ini di kemas dalam konsep yang telah menjadi Political


Catchword di seluruh dunia, yaitu Governance. Secara umum konsep
ini telah di gunakan karena terkait dengan fokus kapabilitas dari
pemeerintah dengan interaksinya dan interaksinya antara pemerintah
dengan masyarakat.

Sebagai contohnya adalah pemanfaatan konsep oleh IMF dan


World Bank dalam rangka good governance. Dalam konteks urban
politics, pemanfaatan konsep melalui Local Governance. Sedangkan
dalam konteks policy analisis, di kembangkan melalui konsep tentang
governance framework. Multi lever mengembangkannya dalam konteks
interaksi antara lembaga lokal, regional, nasional, dan transnasional.
Global Governance juga berkembang melalui level hubungan
internasilonal. Dan yang terkhir adalah dalam konteks interaksi publik
dan private, governance telah di gunakan untuk penelitian-penelitian
tentang peran pemerintah dalam melakukan koordinasi di sektor
ekonomi.

Intervensi Paradigma ini lebih di fokuskan pada konteks


reformasi administrasi saja, yakni pada adopsi instrumen administratif
tertentu yang kelihatan tehnis, namun dalam intervensi global dan
demokrasi telah membuka ruang yang lebih besar bagi politisi untuk
bermainm dalam wilayah birokrasi ini. Intervensi paradigma ini juga
akan mempengaruhi interaksi kekuasaan antara birokrasi yang di
lakukan oleh pelatyan publik dengan politisi pada berbagai tahapan.

Perkembangan ini terkait dengan krisis yang dialami oleh


nega5a, yang bisa juga di katakan merupakan gagalnya suatu
administrasi negara yang di terapkan dalam konteks global yang terjadi
di negara transisi seperti Indonesia ini.

Dalam penerapan reformasi administrasi ini seringkali di


manfaatkan oleh politisi untuk mengambil keuntungan. Sebagai contoh
adalah NPM dan kasus BBM. Dalam kasus BBm, analisis lebih di
fokuskan pada interaksi politik dan birokrasi. Kasus BBM ini
merupakan kebijakn yang sarat dengan tuntutan responsibilitas dari
organisasipublik yang mendelivernya dan nilai-nilai kolektif yang lebih
luas yang menyangkut masyarakat miskin. Dari awal kebijakan ini
memang di kendalikan secara politis. Peluang ini telah terbaca oleh
politisi karena memanng organisasi publik sedang mengalami kesulitan
untuk menggunakan instrumen baru ini. Ini merupakan permasalahan
transfer nilai dari organissai privat ke organisasi publik.

Kenyataan yang seperti ini bisa mengakibatkan kegagalan.


Seharusnya reformasi menghendaki pengelolaan yang sistematis.
Komlpeksitas politik pada transisi demokrasi yang belum matang telah
memutuskan link yang seharusnya terjadi atau di lakukan. Selebihnya,
ada proses perubahan internal organisasi dan juga lingkup eksternal
pada suatu negara yang memungkinkan terjadinya reformasi tersebut,
tetapi belum sepenuhnya berubah. Dengan kenyataan lemahnya proses
reformasi, maka politisi lebih leluasa memanfaatkan instrumen
responsibilitas untuk kepentingan kekuasaan jangka pendek.

Kenaikan harga BBM yang terus di paksakan dengan berbagai


penolakan melalui demonstrasi-demontrasi menunjukan rendahnya
akuntabilitas organisasi publik. Sementara akuntabilitas dalam
reformasi administrasi merupakan instrumen yang penting. Dan lebih
di tekankan lagi bahwa proses internalisasi instrument yang lemah akan
memberikan peluang yang besar bagi politisi untuk memberikan suatu
perfomance dari kebijakan tertentu.

Birokrasi kita sekarang ini masih sangat mengecewakan di


dalam pelaksanaannya, bureaucratic goverment di Indonesia
merupakan birokrasi publik yang mengalami kebingungan arah dan ini
terjadi di tengah perubahan ke arah demokrasi. Dalam reformasi ini di
manfaatkan oleh politisi melalui cara yang tidak demokratis, karena
birokrasi tidak siap untuk berubah.

Rezim kita sekarang ini telah gagal menentukan kualitas yang


tinggi dalam mengelola masalah publik. Padahal rezim seharusnya
menentukan peraturan dasar dan kualitas dari interaksi antara
bermacam-macam lembaga melalui kebenaran proses kebijakan dan
gabungan nilai untuk mengelola masalah publik.

Melihat kenyataan tersebut,maka ada dua hal yang penting


yaitu : reformasi administrasi yang menggunakan beberapa instrumen
yang memiliki nilai kontradiktif satu sama lain dalam dirinya sendiri
karena nilai dari organisasi publik dan privat yang digeneralisasikan
ternyata telah membuka peluang permainan politik. Yang kedua yaitu
adanya kenyataan bahwa demokrasi yang diinternalisasikan masih
dalam tahapan demokrasi formal,prosedural yang memberikan ruang
pada elit politik untuk memberi instrument pada organisasi publik.

Di indonesia antara politisi dan public servant tidak terjadi


kerjasama yang baik dalam pemecahan masalah publik yang seharusnya
secara demokratis dalam perumusan kebijakan dalam perumusan
kebijakan dan responsivitas dalam implementasinya namun disini
terjadi penipuan yang dilakukan publik servant dalam pelayanan
publik. Hal ini ditandai dengan banyaknya lobi yang dilakukan
eksekutif untuk kepentingan kebijakan.

Contohnya,kasus kenaikan harga BBM yang didukung oleh


partai PKS dan PPP padahal dulunya menolak kenaikan BBM. Kedua
partai tersebut setuju dengan kenaikan BBM karena untuk
mempertahankan kekuasaan mereka yaitu demi pertimbangan
kadernya yang mendapatkan posisi sebagai menteri.

Dengan demikian birokrasi kita sekarang ini di bawah kontrol


politisi, politisi memainkan perannya untuk tidak melakukan perannya
untuk tidak melakukan reaksi sama sekali terhadap resistensi yang di
berikan oleh publik. Hal ini dapat merugikan reformasi administrasi
kita, demokrasidan kesejahteraan rakyat miskin. Semua ini terungkap
ketika negara kita melakukan pemilu secara langsung.

Seharusnya reformasi administrasi di pahami sebagai sistem


administrasi yang lebih efektif untuk perubahan sosial, di mana
instrument membawa persamaan politik, keadilan sosial dan
pertumbuhan ekonomi. Jadi reformasi itu bukan sekedar masalah
tehnis administratif. Karena apabila reformasi hanya pada tahapan
tehnis, maka instrumen yang digunakan akan sangat mungkin
bernuansa dan di terjemahkan oleh kepentingan elit yakni politik.

Logika tersebut di kembangkan dengan beberapa alasan,


pertama ide reformasi selalu datang dari kepentingan eksternal dan
bahkan global, kedua kepentingan global tersebut tidak selamanya
berdimensi tunggal. Ketiga, adalah reformasi pastilah produk
keputusan politik dan bukannya administratif belaka. Keempat,
reformasi administrasi yang terbungkus dengan paradigma besar
seperti demokratisasi dan globalisasi, lanngsung maupun tidak
langsung mewarnai nilai kebijakan melalui lembaga presiden atau wakil
presiden yang secara langsung berhadapan dengan rakyat. Jadi
Reformasi administyrasi akan mempertemukan birokrasi, politisi, dan
rakyat, serta pasar menjadi bagian stakeholder dalam reformasi
administrasi.
Komentar:

Indonesia adalah negara yang menganut model pemerintahan


Demokrasi, model pemerintahan demokrasi adalah model
pemerintahan yang bebas mengeluarkan pendapat dan pemerintah
mengutamakan suara rakyatnya di banding kepentingan pimpinannya.
Tetapi pada kenyataanya di Indonesia tidak berjalan seperti teorinya.
Justru pelayanan publik berjalan ketika demokrasi di singkirkan. Para
pejabat sekarang lebih mementingkan kepentingan pribadi dan
golongannya daripada kepentingan publik atau rakyat. Padahal dulu
pada jaman pemerintahan Soeharto pelayanan publik lebih baik. Hal itu
di karenakan adanya pengawasan dan kontrol langsung oleh
pemerintah pusat, dulu jika perintah itu tidak di laksanakan maka akan
di tindak langsung.