Janji-janji & Komitmen

SBY -JK
RUDY S. PONTOH.
Lahir di Poso, Sulawesi
Tengah, 18 Mei
1964. Kuliah di FK
- Unhas (1983-1992)
lalu terjun sebagai
wiraswasta. Pernah
menjabat sebagai
salah seorang direksi
sebuah perusahaan
properti di Yogyakarta, lalu sejak 1994 pindah ke
Jakarta dan bekerja sebagai direktur di sebuah
perusahaan swasta terkenal.
Antara tahun 1983 hingga 1986 ia aktif menulis
masalah hukum dan internasional, dua bidang
kepenulisan yang paling diminatinya. Juga
masalah psikologi dan kesehatan (sesuai latar
belakang pendidikanya) di berbagai media
cetak Ibukota. Di bidang hukum, ia pernah
berpolemik keras dan berkepanjangan dengan
Achmad Ali (kini salah seorang tokoh hukum
di Indonesia). Pada masa itu, ia juga tergolong
penulis aktif angkatan kedua setelah angkatan
Hamid Awaluddin (mantan Menteri Hukum dan
HAM) di Identitas, koran kampus Universitas
Hasanuddin Makassar. Keaktifannya menulis di
berbagai media membuat ia kemudian diangkat
sebuah Ketua FPM (Forum Penulis Makassar),
salah satu organisasi kepenulisan paling elite
yang pernah ada di Makassar.
Kini, di samping kesibukan bisnis, sejak 2005
ia juga aktif sebagai Ketua Umum Forum Poso
Bersatu, sebuah organisasi kaum pemberani
yang selama ini bertindak sebagai kontra
provokator guna menghentikan dan meredam
berulangnya konfik Poso. Alamat Email:
rudypontoh@gmail.com
J
a
n
j
i
-
j
a
n
j
i

&

K
o
m
i
t
m
e
n
S
B
Y
-
J
K
T
e
r
n
y
a
t
a

H
a
n
y
a

A
n
g
i
n
?
R
u
d
y

S
.
P
o
n
t
o
h
(edisi 2)
B
E
S
T
S
E
L
L
E
R
“Kritik Rudy S. Pontoh dalam buku ini memperjelas kita bahwa kritik bukan
saja sebuah keinginan dari warga negara untuk bebas bicara, tapi juga sebuah
kebutuhan dari pemerintah negara agar berbuat lebih baik.” (Usman Hamid,
Koordinator Kontras)
“Yang saya soroti dari buku ini adalah janji SBY untuk membangun demokrasi
melalui kebijakan antidiskriminasi. Akan tetapi, di masa SBY, kebijakan yang
diskriminatif dan antipluralisme sangat menonjol…” (Prof. Dr. Siti Musdah
Mulia, M.A, Aktivis)
“Buku ini mudah-mudahan jadi pelajaran moral nomor satu bagi siapa saja yang
mengaku pemimpin atau siapa saja yang mau terjun ke dunia politik. Negeri ini
tidak butuh janji, tapi kerja nyata yang dikawal oleh visi dan moralitas sejati.”
(Ahmad Ushtuchri, SE, Pimpinan Pondok Pesantren Annur Kota Bekasi)
“Walau saya pernah dekat dan bekerja sama – namun saya tidak pernah bisa
menebak, membaca, dan memprediksi apa yang ada dalam benak dan apa
yang akan dilakukan seorang SBY…” (Sys NS, Ketua Umum DPP Partai NKRI)
“Membaca buku ini saya merasakan pancaran ketulusan dari Bapak SBY. Janji-
janji beliau memberikan optimisme yang besar.” (Prof. Dr. Maizar Rahman,
Gubernur OPEC)
“Seseorang yang tidak mampu menepati janji tidak layak jadi pemimpin.
Secara pribadi saya masih ingin percaya dan berharap pada SBY. Tapi…”(Ratna
Sarumpaet, Aktivis)
“Kita semua sepakat janji adalah hutang. Sampai kapan pun dan oleh siapapun
hutang akan tertagih. Kalau sudah terlontar sebaiknya ditepati supaya selamat
nanti di “sana”.” (Ratih Sanggarwati, Artis dan pengusaha)
“Agar diungkapkan juga mengenai apa yang tidak/belum pernah dijanjikan
SBY-JKkepada rakyat. Kadangpemimpin seringmelupakan apa yangdijanjikan
dan membuat janji-janji baru untuk mempertahankan kepemimpinannya.” (M.
Farhat Abbas, SH, Advokat)
“Semoga buku ini tersedia banyak di toko
buku manapun dan dijual dengan harga
terjangkau sehingga semua orang bisa
memilikinya hingga ke masyarakat kalangan
menengah ke bawah.”(Yudan S, Warga biasa,
tinggal di Malang)
“Janji-janji dan komitmen mereka seperti
yang saya baca dalam buku ini rasanya telah
ditebus secara perlahan…” (Prof. Dr. Amran
Razak, SE, M.Sc, Guru Besar FKMUNHAS)
“Lebih baik saya tidak mengomentari buku
ini karena apapun komentar saya justru akan
dipermasalahkanorang. Biarlahkawan-kawan
pengamat yang berkomentar.“ (Andi Alfan
Malarangeng, Juru Bicara Presiden RI)
“Buku ini sangat dibutuhkan oleh sebagian
besar rakyat Indonesia, yang telah dengan
ikhlas menjatuhkan pilihannya kepada
pasangan SBY-JK….” (Dr. Taruna Ikrar,
M.Pharm., Ph.D, Founder CFIS - Center For
Interregional Study)
“Saya yakin buku ini menarik dan berguna
untuk banyak orang. Namun saya tidak
merasa mampu untuk menulis komentar.”
(Wimar Witoelar, Tokoh Terkenal).
“Buku ini cukupmewakili tuntutan masyarakat
Indonesia yang sangat mengharapkan
realisasi terhadap mimpi-mimpi yang
diberikan para pemimpin bangsa ini ketika
mereka menginginkan dukungan untuk
menduduki tahta kekuasaan di negara ini…”
(Vera T. Tobing, SH, Advokat)
“Buku ini telah merekam semua janji SBY-JK
pada masa kampanye dulu dengan sangat
lengkap dan jelas. Dan saya yakin SBY-JK akan
terus berusaha menepati janji-janjinya. Hanya
soal waktu. Kita lihat saja nanti.“ (Muhammad
Ikbal, SH, General Manager PT BBS)
(
E
d
i
s
i

2
)
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?

Komentar
dan Testimoni
“Yang saya soroti dari buku ini adalah janji SBY untuk
membangun demokrasi melalui kebijakan antidiskriminasi. Akan
tetapi,dimasaSBY,kebijakanyangdiskriminatifdanantipluralisme
sangatmenonjol,khususnyadalambidangagama.Terutamaterhadap
penganutagamadankepercayaanminoritas.Indikator:Pengabaian
hak-hak sipil para penghayat kepercayaan, penyerangan terhadap
Ahmadiyah, penutupan gereja-gereja Kristen, dan penangkapan
parapimpinanaliran-aliranbaru:LiaEden,Al-Qiyadah,danlain-
lain. Akibatnya, timbul konfik horisontal: kelompok mayoritas
menyerangminoritasdengandalihfatwaMUI.
Sepanjang sejarah RI, baru SBY presiden yang tunduk
pada fatwa MUI. Padahal, fatwa MUI tidak punya tempat dalam
strukturhukumdiIndonesia.Mestinyadiahanyaberpedomanpada
PancasiladanUUD‘45yangmenjaminkemerdekaansetiapwarga
untukmenganutagamadankepercayaanmasing-masing.“
Prof. Dr. Siti Musdah Mulia, M.A
Jakarta
“Walausayapernahdekatdanbekerjasama–namunsaya
tidakpernahbisamenebak,membaca,danmemprediksiapayangada
dalambenakdanapayangakandilakukanseorangSBY.Yangdapat
saya pastikan, menurut pendapat pribadi saya, bahwa SBY adalah

Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
seorangpolitisiulung,tangguh,dansabar.Beliaupandaimemainkan
manajemenwaktu,lihaimengaturemosikawanmaupunlawan,dan
amat cerdas menggiring atmosfr di setiap tempat dan komunitas.
Beliau juga sangat tangkas menjadikan dirinya sebagai magnet
dalam seketika. Dalam keadaan serba normal, beliau memang pas
danpantasmenjadipresidenbaginegeriini.“
Sys NS
KetuaUmumDPPPartaiNKRI(NegaraKesatuanRepublik
Indonesia)
Jakarta
“KritikRudyS.Pontohdalambukuinimemperjelaskitabahwa
kritikbukansajasebuahkeinginandariwarganegarauntukbebasbicara,
tapijugasebuahkebutuhandaripemerintahnegaraagarberbuatlebih
baik.”
Usman Hamid
KoordinatorKontras
Menteng,JakartaPusat
“Adanya hasrat dari kalangan SBY-JK untuk berpaket
kembali atau pun secara terpisah menunjukkan keyakinan bahwa
janji-janjidankomitmenmerekasepertiyangsayabacadalambuku
ini rasanya telah ditebus secara perlahan. Proses demokratisasi,
desentralisasi, dan pemberdayaan ekonomi masyarakat relatif baik
dan terbebas dari IMF. Pemberantasan korupsi belum memuaskan
masihbertumpupadapenguataninstitusional.Yangmenonjoladalah
pelaksanaandemokrasidiIndonesiajauhlebihbaikdariSingapura
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?

dan Malaysia. Kabinet ekonominya belum“menggigit” menangani
makroekonomi.”
Prof. Dr. Amran Razak, SE, M.Sc
GuruBesarFKMUniversitasHasanuddin
Makassar
“Seseorangyangtidakmampumenepatijanjitidaklayakjadi
pemimpin. Secara pribadi, saya masih ingin percaya dan berharap
padaSBY.Tapihampirsemuasenimandariberbagaipropinsiyang
hadir di Kongres Dewan Kesenian se-Indonesia di Papua Agustus
2005 lalu menganggap SBY pembohong / tidak bisa memegang
kata-kata.
Pada penutupan kongres dimaksud SBY berjanji
membangunkesenianIndonesiadengansungguh–sungguh,salah
satunya dengan mensahkan DKI (Dewan Kesenian Indonesia)
sebagaikeputusankongres.DuasetengahtahunTimFormaturDKI
melakukanberbagaicaramenagihjanji,NIHIL.Kalaujanjiresmidan
ditayangkanTVRI ke seluruh negeri saja tidak ditepati…sekarang
silahkanrakyatmenilai.Sebabdalamhaltidakkunjungdisahkannya
DKI,SBYhanyamemberikitaduapilihankemungkinan:SBYtidak
mampu atau SBY tidak bisa dipegang kata-katanya. Dua-duanya
tidakdibutuhkanrakyatIndonesia.”
Ratna Sarumpaet
AktivisdanSeniman
Jakarta
v
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
“Agar diungkapkan juga mengenai apa yang tidak/belum
pernahdijanjikanSBY-JKkepadarakyat.Kadangpemimpinsering
melupakanapayangdijanjikandanmembuatjanji-janjibaruuntuk
mempertahankankepemimpinannya.“
M. Farhat Abbas, SH
Basmar,Mampang
JakartaSelatan

“Lebih baik saya tidak mengomentari buku ini karena apapun
komentarsayajustruakandipermasalahkanorang.Biarlahkawan-
kawanpengamatyangberkomentar.”
Andi Alfan Malarangeng
JuruBicaraPresidenRI
Jakarta
“Bukuinimudah-mudahanjadipelajaranmoralnomorsatu
bagi siapa saja yang mengaku pemimpin atau siapa saja yang mau
terjunkeduniapolitik.Negeriinitidakbutuhjanji,tapikerjanyata
yangdikawalolehvisidanmoralitassejati.”
Ahmad Ushtuchri, SE
PimpinanPondokPesantrenAnnur
KotaBekasi
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
v
“Membacabukuinisayamerasakanpancaranketulusandari
BapakSBY.Janji-janjibeliaumemberikanoptimismeyangbesar.“
Prof. Dr. Maizar Rahman
GubernurOPEC
PenelitiUtamaTeknologiMinyak&Gas
“Kita semua sepakat janji adalah hutang. Sampai kapan
pundanolehsiapapunhutangakantertagih.Kalausudahterlontar
sebaiknyaditepatisupayaselamatnantidi“sana”.“
Ratih Sanggarwati
Jakarta
“Buku ini sangat dibutuhkan oleh sebagian besar rakyat
Indonesia,yangtelahdenganikhlasmenjatuhkanpilihannyakepada
pasanganSBY-JK.Jikakedepan,untukperiode2009-2014pasangan
SBY-JK masih ingin terpilih lagi, masih ada sisa waktu untuk
membuktikan implementasi janji dan komitmennya terhadapat
rakyat. Di era globalisasi, bangsa Indonesia sangat membutuhkan
pemimpin yang berjuang membawa perubahan positif bagi rakyat,
bangsa dan negara, dalam menggapai cita-cita Indonesia sebagai
negarayangmajudansejajar,sertadiseganiolehbangsa-bangsadi
duniadalampercaturaninternasional.“
Dr. Taruna Ikrar, M.Pharm., Ph.D
FounderCFIS(CenterForInterregionalStudy)
Jepang
v
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
“Bukuinitelahmemberikankontribusiberhargakarena
sudah melayani kepentingan masyarakat untuk memantau
mereka yang berkuasa (SBY-JK) agar bertanggung jawab pada
setiapperilaku,keputusan,dankebijakannya.“
Josephine Mathilda
AktivisPersaudaraanPoso
Palu,Sulteng
“Buku ini telah merekam semua janji SBY-JK pada masa
kampanye dulu dengan sangat lengkap dan jelas. Dan saya yakin
SBY-JK akan terus berusaha menepati janji-janjinya. Hanya soal
waktu.Kitalihatsajananti.”
Muhammad Ikbal, SH
GeneralManagerPTBBS
Jakarta&Kendari

“Saya yakin buku ini menarik dan berguna untuk banyak
orang.Namunsayatidakmerasamampuuntukmenuliskomentar.”
Wimar Witoelar
PTInterMatrixIndonesia
JakartaSelatan
“Bukuiniadalahwujudupayacerdasgunamencerdaskananak
bangsa.Keberadaannyajelasmemberikanefekpositifpembelajaran.
Jika suatu saat nanti politisi ini hendak kembali naik ke podium
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
v
kampanyenya, maka setidaknya ia akan berpikir ulang untuk tidak
mengumbarjanji-janjipolitiksecarasembarangan.Sebab,sekarang
ia tahu ucapannya tersebut tidak lagi terbang bersama angin tapi
dicetakbukukanmenantipertanggungjawabandalambentuknyata.
Buku ini akan menjadi sumber rujukan bagi kita untuk
mengkritisi sudah sejauh mana janji-janji tersebut terwujudkan.
Semoga SBY-JK atau mungkin para politisi lain di pentas daerah
ataunasionalmenjadikaninisebagaibarometer.”
Mohammad Aqil Ali, SH
HWS&Partners
WismaKemang,JakartaSelatan
“Penyebaran ide dan gagasan dalam buku ini sangat perlu
diketahui khalayak umum, terutama kalangan pendidikan dan
aktivis serta kalangan HAM, bahkan untuk kajian kajian hukum
lebihdalam.”
Dedeng Z
StafPengajarFak.HukumUNSRI
OganIlir,Sumsel
“Para politisi itu mengekploitasi kaum miskin, menjajikan
perubahan dan kesejahteraan, padahal rakyat sudah mencatatnya.
Berulangkaliingkarjanji,adasaatnyamelawandanmenagihbakul
berisijanji-janjiitu.”
Mulyani Hasan
PenulisdanWartawan
Bandung
“Buku ini cukup mewakili tuntutan masyarakat Indonesia
yang sangat mengharapkan realisasi terhadap mimpi-mimpi yang
diberikan para pemimpin bangsa ini ketika mereka menginginkan
dukunganuntukmendudukitahtakekuasaandinegaraini.
Janji-janji yang diumbar pada saat Pemilu 2004 lalu
seharusnya sudah dapat kita rasakan sekarang. Yang terjadi justru
sebaliknya,dimanakeadaansemakinmenujukejurangkesengsaraan
baikdarisudutmoralitas,integritassertakehidupanperekonomian.
Dengan kehadiran buku ini diharapkan SBY-JK menyadari bahwa
yang dibutuhkan masyarakat Indonesia saat ini adalah realisasi
terhadapsetiapkomitmenyangmerekabuat.”
Vera T. Tobing, SH
KantorPengacaraVeraTobing&Patners
Jakarta
“Semogabukuinitersediabanyakditokobukumanapundandijual
dengan harga terjangkau sehingga semua orang bisa memilikinya
hinggakemasyarakatkalanganmenengahkebawah.“
Yudan S
PerumGrahaSengkaling
Dau–Malang,JawaTimur
“Setelah membaca buku ini saya berpendapat: yang
terpenting adalah janji-janji dan komitmen itu dapat terlaksana
secara komprehensif, bertahap, kontinyu, terpadu & terukur demi
mencapaiIndeksPembangunanManusia(IPM)yangideal.”
Zikroen Habibie
Jakarta
v
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Janji-janji & Komitmen
SBY -JK
Ternyata
Hanya Angin?
(edisi 2)

Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Sanksi Pelanggaran Pasal 72
Undang-undang Nomor 19 Tahun 2002
Tentang Hak Cipta
1. Barangsapa dengan sengaja melanggar dan tanpa hak melakukan
perbuatan sebagamana dmaksud dalam Pasal 2 Ayat (1) atau Pasal
49 Ayat (1) dan Ayat (2) dpdana dengan pdana penjara masng-
masng palng sngkat 1 (satu) bulan dan/atau denda palng sedkt
Rp1.000.000,00 (satu juta rupah), atau pdana penjara palng lama
7 (tujuh) tahun dan/atau denda palng banyak Rp5.000.000.000,00
(lmamlarrupah).
2. Barangsapa dengan sengaja menyarkan, memamerkan,
mengedarkan,ataumenjualkepadaumumsuatucptaanataubarang
haslpelanggaranhakcptaatauhakterkatsebagadmaksudpada
Ayat (1) dpdana dengan pdana penjara palng lama 5 (lma) tahun
dan/atau denda palng banyak Rp500.000.000,00 (lma ratus juta
rupah).
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?

Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Janji-janji dan Komitmen
SBY-JK (Edisi 2)
Ternyata Hanya Angin?
Oleh Rudy S. Pontoh
Desain Sampul & Penata Letak: Ad
Sketch Art Sampul: Ledi Raja
Diterbitkan oleh
Penerbit Boki Cipta Media, Jakarta 2008
Email: bokicipta@gmail.com
© 2008 Rudy S. Pontoh
Hak cipta dilindungi oleh undang-undang
ISBN 978-979-17267-0-2
Didistribusikan oleh
Boki Cipta Distributor
Jakarta
Dicetak oleh Percetakan Imagraph
Isi di luar tanggung jawab percetakan
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?

BukuinisayapersembahkanuntukKinanti Syandini
Pontoh (Syasa) — putri tercinta yang selalu meramaikan
hari-harisaya,Marlini Hasan—istrisayatercintayangselalu
setiamendampingisaya,Mbak Dewi Dewo—sahabatsetia
yangselalumemberiinspirasibaru,sertateman-temandalam
karir kepenulisan saya: Belinda Gunawan, Yati Utoyo
Lubis, Amalia T, Petty S. Fatimah, Didin P. Ambardini,
M. Dahlan Abubakar, Moelawarman, Taruna Ikrar,
Syamsul Hilal Salam, Anwar Wardy W, Amran Razak,
Zein Suwelehdanmasihbanyaklagimbak-mbakdanmas-
masyangtidakmungkinsayasebutkansatupersatudisini.
Terimakasihjugasayaucapkankepadakeluargabesar
sayadiPoso,kotakelahiransaya,yanghinggakininasihsetia
bertahan di antara puing-puing kerusuhan: Hary, Elvira
(Pico), Sustin, Hatta, Rita (Nona), Netty, Ma’u, Papa
Dedi, Mohtar, Om Ismail,dansemuanya.
Taklupajugasayaucapkanterimakasihkepadateman-
teman“timsukses”yangdulusukangumpuldiGrahaAnugrah:
Sys NS, Adam Riyanto, M.Iqbal Miad; teman-teman
aktivis yang suka ketemu di Kontras:Usman Hamid, Ratna
Sarumpaet, Bernard Ndawu; dan juga juga teman aktivis
dari Forum Poso Bersatu: Farhat Abbas, Camelia Latjuba,
Vera T. Tobing, Elen Tandawuya, Ritha Mananri, Sese,
Kaimana Lapian, Darma Tongku, Fat Alamrie, Nil
Syeban, M. Taswin,danlain-lain.
JugasayaucapkanterimakasihkepadaPak Syarifudin
— konsultan penerbitan yang rajin menasehati saya, Mbak
Amalia Damaiyanti — kakak ipar yang suka meramaikan
suasana, Mbok Marsiyah yang rajin menyiapkan kopi panas
di meja kerja saya, Yulita yang setia mengawal si kecil, dan
Pak Idi — sopir yang selalu siaga setiap saat.Tak lupa saya
sampaikanciumsayangbuatLedi danGegeyangsenantiasan
menemani saya dengan segala kesabarannya. Juga…di luar
semuaitu,bukuinijugasayapersembahkanbuatCheche—
kucingsayatercintayangkinisudahtiada.
v
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
v
Kata Pengantar
Edisi 2
Ketika saya menawarkan ke penerbit, banyak penerbit yang
menolak dengan berbagai alasan. Saat saya menulis surat pembaca
ke media cetak untuk mencari mitra penerbit, banyak media cetak
bahkantakutmemuatsuratpembacasaya.Setelahmengalamiberbagai
penolakan, buku ini (baca: buku “Janji-Janji & Komitmen SBY-JK”
edisi pertama) akhirnya berhasil diterbitkan untuk pertama kali dan
meledakdipasaran.Kinitakadasatupunbukutersebutyangtersisadi
tokobuku.
Namunjejak-jejakkeberadaanbukuinibisadenganmudah
Anda cari di internet. Jika Anda menulis di Google “janji SBY”
– tanpa tanda kutip – maka situs promosi buku ini yang muncul
beradapalingdiatas.Denganmeng-gogling(melakukanpencarian
dengan Google), Anda juga akan menemukan data bahwa buku
ini,hinggaedisikeduanyaditerbitkan,terusmenjadipembicaraan
hangatdiinternet.DatalainyangbisaAndatemukan,ternyatabuku
initelahmenjadireferensidandaftarpustakaberbagaitesisilmiah
serta koleksi perpustakaan di berbagai belahan dunia termasuk
perpustakaankepresidenanRI.
Sekarang, buku ini saya terbitkan kembali dengan isi yang
hampirsamapersisdenganbukuedisipertamaHanyapenampilannya
sedikit diperbaharui dengan beberapa tambahan penting di sana-
sini,termasuktambahankomentardariorang-orangyangsayasebut
v
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
“pemberani”dan“pemerhati”negeriini.Visidanmisiawalbukuini
untuktetaptampilpolos(tanpapretensidankeberpihakankepada
siapapun)tetapsayapertahankan.
Mungkin benar kata orang, masih terlalu dini untuk
memberi penilaian berhasil tidaknya SBY-JK mewujudkan janji-
janji mereka. Karena ibarat bermain catur, sebelum skak mat, kita
sulit memprediksi apakah seseorang akan kalah atau tidak bahkan
meskibatuyangadatinggalbenteng,raja,danpion.Tetapsajamasih
ada waktu.Tapi bagaimana jika ternyata janji-janji dan komitmen
merekahanyalahangin?
Akhirnya pesan saya, belilah buku ini pada kesempatan
pertama ketika Anda melihatnya. Jangan ragu-ragu untuk
membelinya. Keragu-raguan hanya akan membuat Anda menyesal
sepertibanyakdialamiorangdenganedisipertama.
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
v
Kata Pengantar
Edisi 1
Saat buku ini ditulis, ada beberapa janji dan komitmen
(selanjutnya saya singkat jankomit) Presiden RI Susilo Bambang
Yudhoyono (SBY) dan Wakil Presiden RI Jusuf Kalla ( JK) yang
sudahterbukti.Dalamkomposisikabinetmisalnya,merekamemberi
empatposisimenterikepadawanita,jugamemilihputraPapuauntuk
dudukdikabinetsesuaijanji.Namun,adajugayangtidakterbukti.
Antara lain, janji akan memilih menteri BUMN dari kalangan
nonpartisan. Nyatanya yang terpilih adalah seorang partisan salah
satuparpol.Masihadaratusanjankomitlainyangmenunggubukti
hinggalimatahunkedepan.AdakahAndamencatatnya?
Mungkin “ya”, mungkin juga “lupa-lupa ingat”, tapi bisa
dipastikansebahagianbesarakanmenjawab“tidak”.Padahal,simaklah
apakataJusufKallasaatberbicaradidepanpesertaRakernasBadan
KomunikasiPemudaRemajaMasjidIndonesia(BKPRMI)diBalai
DiklatSrondolSemarang(17Juni2004),“Sayasetujujikajanji-janji
calon presiden dan calon wakil presiden dicatat, agar jika terpilih
nanti,masyarakatbisamenagihnya”.
Berbekalrasapenasaranpluskeinginanuntukmenagihatau
lebihtepatmenunggujanji,sayamelakukanpelacakanmediaguna
menelusuri keberadaan sang jankomit. Kaidah-kaidah sebuah data
sepertiapa,dimana,dankapanjankomitdiucapkanberusahasaya
penuhi.Untukitu,adatigatahapyangsayagunakan:
Pertama,mengumpulkanberbagaiberitadaninformasiapa
sajayangberhubungandenganSBY-JK.Padatahapinisemuaarsip
v
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
koran, majalah, radio, bulletin, televisi yang saya anggap bonafd
(lihatrujukan)sayatelusuribaiksecaraonlinemaupunpenelusuran
langsung. Penulusuran saya batasi pada berita dan informasi yang
dipublikasikan sejak bulan Mei 2004 (masa persiapan pencalonan)
hingga akhir Oktober 2004 (seusai pelantikan calon presiden dan
calonwakilpresidenterpilih).
Selanjutnya,beritadaninformasiyangterkumpulsayapilah-
pilihkembaliuntukmemilihberitadaninformasiyangberhubungan
dengan jankomit. Hasilnya, sunggguh luar biasa: jankomit yang
terkumpuljumlahnyamencapaiangkaribuan.
Banyak jankomit yang diucapkan berulang, hanya tempat
dan waktunya yang berbeda. Jankomit seperti ini saya singkirkan.
Begitupun dengan jankomit yang saya anggap emosional atau
diplesetkan oleh pembuat berita/informasi untuk tujuan-tujuan
tertentu.Langkahmemilih,mengecekulangdenganmenggunakan
sumberlainsepertiitusayalakukanpadatahapterakhir.
Tidaksemuajankomitbisasayatelusuri.Namunapayang
termuatdalambukuinisayaanggapbisamewakilijankomitlainnya
yang tidak berhasil saya lacak. Agar pembaca tidak terlalu banyak
“memakan” janji, buku ini juga saya lengkapi dengan komentar
dan opini dari mereka yang menunggu bukti jankomit. Komentar
dan opini saya kumpulkan dengan menyebarkan pertanyaan “apa
yang ada harapkan dari janji dan komitmen SBY-JK?” di berbagai
mailinglist maupun pertanyaan secara langsung. Sebagai indikator
apakah SBY-JK memenuhi jankomit mereka, pada bagian lain
buku ini saya sertakan fakta dan data keadaan Indonesia saat ini,
saatjankomitdiucapkan.Limatahunmendatang,bukalahkembali
faktadandataini.Jikafaktadandatapadasaatituternyatabanyak
berubahdarifaktadandatadalambukuini,bisadipastikanSBY-JK
telahmemenuhijanji-janjiperubahanyangselalumerekadengung-
dengungkan.Selamatmembaca!
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?

PENDAHULUAN:
Antara Janji SBY-JK
dan Angin
Waktu pemilu dulu, saya adalah pendukung independen
SBY-JK(SusiloBambangYudhoyono-JusufKalla).Bahkanhingga
sayamerasapesimisdenganjanji-janjiyangkerapdilontarkanSBY-
JKpadamasakampanyedulu,sayatetapmendukungmereka.Saya
yakinorangsepertisayaadajutaanjumlahnyadinegeriini.
Jangankandiberiwaktu100hari,dalamwaktulimatahun
masapemerintahnyapunbanyakjanjiyangmenurutsayaakansulit
dibuktikan.Bahkanjikamasapemerintahannyaditambahberlipat-
lipat kali pun masih ada janji yang masih sulit untuk dibuktikan.
Pernahkah Anda membayangkan negeri yang konon mewarisi
budayakorupdari“sononya”danselalumendudukiperingkatkelima
ataukeenamterkorupdiduniainibenar-benarbersihdarikoruptor
hanya berkat program pemberantasan korupsi yang 100 hari, lima
tahun,atau10tahun?Jikaandamenjawabya,ituberartiAndasama
optimisnya dengan generasi tiga, empat atau lima dekade yang
laludansamaakankecewanyaAndadengantiga,empatataulima
generasimendatang.
Laluapaartisebuahjanji?Itutergantungbagaimana,siapa,
danuntukapajanjiitudiucapkan.Bertanyalahpadaseorangulama,
daniaakanmenjawabbahwaseorangmuslimyangbaikseharusnya
menepati janji-janji yang ia ucapkan baik kepada sesama manusia
maupunkepadaAllahSWT.Kitapundiajarkanuntukmelafazkan

Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
“insya Allah” saat mengucapkan janji. Bertanyalah kepada seorang
penyanyi,iamungkinakanberkatabahwajanjiadalahsesuatuyang
enakuntukdidendangkantapitidakuntukdibuktikan.Bertanyalah
kepada seorang ahli flsafat, maka ia akan mengaitkan masalah
janji itu dengan tanggung jawab atau responsibility yang diartikan
sebagai accountabiliy (perhitungan), obligation (kewajiban), dan
cause (penggerak). Dan jika kita bertanya kepada SBY-JK apakah
merekapernahmengucapkanjanjisaatkampanyedulu,merekapun
mungkin akan berpendapat bahwa apa yang mereka ucapkan dulu
itu bukanlah janji melainkan rencana. Jadi, sah saja jika kemudian
sayaberpendapatbahwaapayangdiucapkanSBY-JKdulumemang
bukanlah janji atau komitmen melainkan angin yang keluar dalam
bentuksuaramelaluisebuahprosesditenggorokan.
Kenyataanpertamayangbisakitajadikanindikatorbahwa
apayangmerekakatakanhanyalahangintakperluharusdibuktikan
denganmenungguwaktu100hariatauhinggalimatahunkedepan.
Sejak malam pengumuman kabinet tanggal 20 Oktober 2004 lalu,
aromaanginsebenarnyasudahmulaiterasadiIstana.Padamulanya
pengumuman kabinet dijanjikan akan berlangsung pukul 20.00
WIB. Ternyata para wartawan yang menunggu mewakili jutaan
pemirsa di depan televisi terpaksa cuma menghirup angin karena
waktu pengumuman ditunda hingga pukul 23.00. Ketika waktu
yang dijanjikan tiba, lagi-lagi mereka harus menghirup angin tak
sedap karena pengumuman baru bisa dilaksananakan beberapa
menitmenjelangtengahmalam.
Sesudahnya, banyak lagi indikator lain yang bisa
membuktikan bahwa ucapan mereka dulu itu hanyalah angin.
Dalamriuh-rendahmasakampanyedulumerekamengatakanakan
melakukan shock therapy dalam bidang pemberantasan KKN pada
masa100haripertamapemerintahanmereka.Ekspektasimasyarakat
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?

menjadi begitu tinggi karena mereka berharap shock terapy itu
akan berwujud penangkapan koruptor kelas kakap. Ternyata yang
tertangkaphanyalahkoruptorkelasterisekelasPutehdanGubernur
Sumbaryangsayasendiribahkanlupanamanyakarenatidakbegitu
dikenal.Masyarakatpunbarusadarbahwamerekatelahmenerima
angin. Dalam bidang Hak Asasi Manusia (HAM), Suciwati, istri
almarhum Munir juga sempat terkena angin ketika berkunjung
ke istana. Untungnya ia tak langsung masuk angin begitu tahu
pembentukankomisiindependenuntukmembongkarkasusMunir
ketikaituternyatahanyalahangin.
Indikatorlain,beberapawaktusetelahpelantikanSBY-JK
menjadi presiden dan wakil presiden RI, rakyat terpaksa berteriak
ketikaPertaminamenaikkanhargapetramaxdanelpiji.Kenaikkan
inidiikutidenganpencabutansubsidibahanbakarminyak(BBM)
yang mengakibatkan harga minyak tanah yang Rp 700 per liter
menjadi Rp 2.000 per liter. Padahal, masih terngiang-ngiang
di telinga waktu kampanye dulu SBY-JK dengan lantang dan
merdu menyuarakan bahwa kebijakan yang akan diambil dalam
mengantisipasi kenaikkan minyak dunia tidak akan membebani
rakyatkecil.Inijugaternyatahanyalahangin.Toh,meskitahubahwa
ituhanyalahangin,masyarakatkitahanyabisamenerimakenyataan
itudenganlapanghati.
Mengapa? Karena kita adalah bangsa yang selalu atau
terpaksa menjadi mafhum. Ketika SBY berkunjung ke luar negeri
saat kematian Yasser Arafat dan pertemuan APEC di Chile,
Fakultas Ilmu Sosial dan Ilmu Politik (FISIP) Unhas, Jurusan
PolitikPemerintahanburu-burumenggelardiskusibertajuk;‘Citra
IndonesiadiLuarNegeri;SuatuAnalisisDiplomasiPublikdalam
100HariPemerintahanSBY-JK’.Pasalnya,dalammasakampanye
dulu SBY pernah mengatakan bahwa tiga bulan pertama masa

Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
pemerintahannya ia akan lebih memfokuskan diri pada masalah-
masalah di dalam negeri ketimbang luar negeri. Hasil diskusi?
Kunjungan SBY ke luar negeri masih bisa dimaklumi karena
berhubungandengancitraIndonesiadiluarnegeri.
Kita,sejakdulu,adalahbangsayangselalubisadenganmudah
memaklumidanbisadengansabarmenunggujanjimeskikitatahu
apayangkitatungguituadalahangin.Sebuahrezim,sebuahorde,
sebuahpemerintahansebenarnyaadalahsebuahjanjimeskijanjiitu
tidakpernahdiucapkanatauditandatangani.KetikarezimSoeharto
berkuasa,kitamenungguterjadinyaangin“keajaiban”sehinggakita
bisakeluardarigenggamanrezimotoriter.Setelahdadaterasasesak
menunggu, Soeharto berhasil dimundurkan dan datanglah angin
reformasi.Kitapunmenungguterjadinyaperbaikan.Hinggahidung
terasa sengak untuk bernapas karena banyaknya angin, perbaikan
rasanya tak kunjung datang jua. Jadi, harus dilakukan perubahan.
Maka datanglah angin perubahan. Kita pun menunggu kapan
perubahanakanterjadi.Limatahunkedepansetelahperubahantak
kunjungterasadandadakitasemakinsesakkarenabanyaknyaangin
yang masuk mungkin akan berhembus angin baru yang bernama
angin pelurusan. Alhasil? Ya, kita akan dengan setia menunggu
meskikitatahuapayangkitatungguituadalahangin.
Kita adalah bangsa yang menanti. Sadar atau tidak, jauh
didalamhati,kitamenikmatisaat-saatpenantianitusebagaimana
kitamenikmatianginketikasedangdudukditepipantai.Kitasuka
mendengar janji-janji, karena di dalam janji-janji itu terkandung
sebuahharapan.Kitajugamenikmatisaat-saatmenunggubuktidari
janji-janji itu karena di situ bergulir sebuah ketegangan. Kita akan
senantiasa menikmati apapun yang dijanjikan tak perduli apakah
janjiitubisaterbuktiatautidak.Danketikajanjiitumemangtidak
terbukti,kitaakandengansegeramencaripembenaranagarkitabisa
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?

tetapmenikmatiangin-anginyangbaru.
Lalu masih perlukah kita memperdebatkan soal angin
sementarakitasendirimenikmatiapayangakankitaperdebatkan?
Saya adalah pendukung SBY-JK bahkan ketika saya yakin
janji-janjimerekahanyalahangin.Mengapa?Karenasejakawalsaya
tidakpernahberharapbanyakdariapayangmerekajanjikan.Saya
merasa puas sebagai penikmat angin sejati. Saya melihat, masalah
angin bukanlah indikator baik-buruknya sebuah pemerintahan.
Mereka adalah baik dan kita masyarakat sama baiknya dengan
mereka. Mereka adalah sebuah konfgurasi dari struktur pembuat
janji yang baik dan kita adalah masyarakat yang tersusun atas
unsur-unsurpendengarjanjiyangbaik.Jaditakusahlahkitaterlalu
berharapmerekaakanmenepatijanjimerekapersissamasepertiapa
yang mereka katakan saat kampanye dulu. Di bidang ini mungkin
merekasamaburuknyadengankita.Merekaburukdalammenepati
janji dan kita buruk dalam menuntut janji. Dari pada berdebat
berkepanjangan,bukankahakanlebihbaikkitamenikmatiangin?
Salam,
Rudy S. Pontoh
rudypontoh@gmail.com
CATATAN: Tulisan ini saya tulis kembali berdasarkan tulisan saya
sebelumnya dengan judul yang sama yang saya buat atas permintaan
JurnalMadanipadaawalpemerintahanSBY-JK
v
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
v
DAFTAR ISI
KOMENTAR DAN TESTIMONI...................................... i
KATA PENGANTAR EDISI 2............................................. xv
KATA PENGANTAR EDISI 1............................................. xvii
PENDAHULUAN: Antara Janji SBY-JK dan Angin............ xxi
DAFTAR ISI........................................................................ xxvii
BAGIAN SATU :
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai
Pelantikan
PemberantasanKKN................................................................ 3
KeperdulianTerhadapRakyat.................................................. 7
PerbaikanPendidikan............................................................... 12
PerlindungandanPemberdayaanPerempuan........................... 19
PemulihandanPeningkatanEkonomi..................................... 23
KebijakandanPembangunanDaerah........................................ 31
PenegakkanHukum................................................................. 39
SeputarKepemimpinan............................................................ 43
MasalahKetenagakerjaan......................................................... 49
KeamanandanPertahanan....................................................... 52
PelayananKesehatan................................................................ 58
BudayadanSeni....................................................................... 62
KesejahteraanRakyat............................................................... 65
HubungandanKerjasamaInternasional.................................. 68
v
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
NelayandanPetani................................................................... 71
OtonomiDaerah...................................................................... 74
KebebasanPers......................................................................... 76
PornografdanNarkoba........................................................... 79
BisnisdanUsaha...................................................................... 82
IndonesiaMasaDepan............................................................. 86
Hutan,Laut,danLingkungan.................................................. 89
AjakandanKebersamaan......................................................... 92
SeputarKabinet........................................................................ 97
AgendaKerja............................................................................ 102
Nonkategori.............................................................................. 110
BAGIAN DUA :
Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK
MeningkatkanSalingPercaya.................................................. 117
MencegahdanMenanggulangiSeparatisme............................ 117
MenegakkanHukumdanKetertiban....................................... 117
MencegahTerorisme................................................................ 118
MeningkatkanKemampuanPertahanan.................................. 118
MemantapkanPolitikLuarNegeri.......................................... 118
MembenahiSistemdanPolitikHukum................................... 119
MenciptakanTataPemerintahanyangBersih.......................... 119
MenghapusDiskriminasi......................................................... 120
MengembangkanKebudayaan................................................. 120
MeningkatkanKualitasProsesDesentralisasidanOtonomi.... 121
MenjaminPenghormatandanPengakuanAtasHAM............ 121
MeningkatkanPeranPerempuan............................................. 121
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l
Janji dan Komitmen:
Dari Persiapan Kampanye
Hingga Usai Pelantikan
Bagian Satu
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
2
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 3
Pemberantasan
KKN
Kontrak Politik
S
aya akan mengadakan kontrak politik dengan rakyat dalam
menanggulangi pemberantasan korupsi. Satu rupiah pun
uang negara harus dipertanggungjawabkan dan diaudit.
Pemeriksaan harus trasnparan. Rakyat harus mengetahui apa yang
sudah dilakukan, apa yang belum dilakukan, dan apa yang akan
dilakukan ke depan. (SBY, dalam acara dialog “Visi dan Strategi
Kebudayaan Calon Presiden 2004” di Graha Bhakti Budaya, Taman
Ismail Marzuki, Jakarta, Senin 14 Juni 2004).
Mengkaji Ulang
Saya akan mengkaji ulang semua kasus KKN. Langkah
konkrit pertama saya dalam memberantas korupsi adalah mengkaji
ulang semua proses hukumnya. Untuk itu, saya akan memanggil
Jaksa Agung guna membicarakan apa yang telah dan yang sedang
ia kerjakan. Langkah selanjutnya, saya akan melakukan pengawasan
yang ketat melalui lembaga-lembaga yang ada seperti BPK, Irjen
serta dengan keterlibatan masyarakat. Berikutnya, melibatkan KPK
untuk melakukan pengawasan. Semua pejabat negara harus diaudit
sehingga ketahuan berapa penambahan nilai kekayaannya, apakah
penambahan nilainya masuk akal atau tidak. Jika tidak masuk
akal, harus diadakan penyelidikan lanjutan. Faktor berikutnya
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
4
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
yang menjadi sangat penting dalam pemberantasan KKN adalah
faktor pemimpin. Jika pemimpin melakukan pengawasan terus-
menerus terhadap KKN, dampaknya akan sangat baik bagi upaya
pemberantasan korupsi. (SBY, pidato politik pada penutupan masa
kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI
2004-2009, Jakarta, Kamis 1 Juli 2004).
Resep Ajaib
Tidak ada resep ajaib dalam memberantas korupsi.
Namun perjuangan ini harus dilakukan sekuat tenaga. Kita harus
memberikan contoh teladan dari pimpinan tertinggi sampai
terendah. Ini merupakan tantangan yang harus saya hadapi. (SBY, di
Hotel Permata, Pacitan, Selasa 8 Juni 2004).
Pilar Utama
Kita harus selalu mengawasi usaha pemberantasan korupsi
dengan memperkuat wewenang lembaga-lembaga antikorupsi dan
peraturan-peraturannya. Saya akan berikhtiar untuk meyakinkan
bahwa rule of law akan mengalahkan rule of powerful interests.
Keadilan dan menghormati hak asasi manusia, bagi saya merupakan
pilar utama demokrasi. (SBY, dalam acara seminar Institut Kajian
Pertahanan dan Strategi Singapura, Singapura, Rabu 26 Mei 2004).
Membatasi Kekuasaan
Saya sangat komit untuk memberantas korupsi dan
menegakkan hukum. Menerapkan power concept untuk membatasi
munculnya penyalahgunaan kekuasaan di daerah. Jika kekuasaan
tidak dibatasi, korupsi akan muncul. Jadi harus dibatasi oleh
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 5
undang-undang supaya tidak muncul penyimpangan, terutama
sejak diberlakukannya otonomi daerah. (SBY, dalam pertemuan
dengan Pengurus Besar Persatuan Guru Republik Indonesia di Bumi
Perkemahan Tawangmangu, Solo, Sabtu, 14 Agustus 2004).
Kekayaan Diumumkan
Meski dalam undang-undang laporan kekayaan pejabat
negara tidak harus diumumkan, saya setuju jika hal itu diumumkan.
Ini akan berguna untuk mengatasi korupsi. Kalau bisa, di masa
mendatang ada klarifkasi kekayaan pejabat setiap tahun sekali.
(SBY, saat mengunjungi kantor Komisi Pemberantasan Tindak Pidana
Korupsi, Jakarta, Selasa 31 Agustus 2004).
Memberikan Keteladanan
Pemberantasan korupsi menjadi keharusan. Kita jalankan
dengan memberikan keteladanan yang bersifat top down, harus
dimulai dari pemimpin tertinggi di negara ini. Terus, keteladanan
dan engagement ini mengalir ke pimpinan yang lebih rendah sampai
tingkat kepemimpinan terendah dalam masyarakat kita. Upaya
ini harus dibarengi dengan upaya-upaya hukum yang tegas dan
adil. Dan, secara bertahap mengembangkan sistem hukuman dan
ganjaran atas korupsi i. (SBY, pidato politik pada pembukaan masa
kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI
2004-2009, Jakarta, Selasa 1 Juni 2004).
Memimpin Langsung
Saya akan memimpin langsung pemberantasan korupsi di
negeri ini. Ini adalah masalah serius. Untuk mengetahui pemberantasan
yang dilakukan sudah sejauh mana, kami akan mengadakan rapat
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
6
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
secara terus menerus. Pengauditan kekayaan pejabat harus dilakukan
setiap tahun. Semua lembaga yang dibangun untuk pemberantasan
KKN seperti BPK, KPK akan saya dayagunakan dengan terpadu
agar langkah yang diambil efektif. Pengawasan lebih ketat akan
saya lakukan terhadap pos-pos rawan korupsi seperti bea cukai dan
bagian pengadaan lainnya. Jika presiden memberikan perhatian
yang sungguh-sungguh terhadap pemberantasan korupsi, saya yakin
lima tahun ke depan praktek korupsi dan berbagai penyimpangan
dapat berkurang. (SBY, dalam acara “Dialog Penajaman Visi, Misi,
dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi
Pemilihan Umum di Hotel Hilton, Jakarta, Selasa 14 September 2004).
Tekad Tak Cukup
Tekad saja tak cukup dalam melakukan pemberantasan
korupsi. Diperlukan contoh dari atas, contoh dari pemimpinnya.
(JK, dalam acara “Dialog Penajaman Visi, Misi, dan Program Capres-
Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel
Hilton, Jakarta, Selasa 14 September 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 7
Keperdulian
Terhadap Rakyat
Kalangan Bawah
K
ami akan memprioritaskan upaya penanggulangan
masalah perekonomian bagi masyarakat kalangan bawah.
Pemerintah harus terus menerus membantu kaum dhuafa
dan masyarakat miskin dalam upaya mewujudkan Indonesia yang
aman, damai, adil, demokratis, dan sejahtera. Mereka selama ini
belum mendapat hak-haknya secara proporsional. (SBY, dalam
silaturahmi dengan sejumlah ulama dan cendekiawan muslim di Asrama
Haji Masyhur, Medan, Jumat 18 Juni 2004).
Harapan Rakyat
Banyak hal penting yang mesti kita pikirkan bersama:
agar demokrasi semakin mekar, keamanan semakin pulih, keadilan
semakin tegak, dan kesejahteraan meningkat. Harapan rakyat yang
telah disampaikan kepada calon presiden lain (calon presiden yang
tidak terpilih, Ed.) akan merupakan amanah bagi saya. (SBY, dalam
acara open house di kediamannya, Puri Cikeas, Gunung Putri, Bogor,
Senin 27 September 2004).
Bertemu Langsung
Saya akan mendengar langsung dari rakyat permasalahan
mereka. Saya akan bertemu langsung dan mendengarkan apa adanya,
tanpa ada rekayasa. Saya ingin tahu apa yang mereka harapkan.
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
8
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
(SBY, usai mengadakan rapat dengan tim suksesnya di Hotel Shangri-
la, Surabaya, Sabtu 5 Juni 2004).
Senang Mendengar
Saya senang mendengar langsung suara rakyat. Pemimpin
harus senang mendengar suara rakyat. Pemimpin harus tahu masalah
rakyat. (SBY, saat bertemu dan berdialog dengan sejumlah petani dan
pedagang jamu serta buruh jamu di Bawen, Ungaran, Selasa 29 Juni
2004).
Turun Langsung
Saya siap berkeja keras bersama-sama rakyat untuk
memperbaiki taraf kehidupan rakyat, kaum buruh dan rakyat miskin.
Saya akan meminta para pejabat sebagai pemimpin di daerahnya
untuk sering-sering turun langsung bertemu rakyat. Dengan begitu
mereka bisa melihat secara langsung berbagai persoalan yang
dihadapi rakyat. Jika mereka sudah tahu persoalannya, mereka
bisa memperbaikinya bersama-sama rakyat. (SBY, saat bertemu dan
berdialog dengan sejumlah petani dan pedagang jamu serta buruh jamu
di Bawen, Ungaran, Selasa 29 Juni 2004).
Kebutuhan Pokok
Untuk kepentingan konsumen, saya akan memperhatikan
kebutuhan pokok dan menjamin harga murah dan stabil. Itu menjadi
program kami dalam mesejahterakan rakyat. Agar hal tersebut bisa
terlaksanan, dibutuhkan kondisi aman dan perlakuan adil bagi
masyarakat. Setiap orang diperlakukan sama. (JK, saat bertemu dengan
para nelayan di tempat pelelangan ikan Lempasing, Bandarlampung,
Lampung, Senin 28 Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 9
Pelayanan Publik
Kita akan membangun sistem politik penyadaran atas hak dan
kewajiban ekonomi dan politik rakyat. Rakyat berhak memperoleh
lebih dari yang didapatkan sekarang. Kita ingin rakyat menyadari
dan mengontrol bahwa yang dimaksud pelayan publik berarti
pelayanan untuk seluruh rakyat. Bukan hanya untuk sebagian kecil
masyarakat. Tidak ada satu orang pun yang berada di atas hukum.
(SBY, pidato politik pada pembukaan masa kampanye putaran pertama
Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Selasa
1 Juni 2004).
Sesuai Aturan
Pajabat daerah, gubernur, bupati harus bekerja sesuai aturan.
Yakni, mengutamakan kebutuhan rakyat, bukan mengutamakan
kebutuhan konsumtif pribadi. Saya akan meminta agenda mereka.
Pembangunan yang dilakukan harus diprioritaskan untuk kebutuhan
rakyat banyak. Untuk daerah miskin dan tidak mendapat perhatian
dari kepala daerah, rakyat bisa melakukan usulan langsung kepada
presiden. Kalau untuk pembangunan gedung dan fasilitas sekolah,
pembangunannya harus disesuaikan dengan aturan yang ada, melalui
kepala daerah. (SBY, menjawab pertanyaan masyarakat di kediamannya,
Puri Cikeas, Gunung Putri, Bogor, Selasa, 28 September 2004).
Hari Besar
Adalah lazim jika harga kebutuhan pokok naik saat
menghadapi hari-hari besar keagamaan seperti Lebaran dan
Natal. Yang penting adalah menjaga distribusi agar tidak terjadi
kelangkaan. Namun jika kenaikan itu menyulitkan rakyat kecil, kami
akan melakukan operasi pasar. Upaya perbaikan ekonomi harus
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
l0
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
menyentuh pada keadilan sosial. Wujud dari keadilan sosial itu harus
tampak pada upaya peningkatan hak dasar rakyat. (SBY, dalam acara
“Dialog Penajaman Visi, Misi, dan Program Capres-Cawapres yang
diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton, Jakarta,
Selasa 15 September 2004).
Tetap Stabil
Saya akan memperjuangkan berbagai kebutuhan pokok
masyarakat (sembako) agar tetap stabil dan terjangkau. (JK, dalam
kampanyenya di Jambi, Selasa 15 Juni 2004).
Harus Diantisipasi
Saya akan mengambil kebijakan yang tidak membebani
rakyat kecil dalam mengatasi kenaikan harga BBM. Kenaikan harga
minyak dunia yang terjadi saat ini harus diantisipasi oleh pemerintah
dengan melakukan penyesuaian terhadap subsidi maupun harga
bahan bakar minyak di dalam negeri. Kalau kenaikan terus berlanjut,
dan menganggu APBN tentu harus ada penyesuaian kebijakan.
Namun, percayalah kebijakan yang akan saya ambil tidak akan
memberatkan rakyat kecil. Karena kita tidak bisa lagi menanggung
subsidi yang sangat besar, kita akan menetapkan subsidi terarah
kepada kelompok yang menjadi target. Dalam hal ini, kita akan
memberikan subsidi hanya untuk solar dan minyak tanah, karena
itulah yang paling banyak digunakan oleh rakyat kecil. (SBY, dalam
acara “Dialog Penajaman Visi, Misi, dan Program Capres-Cawapres
yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton,
Jakarta, Selasa 15 September 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? ll
Terjun Langsung
Permasalahan di daerah tidak hanya akan saya pantau
melalui laporan. Tapi saya akan terjun langsung ke lapangan. Saya
akan terjun langsung untuk mengatahui permasalahan-permasalahan
yang dialami masyarakat. Saya akan terus mendorong jajaran kepala
daerah: gubernur, bupati, walikota, dan kepala dinas untuk bersama-
sama bekerja keras. (SBY, saat berdialog dengan sejumlah guru SMAN
I Cileunsi di kediamannya, Puri Cikeas, Gunung Putri, Bogor, Rabu 22
September 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
l2
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Perbaikan Pendidikan
Pendidikan Berkeadilan
D
alam bidang pendidikan, saya tidak menjanjikan
pendidikan gratis. Tapi, saya akan mengusahakan
pendidikan yang berkeadillan bagi rakyat. Artinya,
masyarakat dari golongan mampu tetap membayar biaya pendidikan
sebagaimana aturan yang ada, sementara yang tidak mampu akan
mendapat keringanan. Itu artinya bekeadilan. Biaya pendidikan
sangat dibutuhkan untuk meningkatkan mutu pendidikan itu sendiri.
Sebab, pendidikan sangat penting artinya untuk kemajuan bangsa
dan negara. (JK, saat kampanye di GOR Saburai, Bandarlampung,
Lampung, Senin 28 Juni 2004).
Menaikkan Anggaran
Dalam lima tahun pemerintahan, saya akan menaikkan
anggaran pendidikan menjadi 20 persen dari APBN. Dana untuk itu
akan kami lakukan dengan melakukan pembatasan dan penundaan di
sektor-sektor tertentu. Misalnya, biaya perjalanan dinas, pemberian
mobil mewah untuk pejabat negara, pembangunan gedung-gedung
baru, alokasi dari belanja barang. Juga melakukan pengaturan pajak
yang lebih baik serta pemberantasan korupsi yang sangat keras.
(SBY, dalam acara “Dialog Penajaman Visi, Misi, dan Program Capres-
Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel
Hilton, Jakarta, Kamis 16 September 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l3
Memperbaiki Sistem
Kami akan memperbaiki pendidikan di Indonesia dengan
dua cara. Pertama, kami akan memperbaiki sistemnya, terutama
yang berhubungan dengan cara masuk dan sistem ujian di masing-
masing tingkat pendidikan. Jangan seperti sekarang ini, orang begitu
mudah lulus padahal sebetulnya mereka kurang belajar. Cara kedua
adalah dengan meningkatkan anggaran pendidikan secara bertahap
hingga mencapai 20 persen sesuai yang digariskan undang-undang.
(JK, di hadapan sejumlah santri Pondok Pesantren Modern As Salam
Sukoharjo, Solo, Sabtu 21 Agustus 2004).
Bisa Gratis
Mereka yang tidak mampu akan diupayakan mendapatkan
pendidikan gratis. Tetapi, mereka yang mampu harus tetap membayar.
Ini agar mereka yang miskin bisa gratis mendapatkan pendidikan.
(JK, dalam acara “Dialog Penajaman Visi, Misi, dan Program Capres-
Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel
Hilton, Jakarta, Kamis 16 September 2004).
Relatif Tertinggal
Pembangunan pendidikan di Indonesia relatif tertinggal
dari negara-negara lain. Di antara 500 perguruan tinggi terkemuka
di dunia, ternyata tidak terdapat perguruan tinggi dari Indonesia.
Pada saat pendidikan di negara-negara tetangga maju dengan pesat,
pembangunan pendidikan di Indonesia berjalan di tempat. Saya
berusaha keras untuk meningkatkan berbagai upaya dan kebijakan
yang nyata dan sungguh-sungguh untuk memeratakan dan
meningkatkan kualitas pendidikan di Indonesia.
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
l4
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Pemerataan pendidikan yang saya maksudkan akan kita
lakukan melalui program-program sebagai berikut : memberikan
akses yang lebih besar kepada kelompok masyarakat miskin,
meningkatkan pendidikan nonformal yang bermutu bagi masyarakat
yang putus sekolah, dan menyediakan sarana dan prasarana
pendidikan serta tenaga pendidikan. Bersamaan dengan ini kami
memberikan perhatian pada peningkatan kesejahteraan guru,
peningkatan kualitas guru, dan peningkatan prasarana pendidikan
dasar di seluruh pelosok negeri.
Peningkatan mutu pendidikan akan saya dorong dengan
melakukan upaya-upaya : pengembangan sarana dan prasarana
pendidikan yang baik dan berkualitas, meningkatkan kompetensi dan
profesionalisme guru dan tenaga pendidik lainnya, meningkatkan
kesejahteraan guru dan tenaga pendidik lainnya agar lebih mampu
mengembangkan kompetensinya, dan menyempurnakan manajemen
pendidikan dan partisipasi masyarakat. (SBY, pidato politik pada
penutupan masa kampanye putaran pertama Pemilihan Presiden dan
Wakil Presiden RI 2004-2009, Jakarta, Kamis 1 Juli 2004).
Menjadi Konstruktif
Pondok pesantren harus dikelola dengan baik agar bisa
menjadi konstruktif. Output dari pondon pesantren bisa menjadi
sumberdaya manusia yang tidak hanya memahami ilmu agama
Islam, tapi juga peduli terhadap lingkungan bangsa dan negara.
Keperdulian ini harus direspons positif. Jumlah pesantren sangat
banyak, lulusannya tentu saja sangat banyak. Jika tak ada keperdulian
dari pemerintah, akan sangat banyak alumni pondok pesantren
yang kesulitan mencari pekerjaan. (SBY, sesaat setelah berkunjung ke
sejumlah pondok pesantren, Madura, Selasa 8 Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l5
Pendidikan Informal
Saya akan memberikan perhatian yang lebih besar terhadap
dunia pendidikan informal seperti sekolah swasta dan pesantren.
Sebab, peranannya sama dengan sekolah negeri, sama-sama bertujuan
mencerdaskan bangsa. Jadi harus diperlakukan sama. Oleh karena itu,
saya akan mengalokasikan dana dari APBN untuk dunia pendidikan
informal sesuai kebutuhan. (JK, kepada wartawan, Bengkulu, Minggu
30 Mei 2004).
Kualitas Sejajar
Saya akan memprogamkan kebijakan agar kualitas
pendidikan di pondok pesantren sejajar dengan sekolah negeri
dan sekolah swasta lainnya. Pondok pesantren sudah seharusnya
mendapat bantuan termasuk buku dan gedung. Sebab, pondok
pesantren mendidik anak-anak yang kurang mampu selama 24 jam.
Dengan begitu, kita akan mampu mewujudkan SDM yang handal
di masa depan. (JK, saat berkunjung ke Pondok Pesantren Al Qur’an
Hartal Lakun, Bengkulu, Selasa 29 Juni 2004).
CATATAN: Mutu lembaga pendidikan agama yang
populer dengan sebutan pesantren atau
madrasah memang sering digugat. Padahal
dengan UU no.20 tahun 2003 tentang sistem
pendidikan nasional, status lembaga yang
cikal bakalnya sudah ada di Indonesia sejak
tahun 1900-an ini sudah dianggap setingkat
dengan pendidikan umum (SD, SMP, SMA,
dan PT). Banyak pihak menganggap, salah
satu penyebab rendahnya mutu lulusan
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
l6
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
pesantren adalah tidak adanya kesejahteraan
guru. Dari 500.000 total jumlah guru
pesantren, hanya sekitar 20 persennya
berstatus PNS, selebihnya digaji oleh
yayasan. Selama ini, anggaran dan tanggung
jawab untuk meningkatkan mutu pendidikan
di pesantren berada di bawah Departemen
Agama dengan segala keterbatasan dana dari
pemerintah.
Proteksi dan Bantuan
Saya akan mengupayakan pendidikan murah. Pendidikan
harus menyentuh mereka yang sangat sangat miskin. Mereka yang
miskin perlu mendapat proteksi dan bantuan termasuk dalam bidang
pendidikan. (SBY, dalam acara “Dialog Penajaman Visi, Misi, dan
Program Capres-Cawapres” yang diselenggarakan oleh Komisi Pemilihan
Umum di Hotel Hilton, Jakarta, Kamis 16 September 2004).
Gaji Guru
Saya berharap agar suatu saat gaji guru bisa mencapai dua juta
rupiah per bulan. Tentu saja tidak serta merta, tetapi harus menunggu
hingga penerimaan negara lebih baik. Negara ke depan harus bisa
membantu membayar sekolah mereka yang tidak mampu. (SBY,
saat berdialog dengan sejumlah guru SMAN I Cileunsi di kediamannya,
Puri Cikeas, Gunung Putri, Bogor, Rabu 22 September 2004).
CATATAN: Saat ini, gaji guru golongan IV A dengan masa
kerja 24 tahun hanya Rp 1,5 juta per bulan.
Pada masa pemerintahannya, Abdurahman
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l7
Wahid juga pernah menjanjikan kenaikan
300 persen tunjangan fungsional guru.
Namun yang tercapai hanya 150 persen.
Begitupun keinginan Megawati. Masalah
kesejahteraan guru saat ini memang sedang
dicarikan jalan keluarnya oleh berbagai
pihak. Ada isyarat bahwa gaji guru untuk
masa mendatang akan dikaitkan dengan
kompetensi, dedikasi, dan kualifkasi. Isyarat
lain, titik tolak anggaran dana pendidikan
akan diarahkan pada kesejahteraan guru
sebagai kunci utama pendidikan.
Beasiswa dan Subsidi
Sejalan dengan peningkatan kemampuan negara, kita
akan tingkatkan beasiswa dan subsidi pendidikan bagi kelompok
masyarakat miskin. Di samping itu, kita akan tingkatkan kualitas
kurikulum pendidikan, tingkatkan rasio guru terhadap murid, dan
mendorong anak didik untuk membaca dengan meningkatkan dan
memperkaya perpustakaan sekolah. Yang juga tidak kalah pentingnya
adalah pengembangan ekonomi komunitas dan ekonomi rumah
tangga masyarakat miskin. (SBY, pidato politik pada pembukaan masa
kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI
2004-2009, Jakarta, Selasa 1 Juni 2004).
Lomba Baca
Untuk menjadi bangsa yang maju, kita harus menjadi
bangsa yang belajar. Untuk menjadi bangsa yang belajar,
kita harus menjadi bangsa yang membaca. Saya berharap,
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
l8
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
sekolah menyediakan perpustakaan dan mendorong murid-
muridnya membaca. Selain itu, dibutuhkan peranan lembaga
masyarakat untuk menyediakan taman bacaan. Juga mengadakan
penyelenggaraan lomba baca maupun lomba mengarang: prosa
maupun puisi. (SBY, dalam acara “Dialog Penajaman Visi, Misi,
dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi
Pemilihan Umum di Hotel Hilton, Jakarta, Kamis 16 September
2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l9
Perlindungan
dan Pemberdayaan
Perempuan
Obyek Kekerasan
S
aya akan berusaha mengurangi penderitaan rakyat, khususnya
di daerah konfik, khususnya lagi mencegah agar perempuan
tidak jadi obyek kekerasan. Saya melihat dewasa ini ada tiga
hal fundamental yang terkait dengan permasalahan perempuan.
Salah satu hal yang mesti disoroti adalah masalah keselamatan kaum
perempuan dari tindak kejahatan dan kekerasan. Hal kedua, masalah
pelayanan secara layak dan manusiawi untuk kaum perempuan.
Misalnya, persoalan perempuan dan kemiskinan serta pendidikan.
(SBY, dalam pertemuan dengan aktivis Gerakan Pemberdayaan Suara
Perempuan di Hotel Atlet Century Park, Senayan, Jakarta, Senin 30
Agustus 2004).
Kesenjangan Partisipasi
Masalah kesenjangan partisipasi politik kaum perempuan
sebenarnya bersumber dari struktur sosio-kultural yang ada pada
masyarakat kita. Dalam konteks sosial yang lebih luas, kesenjangan
ini mencerminkan masih terbatasnya akses sebagian besar
perempuan terhadap pelayanan kesehatan yang lebih baik, tingkat
pendidikan yang lebih tinggi, dan keterlibatan dalam kegiatan
publik yang lebih luas. Menghadapi kondisi demikian, diperlukan
tindakan pemihakan yang jelas dan kongkrit guna menyeimbangkan
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
20
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
kesenjangan tersebut. Dalam jangka pendek, beberapa bentuk
afrmative actions barangkali diperlukan untuk memajukan tingkat
keterlibatan perempuan dalam proses politik. Namun dalam jangka
panjang, lebih penting lagi untuk meningkatkan taraf pendidikan dan
layanan kesehatan serta program-program lain untuk mempertinggi
kualitas hidup dan sumberdaya kaum perempuan. Hanya apabila
yang terakhir ini dapat diwujudkan, maka struktur sosial politik yang
lebih egaliter akan tercipta dan kaum perempuan bisa tampil dalam
pentas kehidupan politik secara setara. (SBY, pidato politik pada
penutupan masa kampanye putaran pertama Pemilihan Presiden dan
Wakil Presiden RI 2004-2009, Jakarta, Kamis 1 Juli 2004).
Proteksi dan Layanan
Saya akan memberi perhatian khusus terhadap masalah
perempuan. Dalam hal ini, ada hal penting yang menjadi perhatian
saya. Yakni, memberikan proteksi dan layanan yang baik bagi mereka
dalam situasi pasca krisis, utamanya bagi mereka yang berada di
daerah konfik, sehingga mereka tidak mengalami kesulitan hidup
yang sangat berat. Di daerah pengungsian, jangan sampai anak
mereka tidak bersekolah dan tidak memperoleh pelayanan kesehatan
yang baik. Hal lain, jangan sampai mereka dijadikan komoditas
perdagangan perempuan, penyelundupan, dan sebagainya. Negara
harus memberikan proteksi dan pelayanan sebaik mungkin kepada
mereka. (SBY, saat diwawancarai TV7, Juli 2004).
Penyelundupan Perempuan
Saya akan memberikan keperdulian yang sangat tinggi
terhadap pemberantasan kejahatan transnasional, penyelundupan
kaum perempuan. Hal ini merupakan prioritas dalam aspek
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 2l
penegakan hukum. Harus kita pastikan pemberantasannya dilakukan
dengan lebih serius dan nyata dengan melibatkan semua pihak.
Pemantauan, kontrol, dan perlindungan terhadap kaum perempuan
dan anak harus lebih ditingkatkan dan dilaksanakan secara simultan.
(SBY, dalam acara “Perempuan dan Pemilu” di Metro TV, Sabtu 26 Juni
2004).
Kesetaraan Gender
Saya memandang kesetaraan gender sebagai amanah
demokrasi, juga menyangkut keadilan. Untuk itu, ke depan kesetaraan
gender harus betul-betul menjadi paradigma politik yang kemudian
dituangkan, baik dalam undang-undang maupun kebijakan-kebijakan
politik. Tak ada lagi diskriminasi, semua berkesempatan yang sama.
Pada akhirnya, tinggal terpulang pada kaum perempuan sendiri.
Tinggal bagaimana mereka memanfaatkan peluang dengan memacu
drinya untuk tumbuh dengan baik dan mempunyai daya saing yang
sama dengan kaum laki-laki. (SBY, dalam acara “Perempuan dan
Pemilu” di Metro TV, Sabtu 26 Juni 2004).
Lebih Teliti
Saya menilai, umumnya kaum perempuan lebih teliti,
disiplin, dan gigih dalam mengemban tugas-tugasnya. Ada banyak
pos politik di kabinet yang saya nila tepat jika diduduki oleh kaum
perempuan. Dalam catatan saya, sebelumnya presentase perempuan
di dalam kabinet kurang dari 10 persen. Sudah saatnya jumlah itu
ditingkatkan menjadi 10 persen lebih. Apalagi mengingat, prosentase
jumlah perempuan di negeri ini besar, yakni 50 persen. (SBY, dalam
acara “Perempuan dan Pemilu” di Metro TV, Sabtu 26 Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
22
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 23
Pemulihan
dan Peningkatan
Ekonomi
Ekonomi Sebagai Prioritas
P
residen Indonesia yang baru akan dihadapkan pada
berbagai program. Dari pemulihan di bidang pertahanan
dan keamanan, hukum, sosial, ekonomi, budaya, hingga
pemulihan di bidang budaya. Tapi harus ada prioritas. Jika saya
yang memimpin, masalah ekonomi yang akan menjadi prioritas
saya. Antara lain, masalah penyediaan lapangan kerja. Angka
pengangguran saat ini sudah mencapai angka 10,3 persen. Harapan
saya, lima tahun ke depan angka ini akan menjadi 5,1 persen.
Sementara itu, pertumbuhan ekonomi yang saat ini 4,3 persen harus
ditingkatkan menjadi 6,6 persen. (SBY, di depan peserta acara “Dialog
Interaktif Menuju Indonesia Masa Depan” yang diadakan oleh Forum
Rektor Indonesia Jawa Timur, Surabaya, Selasa 24 Agustus 2004).
CATATAN: Menurut ILO (International Labour
Organization) jumlah pengangguran
(berdasarkan publikasinya tahun 2003)
di Indonesia terus meningkat dari tahun
ke tahun. Tahun 2001 jumlahnya hanya
6,1 juta orang. Lalu menjadi 8,6 juta
orang pada tahun 2002. Pada tahun 2003
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
24
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
angka ini sudah mencapai 10,3 juta jiwa.
Berdasarkan proyeksi Bappenas pada
tahun 2004 angka ini mencapai 10,83
orang (10,32 persen dari angkatan kerja)
dan diperkirakan akan terus berlanjut pada
tahun 2005 menjadi 11,19 juta orang (9,85
persen dari angkatan kerja). Pertumbuhan
ekonomi tidak selalu menjamin penurunan
jumlah pengangguran. Saat ini banyak
negara maju di eropa mengalami situasi
yang disebut unemployment recovery. Yakni,
situasi di mana pertumbuhan ekonomi terus
membaik, tetapi angka pengangguran justru
terus meningkat.
Revitalisasi Ekonomi
Sejalan dengan pengembangan kebijakan peningkatan
daya saing internasional dari industri manufaktur, untuk mengatasi
pengangguran, kita perlu melakukan revitalisasi sektor ekonomi
padat karya. Di antara sektor ekonomi yang penting adalah pertanian
dan industri perdesaan, perikanan dan kelautan, usaha kecil dan
menengah di perkotaan, dan pengelolaan sumberdaya alam secara
berkelanjutan. Dan, secara khusus, saya juga ingin memberikan
perhatian pada perlunya kita melakukan keseimbangan pembangunan
dengan lebih mendayagunakan sumberdaya kelautan yang kita
miliki. Semua ini harus kita lakukan dengan tetap memperhatikan
kelestarian fungsi ekosistem. Dan, dengan melakukan pengawasan
guna menyelamatkan hasil laut kita dari usaha-uasaha illegal. Pada
sektor-sektor ini, investasi publik akan ditingkatkan; di samping,
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 25
tentunya, untuk pendidikan dan kesehatan. (SBY, pidato politik pada
penutupan masa kampanye putaran pertama Pemilihan Presiden dan
Wakil Presiden RI 2004-2009, Jakarta, Kamis 1 Juli 2004).
Rehabilitasi dan Restrukturisasi
Kami akan melakukan rehabilitasi dan restrukturisasi
ekonomi sehubungan dengan terjadinya krisis tahun 1997/1998 lalu.
Ketika itu, masyarakat panik. Banyak dana yang dilarikan ke luar
negeri. Ada yang kemudian kembali lagi secara perlahan, ada juga
yang disimpan di bawah bantal dan lemari besi. Dengan rehabilitasi
dan restrukturisasi ekonomi, kami berharap modal dari luar negeri
, investasi dari luar negeri bisa kita tarik kembali. (SBY, saat acara
silaturahmi dengan sejumlah tokoh masyarakat Sulawesi Selatan di
Ballroom Hotel Sahid Jaya Makassar, Makassar, Rabu 2 Juni 2004).
Pertumbuhan Berkualitas
Kita butuh pertumbuhan yang lebih tinggi dan lebih adil.
Dengan sumber-sumber pertumbuhan yang lebih berkualitas,lima
tahun ke depan pertumbuhan ekonomi rata-rata per tahun diharapkan
sebesar 6,6 persen, dengan tingkat pertumbuhan sekitar 5,5 persen
pada tahun 2005 dan sekitar 7,6 persen per tahun pada tahun 2009-
kita bisa menciptakan kesempatan kerja baru. Dalam periode ini,
kita akan mampu menurunkan tingkat pengangguran dari 10,1
persen menjadi 5,1 persen pada tahun 2009. Pendapatan masyarakat
yang ditandai oleh pendapatan per kapita akan meningkat dari 968
dollar AS pada tahun 2003 menjadi 1731 dollar AS pada tahun 2009.
Tingkat kemiskinan dalam periode lima tahun ke depan diharapkan
turun dari 17,4 persen pada tahun 2003 menjadi 8,2 persen pada
tahun 2009. Dan, dengan tingkat pertumbuhan yang ditetapkan
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
26
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
tersebut berbagai indikator kualitas hidup manusia Indonesia juga
akan meningkat. (SBY, pidato politik pada pembukaan masa kampanye
putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-
2009, Jakarta, Selasa 1 Juni 2004).
Ekonomi yang Kuat
Saya akan menciptakan ekonomi bangsa yang kuat dan
adil bagi seluruh rakyat Indonesia. Dulu, ekonomi Indonesia kuat.
Namun tak adil. Yang menikmatinya hanya orang Jakarta saja. Hal
itu tak boleh terjadi lagi. Ekonomi bangsa haruslah kuat namun juga
harus bisa memberikan kesejahteraan dan kemakmuran bagi rakyat
semua. (JK, saat berdialog dengan Kosgoro-Pengurus Daerah Kabutan
Brebes, Brebes, Senin 9 Agustus 2004).
Kebijakan Fiskal
Kita menghadapi masalah pengangguran dan kemiskinan
yang tidak ringan sifatnya. Hal ini yang harus menjadi perhatian
utama kita lima tahun ke depan. Pertumbuhan ekonomi kita saat
ini masih belum memungkinkan untuk menekan kedua persoalan
penting ini. Oleh karena itu, saya akan arahkan kebijakan fskal kita
untuk bisa memberikan stimulus bagi berkembangnya perekonomian
kita. Stimulasi yang saya pandang efektif adalah stimulasi yang
bersifat kick start untuk mendorong bergulirnya sektor riil. Simulasi
ini akan dilakukan melalui, yang pertama, pembangunan infrastruktur
pertanian, agroindustri, dan ekonomi pedesaan lainnya. Dan, yang
kedua, pembangunan infrastruktur penunjang, meliputi jalan,
jembatan, pelabuhan, pasar, energi, listrik, dan air. Pengembangan
infrastruktur penunjang ini akan memberikan lapangan kerja baru
dan sekaligus mendukung percepatan pengembangan sektor riil.
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 27
(SBY, pidato politik pada penutupan masa kampanye putaran pertama
Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Kamis
1 Juli 2004).
Dua Kali Lipat
Untuk menanggulangi kemiskinan dan memperbaiki sosial
ekonomi rakyat, saya akan mengurangi tingkat pengangguran dari
10,1 persen tahun ini menjadi 5,1 persen, menurunkan angka
kemiskinan dari 17,4 persen menjadi 8,2 persen. Agar tercapai
kesejahteraan sosial, saya menargetkan peningkatan pendapatan per
kapita hingga dua kali lipat dari 968 dollar AS menjadi 1.731 dollar
AS. (SBY, dalam acara dialog ekonomi dengan anggota Kadin bertajuk
“Indonesia Menuju Era Baru” di Balai Sidang Senayan, Jakarta, Senin
2 Agustus 2004).
Sektor Riil
Pembangunan sektor riil sungguh sangat saya beri penekanan.
Berkembangnya sektor riil inilah yang dibutuhkan masyarakat. Baik
untuk meningkatkan daya beli maupun untuk menciptakan lapangan
kerja dan menurunkan kemiskinan. Di samping itu, sektor riil inilah
yang merupakan jembatan yang mengaitkan antara ekonomi makro
dan ekonomi mikro yang selama ini seperti tidak nyambung.
Untuk secara efektif mengembangkan sektor riil ini, saya
mencanangkan tiga langkah penting, yaitu : pengembangan investasi,
peningkatan intermediasi perbankan, serta pengembangan lembaga
keuangan mikro serta lembaga keuangan pertanian dan perdesaan.
(SBY, pidato politik pada penutupan masa kampanye putaran pertama
Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Kamis
1 Juli 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
28
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Penjualan Aset
Saya berpendapat, melakukan penjualan aset negara sebagai
solusi mengatasi krisis bukanlah langkah yang bijak. Menjual aset
saat harganya sedang jatuh dan dengan harga murah, bukanlah proses
yang benar. Ada manipulasi, ada kongkalikong sehingga rakyat dan
bangsa mengalami kerugian dalam jumlah yang sangat banyak. Bangsa
Indonesia mempunyai hutang banyak, devisitnya jumlahnya besar
sekali, lalu fskal yang ada sangat berat. Penjualan aset, privatisasi,
BLBI, dan sebagainya pada saat itu mestinya dihentikan dulu sambil
kita melakukan review. (SBY, saat acara “Talk Show Calon Presiden
RI 2004” di Kampus Universitas Hasanuddin, Makassar, Rabu 2 Juni
2004).
Mengangkat Pertumbuhan Ekonomi
Saya optimis untuk mengangkat pertumbuhan ekonomi
kita menjadi lebih baik. Jika pada tahun 2003 pertumbuhan
ekonomi kita berkisar 4,1 persen, saya optimis untuk
meningkatkannya hingga 7,6 persen dengan pertumbuhan rata-
rata 6,6 persen setiap tahun. (SBY, dalam acara dialog ekonomi
dengan anggota Kadin bertajuk “Indonesia Menuju Era Baru” di
Balai Sidang Senayan, Jakarta, Senin 2 Agustus 2004).
Keyakinan Investor
Stabilitas makro dan moneter merupakan syarat keharusan
untuk pembangunan ekonomi Indonesia. Stabilitas makro
memberikan harapan tumbuh dan berkembangnya ekonomi;
sehingga, dapat mendorong perbaikan kinerja sektor riil. Bersama
dengan perbaikan iklim usaha, kondisi makro yang stabil akan
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 29
meningkatkan minat dan keyakinan investor untuk menanamkan
modalnya. Stabilitas makro akan membuat para pelaku usaha dapat
merencanakan investasi dan kegiatan usahanya dengan tingkat
kepastian yang memadai. Ke depan, kita butuh kerjasama yang baik
antara otoritas moneter dan otoritas fskal sehingga stabilitas makro
dapat dikelola secara baik. (SBY, pidato politik pada penutupan masa
kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI
2004-2009, Jakarta, Kamis 1 Juli 2004).
Pergerakan Ekonomi
Untuk membangun kembali ekonomi kita pasca krisis,
diperlukan stimulus fskal untuk mempercepat pergerakan ekonomi.
Stimulus fskal harus memenuhi empat syarat bagi terciptanya
prakondisi bagi pergerakan sektor riil yang telah saya sebut di atas,
serta untuk pembangunan dan pemeliharaan infrastruktur sosial
dan ekonomi. Hal ini akan membuat pertumbuhan ekonomi kita
meningkat secara bertahap. Semakin cepat pemenuhan hak dasar
rakyat serta semakin cepatnya pembangunan infrastruktur, semakin
cepat sektor riil bergulir; dan, pada akhir tahun 2009 diharapkan
pertumbuhan ekonomi bisa mencapai 7,6 persen dengan rata-rata
tahunan sebesar 6,6 persen selama lima tahun ke depan. Tentu, kita
akan memulainya dengan tingkat pertumbuhan yang belum terlalu
tinggi, yaitu sebesar 5,5 persen pada tahun 2005. (SBY, pidato politik
pada penutupan masa kampanye putaran pertama Pemilihan Presiden
dan Wakil Presiden RI 2004-2009, Jakarta, Kamis 1 Juli 2004).
Pertumbuhan Berkualitas
Untuk mewujudkan masyarakat Indonesia yang lebih
sejahtera tentu ekonomi kita harus tumbuh. Tetapi pertumbuhan
yang kita tuju adalah pertumbuhan yang berkualitas, terdistribusikan
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
30
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
secara adil, dan berkelanjutan. Meski ekonomi kita harus tumbuh,
tetapi pertumbuhan hendaklah kita pandang hanya sebagai wahana.
Tujuannya adalah meningkatkan kesejahteraan rakyat. Meningkatkan
kemakmuran bersama. (SBY, pidato politik pada pembukaan masa
kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI
2004-2009, Jakarta, Selasa 1 Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 3l
Kebijakan
dan Pembangunan
Daerah
Masalah Aceh Prioritas Utama
S
aya akan mencari solusi terbaik -- dengan cara damai
dan bermartabat -- dalam menyelesaikan kasus Aceh.
Penyelesaian masalah Aceh akan menjadi prioritas utama
saya. Bukan hanya masalah keamanan, tapi juga masalah harkat-
martabat, pendidikan, dan keadilan bagi mereka. Saya akan berusaha
memulihkan kembali perekonomian di Aceh yang sempat terhenti.
Menjadi tugas kita semua -- pemimpin agama, pemimpin masyarakat,
pemimpin negeri -- untuk mewujudkan hal itu secara bersama-sama.
(SBY, di depan masyarakat Aceh dalam acara perayaan Isra Mi’raj Nabi
Muhammad SAW di halaman Masjid Bujang Salim Krueng Geukueh,
Lhokseumawe, Aceh Utara, Sabtu 4 September 2004).
CATATAN: SBY adalah salah satu pejabat yang sangat
perduli dengan masalah Aceh. Saat
menjabat sebagai Menkopolkam, SBY
pernah ke Banda Aceh (13 Januari 2003).
Ia datang bersama beberapa duta besar:
Yutaka Iimura ( Jepang), Ralph L Boyce
(AS), Francesco Maria Greco (Italia).
Kepala Perwakilan Bank Dunia di Indonesia
Andrew Steer dan Rini MS Soewandi
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
32
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
(Menteri Perindustrian dan Perdagangan
waktu itu) juga ikut dalam rombongan.
Mereka datang untuk melihat kondisi
Aceh serta mempelajari dan merancang
pemulihan Aceh pasca konfik. Dalam
kesempatan tersebut, SBY menyerukan
agar mesin perdamaian tak boleh
berhenti di Aceh. Ia juga mengingatkan
pentingnya menjalankan lima agenda
yang telah ada. Yakni, pemeliharaan dan
penguatan perdamaian, aksi kemanusiaan
dan rehabilitasi sosial, pelaksanaan proses
politik yang demokratis, rekonstruksi
ekonomi, rekonsiliasi, dan society building.
Amnesti untuk GAM
Saya akan memberikan amnesti kepada anggota GAM
yang betul-betul secara sukarela kembali ke NKRI. Penyelesaian
masalah Aceh harus dilakukan secara komprensif dengan segala
daya dan upaya yang dimiliki. Pemerintah daerah juga bisa ikut
berperan. (SBY, dalam pertemuan dengan Dewan Perwakilan Daerah
se-Sumatera di Hotel Regent Jakarta, Rabu 15 September 2004).
Kalah Populer
Saya sangat setuju jika di Yogyakarta ada pusat layanan
informasi seni dan budaya. Obyek wisata dan seni budaya di
Indonesia, khususnya di Yogyakarta tak kalah menariknya dibanding
tempat lain. Sangat disayangkan, banyak obyek wisata serta seni
dan budaya di Indonesia kalah populer di mancanegara. Hal ini
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 33
dikarenakan kurangnya informasi serta publikasi yang ditujukan
untuk masyarakat internasional secara luas. Jika itu dilakukan, kita
bisa bersaing di dunia internasional. (SBY, di hadapan sejumlah
seniman dan budayawan, Yogyakarta, Senin 21 Juni 2004).
Masalah Pengungsi
Banyak masalah pengungsi di sejumlah daerah di Indonesia
yang belum terselesaikan hingga kini. Contohnya di NTT dan Aceh.
Namun, saya sudah mengagendakannya sebagai prioritas untuk
diselesaikan. (SBY, dalam kampanye dialogis yang dihadiri sejumlah
perwakilan Badan Eksekutif Mahasiswa se-Propinsi Nanggroe Aceh
Darussalam, Banda Aceh, Jumat 18 Juni 2004).
Wilayah Timur
Di bidang pendidikan, wilayah Timur termasuk Kalimantan,
akan menjadi salah satu prioritas saya. Saya akan berusaha agar
pendidikan bisa lebih murah, mutu pendidikan dan penyelenggaraan
pendidikan di sini bisa lebih baik. (JK, dalam dialog dengan masyarakat
adat di Lembaga Musyawarah Dayak Daerah Kalimantan Tengah,
Jumat 11 Juni 2004).
Kondisi Pendidikan di Aceh
Saya prihatin dengan kondisi pendidikan di Aceh yang
menurun akibat konfik. Oleh karena itu, untuk mengembalikan
pendidikan agar setara dengan propinsi-propinsi lain di Indonesia,
diperlukan kerja ekstra semua pihak. (SBY, dalam kampanye dialogis
yang dihadiri sejumlah perwakilan Badan Eksekutif Mahasiswa se-
Propinsi Nanggroe Aceh Darussalam, Banda Aceh, Jumat 18 Juni
2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
34
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Agar Papua Makmur
Agar rakyat Papua bisa hidup lebih makmur, ekonomi rakyat
harus tumbuh dan berkembang dengan baik. Agar ekonomi tumbuh
baik, harus ada modal yang ditanam di Papua: modal dari daerah
lain, dari dalam negeri maupun dari luar negeri. Tapi investor baru
akan ke Papua jika Papua aman, damai, dan bebas dari korupsi. Oleh
karena itu, rakyat Papua harus mau bekerja keras untuk membangun
daerahnya. (SBY, dalam kampanye di lapangan Trikora, Abepura,
Jayapura, Jumat 4 Juni 2004).
Prioritas Untuk NTT
Kami akan memprioritaskan pembangunan sektor
pendidikan dan infrastruktur di Propinsi NTT. Dibanding kawasan
barat Indonesia, NTT dan KTI kondisi sektor pendidikannya sangat
merosot. Oleh sebab itu, khusus untuk KTI, ketersediaan anggaran
dan SDM pendidikan perlu diupayakan agar memadai, sehingga tidak
lagi selalu berada di urutan belakang dalam sektor pembangunan.
(JK, seusai acara dialog dengan tokoh-tokoh masyarakat, tokoh agama,
dan pemuda di Hotel Sasando, Kupang, Senin 6 September 2004).
Kondisi Pariwisata Bali
Saya akan memulihkan kembali kondisi pariwisata Bali.
Perekonomian dan kesejahteraan rakyat akan membaik jika pariwisata
bisa dibangkitkan dari keadaan terpuruk akibat berbagai tragedi
yang berhubungan dengan keamanan dan ketertiban. Guna meniju
Indonesia yang lebih aman, adil, dan sejahtera, dunia pariwisata
harus lebih terkendali dan maju. Usaha rakyat berupa kerajinan
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 35
dan usaha-usaha rakyat kecil lainnya harus ditumbuhkan kembali.
Wisatawan domestik dan mancanegara harus kembali berkunjung
ke Bali. Bali telah menjadi salah satu tujuan wisata dunia. Keragaman
dan keunikan budayanya, keramahan masyarakatnya, keindahan
alamnya, membuat Bali berbeda di banding tempat wisata lainnya.
Dan itu semua harus kita jaga. (SBY, saat menggelar kampanye terbuka
di Lapangan Kapten Japa, Padanggalak, Denpasar, Bali, Kamis 24 Juni
2004).
CATATAN: Selama ini, sektor pariwisatalah yang menjadi
unggulan perputaran ekonomi masyarakat
Bali. Sudah lebih 20 tahun perekonomian Bali
sangat bergantung dari industri pariwisata.
Tapi sejak tragedi bom Bali (12 Oktober
2002) perekonomian Bali menjadi terpuruk.
Banyak wisatawan, baik lokal maupun asing,
yang menjadi enggan berkunjung ke Bali.
Keadaan ini lebih diperparah lagi dengan
isu SARS (Severe Acute Respiratory Syndrome
-- sindrom pernapasan akut parah) pada
bulan April 2003. Belum lagi dampak yang
diakibatkan oleh berbagai tragedi kekerasan
serta pemboman di berbagai tempat di
Indonesia.
Membangun Bali
Saya akan memperbaiki perekonomian masyarakat Bali.
Untuk itu, jaminan keamanan akan menjadi poin penting. Tindakan
kekerasan dan terorisme tidak akan terjadi lagi. Begitupun halnya
dengan narkoba, tidak ada lagi. Tapi, semua usaha takkan ada artinya
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
36
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
tanpa didukung oleh semangat kebersamaan dari semua unsur dan
komponen masyarakat. Saya mengajak semua pihak : pemerintah
propinsi, tokoh masyarakat, pemuda, dan masyarakat dari berbagai
elemen untuk sama-sama menjaga dan memelihara Pulau Bali.
Memelihara Bali berarti memelihara kesejahteraan bangsa Indonesia.
Jika Bali berkembang, niscaya kesejahteraan rakyat Indonesia
juga akan ikut membaik. (SBY, saat menggelar kampanye terbuka di
Lapangan Kapten Japa, Padanggalak, Denpasar, Kamis 24 Juni 2004).
Konfik Maluku
Saya akan mengutamakan penyelesaian konfik Maluku.
Terutama dalam bidang keamanan. Dulu, kami (ia dan Jusuf Kalla)
telah melakukan langkah panjang secara bersama-sama. Tapi tidak
berlanjut atau terganggu oleh keadaan. Kami berdua bertekad, proses
penyelesaian Maluku akan menjadi prioritas di bidang keamanan.
(SBY, kepada wartawan dalam rangkaian acara kampanye di Ambon,
Maluku, Sabtu 5 Juni 2004).
Papua yang Lebih Baik
Saya akan meningkatkan perekonomian Papua. Jangan
sampai saudara-saudara saya di Papua hidup miskin. Saya akan
menghantarkan rakyat Papua pada kehidupan yang lebih baik,
kesehatan terjamin serta bisa sekolah dengan baik. Bila anak-anak
bisa didik dengan baik dan sehat, ke depannya akan menjadi lebih
baik. Akan membawa perbaikan pada Papua. (SBY, dalam kampanye
di lapangan Trikora, Abepura, Jayapura, Jumat 4 Juni 2004).
Papua dan Otonomi Khusus
Saya ingin sekali memajukan Papua. Negara kita sudah
menetapkan Papua sebagai daerah otonomi khusus. Negara memberi
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 37
perhatian dengan memberikan ruang yang luas agar Papua bisa
mengatur dirinya sendiri. Dibanding daerah lain, Papua diberikan
anggaran yang lebih besar. Papua memiliki sumber daya alam yang
melimpah. Adalah wajib jika rakyat Papua menikmati hasilnya.
Mari kita jalankan dengan benar otonomi khusus itu. Untuk itu,
semua pihak, baik pemerintah propinsi, kota, kabupaten maupun
masyarakatnya, harus bersikap jujur dan mau bersama-sama bekerja
keras untuk memakmurkan Papua. (SBY, dalam kampanye di lapangan
Trikora, Abepura, Jayapura, Jumat 4 Juni 2004).
Aceh Bukan Hanya GAM
Persoalan Aceh bukan hanya persoalan GAM. Persoalan
Aceh juga menyangkut masalah kesejahteraan masyarakat. Oleh sebab
itu, adanya pembagian bagi hasil sumberdaya alam dengan NAD
bisa digunakan meningkatkan kesejahteraan masyarakat. Langkah-
langkah penyelesaian bisa dilakukan dengan: pertama, meneruskan
pendekatan komprehensif. Kedua, melakukan usaha-usaha untuk
meningkatkan kesejahteraan masyarakat. Ketiga, menyerukan
menyerugan agar GAM kembali untuk tidak memerangi saudaranya
sendiri. Saya masih optimis masalah Aceh dapat diselesaikan secara
baik dalam kerangka NKRI. Saya akan terus menyelesaikan masalah
NAD sedamai mungkin. (SBY, dalam pertemuan dengan Dewan
Perwakilan Daerah se-Sumatera di Hotel Regent Jakarta, Rabu 15
September 2004).
Masa Depan Pengungsi
Saya akan memperbaiki masa depan eks-pengungsi
Timor Timur di wilayah Timor Barat NTT. Mereka adalah rakyat
Indonesia juga. Mereka juga harus mendapat sentuhan kehidupan
yang layak seperti juga rakyat Indonesia lainnya. Saya bertekad
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
38
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
untuk melaksanakan ini. (SBY, dalam kampanye terbuka di GOR
Oepoi Kupang, Jumat 25 Juni 2004).
CATATAN: Setelah jajak pendapat pada bulan Agustus
1999, banyak eks-pengungsi yang memilih
menjadi WNI bermukim di Kabupaten Belu
NTT, wilayah yang berbatasan langsung
dengan negara Timor Leste. Berbagai laporan
pandangan mata dari para pemberi bantuan
kemanusiaan menggambarkan kondisi hidup
mereka yang tidak layak dengan tingkat
kesehatan yang mengkhawatirkan.
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 39
Penegakkan
Hukum
Keppres dan Borgol
K
epada Jaksa Agung, saya akan memberikan Keppres
(Keputusan Presiden) dan borgol. Sebagai pejabat, ia perlu
diberi keputusan presiden. Tapi, ia juga perlu dibekali
borgol agar tetap konsisten terhadap penegakan hukum serta tidak
melakukan jual-beli perkara serta berbagai aksi korupsi lainnya.
Setelah masa jabatannya habis lima tahun kemudian, borgol itu harus
dikembalikan. Jangan sampai borgol itu dipakai sendiri sebelum
masa jabatannya berakhir. (SBY, dalam acara dialog “Visi dan Strategi
Kebudayaan Calon Presiden 2004” di Graha Bhakti Budaya, Taman
Ismail Marzuki, Jakarta, Senin 14 Juni 2004).
CATATAN: Posisi Jaksa Agung diyakini oleh banyak
kalangan merupakan posisi kunci dan
merupakan indikator utama arah politik
penegak hukum suatu pemerintahan. Dalam
pemerintahan sebelumnya, posisi ini sering
dijabat oleh orang yang terpilih berdasarkan
hasil kompromi, bukan karena kredibilitas
dan loyalitasnya terhadap kebenaran.
Sampai saat ini, disebut-sebut hanya ada dua
mantan Jaksa Agung yang bisa dijadikan
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
40
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
teladan. Yakni, Soeprapto ( Jaksa Agung
masa pemerintahan Presiden Soekarno)
dan Baharuddin Lopa ( Jaksa Agung masa
pemerintahan Presiden Abdurrahman
Wahid).
Berdasarkan Perilaku
Setiap orang punya kewajiban mencintai bangsanya.
Siapapun yang merusak bangsa ini, siapapun yang membawa lari
uang bangsa ini, siapapun orangnya, namanya, agamanya, ia harus
ditindak. Kita tidak mengenal diskriminasi dalam pengertian
asal-usul, agama, tetapi berdasarkan perilaku. (JK, dalam acara
“Dialog Penajaman Visi, Misi, dan Program Capres-Cawapres” yang
diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton, Jakarta,
Kamis 16 September 2004).
Aspek Keadilan
Saya akan memperkuat upaya-upaya pemberantasan korupsi,
kolusi, nepotisme, dan kroniisme. Untuk itu, saya memandang penting
perbaikan di aspek keadilan. Itu akan memudahkan tercapainya
kesejahteraan dan kedamaian. Saya memiliki sejumlah rencana
program guna meningkatkan penegakan hukum serta ketertiban di
masa mendatang. Antara lain, meningkatkan profesionalisme dan
kualitas sistem peradilan, menyederhanakan sistem serta memastikan
bahwa hukum benar-benar diterapkan dengan adill dan memihak
pada kebenaran, menghormati serta memperkuat kearifan dan
hukum adat yang bersifat lokal. (SBY, saat berkampanye di lapangan
Sario, Manado, Jumat 11 Juni 2004).
Tanpa Pandang Bulu
Jika ingin maju, negara membutuhkan keadaan tertib
dengan menjalankan hukum yang baik. Siapapun yang bersalah harus
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 4l
diperiksa kesalahannya. Selanjutnya, pengadilan akan memutuskan
salah dan benarnya tanpa pandang bulu. (JK, di hadapan sejumlah
santri Pondok Pesantren Modern As Salam Sukoharjo, Solo, Sabtu 21
Agustus 2004).
Sama di Hadapan Hukum
Kami akan kembali memeriksa Soeharto. Tentu saja setelah
ia sehat. Sebab, orang yang sakit tidak bisa dibawa ke pengadilan. Jika
ia sudah sehat, akan diperiksa lagi agar mendapatkan keadilan yang
seadil-adilnya. Siapapun orangnya, hukum harus tetap ditegakkan.
Semua orang sama di hadapan hukum. (JK, di hadapan sejumlah
santri Pondok Pesantren Modern As Salam Sukoharjo, Solo, Sabtu 21
Agustus 2004).
Makin Kredibel dan Bersih
Kami akan meningkatkan budaya hukum, pendidikan politik
dan penciptaan sistem pengadilan yang makin kredibel dan makin
bersih, meningkatkan kualitas dan profesionalitas para penegak
hukum. Law enforcement akan diprioritaskan pada pemberantasan
korupsi juga memberantas penyelundupan, pemberantasan
narkoba dan kejahatan jalanan. (SBY-JK, pemaparan dalam acara
“Dialog Penajaman Visi, Misi, dan Program Capres-Cawapres” yang
diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton, Jakarta,
Selasa 14 September 2004).
Ujung Tombak
Jaksa Agung adalah ujung tombak dalam penegakan hukum.
Jadi, kalau kita ingin menegakan hukum, kita harus memiliki Jaksa
Agung yang jujur dan tegas dalam bertindak. Saya akan memberikan
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
42
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
kekuasaan penuh kepadanya untuk melaksanakan kewenangannya.
Namun konsekwensinya, jika ia tak dapat melaksanakan tugasnya
dengan baik, ia akan diberi hukuman. (JK, kepada wartawan,
Bengkulu, Minggu 30 Mei 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 43
Seputar
Kepemimpinan
Bekerja Keras
B
angsa Indonesia harus bangkit kembali demi masa depan
yang terhormat. Untuk itu diperlukan pemimpin yang
jujur, berkemampuan dan dekat dengan rakyat. Dan yang
tak kalah penting, pemimpin harus mau bekerja keras. Ia harus
didukung pemerintahan yang bersih, terbuka serta tanggap terhadap
berbagai permasalahan. Kita harus kompak dan mengutamakan
kebersamaan. (SBY, dalam kampanye di lapangan Deggung, Sleman,
Yogyakarta, Senin 21 Juni 2004).
Lebih Efektif
Kita memerlukan perubahan, yakni dengan menciptakan
pemerintahan dan kepemimpinan yang lebih efektif dengan program
konkrit dan prioritas yang jelas. Tidak ada penyelesaian instan karena
masalahnya sangat kompleks dan saling kait-mengkait: isu-isu di
bidang politik, hukum, keamanan, dan otonomi daerah. Namun,
satu persatu masalah itu, dengan pemim;pin yang akan bekerja
bersama rakyat, bisa kita atasi bila ada perubahan. (SBY, dalam acara
“Dialog Penajaman Visi, Misi, dan Program Capres-Cawapres” yang
diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton, Jakarta,
Selasa 14 September 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
44
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Mencontoh Rasul
Marilah kita mencontoh Rasul dan mengaplikasikannya
dalam kehidupan berbangsa dan bernegara. Indonesia butuh
pemimpin yang meneladani Rasul. Pemimpin yang patut diteladani
dan memikirkan rakyatnya. Saat mengenang Rasul, ada dua dimensi
yang mesti kita pelajari dan teladani. Yakni, dimensi kepribadian
dan kepemimpinan. Dari dimensi kepribadian, Rasul memiliki
akhlak yang mulia, sabar dan senantiasa santun dalam bicara.
Dari dimensi kepemimpinan, Rasul adalah sosok yang jujur, dapat
dipercaya, cerdas, dan bijak dalam berkomunikasi.dengan umatnya.
(SBY, dalam acara Maulid Nabi Muhammad SAW di Masjid Arriyah
Kwitang, Jakarta, Kamis 20 Mei 2004)
Hilang Kebesaran
Bangsa Indonesia adalah bangsa yang besar. Oleh sebab
itu, bangsa Indonesia haruslah dipimpin oleh orang yang benar.
Jika salah memilih pemimpin, maka bangsa yang besar ini akan
hilang kebesarannya. Sebagai bangsa yang besar, kita harus
menghargai dan menjunjung tinggi hukum sehingga keamanan
dan keadilan dapat ditegakkan di bumi Indonesia. Insya Allah
pada masa mendatang kita bisa sejajar dengan negara-negara
maju di dunia. (JK, saat berkampanye di lapangan Karebosi,
Makassar, Rabu 2 Juni 2004).
Memperbaiki Kehidupan
Berbekal pengalaman selama berada di Jakarta dan menjadi
menteri, saya yakin bisa menjadi wakil presiden. Bahkan, bisa berbuat
lebih baik dari yang pernah dilakukan wakil presiden lain. Dengan
menjadi wapres, saya ingin memperbaiki kehidupan bangsa dan
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 45
kesejahteraan rakyat, serta meningkatkan kehidupan keagamaan.
Mohon doa restu agar saya bisa memperbaiki kehidupan bangsa
dan bisa mengangkat harkat dan martabat orang Bugis. (JK, saat
berkunjung di ruamah Pimpinan tertinggi tarekat Halwatiah Samman,
Pattene Maros, H A Abdullah Puang Ralla, Pattene, Minggu 9 Mei
2004)
Harus Bersatu
Pemimpin harus bersatu dengan rakyat, suka mendengar
suara rakyat, serta peduli terhadap persoalan yang terjadi di tengah
rakyat. Jika pemimpin peduli dan bersatu dengan rakyat, maka
persoalan seberat apapun bisa dicarikan jalan keluar bersama.
Pemimpin yang baik, selain peduli dan bersatu dengan rakyat, dia
juga harus jujur, terbuka, dan aspiratif. (SBY, di hadapan pendukung
dan simpatisannya di lapangan Simpang Lima, Semarang, Selasa 29
Juni 2004).
Babak Baru
Mengawali babak baru, saya ingin suasana yang baik. Sebuah
awal yang dimulai dengan kerja keras akan membawa hasil yang baik.
Saya tak ingin masyarakat terkotak-kotak menurut partai atau calon
presiden pilihannya. Setelah dilantik, saya bukan lagi presiden bagi
konstituen saya, melainkan presiden bagi seluruh bangsa Indonesia.
(SBY, dalam acara open house di kediamannya, Puri Cikeas, Gunung
Putri, Bogor, Senin 27 September 2004).
Sesuai Aspirasi
Saudaraku sebangsa dan se-tanah air, perubahan kini berada
di tangan rakyat. Dengan memilih SBY-JK, Anda telah membuat
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
46
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
perubahan besar. Insya Allah, apabila kami dipercaya rakyat,
kami tidak akan menyia-nyiakan kesempatan untuk melakukan
perubahan yang sesuai dengan aspirasi rakyat. Saudaraku, berilah
kami kesempatan untuk mewujudkan Indonesia yang lebih baik
dengan memilih kami. (SBY-JK, dalam iklan berjudul “Berilah kami
kesempatan untuk Memimpin Negeri Ini” yang dimuat di berbagai
media cetak terbitan Jakarta dan daerah menjelang pemilihan 20
September 2004).
Setiap Insan
Saya bertekad bukan saja untuk menjadi Presiden Republik
Indonesia, namun juga menjadi presiden seluruh rakyat Indonesia.
Saya akan terus menjaga kontrak politik yang mulia dengan rakyat.
Pikiran, tenaga, dan waktu yang saya miliki akan saya dedikasikan
untuk memajukan dan melindungi setiap insan Indonesia. (SBY,
saat menyampaikan pidato politik pertamanya sebagai presiden Republik
Indonesia ke-6 di Istana Merdeka, Jakarta, Rabu 20 Oktober 2004).
Merasa Terhormat
Saya dan Pak Jusuf Kalla merasa terhormat diberi
kepercayaan menjadi calon presiden dan wakil presiden yang akan
dipilih rakyat secara langsung. Ini, tentu, mengemban kewajiban.
Kewajiban untuk menjalankan amanah rakyat. Rakyat memerlukan
pemimpin yang bersih, yang sejuk, yang dapat diandalkan, yang
sejalan kata-kata dan perbuatannya. Pemimpin yang melakukan apa
yang dijanjikan. Pemimpin yang mampu berkata dan bertindak yang
benar, apa pun risikonya. (SBY, pidato politik pada pembukaan masa
kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI
2004-2009, Jakarta, Selasa 1 Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 47
Menjalankan Amanah
Saya selaku presiden RI, dan saudara Muhammad Jusuf
Kalla selaku wakil presiden, telah mengucapkan sumpah di hadapan
Majelis Permusyawaratan Rakyat, dengan menyebut Asma Allah.
Dengan sumpah itu kami berjanji, akan menjalankan amanah yang
diberikan oleh rakyat dengan sebaik-baiknya, selurus-lurusnya dan
seadil-adilnya. Karena itu, saya selalu bermohon ke hadirat Allah
SWT, semoga Dia senantiasa menunjuki saya ke jalan yang lurus. Saya
pun memohon dukungan segenap rakyat, sepanjang saya berada di
jalan yang benar. Sebaliknya, saya pun memohon kritik, teguran, dan
saran yang konstruktif, kalau-kalau saya melakukan kekeliruan dan
kealpaan. Saya hanyalah hamba Allah yang dhaif, yang tidak terlepas
dari kekurangan dan kesalahan. (SBY, dalam pidato peringatan Nuzul
Al Quran tahun 1425 Hijriah di Masjid Istiqlal, Jakarta, Sabtu 30
Oktober 2004).
Dari Diri Sendiri
Semua pemimpin harus memperlihatkan keteladanan di
hadapan rakyat. Keteladanan harus dimulai dari diri sendiri. Agama
menduduki posisi penting untuk tak sekedar dijadikan simbol, tapi
juga dipraktekkan. Apa yang dikatakan, itulah yang mesti dilakukan.
Jangan sampai terjadi keretakan antara kata dan tingkah laku (SBY,
dalam acara “Dialog Penajaman Visi, Misi, dan Program Capres-
Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel
Hilton, Jakarta, Kamis 16 September 2004).
Efsien dan Terbuka
Untuk melakukan perubahan, diperlukan pemimpin
yang baik, jujur, dan transparan. Diperlukan pemerintahan yang
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
48
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
efsien dan terbuka. Diperlukan pemimpin yang aspiratif, dekat
dengan masyarakat, bertanggung jawab, serta mau bekerja keras.
Pemimpin harus terlibat langsung bersama-sama masyarakat untuk
menyelesaikan berbagai persoalan. Pemimpin tidak boleh setengah
hati menyelesaikan persoalan.. (SBY, saat berkampanye di lapangan
Sario, Manado, Jumat 11 Juni 2004).
Pemimpin Gagal
Masalah di Indonesia adalah masalah korupsi. Jika gagal
memerangi korupsi, maka akan gagal pula pemimpinnya, siapapun
yang menjadi pemimpin. Dan saya tidak mau dianggap gagal. Saya
tidak akan berani mencalonkan diri sebagai wakil presiden jika saya
tidak berani memberantas KKN. (JK, di hadapan sejumlah santri
Pondok Pesantren Modern As Salam Sukoharjo, Solo, Sabtu 21 Agustus
2004).
Bukan Kesalahan Masa Lalu
Kita harus menempatkan masa lalu, masa kini, dan masa
depan secara adil. Belum tercapainya tujuan nasional Indonesia
hingga kini bukanlah diakibatkan kesalahan pemimpin di masa lalu.
Kita tak boleh begitu saja menyalahkan pendahulu kita. Mereka telah
berusaha keras untuk mewujudkan tujuan nasional dengan segala
kelebihan dan kekurangannya. Diperlukan perjuangan yang terus
menerus dan berkelanjutan. (SBY, dalam acara renungan proklamasi
di Monumen Proklamasi, Jakarta, Rabu 18 Agustus 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 49
Masalah
Ketenagakerjaan
Standar Upah
U
paya meningkatkan taraf hidup kaum pekerja terutama
upaya meningkatkan standar upah di Indonesia akan saya
jadikan prioritas utama.saya. Saya akan memilih menteri
tenaga kerja yang mau bekerja kerasa dan mau melindungi kaum
pekerja. (SBY, saat melakukan dialog dengan kalangan pekerja di
kawasan industri Balaraja, Tangerang, Banten, 10 Juni 2004).
Buruh Migran
Saya akan tetap melanjutkan kebijakan yang mengakomodasi
buruh migran hingga saatnya nanti lapangan kerja makin terbuka
untuk mereka. Sepatutnya kita berterimakasih kepada mereka.
Di saat lapangan kerja belum terbuka luas, pengangguran begitu
tinggi, mereka dapat menghidupi keluarganya. Selayaknyalah kita
melindungi mereka. Mulai dari kemanusiaan hingga hak-haknya.
Mereka harus bisa kita persiapkan dengan baik agar berdaya
saing, profesional, dan berpenghasilan tinggi. (SBY, dalam acara
“Dialog Penajaman Visi, Misi, dan Program Capres-Cawapres” yang
diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton, Jakarta,
Kamis 16 September 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
50
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Menyiapkan Pengacara
Masalah tenaga kerja merupakan salah satu hal terpenting
untuk segera diselesaikan. Penempatan dan perlindungan terhadap
mereka harus ditata dengan baik, dengan memperhatikan gaji yang
diberikan dan memberikan perlindungan terhadap mereka di luar
negeri. Dengan menyiapkan pengacara, misalnya. Bukan apa-apa,
mereka juga adalah pahlawan bangsa. Masalah tenaga kerja ilegal
bukan hanya dialami oleh kita, melainkan juga oleh megara-negara
lain yang memiliki pendapatan relatif rendah. Contohnya, Cina,
India, dan Meksiko. (JK, dalam acara dialog dengan Musyawarah
Nasional V Apjati, Bandung, Kamis, 26 Agustus 2004).
Sumberdaya Manusia
Untuk menciptakan kesempatan kerja baru, kita kembangkan
iklim usaha dan investasi yang baik dan kita dorong sektor swasta
menjadi pilar dari dinamika perekonomian. Untuk menanggulangi
kemiskinan, kita terutama akan melakukan investasi yang akan terus
meningkat untuk rakyat kita melalui pendidikan. Pengembangan
sumberdaya manusia menempati prioritas utama sebagaimana halnya
pengembangan infrastruktur yang lebih baik dan kebijakan ekonomi
yang berorientasi pasar (market-friendly policies), tanpa meninggalkan
kepedulian dan bantuan kepada golongan ekonomi lemah, sebagai
perwujudan dari keadilan ekonomi dan keadilan sosial. (SBY,
pidato politik pada pembukaan masa kampanye putaran pertama
Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta,
Selasa 1 Juni 2004).
Mampu Melindungi
Saya akan memperhatikan nasib TKI. Saya berharap negara
dan pemerintah, serta agen-agen pemberangkatan TKI ke luar
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 5l
negeri bisa lebih bertanggung jawab. Semua pihak yang terkait harus
mampu melindungi TKI yang mendapat perlakuan tidak manusiawi
atau ketidakadilan. Hak dasar mereka harus bisa dipenuhi. (SBY,
dalam acara Dialog Terbatas Civitas Akademika Universitas Indonesia,
Jakarta, Kamis 10 Juni 2004).
Usaha Mikro
Untuk mendorong penciptaan lapangan kerja, lebih lanjut,
kita kembangkan terutama usaha mikro, kecil, dan menengah-baik
yang masuk dalam sektor formal maupun sektor informal. Kita
kembangkan kebijakan yang ramah terhadap usaha kecil; karena,
terbukti bahwa selama ini mereka menjadi mesin pemulihan
perekonomian Indonesia. Kita perlu memberikan saluran kredit yang
lebih baik kepada mereka dan mendorong pemerintah daerah untuk
meningkatkan fasilitas pelatihan bagi para pekerja. (SBY, pidato
politik pada pembukaan masa kampanye putaran pertama Pemilihan
Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Selasa 1 Juni
2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
52
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Keamanan
dan Pertahanan
Deteksi Dini
S
aya berkomitmen untuk memerangi terorisme. Untuk itu,
kemampuan deteksi dini harus ditingkatkan. Dalam hal
ini, intelejen tak bisa bekerja sendiri. Diperlukan kerjasama
dengan kepolisian, imigrasi, serta negara sahabat. Kapasitas intelejen
harus ditingkatkan dengan cara: melakukan operasi yang lebih
efektif, meningkatkan kerjasama, memodernisasi peralatan, serta
bekerja selama 24 jam. Juga diperlukan kerjasama masyarakat
sebagai mata dan telinga intelejen. Terorisme adalah ancaman serius
dan tidak mudah terdeteksi dengan sistem apapun dan oleh negara
manapun. Namun, harus ada upaya untuk terus menerus melakukan
operasi yang efektif. (SBY, dalam acara “Dialog Penajaman Visi, Misi,
dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi
Pemilihan Umum di Hotel Hilton, Jakarta, Selasa 14 September 2004).
Pendekatan Keamanan
Meski saya berlatarbelakang militer, saya tidak akan
mengedepankan pendekatan keamanan yang mengurangi hak
sipil dan HAM. Saya pelaku reformasi internal TNI. Selama
berada di pemerintaha, tugas-tugas saya, saya jalankan dengan
undang-undang dan menghormati otoritas sipil. Tak ada satu pun
yang harus didekati dengan keamanan semata. (SBY, dalam acara
“Dialog Penajaman Visi, Misi, dan Program Capres-Cawapres” yang
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 53
diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton, Jakarta,
Selasa 14 September 2004).
Gerakan Separatis
Dalam jangka pendek, kita memberikan perhatian penuh
pada tiga hal berikut. Yang pertama, kita harus mengakhiri gerakan
separatis bersenjata di Aceh dan Papua. Proses ini dilakukan dengan
tetap menjaga hak, martabat, kehormatan, dan rasa keadilan saudara-
saudara kita di kedua propinsi ini. Kita lakukan hal ini dengan
meningkatkan pelaksanaan otonomi khusus secara konsisten. (SBY,
pidato politik pada pembukaan masa kampanye putaran pertama
Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Selasa
1 Juni 2004).
Reformasi Militer
Jangan memandang rendah militer, sebab bagaimanapun
militer adalah bagian penting dari bangsa ini. Latar belakang militer
yang saya miliki justru sangat berguna untuk memberi perspektif
bagaimana menata kekuatan militer ke depan. Dalam tahun-tahun
terakhir karier militer, saya sempat menyusun cetak biru reformasi
militer. Saya yakin, militer bisa lebih demokratis dari sipil. Contohnya,
Presiden Fidel Ramos, ia dari militer tapi bisa lebih demokratis dari
presiden sipil. (SBY, di depan sejumlah duta besar, perwakilan dagang,
dan eksekutif perusahaan asing, di Jakarta, Rabu 9 Juni 2004).
Indonesia yang Aman
Indonesia yang lebih aman dan damai mengharuskan kita
untuk menjaga keutuhan NKRI, mengokohkan integrasi nasional,
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
54
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
dan membangun hubungan internasional dengan mengedepankan
tegaknya kedaulatan negara. Juga, memelihara dan meningkatkan
keamanan dalam negeri. Menghentikan separatisme bersenjata.
Mengakhiri konfik-konfik komunal. Memantapkan keamanan
publik. Memerangi kejahatan, termasuk kejahatan transnasional dan
terorisme. Memperkuat harmoni dan integrasi sosial serta toleransi
kehidupan beragama. (SBY, pidato politik pada pembukaan masa
kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI
2004-2009, Jakarta, Selasa 1 Juni 2004).
Korban Terorisme
Kita adalah korban terorisme. Saya telah menghabiskan
tahun-tahun saya di pemerintahan memerangi terorisme ini.
Menghabiskan waktu-waktu saya untuk menjaga keselamatan
seluruh masyarakat kita. Memang bukan upaya mudah; tetapi, kita
harus terus meningkatkan upaya pemberantasan tindak pidana
terorisme.
Upaya pemberantasan terorisme ini akan kita perkuat
dengan pengembangan kerangka dan perangkat hukum yang
memadai dan secara terus menerus meningkatkan infrastruktur
keamanan kita. Melihat korban terorisme di berbagai wilayah
Indonesia, membuat saya berjanji pada diri sendiri bahwa saya
tidak ingin terjadi lagi tindakan terorisme di negeri ini. Tindakan
terorisme yang menghancurkan kehidupan, menghancurkan nilai-
nilai kemanusiaan, dan meninggalkan luka yang pedih bagi keluarga
korban. Cukup yang telah terjadi. Begitu juga dengan kejahatan
transnasional khususnya narkoba dan perdagangan anak. Cukup.
Kita akan perangi sampai ke akar-akarnya. (SBY, pidato politik pada
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 55
pembukaan masa kampanye putaran pertama Pemilihan Presiden dan
Wakil Presiden RI 2004-2009, Jakarta, Selasa 1 Juni 2004).
Penyebab Utama
Kita harus mengakhiri konfik-konfik komunal yang
terjadi di Maluku, Poso, dan beberapa daerah lainnya. Kita harus
menciptakan harmoni sosial untuk mencegah kerusakan yang
lebih besar di kemudian hari. Kita bangun infrastruktur untuk
mengembalikan masyarakat dalam kehidupan yang normal. Dan,
yang lebih penting kita akan bersama-sama masyarakat di wilayah
ini untuk menemukan dan mengatasi penyebab utama konfik.
(SBY, pidato politik pada pembukaan masa kampanye putaran pertama
Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Selasa
1 Juni 2004).
Berusaha Keras
Saya akan berusaha menyelesaikan masalah-masalah
keamanan seperti yang terjadi di Poso, Papua, dan daerah-daerah lain
di Indonesia. Tidak hanya menyelesaiakn tetapi juga akan berusaha
keras agar hal ini tidak terulang lagi. Hal ini penting untuk stabilitas.
Bila itu tidak dijaga, kita akan kesulitan untuk bangkit. Akibatnya,
terjadilah kemunduran. Untuk keamanan negara, pemimpin bangsa
haruslah besikap adil, jujur, transparan, dan bertanggung jawab. (JK.
Saat berkampanye di halaman parkir GOR Segiri, Samarinda, Sabtu
12 Juni 2004).
TNI dan Bisnis
Saya akan melanjutkan agenda reformasi internal TNI di
bidang bisnis, komando teritorial, dan military impunity (kekebalan
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
56
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
hukum militer, Ed.). Teman-teman di TNI akan senang jika tidak
lagi berbisnis sementara anggaran terpenuhi. Soal komando teritorial,
asalkan tidak tergoda untuk bermain politik. Sementara mengenai
military impunity, akan di dorong ke depan sehingga menyentuh
mereka yang bersalah. (SBY, dalam acara “Dialog Penajaman Visi,
Misi, dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi
Pemilihan Umum di Hotel Hilton, Jakarta, Selasa 14 September 2004).
Iklim Demokrasi
Saya menjamin, pendekatan keamanan dalam pemerintahan
saya tetap akan menjaga iklim demokrasi di Indonesia. Kami tidak
akan bersikap represif. Kita bisa mengatasi terorisme, gangguan
nasional, separatisme, dan sebagainya, tanpa harus represif sepanjang
dikembalikan kepada aturan main. Undang-undang Antiterorisme
adalah contoh yang sangat jelas untuk mencegah adanya
penyalahgunaan kekuasaan. Jangan sampai ada alasan keamanan
tetapi mengancam demokrasi. Mari sama-sama kita kawal demokrasi.
(SBY, dalam acara “Dialog Penajaman Visi, Misi, dan Program Capres-
Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel
Hilton, Jakarta, Selasa 14 September 2004).
Ancaman Nyata
Saya tidak akan memberikan ruang kepada teroris untuk
beraksi lagi di Indonesia. Ingat, teroris itu ancaman nyata. Jangan
pernah berhenti untuk mencegah dan memberantas mereka. Saya
mengutuk aksi-aksi yang tidak bertanggung jawab dan merenggut
korban orang-orang yang tidak berdosa. Bagi saya, mereka harus
dihukum seberat-beratnya dan sekeras-kerasnya. Harus dicari akar
permasalahan sehingga mereka bisa diperangi secara efektif. Ini
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 57
semua menyangkut masalah hukum. Oleh karena itu, kita harus
tegakkan hukum demi menjaga kemanan di negeri kita. Saya
berharap agar kepolisian TNI, intelejen serta semua pihak untuk
meningkatkan langkah-langkah pencegahan yang efektif. (SBY, saat
menjenguk korban Bom Kuningan di Rumah Sakit MMC, Jakarta 9
September 2004).
Sistem Persenjataan
Saya bertekad akan meningkatkan anggaran pertahanan
dan keamanan. TNI dan Polri harus diberi anggaran yang cukup
untuk menyelesaikan konfik-konfik di dalam negeri. Saat ini,
anggaran pertahanan dan keamanan dari APBN sangat kecil. Sistem
persenjataan yang dimiliki TNI dan Polri bisa dikatakan sudah
tertinggal. Kekuatan pertahanan harus terus menerus dibangun
serta dialokasikan anggaran yang cukup untuk jangka menengah
dan panjang. Anggarannya tentunya harus disinkronkan dengan
prioritas-prioritas lainnya, seperti pendidikan, kesehatan, dan
sebagainya. (SBY, di atas pesawat dalam perjalanan Denpasar-Kupang,
Jumat 25 Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
58
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Pelayanan Kesehatan
Asuransi Sosial
S
aya setuju untuk memberlakukan asuransi sosial kesehatan
bagi seluruh rakyat. Tujuannya, agar masyarakat bisa
mendapatkan pelayanan kesehatan gratis di rumah sakit. Hal
yang tak kalah pentingnya juga adalah pendidikan perilaku hidup
bersih dan sehat kepada masyarakat. Contohnya, selalu mencuci
tangan sebelum makan dan minum, mengkonsumsi makanan
dengan gizi seimbang, berolahraga cukup, tidak merokok, tidak
mengkonsumsi alkohol dan narkoba. Ini perlu terus ditingkatkan
agar masyarakat mampu mencegah penyakit. (SBY, dalam acara
“Dialog dan Silaturahmi Capres RI dan Calih Profesi Kesehatan
DPR RI dengan Masyarakat Profesi Kesehatan,” Jakarta, Minggu 29
Agustus 2004).
CATATAN: Data terakhir menunjukkan bahwa saat
ini lebih dari 80 persen rakyat Indonesia
tidak mampu mendapat jaminan kesehatan
dari lembaga atau perusahaan di bidang
pemeliharaan kesehatan, seperti Askes,
Taspen, dan Jamsostek. Hanya kurang dari
20 persen yang mampu mendapatkannya.
Golongan masyarakat yang dianggap
‘teranaktirikan’ dalam hal jaminan kesehatan
adalah mereka dari golongan masyarakat
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 59
kecil dan pedagang. Solusinya, saat ini
tengah digodok RUU untuk memberlakukan
SJSN.
Lebih Banyak Dana
Kita harus mengalokasikan lebih banyak dana untuk
membantu mereka yang sangat membutuhkan. Kita harus
menyediakan pelayanan kesehatan dasar dengan secara bertahap
membangun lebih banyak klinik, meningkatkan subsidi kesehatan
untuk mereka, dan meningkatkan pengetahuan mereka untuk
pencegahan. (SBY, pidato politik pada pembukaan masa kampanye
putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-
2009, Jakarta, Selasa 1 Juni 2004).
Hak Dasar
Layanan kesehatan merupakan bagian dari hak dasar
masyarakat yang harus terpenuhi. Meskipun fasilitas pelayanan dasar
seperti puskesmas relatif telah tersedia di hampir seluruh wilayah
Indonesia, namun keterjangkauan pelayanan dan mutu pelayanan yang
diberikan masih belum merata. Indonesia memiliki 7.237 puskesmas
pada tahun 2000 dan 21.267 puskesmas pembantu. Tenaga kesehatan
yang tersedia, diukur dari rasio per jumlah penduduk, masih belum
mencukupi, meskipun telah terjadi perbaikan yang berarti. Daya
jangkau masyarakat terhadap obat-obatan juga masih rendah. Untuk
itu, sebagai proses pemenuhan hak dasar rakyat, saya mendorong
untuk terus dilakukannya peningkatan pencegahan penyakit menular,
peningkatan upaya imunisasi, penurunan angka kematian ibu dan
anak, pemerataan, dan peningkatan kualitas fasilitas kesehatan dasar,
peningkatan kualitas dan ketersediaan petugas kesehatan, obat dan
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
60
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
perbekalan kesehatan, mendorong berkembangnya industri obat di
Indonesia, perbaikan pengawasan obat dan makanan. (SBY, pidato
politik pada penutupan masa kampanye putaran pertama Pemilihan
Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Kamis 1 Juli
2004).
Tidak Muncul Ketimpangan
Saya akan menaikkan presentase anggaran bidang kesehatan
dalam APBN menjadi 10 hingga 15 persen. Akan ada kajian
mendalam tentang beberapa aspek terkait. Tapi saya bisa pastikan
, presentase pengeluaran pemerintah akan ada kenaikkan untuk
bidang kesehatan. Selain bidang pendidikan, bidang kesehatan
merupakan prioritas program kesejahteraan rakyat. Di dalamnya
sudah termasuk pengurangan angka kemiskinan dan pengangguran
serta peningkatan daya beli masyarakat. Jadi, perlu dihitung dulu
secara menyeluruh agar tidak muncul ketimpangan. Kalau hal itu
sampai terjadi, bisa menimbulkan masalah serius. (SBY, dalam acara
“Dialog dan Silaturahmi Capres RI dan Calih Profesi Kesehatan
DPR RI dengan Masyarakat Profesi Kesehatan,” Jakarta, Minggu 29
Agustus 2004).
CATATAN : Menurut data terakhir dari Pengurus Besar
IDI, selama 50 tahun sejak Indonesia
merdeka, anggaran pembangunan kesehatan
masyarakat dalam APBN tidak pernah lebih
dari empat persen, hanya berkisar di antara
angka 2,5 hingga 3,5 persen.
Fasilitas Puskesmas
Saya prihatin terhadap rendahnya tingkat kesehatan
masyarakat. Sebelumnya, saya sudah berkunjung ke beberapa daerah
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 6l
di Jawa Timur. Saya mengamati, betapa kurangnya fasilitas di berbagai
puskesmas. Jumlah tenaga medisnya tak mencukupi, fasilitas rawat
inap dan obat-obatan juga kurang. Padahal, Puskesmas merupakan
tempat berobat masyarakat kebanyakan dengan standar ekonomi
kelas bawah. Puskesmas harusnya perlu mendapat perhatian yang
lebih serius. (SBY, saat acara pengobatan gratis yang diadakan oleh
Gerakan Pro-SBY, Ciawi, Bogor, Selasa 15 Juni 2004).
Motor Besar
Untuk mempercepat pertolongan kesehatan ke rumah sakit,
saya berpikir perlu adanya petugas kesehatan yang mengendarai
motor besar berkeliling jalan raya. Saya menyaksikan di Inggris,
petugas kesehatan mereka mengendarai motor besar di jalan.
Mereka bekerja 24 jam di jalan untuk mempercepat pertolongan
bagi warga yang menjadi korban kecelakaan atau warga yang sakit
untuk segera dibawa ke rumah sakit. Dengan motor besar, mereka
bisa leluasa bergerak di jalan-jalan yang macet sekalipun. (SBY,
dalam acara “Dialog dan Silaturahmi Capres RI dan Calih Profesi
Kesehatan DPR RI dengan Masyarakat Profesi Kesehatan,” Jakarta,
Minggu 29 Agustus 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
62
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Budaya dan Seni
Kebebasan Berekspresi
S
aya sangat menghormati kebebasan berekspresi dan ekspresi
kebebasan. Karena itu, saya sangat menghormati usulan
agar seniman masuk kabinet. Seniman atau bukan, silahkan
masuk kalau memang mampu. Saya yakin budayawan punya potensi
untuk itu. (SBY, dalam acara dialog “Visi dan Strategi Kebudayaan
Calon Presiden 2004” di Graha Bhakti Budaya, Taman Ismail Marzuki,
Jakarta, Senin 14 Juni 2004).
Posisi Budaya
Karena selama ini kita banyak mengabaikan masalah
budaya, banyak persoalan di negeri ini yang tidak dapat terselesaikan.
Melalui pendidikan, seharusnya orang dididik untuk menghargai
dan meletakkan posisi budaya pada tempatnya. Berkat kearifan
budaya yang dimiliki masing-masing daerah, berbagai persoalan
bisa diselesaikan dengan baik. (SBY, di hadapan sejumlah seniman
dan budayawan, Yogyakarta, Senin 21 Juni 2004).
Departemen Kebudayaan
Saya akan mempertahankan departemen kebudayaan dan
pariwisata. Tujuannya agar kegiatan budaya dan kesenian berkembang
pesat. Aktivitas seni dan budaya akan mampu mendorong
meningkatnya SDM. Juga akan mempermantap perdamaian dan
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 63
toleransi di berbagai daerah di Indonesia. (JK, seusai menyaksikan
pertunjukan debus pada acara kunjungan silahturahmi memperingati
Mi’raj Nabi Muhammad SAW di Serang, Banten, Minggu 12 September
2004).
Dialog Budaya
Di masa lalu, dialog-dialog budaya terhambat akibat
tertutupnya ruang demokrasi. Benturan-benturan mengenai budaya-
budaya lokal, termasuk masalah etnis dan agama, tidak diselesaikan
melalui dialog budaya, melainkan direpresi dengan dalih masalahg
SARA. Saya bertekad mendorong terciptanya wadah yang terbuka
dan demokratis bagi terlaksananya dialog kebudayaan. Ini bertujuan
agar benturan-benturan yang terjadi tidak sampai melebar menjadi
konfik sosial. (SBY, dalam acara dialog “Visi dan Strategi Kebudayaan
Calon Presiden 2004” di Graha Bhakti Budaya, Taman Ismail Marzuki,
Jakarta, Senin 14 Juni 2004).
Peran Budaya
Melihat potensi dan peran budaya yang begitu besar sebagai
pemersatu bangsa, saya melihat menjadi tidak tepat jika sektor
budaya dijadikan satu dengan pariwisata dalam satu departemen.
Saya setuju jika budaya dan pariwisata dipisah. (SBY, di hadapan
sejumlah seniman dan budayawan, Yogyakarta, Senin 21 Juni 2004).
Seni Nasyid
Saya menaruh perhatian pada seni nasyid. Kesenian
ini mestinya mendapat perhatian lebih banyak dari masyarakat.
Kehidupan masyarakat akan lebih sejuk dan damai jika bisa
mengapresiasi seni nasyid sepanjang waktu. (SBY, di hadapan
sejumlah seniman dan budayawan, Yogyakarta, Senin 21 Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
64
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
CATATAN: Nasyid adalah salah satu jenis seni islami yang
telah berkembang sejak lama. Bentuknya
berupa, syair-syair pujian dan dakwah yang
dibawakan dengan lagu yang terkadang
diiringi alat musik seperti perkusi. Contoh
nasyid yang terkenal adalah selawat Badar
yang dibawakan penduduk Madinah saat
menyambut kedatangan Nabi Muhammad
SAW.
Pembajakan Kaset
Saya menaruh perhatian pada upaya memerangi pembajakan
kaset. Saat saya masih menjabat Menkopolkam, awal tahun 2003,
saya memonitori perlawanan terhadap pembajakan kaset. Waktu itu,
bersama 11 seniman nasional, saya berkampanye di banyak tempat
guna memerangi pembajakan kaset. Dalam forum pemerintahan,
bersama Kapolri, Jaksa Agung serta aparat penegak hukum lainnya,
kami berkomitmen untuk mendukung kampanye itu. Hasilnya
memang ada, pembajakan kaset jadi menurun. Tapi belum tuntas.
Untuk menuntaskannya, harus terus disosialisasikan pemahaman
bahwa pembajakan adalah suatu tindakan melanggar hukum dan
karya cipta yang dilindungi oleh undang-undang. Mereka harus
diberi sanksi seberat-beratnya sesuai kesalahan yang mereka perbuat.
(SBY, saat silaturahmi dengan tokoh masyarakat Sumatera Barat di
Padang, Minggu 20 Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 65
Kesejahteraan
Rakyat
Rakyat Ukurannya
B
erbagai kemajuan telah kita capai. Namun kita tahu, lebih
banyak lagi yang masih harus diperjuangkan. Ukurannya
adalah kesejahteraan rakyat. Ukurannya adalah rasa aman
masyarakat. Ukurannya adalah terjaminnya rasa keadilan masyarakat.
Ukurannya adalah, di masa datang, krisis-krisis yang pernah kita
alami tidak terulang lagi. Kita tahu, semua ini belum terwujud. Kita
tahu, kita masih harus berjuang lebih keras lagi. Tapi kita juga tahu,
kita bisa melakukannya. (SBY, pidato politik pada pembukaan masa
kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI
2004-2009, Jakarta, Selasa 1 Juni 2004).
Kesetiakawanan Sosial
Dalam program membantu rakyat kecil, perlu adanya
kesetiawanan sosial dan antidiskriminasi. Dari dulu banyak teori
yang dikemukakan. Namun, apapun teorinya, yang penting ke depan
kesejahteraan rakyat harus makin baik. Tidak boleh miskin terus,
ingin berobat tidak punya uang atau ingin sekolah tidak punya uang.
Saya akan berusaha mensejahterakan rakyat dengan berupaya keras
memperbaiki ekonomi, meningkatkan pendapatan negara, mencegah
kebocoran dan memperkecil adanya korupsi. Dengan begitu, uang
negara dapat digunakan untuk membangun jalan, sekolah, dan
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
66
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
sarana kesehatan. (SBY, dalam acara open house di kediamannya, Puri
Cikeas, Gunung Putri, Bogor, Senin, 29 September 2004).
Menanam Modal
Saya akan memerangi kemiskinan yang menyengsarakan
rakyat dengan menanam modal besar-besaran kepada rakyat
Indonesia sendiri melalui pendidikan dan pengembangan sumberdaya
manusia sebagai prioritas utama. Kami juga akan membangun dan
meningkatkan prasarana-prasarana penting di sektor pedesaan
dan pertanian seperti juga halnya prasarana penghubung antara
pedesaaan dan perkotaan. (SBY, dalam acara seminar Institut Kajian
Pertahanan dan Strategi Singapura, Singapura, Rabu 26 Mei 2004).
Tinggi dan Berkualitas
Membangun kesejahteraan rakyat mengharuskan kita untuk
membangun ekonomi secara baik. Bangun ekonomi yang baik yang
saya maksudkan adalah bangun ekonomi yang memiliki pertumbuhan
yang tinggi dan berkualitas, resisten terhadap goncangan dan
terdistribusikan secara adil. Namun demikian, kesejahteraan rakyat
mengharuskan berkembangnya rasa aman. Kesejahteraan juga tidak
mungkin tanpa berkembangnya rasa keadilan. (SBY, pidato politik
pada penutupan masa kampanye putaran pertama Pemilihan Presiden
dan Wakil Presiden RI 2004-2009, Jakarta, Kamis 1 Juli 2004).
Keluarga Miskin
Pemerintahan saya akan mengalokasikan lebih banyak
dana untuk membantu keluarga yang miskin, menyediakan fasilitas
kesehatan yang dasar dengan membangun lebih banyak klinik,
memperbesar anggaran subsidi kesehatan. Untuk keluar dari
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 67
lingkaran kemiskinan, pencerdasan masyarakat harus dimulai dengan
memberikan pendidikan pada anak-anak. Kita harus meningkatkan
subsidi bagi sekolah-sekolah di kalangan masyarakat yang termiskin,
memperbaiki kurikulum nasional, dan meningkatkan rasio murid
dan guru. (SBY, dalam acara seminar Institut Kajian Pertahanan dan
Strategi Singapura, Singapura, Rabu 26 Mei 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
68
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Hubungan dan Kerjasama
Internasional
Bukan Mandor
D
alam kerjasama internasional termasuk kerjasama dengan
lembaga keuangan asing, kita tidak boleh mengabaikan
dan merugikan kepentingan dalam negeri. Jangan
sampai konstitusi dan undang-undang serta kepentingan nasional
tersingkirkan karena harus mengadopsi nilai-nilai dan hukum global
yang ada. Keberadaan IMF, Bank Dunia bukanlah sebagai mandor
dan mereka pun tidak boleh meletakkan diri sebagai mandor. (SBY,
saat acara ‘ Talk Show Calon Presiden RI 2004” di Kampus Universitas
Hasanuddin, Makassar, Rabu 2 Juni 2004).
Prinsip Dasar
Saya tidak memiliki rencana untuk membuka hubungan
dengan Israel. Dalam visi dan misi saya tidak ada agenda yang
berhubungan dengan pembukaan hubungan diplomatik dengan
Israel atau agenda lain yang bertentangan dengan keinginan rakyat
Indonesia. Saya mendukung upaya perjuangan bangsa Palestina
dalam upaya mencapai kemerdekaannya. Itu merupakan prinsip
dasar politik luar negeri RI, yang juga harus menjadi komitmen
seluruh bangsa Indonesia. (SBY, saat mendatangi kantor DPP PKS di
Jakarta, Kamis 26 Agustus 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 69
Bebas dan Aktif
Banyak agenda besar kebangsaan kita yang akan menemukan
bentuk terbaiknya melalui kerjasama internasional, pemulihan
ekonomi dan penanganan terorisme misalnya. Saya akan tetap
menjalankan dan mempromosikan kebijakan luar negeri kita yang
bebas dan aktif. Kita akan memposisikan Indonesia sebagai negara
yang terbuka, toleran, modern, demokratis, dan punya pandangan
keluar yang sangat jauh dengan suara yang jelas, tegas, dan tak
pernah lelah untuk memperjuangkan terwujudnya perdamaian dan
keadilan. Indonesia akan tetap menjadi negara terkemuka dalam
perang melawan terorisme dan akan melakukan kerjasama untuk
counter-terrorism dengan negara-negara lain. (SBY, pidato politik
pada pembukaan masa kampanye putaran pertama Pemilihan Presiden
dan Wakil Presiden RI 2004-2009, Jakarta, Selasa 1 Juni 2004).
Prinsip Keseimbangan
Masuknya modal asing ke Indonesia harus disikapi secara
proporsional. Kita tidak mungkin bisa mengelak dari bentuk
kerjasama internasional. Namun hal itu harus dilakukan berdasarkan
prinsip keseimbangan. (SBY, saat berdialog dengan sejumlah mahasiswa
dan dosen Universitas Indonesia, Jakarta, Kamis, 10 Juni 2004).
Hubungan yang Konstruktif
Kita harus membangun hubungan internasional yang
konstruktif, dan kebijakan luar negeri yang tepat. Saya sadari bahwa
kondisi dunia yang kita hadapi ke depan terasa tetap rentan. Kita tidak
bisa menyatakan bahwa dunia akan lebih aman. Akan kita temukan
tentunya gejolak di berbagai bagian dunia. Dan, kondisi ASEAN
juga akan mengalami perubahan di masa datang. (SBY, pidato politik
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
70
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
pada pembukaan masa kampanye putaran pertama Pemilihan Presiden
dan Wakil Presiden RI 2004-2009, Jakarta, Selasa 1 Juni 2004).
Proaktif untuk Palestina
Saya akan bersikap proaktif terhadap permasalahan yang
terjadi di Palestina. Saya juga berharap agar pembentukan suatu
negara Palestina yang berdaulat, merdeka, dan independen bisa
diwujudkan dalam waktu dekat. (SBY, di hadapan 17 duta besar yang
mengunjunginya, Jumat 15 Oktober 2004).
Tidak Ada Lagi Komitmen
Sudah ada kebijakan dari MPR, DPR, dan Pemerintah
Republik Indonesia untuk mengakhiri program yang disebut
dengan Letter of Intens bersama IMF, sudah selesai tidak ada lagi
komitmen kita dengan IMF. Jadi tak ada pikiran-pikiran kita untuk
terus bernaung kembali ke IMF. (SBY, saat memberikan keterangan
kepada pers di pendopo Puri Cikeas, Gunung Putri, Bogor, Minggu 17
Oktober 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 7l
Nelayan dan Petani
Pinjaman Modal
N
elayan adalah basis ekonomi rakyat. Oleh karena itu,
saya akan memberikan akses yang lebih mudah bagi para
nelayan untuk mendapatkan pinjaman modal dari bank.
Dalam hal penjualan, saya juga akan membantu mereka dengan
membuka akses pasar yang lebih baik untuk hasil tangkapannya.
(JK, saat bertemu dengan para nelayan di tempat Pelelangan Ikan
Lempasing, Bandarlampung, Lampung, Senin 28 Juni 2004).
CATATAN: Profesi nelayan dianggap sebagai salah
satu profesi penting dalam menunjang
perekonomian Bandarlampung karena
kontribusinya dalam penyediaan protein
hewani. Sayangnya, lembaga-lembaga yang
seharusnya menyediakan pinjaman modal,
sering mempersulit mereka. Akibatnya,
banyak di antara mereka ‘terikat kerja’
dengan pemilik modal besar dari perusahaan
swasta atau perorangan. Mereka diwajibkan
menjual hasil tangkapannya kepada pemilik
modal tersebut dengan harga yang sangat
rendah.
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
72
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Kepastian Penghasilan
Saya akan meningkatkan taraf hidup para nelayan. Itu
sudah menjadi agenda, akan menjadi program pemerintah lima
tahun mendatang. Saya sudah meninjau beberapa tempat nelayan.
Saya melihat, memang harus ada kepastian penghasilan sehari-
hari, bantuan permodalan, koperasi, kesehatan. Jangan sampai
kalah oleh para nelayan yang menggunakan perahu berteknologi
tinggi. Kehidupan para nelayan saat ini memang penuh dengan
ketidakpastian, apalagi jika harga solar tinggi. (SBY, di depan
masyarakat nelayan Kampung Baru Bugis, Desa Banten Kecamatan
Kasemen, Kabupaten Serang, Juni 2004).
Sektor Unggul
Saya akan memperhatikan sektor pertanian. Di Indonesia
sektor pertanian adalah salah satu sektor ekonomi yang unggul. Ini
sudah terbukti. Di saat perekonomian Indonesia runtuh dilanda krisis,
enam tahun lalu, sektor ekonomi yang bisa bertahan adalah ekonomi
rakyat serta sektor informal, termasuk pertanian. (SBY, saat bertemu
dan berdialog dengan sejumlah petani dan pedagang jamu serta buruh jamu
di Bawen, Ungaran, Selasa 29 Juni 2004).
Kualitas Hidup
Saya pastikan bahwa kita akan melakukan revitalisasi pertanian
dan perdesaan. Upaya ini terutama dimaksudkan untuk meningkatkan
kesejahteraan dan kualitas hidup petani dan nelayan serta rumah tangga
petani dan nelayan. Meningkatkan akses petani dan nelayan terhadap
sumberdaya produktif dan permodalan. Meningkatkan produktivitas
dan kualitas petani dan nelayan serta meningkatkan produktivitas
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 73
dan kualitas pertanian. Mengembangkan diversifkasi aktivitas
ekonomi pedesaan. Mengembangkan industrialisasi pedesaan. Dan,
melaksanakan reformasi agraria. Berkembangnya pedesaan dan
pertanian akan menjamin perkembangan perkotaan dan industri
yang berkelanjutan. (SBY, pidato politik pada pembukaan masa
kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI
2004-2009, Jakarta, Selasa 1 Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
74
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Otonomi Daerah
Mengevaluasi Kelemahan
K
ita harus meningkatkan dan mendalami proses desentralisasi
dan otonomi daerah yang sedang berlangsung. Kita harus
dari waktu ke waktu mengevaluasi kelemahan yang
terjadi dengan mengangkat ide-ide inovatif yang berkembang di
tingkat lokal. Kita perlu menyeimbangkan kepentingan nasional
dengan kepentingan daerah, lokal, dan masyarakat. Dengan terus
mengembangkan saluran-saluran ide yang berkembang di masyarakat,
kita dari waktu ke waktu akan mampu meningkatkan rasa saling
percaya antara pemerintah pusat dan daerah, antara pemerintah dan
masyarakat, dan antarkelompok masyarakat. (SBY, pidato politik pada
pembukaan masa kampanye putaran pertama Pemilihan Presiden dan
Wakil Presiden RI 2004-2009, Jakarta, Selasa 1 Juni 2004).
Menata Propinsi dan Kota
Kami akan mendorong peningkatan reformasi birokrasi
menjadi lebih efsien, lebih disiplin, lebih produktif, kinerja yang baik
untuk pelayanan kepada publik, melakukan pengelolaan yang makin
efektif dalam implementasi, sentralisasi dan otoda dengan semangat
untuk menata kembali propinsi dan kota. (SBY-JK, pemaparan dalam
acara “Dialog Penajaman Visi, Misi, dan Program Capres-Cawapres”
yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton,
Jakarta, Selasa 14 September 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 75
Penataan Ulang
Kami akan membenahi efektivitas gubernur yang selama ini
banyak dipertanyakan orang. Juga kami akan memperjelas aturan dan
kewenangan bupati/walikota. Tidak mungkin lagi semuanya diatur di
tingkat pusat. Pemecahannya, harus ada penataan ulang kewenangan
di tiap tingkat pemerintahan. (JK, dalam acara “Dialog Penajaman
Visi, Misi, dan Program Capres-Cawapres” yang diselenggarakan oleh
Komisi Pemilihan Umum di Hotel Hilton, Jakarta, Selasa 14 September
2004).
Harus Ada Mekanisme
Kami akan meninjau kembali pemekaran yang telah
dilakukan terhadap kabupaten/kota. Pemekaran yang telah
dilakukan selama ini hanya sebatas pertimbangan politis tanpa
dilandasi prinsip-prinsip yang jelas. Misalnya, pertimbangan
potensi daerah, jumlah penduduk, kultur soasial maupun politik.
Harus ada mekanisme daerah dan pusat untuk duduk bersama guna
memecahkan persoalan tentang otonomi daerah dan pemekaran.
(SBY, dalam acara “Dialog Penajaman Visi, Misi, dan Program Capres-
Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel
Hilton, Jakarta, Selasa 14 September 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
76
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Kebebasan Pers
Tidak Selalu Benar
D
i masa depan, pemerintah siapapun yang berkuasa tidak
boleh lagi melakukan pembreidelan atau penyensoran
terhadap pers. Sebab, itu artinya kita kembali ke masa lalu.
Kebebasan pers seperti juga demokrasi, sudah merupakan way of
life, tidak bisa lagi dicabut. Harus terus dijaga dan dipertahankan.
Namun begitu, dalam pelaksanaannya, tugas pers tidak boleh
dianggap selalu benar. Soal kesalahan wartawan, tergantung keadaan
dan kadarnya. Tidak boleh karena alasan tugas, ia lalu dianggap
menjadi tidak bersalah. (JK, dalam acara dialog ulang tahun Aliansi
Jurnalis Independen, Hotel Nikko, Jakarta, Kamis 5 Agustus 2004).
CATATAN: Di Indonesia telah beberapa kali terjadi
pembreidelan atau pembekuan/pencabutan/
pembatalan SIUPP terhadap media cetak
Sebut saja harian Sinar Harapan (dicabut
SIUPP-nya 9 Oktober 1986), harian
Prioritas (29 Juni 1987), tabloid Monitor
(23 Oktober 1990), dan Majalah Tempo (21
Juni 1994). Meninjau jauh ke belakang, pada
tahun 1974 tak kurang dari 123 media cetak
diberangus hanya gara-gara mengungkap
kasus korupsi Ibnu Sutowo dan keluarga
Soeharto di Pertamina. Pada tahun 1978,
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 77
pemberangusan terjadi lagi terhadap 8
media massa lantaran melaporkan bisnis-
bisnis yang berhubungan dengan keluarga
Soeharto.
Terus Berlanjut
Saya akan mendorong kebebasan pers terus berlanjut. Saya
berharap pers ke depan bisa lebih matang. Bisa menjembatani
dialog antara pemerintah dengan rakyat, rakyat dengan lesgislatif,
atau pemerintah dengan legislatif. Kebebasan pers harus terus
berlanjut karena kebebasan pers adalah bagian dari demokrasi.
(SBY, kepada wartawan di sela-sela kampanye di Denpasar, Bali,
Kamis 24 Juni 2004).
CATATAN: Reporters Sans Frontieres (Pewarta
Tanpa Batas), organisasi internasional
dalam bidang kebebasan pers pernah
menempatkan Indonesia sebagai peringkat
terbaik di antara negara-negara ASEAN.
Selama pemerintahan Megawati, kebebasan
pers dianggap cukup bagus oleh banyak
kalangan. Salah satu indikatornyanya
adalah tidak adanya penerbitan yang
dibreidel seperti pada jaman Soeharto.
Hanya saja, ada beberapa kasus yang
kemudian sedikit mengaburkan anggapan
itu. Contohnya, kasus Pemimpin Redaksi
Majalah Tempo yang divonis satu tahun
penjara karena pencemaran nama baik,
kasus gugatan Megawati terhadap harian
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
78
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Rakyat Merdeka akibat pemberitaan
kenaikan harga bahan bakar minyak. Juga
kasus gugatan Akbar Tanjung terhadap
harian yang sama terkait dengan kasus
penyelewengan dana Bulog.
Peran Sentral
Saya berkomitmen untuk mendukung kebebasan pers. Pers
memiliki peran sentral dalam demokrasi sehingga kebebasan pers
yang beretika merupakan unsur terpenting untuk membangun
demokrasi yang sehat. (SBY, di kantor redaksi Harian Sore Surabaya
News, Surabaya, Senin 7 Juni 2004).
Terus Berkembang
Saya menjamin tidak akan ada lagi pemberidelan terhadap
pers. Saya akan membuat pers terus berkembang, mendapatkan peran
dalam kebebasannya sesuai dengan konstitusi dan aturan main yang
berlaku. (SBY, saat bersilaturahmi ke Kantor Majalah Tempo, Jakarta,
Senin 2 Agustus 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 79
Pornograf
dan Narkoba
Kejahatan dan Kemaksiatan
S
aya akan melakukan langkah konkrit untuk menolong
bangsa ini dari kejahatan dan kemaksiatan yang implikasinya
merusak moral bangsa. Misalnya, peredaran video porno,
narkoba, alkohol, dan sebagainya. Untuk mengatasinya, saya akan
menggunakan tiga langkah. Pertama, menggunakan jalur pendidikan
dalam dimensi pencegahan dan pembinaan. Melalui pendidikan 12
sampai 16 tahun anak-anak dididik dan diingatkan terus untuk tidak
melakukan hal itu. Selanjutnya, saya melibatkan gerakan orangtua,
tokoh agama dan tokoh adat. Langkah ketiga adalah melakukan
penegakan hukum. Hal-hal yang dapat merusak moral masyarakat,
tidak bisa kita anggap biasa-biasa saja. Harus ada tindakan tegas
demi masa depan dan generasi mendatang. (SBY, dalam acara
“Dialog Penajaman Visi, Misi, dan Program Capres-Cawapres” yang
diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton, Jakarta,
Kamis 16 September 2004).
CATATAN: Masalah pornograf dan pornoaksi sering
dituding sebagai akar masalah kemerosotan
moral di negeri ini. Tingkat kriminalitas akibat
pornograf dan pornoaksi sudah mencapai
tahap yang memprihatinkan. Maraknya
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
80
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
peredaran berbagai benda dan aktivitas yang
berhubungan dengan pornograf (VCD/
DVD, tabloid/koran panas, internet, goyang
ngebor, goyang buldoser, goyang ngocok, dan
sebagainya) bisa dijadikan indikator. Banyak
pakar yang mengatakan, pornograf dan
pornoaksi marak di Indonesia diakibatkan
kesalahan menerjemahkan arti reformasi.
Hal itu semakin bersemi dengan tidak
adanya larangan tegas dengan belum
diberlakukannya Undang-undang Pornograf
dan Pornoaksi.
Pembatasan Penayangan
Saya akan melakukan pembatasan terhadap penayangan
adegan pornograf, pornoaksi, sadisme di televisi yang bisa ditonton
selama 24 jam. Pembatasan itu bukan dimaksudkan mengontrol
pikiran dan tidak menghormati HAM. Namun, harus ada regulasi
yang baik demi moral, akhlak, dan perilaku anak-anak kita di masa
mendatang. Harus ada pembatasan untuk penayangan hal-hal yang
menjurus ke tindak kejahatan yang dapat merusak moral. Kalau
moral bangsa tidak ditangani dari sekarang, 10-20 tahun lagi tanpa
kita sadari keboborakan dan kemaksiatan telah berkembang luas.
(SBY, dalam acara “Dialog Penajaman Visi, Misi, dan Program Capres-
Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel
Hilton, Jakarta, Kamis 16 September 2004).
Budaya Kekerasan
Ada tiga cara pendekatan yang akan saya lakukan terhadap
budaya kekerasan, penyalahgunaan obat-obatan terlarang (narkoba
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 8l
dan psikotropika), pornograf dan penyakit sosial lainnya. Yakni,
pendekatan pendidikan, pendekatan keagamaan , dan pendekatan
hukum. Tiga pendekatan ini ampuh untuk memberantas penyakit
sosial. Jika masyarakat tetap tidak memperhatikan aturan, norma,
dan nilai-nilai yang berkembang, penegakan hukum menjadi
alternatif terakhir. (SBY, dalam acara dialog “Visi dan Strategi
Kebudayaan Calon Presiden 2004” di Graha Bhakti Budaya, Taman
Ismail Marzuki, Jakarta, Senin 14 Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
82
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Bisnis dan Usaha
Seluk-beluk Perdagangan
M
asalah dalam aktivitas perdagangan antardaerah,
antarnegara, dan kebijakan harus diperbaiki. Jangan
hanya menguntungkan sekelompok orang tapi
merugikan kelompok lain. Ini bukan hanya urusan menteri tapi
juga direktur jenderal, gubernur, bupati, dan wali kota. Mereka yang
menentukan kebijakan perdagangan harus memahami betul seluk-
beluk perdagangan. Namun, dalam mengambil suatu kebijakan,
harus dapat dijelaskan kepada rakyat. Sebelum kebijakan diambil,
suara rakyat dan semua kelompok masyarakat harus didengarkan.
Namun, setelah keputusan dan kebijakan diambil, semua harus patuh
menjalankan keputusan. (SBY, dalam acara open house di kediamannya,
Puri Cikeas, Gunung Putri, Bogor, Senin, 29 September 2004).
Kontrak Sosial
Saya akan membuat kontrak sosial baru dengan dunia usaha.
Kontrak sosial baru ini merupakan kebijakan untuk mendorong
dunia usaha agar bisa menggarap peluang-peluang bisnis melalui
berbagai kemudahan yang kami berikan. Dengan peluang itu, saya
berharap kehidupan bisnis dapat berkembang lebih baik. Sejalan
dengan keuntungan mereka, pelaku bisnis bisa membayar pajak
dengan benar, menciptakan lapangan kerja, dan berkontribusi untuk
community development. Dengan kerangka seperti ini, saya optimis
masyarakat kita bisa didorong menjadi modal sosial yang produktif,
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 83
disiplin, efsien, dan mampu mendorong terciptanya iklim usaha
kondusif. Itulah kontrak sosial yang saya maksud. Saya percaya jika
hal itu bisa kita bangun melalui dialog dengan semua pihak, dalam
jangka waktu lima tahun dunia usaha kita akan kembali bangkit.
(SBY, dalam acara dialog ekonomi dengan anggota Kadin bertajuk
“Indonesia Menuju Era Baru” di Balai Sidang Senayan, Jakarta, Senin
2 Agustus 2004).
Kebangkitan ekonomi
Kebangkitan ekonomi jangan hanya diletakkan padan
sentra-sentra ekonomi seperti di Jakarta, Surabaya, dan Makassar
saja. Tetapi mari kita distribusikan kebangkitan ini ke seluruh tanah
air secara merata. Kami akan mencurahkan segalanya terhadap
dunia usaha menuju kebangkitan dunia usaha di waktu yang akan
datang. (SBY, dalam acara dialog ekonomi dengan anggota Kadin
bertajuk “Indonesia Menuju Era Baru” di Balai Sidang Senayan,
Jakarta, Senin 2 Agustus 2004).
Hubungan Baik
Saya akan memperioritaskan pembangunan usaha yang
perusahaannya mempunyai hubungan baik dengan karyawannya.
Semuanya, baik perusahaan maupun karyawan, harus bekerja
dengan baik. Jika usahanya maju, maka semuanya secara bersama-
sama akan menjadi maju. Kita akan mempelajari apakah aturan
perusahaanya sudah tepat, sudah bertanggung jawab, akomodatif ,
apakah karyawannya berkerja baik. (SBY, saat bertemu dan berdialog
dengan sejumlah petani dan pedagang jamu serta buruh jamu di Bawen,
Ungaran, Selasa 29 Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
84
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Pilar Utama Dinamisme
Pemerintahan saya akan menciptakan lapangan kerja
dengan cara menciptakan iklim yang ramah terhadap penanaman
modal, memberikan stimulasi kepada sektor nonpemerintah agar
menjadi pilar utama dinamisme perekonomian. Juga mendorong
pertumbuhan usaha kecil menengah formal dan informal, dengan
kebijakan yang lebih ramah terhadap UKM, antara lain dengan
penyaluran kredit yang lebih baik. (SBY, dalam acara seminar Institut
Kajian Pertahanan dan Strategi Singapura, Singapura, Rabu 26 Mei
2004).
Investasi yang Menjanjikan
Saya menargetkan, lima tahun ke depan Indonesia mampu
menyerap dana investasi langsung maupun tidak langsung hingga
30 persen dari PDB dalam negeri pada 2009. Saat ini masuknya
investasi baru mencapai 16,7 persen dari PDB. Karena itu, tentu
saja, ini tak cukup. Dalam hal ini, jika sektor swasta bisa berperan
dengan baik, saya pastikan Indonesia akan bangkit kembali dan
mendapatkan investasi yang lebih menjanjikan. Saya akan ciptakan
kondisi yang lebih baik sehingga partner dari luar negeri mau datang
dan bekerjasama dengan kita. (SBY, dalam acara dialog ekonomi
dengan anggota Kadin bertajuk “Indonesia Menuju Era Baru” di Balai
Sidang Senayan, Jakarta, Senin 2 Agustus 2004).
Penanaman Modal
Saya menganggap, penanaman modal dalam dan luar negeri
perlu ditingkatkan. Berdasarkan pengalaman saya sebagai Menteri
Pertambangan dan Energi, saya merasa penting untuk memperbaiki
tatanan sistim hukum dan keterbukaan terhadap perdangan serta
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 85
investasi global, termasuk reformasi birokrasi. Peraturan-peraturan
hukum mengenai perburuhan juga harus diperbaiki agar majikan
maupun buruh mendapat perlindungan. Juga agar saluran komunikasi
antara bisnis dan serikat buruh bisa lebih lancar. (SBY, dalam acara
seminar Institut Kajian Pertahanan dan Strategi Singapura, Singapura,
Rabu 26 Mei 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
86
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Indonesia Masa Depan
Lebih Aman
K
ami akan membawa Indonesia menjadi lebih aman, adil,
demokratis, dan lebih sejahtera dalam lima tahun ke depan.
(SBY-JK, pemaparan dalam acara “Dialog Penajaman Visi,
Misi, dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi
Pemilihan Umum di Hotel Hilton, Jakarta, Selasa 14 September 2004).
Adil dan Demokratis
Jika Indonesia telah aman dan damai, selanjutnya kita
harus mewujudkan Indonesia yang adil dan demokratis. Untuk itu,
keadaan ekonomi dan keadilan sosial harus makin baik, hukum
harus ditegakkan secara tegas, korupsi diberantas, HAM ditegakkan
dan dihormati, demokrasi dikembangkan, rakyat didengar suaranya,
pemimpin harus terbuka dan aspiratif, pemimpin harus menegakkan
sendi-sendi demokrasi. Setelah Indonesia adil dan demokratis,
kita wujudkan sejahtera. Untuk mewujudkannya, ekonomi harus
pulih, perekonomian harus terus tumbuh. Jika ekonomi telah pulih,
lapangan kerja akan lebih banyak, sehingga pengangguran dan
kemiskinan bisa dikurangi. Selain itu, pendidikan dan kesehatan
rakyat bisa lebih baik. Jika pendidikan dan kesehatan masyarakat
lebih baik, maka generasi berikutnya akan lebih baik. (SBY, saat
berkampanye di lapangan Sario, Manado, Jumat 11 Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 87
Tahan Resesi
Indonesia ke depan mestilah Indonesia yang berkembang
berdasarkan jiwa, semangat, nilai, dan konsensus dasar berdirinya
negara Republik Indonesia. Indonesia ke depan mestilah Indonesia
yang tahan terhadap resesi, krisis, dan berbagai goncangan perubahan.
Indonesia ke depan mestilah Indonesia yang siap menghadapi
perubahan serta yang yakin akan keharusan pergaulan internasional.
Inilah Indonesia yang semestinya, Indonesia yang lebih aman dan
damai, lebih adil dan demokratis, dan lebih sejahtera. (SBY, pidato
politik pada pembukaan masa kampanye putaran pertama Pemilihan
Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Selasa 1 Juni
2004).
Selesaikan Konfik
Indonesia lima tahun yang akan datang akan lebih aman
bila konfik di berbagai daerah, terutama di Aceh, Papua, Poso, dan
Maluku terselesaikan secara tuntas. Separatisme bersenjata kita
hentikan; dan, hak rakyat yang berupa harga diri, martabat, keadilan,
dan kesejahteraan dapat terus kita bangun dan kembangkan.
Konfik horisontal terselesaikan dengan sekaligus mengatasi akar-
akar konfiknya. Konfik dan ketegangan antar kelompok dan
antar golongan masyarakat dapat diselesaikan. Kejahatan terorisme
dapat terus diupayakan untuk dicegah dan ditangkal secara efektif.
Angka kriminalitas di perdesaan dan di perkotaan dapat diturunkan
sampai tingkat yang memberikan rasa aman bagi rakyat. Kejahatan
lintas batas, baik dalam bentuk perdagangan anak dan perempuan
maupun narkoba dapat terus diperangi. Perampokan, pembajakan,
dan penyelundupan terus dilakukan pemberantasannya. NKRI yang
berdasar Pancasila dan UUD 1945 semakin kokoh dan berkembang.
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
88
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Kehidupan masyarakat yang majemuk, yang plural, terus berkembang.
Dan, hubungan internasional dapat terus kita kembangkan secara
bermartabat, di atas kedaulatan sendiri. (SBY, pidato politik pada
penutupan masa kampanye putaran pertama Pemilihan Presiden dan
Wakil Presiden RI 2004-2009, Jakarta, Kamis 1 Juli 2004).
Berjuang Bersama Rakyat
Saya akan berjuang bersama rakyat untuk membawa bangsa
Indonesia menjadi lebih baik dalam lima tahun ke depan. (SBY, di
depan ribuan pendukungnya di lapangan parkir Stadion Bumi Siliwangi,
Palembang, Minggu 20 Juni 2004).
Hidup Harmonis
Untuk mewujudkan Indonesia yang aman dan damai,
masyarakat harus bisa hidup harmonis, saling hormat menghormati,
saling menghargai dan toleransi beragama, serta tidak menyuarakan
SARA. (SBY, saat berkampanye di lapangan Sario, Manado, Jumat 11
Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 89
Hutan, Laut, dan
Lingkungan
Langkah Nyata
S
aya memandang upaya penting perbaikan lingkungan hidup.
Ini harus segera diwujudkan. Sebab, lingkungan hidup adalah
bagian dari pengelolaan kehidupan kita di masa sekarang dan
mendatang. Untuk itu, kita tak usah berdebat terlalu panjang, yang
kita butuhkan adalah langkah nyata. Kondisi lingkungan hidup yang
baik merupakan salah satu tujuan pembangunan. (SBY, dalam acara
“Diskusi Kearifan Ekologi” di Hotel Grand Hyatt, Bandung, Selasa 15
Juni 2004).
Pengelolaan Hutan
Saya akan memberantas dan menghapuskan praktek ilegal
logging yang sangat merugikan negara bertriliun-triliun rupiah. Ini
sangat penting dan merupakan salah satu prioritas program yang
akan segera saya laksanakan. Keadaan ini tidak bisa dibiarkan terus
menerus. Saya akan menata secara nasional soal bagaimana kebijakan
dan pengawasan yang tepat. Masalah pengelolaan hutan harus
dilakukan sebaik mungkin. Di satu sisi, penggundulan hutan yang
berlebihan harus dicegah, karena bisa merusak lingkungan dan
menyebabkan banjir di mana-mana. Di sisi lain, negara tidak boleh
dirugikan akibat praktek penebangan hutan secara liar. Untuk
mengatasinya, harus ada tindakan nyata yang dilakukan secara
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
90
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
konprehensif. Pemimpin, TNI dan Polri harus menjadi bagian
dalam upaya pemberantasan praktek penebangan hutan secara
liar. (SBY, saat berdialog dengan para nelayan di perkampungan
nelayan Karangatu, Serang, Banten, Kamis 10 Juni 2004).
CATATAN: praktek ilegal logging atau penebangan
kayu liar adalah salah satu masalah besar
di Indonesia. Penebangan kayu liar pada
hutan-hutan produksi dan lindung telah
mencapai 50,7 juta m3 per tahun. Kerugian
fnansial yang diakibatkannya Rp30,42
triliun per tahun. Belum terhitung kerugian
ekologi akibat hilangnya beberapa spesies
keanekaragaman hayati. Banyak ahli
menduga, keadaan ini bisa tetap berlangsung
dikarenakan tidak adanya penanganan
hukum yang jelas terhadap pihak-pihak
yang terlibat. Ada diskriminasi hukum untuk
melindungi pihak-pihak tertentu.
Sumberdaya Alam
Pembangunan Indonesia sangat ditentukan oleh sejauh
mana bangsa ini menghargai dan mengelola sumberdaya alam
yang dimilikinya dan lingkungan hidup yang melingkupinya. Saya
memberikan prioritas pada kebijakan peningkatan fungsi dan
kualitas lingkungan, di antaranya melalui : menegakkan hukum dan
menyerasikan aturan mengenai pengelolaan sumberdaya alam dan
lingkungan, menciptakan sistem insentif dan disinsentif yang tegas
dalam pengelolaan sumberdaya alam dan lingkungan, memperbaiki
koordinasi lintas departemen dalam pengendalian pengelolaan
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 9l
sumberdaya alam dan lingkungan, meningkatkan partisipasi
masyarakat dalam pengelolaan sumberdaya alam dan lingkungan,
menindak secara tegas dan efektif praktek-praktek penyelewengan
pengawasan dan pengendalian pengelolaan sumberdaya alam dan
lingkungan yang dilakukan oleh aparat birokrasi. (SBY, pidato politik
pada penutupan masa kampanye putaran pertama Pemilihan Presiden
dan Wakil Presiden RI 2004-2009, Jakarta, Kamis 1 Juli 2004).
Rasio Daratan
Saya berharap, pembangunan dalam bidang kelautan ke
depan bisa lebih ditingkatkan. Tidak ada harmoni jika pembangunan
tidak memperhatikan rasio daratan dengan lautan. Indonesia
lautnya begitu luas, sumber daya begitu kaya, namun fasilitas untuk
menjaganya sangat minim. (SBY, dalam acara “Diskusi Kearifan
Ekologi” di Hotel Grand Hyatt, Bandung, Selasa 15 Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
92
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Ajakan dan
Kebersamaan
Melanjutkan Reformasi
M
ari kita lanjutkan reformasi dengan melakukan penataan,
pendalaman, dan penyeimbangan berbagai aspeknya.
Mari kita lanjutkan reformasi dengan meletakkannya
di dalam kerangka jiwa, semangat, nilai, konsensus, cita-cita, dan
tujuan kemerdekaan.
Saya tahu dan menyadari sepenuhnya tidak ada jalan yang lunak bagi
sebuah reformasi. Reformasi bukanlah bulan purnama. Masa transisi
adalah masa yang sulit dan bahkan kritis. Perubahan berbagai tatanan
dan nilai yang otoritarian ke tatanan dan nilai yang demokratis juga
sesuatu yang tidak mudah. Namun, saya yakin dan percaya apabila
tetap teguh dan tidak kehilangan orientasi, reformasi berskala besar
yang hendak kita teruskan ini akan mencapai tujuan dan sasarannya.
Dengan kerangka ini, kita memasuki Reformasi Gelombang Kedua.
Reformasi yang menjadikan semangat perubahan ke dalam sistem
kehidupan bersama. (SBY, pidato politik pada pembukaan masa
kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI
2004-2009, Jakarta, Selasa 1 Juni 2004).
Komitmen dan Keja Keras
Untuk membangun Indonesia yang lebih baik, marilah kita
sama-sama membuat komitmen dan bekerja keras. Jika Indonesia
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 93
menjadi lebih baik, marilah kita menikmatinya bersama-sama. Jika
Indonesia menjadi lebih
maju, marilah kita maju bersama-sama. Tapi ingat, membangun
Indonesia yang lebih baik memerlukan proses dan kerja keras.
(SBY, saat merayakan hari ulangtahun ke-3 Partai Demokrat di Istora
Senayan, Jakarta 9 September 2004).
Integrasi Nasional
Enam tahun lalu Indonesia dilanda krisis moneter. Situasi
yang sulit itu telah membuat integrasi nasional kita luntur. Keadaan
itu tidak boleh berlanjut lagi. Harus ada tekad dan kesatuan guna
mengukuhkan kembali rasa nasionalisme. (SBY, saat merayakan
hari ulangtahun ke-3 Partai Demokrat di Istora Senayan, Jakarta 9
September 2004).
Momentum Perubahan
Mari kita jadikan demokrasi yang tengah tumbuh dan
mekar ini sebagai momentum untuk melakukan perubahan yang
kita inginkan. Kita harus cukupkan dan hentikan sikap dan tindakan
kita yang terlalu melihat ke belakang, dan yang terlalu saling
menyalahkan. Kita cukupkan dan hentikan sikap dan tindakan
politik kita yang masih memberikan ruang gerak bagi politik kotor,
politik kekerasan, dan politik yang membodohi rakyat. Mari kita
katakan untuk semua ini: cukup sampai di sini! Selanjutnya, mari
kita katakan: ayo bersama melakukan perubahan untuk kehidupan
bersama yang lebih baik! (SBY, pidato politik pada pembukaan masa
kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI
2004-2009, Jakarta, Selasa 1 Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
94
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Mempertahankan Konsensus
Marilah kita memahami dan mempertahankan konsensus
dasar yang sudah dibuat oleh para pendiri negara Republik
Indonesia, yakni Pancasila dan UUD 1945. Di situ sudah diatur
bagaimana masyarakat Indonesia yang plural, hidup rukun dan saling
menghargai. (SBY, saat berkampanye di lapangan Sario, Manado,
Jumat 11 Juni 2004).
Melakukan Perubahan
Saya mengajak seluruh rakyat untuk secara bersama-sama
melakukan perubahan. Perubahan menuju Indonesia yang lebih
baik. Kita bersama akan terus berjuang untuk melakukan perubahan
ke arah yang lebih baik. Hanya dengan berjuang terus dengan gigih
inilah kita akan terhindar menjadi bangsa yang merugi. Inilah
amanah reformasi yang harus kita jalankan bersama. Ini juga amanah
konstitusi. Dan, yang terutama, inilah suara dan harapan rakyat.
(SBY, pidato politik pada pembukaan masa kampanye putaran pertama
Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Selasa
1 Juni 2004).
Lima Persen Gaji
Karena minimnya danan APBN untuk bidang pendidikan
dan kesehatan, pendanaannya harus kita atasi bersama-sama. Harus
ada gerakan melakukan donasi dari mereka yang mampu untuk
mereka yang kurang mampu. Mereka yang tidak mampu jangan
dipaksa membayar biaya pendidikan dan kesehatan yang tinggi.
Namun, jangan hanya ‘diperas’ untuk donatur yang masuk kantong
pribadi. Mereka harus diarahkan menjadi donatur untuk mengatasi
masalah pendidikan, kesehatan, dan pengangguran. Sebagai langkah
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 95
awal, saya akan memberi contoh dengan memberikan lima persen
gaji saya untuk masalah di pendidikan dan kesehatan. (SBY, di depan
peserta acara “Dialog Interaktif Menuju Indonesia Masa Depan” yang
diadakan oleh Forum Rektor Indonesia Jawa Timur, Surabaya, Selasa
24 Agustus 2004).
Tidak Bisa Sendirian
Saya mengajak masyarakat Indonesia dari seluruh lapisan
untuk bersatu dan bergandengan tangan lebih erat membantu
pemerintahan mendatang. Saya tidak mempersoalkan apakah dia
dulu mendukung saya atau tidak. Marilah kita bersatu kembali.
Saya menyadari, saya takkan dapat sendirian menjalankan amanah
mensejahterakan rakyat tanpa dukungan penuh seluruh rakyat
Indonesia. (SBY, seusai sholat Jumat di Mesjid Al-Istiqomah, Cikeas,
Desa Nagrak, Gunung Putri, Bogor, Jumat 24 September 2004).
Menatap ke Depan
Kita perlu menatap ke depan. Kita perlu berbenah
menghadapi kehidupan yang berubah secara cepat ini. Mari kita
pusatkan perhatian kita untuk menata masa depan. Mari kita pusatkan
segala daya kita untuk menjadi bangsa yang berkepribadian dengan
tingkat kemandirian yang tinggi. Kini waktunya menatap ke depan.
(SBY, pidato politik pada pembukaan masa kampanye putaran pertama
Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Selasa
1 Juni 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
96
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Seputar Kabinet
Profesional Nonpartisan
J
abatan Jaksa Agung, Kepala BIN dan Menteri BUMN, akan
saya isi dengan orang profesional nonpartisan. Ini agar tidak
menganggu kinerja mereka. Andai orang jujur pun mengisi
jabatan itu, kalau dia partisan, dia akan dianggap memihak pada
politik-politik tertentu. (SBY, dalam pertemuan dengan Pengurus
Besar Persatuan Guru Republik Indonesia di Bumi Perkemahan
Tawangmangu, Solo, Sabtu 14 Agustus 2004).
Empat Menteri Perempuan
Kabinet saya nantinya terdiri dari the dream team paduan
politisi dan kaum profesional, juga memperhatikan kebhinekaan
tunggal ika dan masalah gender. Kalau dalam kabinet sekarang
hanya ada dua menteri perempuan, maka dalam kabinet mendatang
bisa empat orang namun harus tetap memperhatikan kualifkasi
dan profesionalismenya. (SBY, dalam pertemuan dengan Pengurus
Besar Persatuan Guru Republik Indonesia di Bumi Perkemahan
Tawangmangu, Solo, Sabtu 14 Agustus 2004).
Harus Bisa Mengayomi
Saya akan memilih menteri agama dari NU berdasarkan
pertimbangan sosiologis. Seorang menteri agama harus bisa
mengayomi semua umat beragama, seorang muslim yang baik,
berwawasan luas, dan memiliki kepribadian baik. Pengelolaan
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 97
kehidupan beragama, toleransi dan harmoni antarumat beragama
akan menjadi tugas dan perannya. (SBY, di hadapan peserta acara
“Dialog Wawasan Kebangsaan” di Graha Samudera, Bumimoro,
Surabaya, Selasa 24 Agustus 2004).
Tidak Akan Melupakan
Saya tidak akan melupakan putra-putri terbaik Papua. Insya
Allah saya akan mengajak putra-putri terbaik Papua ikut dalam
kabinet saya. (SBY, dalam kampanye di lapangan Trikora, Abepura,
Jayapura, Jumat 4 Juni 2004).
Jika Mampu Bersaing
Saya akan mempertimbangkan putra Dayak dari Kalimantan
Tengah untuk menduduki jabatan menteri di kabinet mendatang jika
mampu bersaing dengan tokoh-tokoh dari daerah lain. Hal ini demi
terjadinya persaingan yang sehat antar semua daerah di Indonesia.
(JK, dalam dialog dengan masyarakat adat di Lembaga Musyawarah
Dayak Daerah Kalimantan Tengah, Jumat 11 Juni 2004).
Menyingsingkan Lengan
Marilah kita bekerja keras untuk menghadapi segala
tantangan berat yang dihadapi bangsa dan negara. Besok pagi, insya
Allah saya akan melantik anggota kabinet masa bakti 2004-2009.
Setelah itu, kami akan langsung menyingsingkan lengan baju untuk
merumuskan dan menjalankan langkah-langkah awal kebijakan
dan rencana aksi pemerintah. (SBY, saat menyampaikan pidato
politik pertamanya sebagai Presiden Republik Indonesia ke-6 di Istana
Merdeka, Jakarta, Rabu 20 Oktober 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
98
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Mengundurkan Diri
Apabila anggota kabinet saya terlibat dalam berbagai tindak
penyimpangan, termasuk korupsi. Dan apabila dinyatakan bersalah
oleh hukum, ia harus siap untuk mengundurkan diri dan menerima
sanksi sesuai hukum yang berarti. Sebagai pemimpin tertinggi di
pemerintahan, saya pun akan melakukan hal yang sama dengan para
menteri, menjadi pejabat yang bersih, bebas dari korupsi dan segala
bentuk penyimpangan. (SBY, saat melantik 36 menteri dan pejabat
setingkat menteri dalam Kabinet Indonesia Bersatu di Istana Negara,
Jakarta, Kamis 21 Oktober 2004).
Bisa Dipertimbangkan
Mengenai kriteria fgur yang akan duduk di kabinet, kita
akan melihat bagaimana integritas kepribadiannya, kapabilitasnya,
track recordnya, serta pengalamannya. Saya tidak melihat seseorang
dari latar belakangnya dari mana, tapi jika dia memenuhi kriteria,
bisa dipertimbangkan. (SBY, di Hotel Permata, Pacitan, Selasa 8 Juni
2004).
Agar Bisa Lebih Berperan
Saya akan memberikan empat pos menteri bagi perempuan.
Ini agar kaum perempuan Indonesia bisa lebih berperan dalam
proses politik dan pengambilan kebijakan untuk publik, baik itu
di legislatif, eksekutif maupun yudikatif. Hal ini sudah saya sudah
pikirkan secara mendalam dan rasiional. Saya terinspirasi setelah
melihat perkembangan potensi kaum perempuan di lembaga
eksekutif dan legislatif. (SBY, dalam pertemuan dengan aktivis
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 99
Gerakan Pemberdayaan Suara Perempuan di Hotel Atlet Century Park,
Senayan, Jakarta, Senin 30 Agustus 2004).
Harmoni Kehidupan
Saya akan mengajak kader dari Papua yang kapabilitas, jujur,
dan mau bekerja keras untuk masuk dalam kabinet. Ini penting untuk
menjaga harmoni kehidupan berbangsa dan bernegara. (JK, saat
berdialog dengan tokoh adat dan pemuka masyarakat di Manokwari,
Irian Jaya Barat, Rabu 25 Agustus 2004).
Pro Maupun Kontra
Saya memahami, siapapun yang dinominasi untuk menjadi
menteri atau pejabat setingkat menteri selalu ada pandangan pro
maupun kontra. Saya menyadari, tidak mungkin nama-nama itu
disetujui oleh semua kalangan atau memuaskan semua pihak. Namun
semua itu telah saya pertimbangkan secara matang dan melihat
semua aspek sesuai kriteria yang telah saya tetapkan. Bagi saya
bukan setuju atau tidak setuju, bukan pula juga soal pro atau kontra.
Tetapi mereka yang akan bertindak sebagai menteri, kinerja mereka,
kerja keras mereka, pengabdian mereka agar lima tahun mendatang
kondisi Indonesia menjadi lebih baik. Karena itu, kita harus melihat
kabinet ini secara utuh, jangan orang per orang. Yakinlah Kabinet
Indonesia Bersatu akan bekerja sesuatu tenaga untuk membuat
Indonesia menjadi lebih baik. (SBY, saat mengumumkan nama-nama
anggota Kabinet Indonesia Bersatu di Istana Negara, Jakarta, Rabu 20
Oktober 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
l00
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Karya Nyata
Saya mendengar dan memahami banyak terjadi pro dan
kontra pada pengangkatan menteri-menteri Kabinet Indonesia
Bersatu ini, bahkan ada kesanksian apakah para menteri termasuk
saya dan Pak Jusuf Kalla dapat mengemban tugas yang tidak ringan
ini. Dalam suasana demokrasi, dalam nuansa yang positif, anggaplah
itu sebagai pemicu, cambuk, dan penantang untuk bisa bekerja
dengan baik. Tidak perlu kesanksian atau keragu-raguan rakyat
terhadap saudara dijawab dengan kata-kata. Jawablah itu dengan
kerja dan karya nyata. (SBY, saat melantik 36 menteri dan pejabat
setingkat menteri dalam Kabinet Indonesia Bersatu di Istana Negara,
Jakarta, Kamis 21 Oktober 2004).
Melakukan Evaluasi
Sebelum acara pelantikan, para menteri dan jaksa agung
telah menandatangani surat pernyataan yang hakekatnya merupakan
kontrak politik antara para menteri dengan saya. Hal itu dilakukan
dengan sepenuh hati dan penuh kesadaran untuk setia kepada
pemerintah dan negara, untuk jujur dan bekerja kerjas, mengutamakan
kepentingan pemerintah dan negara diatas kepentingan partai atau
golongan. Saya akan melakukan evaluasi atas kinerja dan prestasi
mereka. Saya mengajak mereka untuk bekerja keras dan bekerja
cerdas. Lima tahun adalah waktu yang cukup untuk kita bisa
menyumbangkan sesuatu yang optimal kepada bangsa dan negara
kita. (SBY, saat melantik 36 menteri dan pejabat setingkat menteri
dalam Kabinet Indonesia Bersatu di Istana Negara, Jakarta, Kamis 21
Oktober 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l0l
Segera Dicopot
Kami akan memecat anggota kabinet yang terlibat KKN.
Itu sudah menjadi komitmen kami. Orang yang melakukan KKN
harus segera dicopot dari jabatannya, sebab mereka tidak bisa
memberikan contoh yang baik. (JK, saat bertemu pengurus dan kader
Partai Keadilan Sejahtera Sumatera Barat di Hotel Bumi Minang,
Padang, Sabtu 4 September 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
l02
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Agenda Kerja
Tema K2A
S
aya akan mengawali 100 hari pemerintahan saya dengan tema
Konsolidasi, Konsiliasi, dan Aksi (K2A). Konsolidasi artinya,
mempertegas program-program yang utama dan mendesak
bagi rakyat sebagai landasan untuk program kerja selanjutnya.
Konsiliasi, menjalin dan mempererat kembali hubungan dengan
pihak-pihak yang -- karena perbedaan kubu dan dukungan dalam
Pemilu -- telah berjarak. Aksi, melaksanakan misi pemerintahan dan
program kerja kabinet secara konsisten dan konsekwen. Saya yakin,
tema ini akan jalan dengan baik. (SBY, dalam acara open house di
kediamannya, Puri Cikeas, Gunung Putri, Bogor, Senin 27 September
2004).
Negara Modern
Ada dua agenda utama yang menjadi prioritas program
saya. Pertama, menyelamatkan kehidupan bernegara sesuai dengan
konsensus dasar negara. Indonesia harus menjadi negara modern
tetapi jangan sampai modernitas menghilangkan akar budaya.
Kedua, setelah Indonesia krisis, maka agenda pasca krisis kami
adalah menjadikan Indonesia lebih aman, adil, dan sejahtera dengan
komitmen dan kerja keras. (SBY, saat merayakan hari ulangtahun ke-
3 Partai Demokrat di Istora Senayan, Jakarta 9 September 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l03
Dewan Ekonomi dan Dewan Keamanan
Staf kepresiden selama ini belum bekerja efektif. Saya akan
memberdayakannya. Saya juga akan memberdayakan Dewan
Ekonomi Nasional dan Dewan Keamanan. Jika kedua lembaga
tersebut diperdayakan secara penuh dan efektif, akan menghasilkan
sesuatu yang baik. (SBY, saat bertemu dengan warga Jawa Timur
dari berbagai profesi, Puri Cikeas, Gunung Putri, Bogor, Senin 27
September 2004).
CATATAN: Dewan Ekonomi Nasional atau biasa disebut
DEN pernah ada pada masa kepemimpinan Presiden
Abdurrahman Wahid yang diwujudkan dengan Keppres RI
No. 144 Tahun 1999. Tujuannya, mempercepat pemulihan
ekonomi nasional dari krisis. Dengan tugas utama,
memberi nasehat kepada presiden mengenai kebijakan
ekonomi. Namun, DEN banyak dikritik karena tugasnya
dianggap tumpangtindih dengan peran serta tugas menteri.
Sementara itu, Dewan Keamanan Nasional (DKN) belum
dikenal di Indonesia. Yang ada saat ini adalah Dewan
Ketahanan Nasional (Wantanas). Wantannas yang semula
bernama Dewan Pertahanan Negara dibentuk tahun 1946
(berdasarkan Undang-Undang Nomor 6/1946). Tugasnya
antara lain merumuskan kebijakan pemerintah di bidang
ketahanan nasional.
Reformasi Birokrasi
Saya akan melakukan reformasi birokrasi. Ini adalah
tantangan berat. Meskipun membutuhkan waktu lama, tapi tetap
harus dilakukan. Reformasi birokrasi bukan hanya menyangkut
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
l04
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
struktural, melainkan juga kultural. Harus dilakukan secara
menyeluruh di departemen-departemen dan lembaga pemerintahan
lainnya. Jangan sampai uang negara dikeluarkan secara tidak
efsien sehingga pemasukannya tidak sepadan. Dengan reformasi
birokrasi, kinerja dan out put yang dihasilkan bisa lebih baik. Dengan
pemerintahan yang efsien, pengeluaran anggaran yang tidak penting
bisa ditiadakan. (SBY, di Hotel Permata, Pacitan, Selasa 8 Juni 2004).
Menghormati Kemajemukan
Ada dua agenda besar saya demi kesejahteraan rakyat, rasa
aman, dan terjaminnya rasa keadilan masyarakat. Pertama, menata
kembali sistem pemerintahan dan kenegaraan, serta menghormati
kemajemukan. Hal ini dibutuhkan untuk mengembangkan sistem
sosial politik yang berkelanjutan, dan sistem kelembagaan tata
negara, serta pemerintahan yang tahan menghadapi guncangan.
Kedua, membangun kembali Indonesia pasca krisis. Untuk ini, saya
akan melakukan penyediaan dan pemenuhan hak-hak dasar rakyat
meliputi pangan, pendidikan, kesehatan, dan keamanan. (SBY,
pidato politik pada pembukaan masa kampanye putaran pertama
Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Selasa
1 Juni 2004).
Agenda Besar
Kita kembangkan dua agenda besar kebangsaan kita ke depan.
Yang pertama, menata kembali sistem kenegaraan, pemerintahan,
dan pembangunan sesuai dengan jiwa, semangat, dan konsensus
dasar berdirinya negara kita, terutama Pancasila, UUD 1945,
keutuhan NKRI, dan berkembangnya kehidupan masyarakat yang
majemuk, yang menghormati kebhinekaan. Agenda besar pertama
ini dimaksudkan untuk mengembangkan : (a) sistem sosial-politik
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l05
yang berkelanjutan; dan (b) sistem dan kelembagaan ketatanegaraan,
pemerintahan, dan pembangunan yang tahan menghadapi
guncangan. Yang kedua, melakukan pembangunan di segala bidang,
termasuk ekonomi, politik, sosial, budaya, hukum dan HAM, serta
pertahanan dan keamanan. Agenda besar kedua ini akan kita mulai
dengan agenda khusus : membangun kembali Indonesia pasca krisis.
Inilah yang menjadi inti agenda dari reformasi gelombang kedua
yang kita canangkan. (SBY, pidato politik pada pembukaan masa
kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI
2004-2009, Jakarta, Selasa 1 Juni 2004).
Fokus di Dalam Negeri
Saya akan lebih memfokuskan waktu saya untuk persoalan-
persoalan di dalam negeri. Selama tiga bulan pertama masa
pemerintahan saya, seminim mungkin saya tidak akan bepergian
ke luar negeri. Saya akan berkeliling, mengunjungi berbagai daerah
dan melihat langsung berbagai masalah di dalam masyarakat. Jika
mungkin, sebulan sekali. Bertemu dengan petani, buruh, nelayan, dan
berbagai golongan masyarakat lainnya. Saya ingin mempelajari secara
langsung pada masyarakat berbagai persoalan yang mereka hadapi.
Di dalam negeri, banyak persoalan yang harus menjadi perhatian
sejak awal pemerintahan saya. Konfik di Poso, Aceh, Maluku dan
Atambua harus segera diselesaikan secara komprehensif. Bukan
hanya masalah keamanannya, tetapi juga masalah pendidikan dan
kesejahteraannya. (SBY, saat berdialog dengan sejumlah guru SMAN I
Cileunsi di kediamannya, Puri Cikeas, Gunung Putri, Bogor, Rabu 22
September 2004).
Diskriminasi Harus Dihapus
Kita harus memastikan bahwa diskriminasi harus dihapus di
bumi pertiwi. Untuk ini, kita harus memastikan bahwa setiap warga
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
l06
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
negara memiliki kedudukan yang sama di hadapan hukum. Juga,
profesionalisasi setiap pihak yang menangani hukum. Menghapus
peraturan yang bersifat diskriminatif dan yang melanggar prinsip
keadilan. Dan, meningkatkan kesadaran warga negara atas hak dan
kewajibannya. (SBY, pidato politik pada pembukaan masa kampanye
putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-
2009, Jakarta, Selasa 1 Juni 2004).
Indeks Pembangunan Manusia
Saya akan memberikan perhatian yang seksama pada
pendidikan, kesehatan, lingkungan, dan peningkatan peran dan
kualitas perempuan dan keluarga.
Berdasarkan indeks pembangunan manusia, bangsa Indonesia
berada di peringkat bawah di antara bangsa-bangsa di dunia. Indeks
tersebut mencerminkan keadaan harapan hidup, kemampuan literasi
dan tingkat pendidikan, serta pendapatan per kapita rakyat Indonesia
yang rendah. Kualitas sumberdaya manusia merupakan tujuan dan
sekaligus faktor utama yang menentukan keberhasilan di berbagai
bidang. Indeks pembangunan manusia (HDI) menempatkan
Indonesia pada urutan 112 dari 175 negara. Rendahnya angka HDI
yang diperoleh Indonesia mengindikasikan bahwa angka harapan
hidup, angka melek aksara, partisipasi jenjang pendidikan dasar
sampai pendidikan tinggi, serta pendapatan per kapita tergolong
rendah. (SBY, pidato politik pada penutupan masa kampanye putaran
pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta,
Kamis 1 Juli 2004).
Tali Persaudaraan
Saya akan senantiasa menjaga tali persaudaraan dengan
Ibu Megawati Soekarnoputri dan Bapak Hamzah Haz yang saya
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l07
hormati sebagai tokoh nasional. Kita perlu menjunjung tinggi
petuah Presiden Soekarno yang pernah mengingatkan, di dalam
persatuan kita berdiri, di dalam perceraian kita runtuh. (SBY, saat
menyampaikan pidato politik pertamanya sebagai presiden Republik
Indonesia ke-6 di Istana Merdeka, Jakarta, Rabu 20 Oktober 2004).
Tiga Hal Penting
Platform kami adalah mewujudkan Indonesia yang lebih
aman dan damai, yang lebih adil dan demokratis, dan yang lebih
sejahtera. Tiga hal yang tak terpisahkan. Saling terkait. Tidak ada
rasa aman tanpa keadilan dan kesejahteraan. Tidak terbangun rasa
keadilan tanpa meningkatnya kesejahteraan dan rasa aman. Dan,
tentu kesejahteraan rakyat tidak akan terwujud tanpa berkembangnya
rasa aman dan rasa adil dalam masyarakat. (SBY, pidato politik pada
penutupan masa kampanye putaran pertama Pemilihan Presiden dan
Wakil Presiden RI 2004-2009, Jakarta, Kamis 1 Juli 2004).
Tiga Perubahan Dasar
Ada tiga perubahan dasar yang akan saya lakukan. Ketiga
fondasi itu belum tampak pada pemerintahan sekarang (pemerintahan
Megawati, Ed.). Yakni, perbaikan ekonomi, penegakan supremasi
hukum, dan peningkatan kualitas pendidikan. Sewaktu saya
menjabat dulu, banyak hal yang tidak bisa saya kerjakan. Saya tahu
persis berbagai permasalahan yang dihadapi, namun karena masalah
kepemimpinan, berbagai persoalan itu tak bisa terselesaikan. Saya
keluar dari kabinet agar nanti bisa menyelesaikan permasalahan-
permasalahan itu. (JK, saat berdialog dengan Kosgoro Pengurus Daerah
Kabutan Brebes, Brebes, Senin 9 Agustus 2004).
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
l08
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Saling Percaya
Perlu tindakan nyata untuk menghilangkan ketidakadilan
dan mengembalikan rasa saling percaya di antara komponen
masyarakat. Masyarakat sering diperlakukan tidak adil sehingga
timbullah ketidakpercayaan. Ketidakadilan inilah adalah akar dari
ketidakpercayaan. Untuk membina rasa saling percaya, kita harus
mencegah tindakan-tindakan yang menimbulkan ketidakadilan
dan ketidakjujuran. Dengan begitu, akan terbentuk civil society
(masyarakat sipil) yang kokoh. Program yang akan kami lakukan
adalah memperkuat dan mengartikulasikan identitas bangsa. Yakni,
Bhineka Tunggal Ika, kerukunan antarumat beragama, harmoni
antaretnis dan integrasi sosial. (JK, Saat berkampanye di halaman
parkir GOR Segiri Samarinda, Sabtu 12 Juni 2004).
Lebih Adil
Mewujudkan Indonesia yang lebih adil lima tahun ke
depan, minimal harus dilakukan melalui pemberantasan korupsi.
Menciptakan sitem pemerintahan dan birokrasi yang bersih, akuntabel,
transparan, tanggap, efsien, dan berwibawa. Menghapuskan seluruh
peraturan dan praktek kehidupan yang bersifat diskriminatif terhadap
warga negara, kelompok, atau golongan masyarakat. Menjamin
keadilan gender dalam berbagai produk perundangan, program
pembangunan, dan kebijakan publik. Menegakkan sistem hukum.
Meningkatkan partisipasi masyarakat dalam pengambilan keputusan
publik. Berkembangnya sistem demokrasi yang menjamin kedaulatan
rakyat. Berkembangnya kebebasan pers. Berkembangnya kebebasan
beragama bagi setiap warga negara sesuai dengan keyakinannya.
Mengembangkan konsistensi peraturan dan kebijakan antarsektor,
antarwilayah, dan antara pusat dan daerah. (SBY, pidato politik pada
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l09
penutupan masa kampanye putaran pertama Pemilihan Presiden dan
Wakil Presiden RI 2004-2009, Jakarta, Kamis 1 Juli 2004).
Kehidupan Demokrasi
Dalam bidang politik kami akan mengembangkan kehidupan
demokrasi partisipasi politik rakyat yang melibatkan publik dalam
menetapkan kebijakan publik dan tahun 2009. Tipe kualitas yang lebih
demokratis, menata hubungan yang sehat antara lembaga eksekutif
dan yudikatif, melanjutkan reformasi, mengembangkan kebebasan
pers yang sudah terwujud, memberdayakan perempuan dalam
kehidupan politik, mengembangkan politik yang nondiskriminatif
sekaligus mengembangkan kehidupan yang lebih harmonis dengan
tingkat toleransi yang tinggi. (SBY-JK, pemaparan dalam acara
“Dialog Penajaman Visi, Misi, dan Program Capres-Cawapres” yang
diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton, Jakarta,
Selasa 14 September 2004)
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
ll0
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Nonkategori
Tinggal di Istana
S
aya akan tinggal di Istana. Di situ, pengaturan kegiatan
kepresidenan dari pagi hingga malam hari akan lebih mudah.
Juga memudahkan pengamanan, tamu-tamu mudah ditata,
dan saya pun tidak perlu mondar-mandir sehingga tidak terlambat
karena masalah lalulintas. Selain itu, tinggal di istana juga akan
menghemat pengeluaran. Jika di luar istana , akan ada penambahan
biaya fasilitas. Kan lebih baik bila uang tersebut dipakai untuk
memperbaiki fasilitas yang sudah ada, agar bisa digunakan untuk
presiden berikutnya. (SBY, seusai sholat Jumat di Mesjid Al-
Istiqomah, Cikeas, Desa Nagrak, Gunung Putri, Bogor, Jumat 24
September 2004).
CATATAN: Jarak kediaman SBY di Puri Cikeas Bogor
cukup jauh dari pusat pemerintahan RI.
Yakni, sekitar 50 km. Istana Kepresidenan
adalah tempat resmi kediaman dan kantor
presiden. Sebelumnya, Presiden RI yang
pernah tinggal di istana kepresidenan Jakarta
adalah Presiden Soekarno dan Abdurrahman
Wahid. Presiden Soeharto dan Habibie,
saat menjadi Presiden, memilih menetap
di kediamannya, sementara Presiden
Megawati memilih tinggal di rumah dinas
kepresidenan.
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? lll
Ajaran Universal
Saya ingin melihat umat Islam di Indonesia yang memang
mayoritas penduduknya memeluk agama ini, akan menjadi teladan
bagi umat Islam lainnya di dunia dengan menampilkan Islam yang
ramah dengan ajaran universalnya. Jabaran-jabaran ini, saya kira,
para ulamalah yang lebih mengetahuinya. Saya hanyalah salah satu
umatnya saja yang masih terus menerus membutuhkan ‘tausiyah’ dari
para ulama dan kiai. (SBY, dalam silaturahmi dengan sejumlah ulama
dan cendekiawan muslim di Asrama Haji Masyhur, Medan, Jumat 18
Juni 2004).
Tidak Suka Berjanji
Kami tidak suka berjanji, apalagi berjanji tentang hal yang
saya tidak mempunyai kewajiban untuk memenuhinya. Kami tidak
mengkomunikasikan sesuatu yang tidak kami tulis dan serahkan
kepada KPU. Kami tidak mengkomunikasikan sesuatu yang tidak
kami pikirkan secara matang, dan hanya seingat-ingatnya saja.
Sesuatu yang semua kita tahu pasti tidak melahirkan manfaat, malah
sebaliknya melahirkan ketidakkonsistenan. Ketidakkonsistenan
yang dapat membuat rakyat bingung; tetapi, tidak bisa dituntut
pertanggungjawabannya. (SBY, pidato politik pada penutupan masa
kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden
RI 2004-2009, Jakarta, Kamis 1 Juli 2004).
Bukan Urusan Keluarga
Urusan negara jangan dicampuradukan dengan urusan
keluarga. Kebijakan nasional yang berorientasi pada kepentingan
keluarga presiden dan orang-orang dekatnya dapat berakibat buruk.
Selama ini, proses pengambilan keputusan pemerintah di bawah
tanggung jawab dan kewenangan saya, tidak pernah diintervensi
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
ll2
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
atau dipengaruhi istri. Istri berurusan dengan urusan rumah tangga.
(SBY, menjawab pertanyaan salah seorang peserta dalam acara bertema
‘‘Berbenah Bersama Membangun Bangsa’’ di Hotel Hyatt Surabaya,
Sabtu 26 Juni 2004).
Sangat Mencemaskan
Saya mempunyai perhatian khusus terhadap program KB.
Program ini perlu terus mendapat perhatian dari pemerintah. Dalam
enam tahun terakhir ini, pengendalian jumlah penduduk mengendur.
Hal ini sangat mencemaskan. Setinggi apapun pertumbuhan
ekonomi, jika jumlah penduduk terus meningkat akan menjadi
masalah serius. (SBY, dalam acara “Dialog dan Silaturahmi Capres
RI dan Calih Profesi Kesehatan DPR RI dengan Masyarakat Profesi
Kesehatan,” Jakarta, Minggu 29 Agustus 2004).
CATATAN: Kekhawatiran yang sama kemudian juga
dikemukakan Megawati mantan Presiden
Indonesia, menjelang akhir masa jabatannya.
Ia sendiri heran bagaiman keberadaan program
keluarga berencana, apakah sudah berkurang
atau malah sudah mandeg sama sekali.
Menurutnya, ia tidak bisa membayangkan
apa jadinya Indonesia di tahun mendatang
jika program KB dihentikan. Jika sekitar 100
meter ada 20 anak yang digendong ibu-ibu,
dan jumlahnya makin bertambah dari hari ke
hari, ia tidak dapat membayangkan berapa
banyak anak yang akan ia temua sepanjang
jalan yang ia lewati.
Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan
Bagian Satu
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? ll3
Sudah Final
Bagi kita bangsa Indonesia, komitmen terhadap dasar negara
Pancasila sudah fnal. Komitmen terhadap negara kesatuan sudah
fnal. Komitmen terhadap UUD 1945 sudah fnal. Amandemen
terhadap beberapa pasal dari batang tubuh UUD 1945 harus tetap
sejalan dengan isi, jiwa, semangat, dan nilai-nilai yang terkandung
dalam Pembukaan UUD 1945. Tetapi yang lebih penting, amandemen
atas pasal-pasal dalam batang tubuh haruslah mencerminkan
kehendak dan aspirasi seluruh rakyat Indonesia. Amandemen tidak
boleh dilakukan untuk kepentingan suatu golongan atau hanya
kepentingan politik jangka pendek. Konstitusi adalah bangun
utama keindonesiaan kita. Komitmen untuk menumbuhsuburkan
kehidupan bermasyarakat, berbangsa, dan bernegara yang majemuk
dan yang menghargai kebhinekatunggalikaan juga sudah fnal. Kita
tidak lagi perlu memperdebatkan dan membangun konsensus baru
atas konsensus dasar berdirinya negara. Di dalam kerangka konsensus
dasar inilah kedirian kita sebagai bangsa dan keindoinesiaan
kita menemukan bentuknya. Di dalam kerangka inilah identitas
kebangsaan kita berkembang di antara bangsa-bangsa lain. (SBY,
pidato politik pada pembukaan masa kampanye putaran pertama
Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Selasa
1 Juni 2004).
1anìl dan Komltmen
yang Terslrat Darl
vlsl dan Mlsl SBY-JK
Bagian Dua
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? ll5
ll6
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK
Bagian Dua
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? ll7
Meningkatkan Saling Percaya
Kami akan meningkatkan rasa saling percaya dan harmoni
antarkelompok masyarakat untuk mencegah dan mengatasi terjadinya
peristiwa pertikaian antarkampung, desa, ataupun antargolongan.
Untuk itu, langkah yang akan kami lakukan adalah: memperkuat
harmoni yang ada dan mencegah tindakan-tindakan yang menimbulkan
ketidakadilan, sehingga terbangun masyarakat sipil (civil society)
semakin kokoh; memperkuat dan mengartikulasikan identitas bangsa
Indonesia (Bhinneka Tunggal Ika, kerukunan antarumat beragama,
harmoni antaretnis, dan integrasi sosial); memperbaiki proses
desentralisasi dan otonomi daerah yang dapat memperkuat harmoni
antar kelompok masyarakat, antar daerah, dan hubungan antarpusat
dan daerah; membangun kembali kepercayaan sosial antarkelompok
masyarakat; serta membangun kembali infrastruktur yang rusak di
daerah-daerah yang pernah dilanda kerusuhan.
Mencegah dan Menanggulangi Separatisme
Kami akan melakukan pencegahan dan penanggulangan
terhadap separatisme (gerakan untuk memisahkan diri dari NKRI).
Cara yang akan kami tempuh adalah dengan: melakukan pemerataan
pembangunan antardaerah; meningkatkan kesejahteraan masyarakat
di daerah konfik;.memperbaiki akses masyarakat lokal pada sumber-
daya ekonomi; meningkatkan mutu pelaksanaan otonomi dan
desentralisasi; serta menindak secara tegas separatisme dan sekaligus
menghormati hak-hak masyarakat sipil.
Menegakkan Hukum dan Ketertiban
Kami akan menegakkan hukum dan ketertiban serta
melakukan langkah-langkah pencegahan dan penanggulangan
kriminalitas. Untuk itu, kami akan: menegakkan hukum dengan
Bagian Dua
Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK
ll8
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
tegas, adil dan tidak diskriminatif; memperkuat atau meningkatkan
kemampuan lembaga keamanan negara; meningkatkan peran serta
masyarakat untuk mencegah kriminalitas dan gangguan keamanan
dan ketertiban di tempat tinggalnya masing-masing; menanggulangi
dan mencegah tumbuhnya permasalahan yang berkaitan dengan
penggunaan dan penyebaran narkoba; meningkatkan kesadaran
akan hak-hak dan kewajiban hukum masyarakat; serta memperkuat
kerjasama internasional untuk memerangi kriminalitas dan kejahatan
lintas negara.
Mencegah Terorisme
Kami akan melakukan pencegahan dan penanggulangan
gerakan terorisme. Untuk itu kami akan: menyusun dan menerapkan
kerangka hukum antiterorisme yang efektif; meningkatkan
kemampuan dan kapasitas kelembagaan antiterorisme; menjaga
dan memelihara integritas bangsa dan negara Indonesia; dan
meningkatkan kerjasama internasional untuk secara obyektif
memerangi terorisme.
Meningkatkan Kemampuan Pertahanan
Kami akan meningkatkan kemampuan pertahanan negara.
Untuk itu, program yang akan kami lakukan adalah: meningkatkan
profesionalisme anggota TNI dalam menghadapi ancaman dan
gangguan termasuk pencegahan serta penanggulangan separatisme;
memodernisasi peralatan pertahanan negara; dan meningkatkan
kesejahteraan prajurit.
Memantapkan Politik Luar Negeri
Kami akan memantapkan politik luar negeri dan
meningkatkan kerjasama internasional. Kami akan mencanangkan
Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK
Bagian Dua
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? ll9
antara lain: meningkatkan kualitas diplomasi Indonesia dalam rangka
memperjuangkan kepentingan nasional; melanjutkan komitmen
Indonesia terhadap pembentukan identitas dan pemantapan
integrasi regional; serta melanjutkan komitmen Indonesia terhadap
upaya-upaya pemantapan perdamaian dunia.
Membenahi Sistem dan Politik Hukum
Kami akan membenahi sistem dan politik hukum yang
menjamin penegakan dan kepastian hukum. Langkah yang akan
kami lakukan adalah: memperkuat upaya-upaya pemberantasan KKN
dan kroniisme; meningkatkan profesionalisme dan kualitas sistem
peradilan; menyederhanakan sistem peradilan dan memastikan bahwa
hukum diterapkan dengan adil, yaitu memihak pada kebenaran;
meningkatkan kapasitas dan kualitas lembaga keamanan, pertahanan,
dan ketertiban; menghormati dan memperkuat kearifan-kearifan dan
hukum adat yang ber bersifat sifat lokal untuk memperkaya sistem
hukum dan peraturan; menghormati persamaan setiap warga negara
di depan hukum, melalui keteladanan kepala negara dan jajarannya
dalam mematuhi dan menaati hukum; serta meningkatkan kerjasama
internasional untuk menciptakan kawasan yang aman, damai, adil
dan kondusif untuk meningkatkan kesejahteraan.
Menciptakan Tata Pemerintahan yang Bersih
Kami akan menciptakan tata pemerintahan yang bersih dan
berwibawa (good governance). Untuk itu, program-program yang
akan kami lakukan adalah: mempertegas tugas, wewenang, dan
tanggungjawab dari seluruh kelembagaan negara/pemerintahan,
yang berdasarkan mekanisme checks and balances yang simetris;
menyelenggarakan pembinaan dan pengembangan aparatur negara/
pemerintahan, termasuk anggota TNI dan Polri; meningkatkan
Bagian Dua
Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK
l20
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
kesejahteraan aparatur negara/pemerintahan, anggota TNI dan Polri,
dan pensiunan/purnawirawan; mewujudkan sistem dan mekanisme
kerja aparatur negara/pemerintahan yang efektif, efsien dan akuntabel,
dalam rangka pelayanan kepada publik; meningkatkan pengawasan
untuk menjamin akuntabilitas, transparansi, dan perbaikan kinerja
aparatur negara/pemerintahan, termasuk anggota TNI dan Polri;
menciptakan iklim usaha yang mendorong berkembangnya etika
usaha yang sehat dan terlaksananya tata kelola perusahaan yang baik
(good corporate governance).
Menghapus Diskriminasi
Kami akan menghapuskan diskriminasi. Langkah-langkah
dan kebijakan yang akan kami tempuh adalah: memastikan setiap
warga negara memiliki kedudukan yang sama di hadapan hukum;
menegakkan hukum dengan adil, melalui perbaikan sistem hukum
yang profesional, bersih, dan berwibawa; menghapus peraturan
yang ber bersifat sifat diskriminatif; dan yang melanggar prinsip
keadilan; serta meningkatkan kesadaran warga negara atas hak dan
kewajibannya.
Mengembangkan Kebudayaan
Kami akan mengembangkan seluas-luasnya kebudayaan
yang berlandaskan pada nilai-nilai luhur. Untuk itu, kebijakan yang
akan kami ambil adalah: mendorong terciptanya wadah yang terbuka
dan demokratis bagi dialog kebudayaan agar benturan-benturan
yang terjadi tidak sampai melebar menjadi konfik sosial; mendorong
tuntasnya proses modernisasi yang dicirikan dengan terwujudnya
negara kebangsaan Indonesia modern yang berkelanjutan, dan
menguatnya masyarakat sipil (civil society); reaktualisasi nilai-nilai
kearifan lokal sebagai salah satu dasar pengembangan etika pergaulan
Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK
Bagian Dua
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l2l
sosial untuk memperkuat identitas nasional; dan meningkatkan
kecintaan masyarakat terhadap budaya dan produk-produk dalam
negeri.
Meningkatkan Kualitas Proses Desentralisasi dan
Otonomi
Kami akan meningkatkan kualitas proses desentralisasi
dan otonomi daerah. Untuk itu, kebijakan yang akan kami lakukan
antara lain: menyempurnakan Undang-undang No. 22/ 1999 dan
No. 25/1999 untuk menciptakan otonomi daerah yang lebih efektif
dan akuntabel serta perimbangan keuangan pusat-daerah yang
bertanggung-jawab; menyempurnakan seluruh peraturan pusat dan
daerah dalam rangka revitalisasi otonomi daerah; serta mendorong
peningkatan kerja sama antar pemerintah daerah.
Menjamin Penghormatan dan Pengakuan Atas HAM
Kami akan menjamin penghormatan dan pengakuan
atas HAM. Langkah-langkah yang akan kami lakukan adalah:
meningkatkan profesionalisme lembaga keamanan dan pertahanan
negara; menegakkan hukum secara adil, konsekuen, dan tidak
diskriminatif; meningkatkan kerjasama yang harmonis antarkelompok
atau golongan dalam masyarakat, agar mampu saling memahami
dan menghormati keyakinan dan pendapat masing-masing; serta
memperkuat dan melakukan konsolidasi demokrasi.
Meningkatkan Peran Perempuan
Kami akan meningkatkan kualitas kehidupan dan peran
perempuan. Untuk itu, program dan kebijakan yang akan kami ambil
adalah: memajukan tingkat keterlibatan perempuan dalam proses
Bagian Dua
Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK
l22
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
politik dan jabatan publik; meningkatkan taraf pendidikan dan
layanan kesehatan serta program-program lain untuk mempertinggi
kualitas hidup dan sumberdaya kaum perempuan; meningkatkan
kampanye anti kekerasan terhadap perempuan dan anak-anak;
menyempurnakan perangkat hukum pidana yang lebih lengkap
dalam melindungi setiap individu dari kekerasan dalam rumah
tangga; meningkatkan kualitas pendidikan dan pengasuhan anak.
Menciptakan Kesempatan Kerja
Kami akan melakukan perbaikan dan menciptakan
kesempatan kerja. Untuk itu, kebijakan yang akan kami tempuh
adalah: menciptakan landasan kuat, memajukan perekonomian,
dan menumbuhkan kepercayaan akan kemampuan bangsa
sendiri; menciptakan kepastian hukum, peraturan, dan rasa aman
untuk berusaha dan bekerja; merevitalisasi hubungan industrial
tripartit, yang mendorong terciptanya lapangan kerja yang luas
dan menyejahterakan; mencapai dan mempertahankan tingkat
pertumbuhan ekonomi yang memadai, berkualitas, dan dinamis;
meningkatkan kualitas dan memperbaiki akses rakyat terhadap
pendidikan; memperbaiki akses rakyat terhadap layanan kesehatan;
revitalisasi pertanian dan aktivitas-aktivitas ekonomi pedesaan;
revitalisasi sektor kelautan dan aktivitas-aktivitas ekonomi wilayah
pesisir, dalam rangka mendayagunakan potensi negara kepulauan;
mendorong pelaksanaan reforma agraria; meningkatkan kuantitas dan
kualitas infrastruktur; menerapkan kebijakan fskal yang ditargetkan
dengan lebih tepat dan bertanggungjawab; mengembangkan
industri yang memiliki daya saing dan menyediakan kesempatan
kerja; mendorong perkembangan usaha mikro, kecil, dan menengah
(UMKM); meningkatkan daya saing ekonomi pedesaan dan UMKM
melalui pengembangan dan penerapan ilmu dan teknologi yang tepat
Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK
Bagian Dua
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l23
guna; mendukung mekanisme pasar yang efsien dan berkeadilan
termasuk mengembangkan pasar-pasar tradisional dalam jaringan
perdagangan yang sehat; meningkatkan usaha perbaikan akses
sektor riil, terutama pelaku UMKM, terhadap permodalan/kredit
perbankan dan lembaga keuangan lainnya; meningkatkan kualitas
layanan yang dapat meningkatkan daya saing dan perlindungan
sumberdaya manusia Indonesia di pasar tenaga kerja internasional;
memperbaiki dan meningkatkan peran Indonesia dalam kerjasama
ekonomi antarnegara.
Meningkatkan Kinerja dan Stabilitas Ekonomi Makro
Kami akan meningkatkan kinerja dan stabilitas ekonomi
makro. Langkah-langkah yang akan kami ambil antara lain:
memformulasikan APBN yang memberikan prioritas penciptaan
lapangan kerja melalui pertumbuhan ekonomi yang berkelanjutan;
mengelola kebijakan fskal, termasuk pengelolaan utang publik, secara
lebih efektif, efsien, dan bertanggung-jawab; menyempurnakan
kebijakan sektor Perminyakan dan Gas Bumi dalam rangka
peningkatan penerimaan negara dari sektor migas; meningkatkan
koordinasi kebijakan fskal dan moneter antara Pemerintah dan
Bank Indonesia, dengan tetap menjaga peran masing-masing, untuk
lebih meningkatkan pembangunan ekonomi nasional; menciptakan
iklim usaha yang sehat dan transparan; meningkatkan daya-saing
ekonomi melalui peningkatan mutu dan produktivitas, yang
antara lain dapat dicapai melalui invensi, inovasi, dan teknologi;
meningkatkan upaya-upaya penyehatan dan penertiban lembaga
keuangan dan perbankan; merevitalisasi pengelolaan aset-aset
negara, serta mendorong terwujudnya pengelolaan BUMN secara
efsien dan bertanggung-jawab; memperbaiki dan meningkatkan
peran Indonesia dalam kerjasama ekonomi antarnegara.
Bagian Dua
Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK
l24
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Menghapus Kemiskinan
Kami akan berupaya menghapus kemiskinan. Kebijakan-
kebijakan yang akan kami ambil adalah: memperbaiki mutu
layanan pendidikan dan kesehatan, dan meningkatkan akses
penduduk miskin terhadap layanan-layanan tersebut; meningkatkan
ketahanan pangan masyarakat; meningkatkan akses penduduk untuk
memperoleh perumahan yang layak; memperbaiki iklim usaha,
sehingga mampu membuka peluang bekerja; revitalisasi pertanian
dan aktivitas ekonomi pedesaan tempat penduduk miskin banyak
bekerja dan bermukim; revitalisasi kelautan dan aktivitas ekonomi
daerah pesisir; meningkatkan kuantitas dan kualitas infrastruktur di
pedesaan dan daerah terpencil; memperbaiki akses penduduk miskin
pada sumberdaya ekonomi; menerapkan kebijakan APBN dengan
target penciptaan lapangan kerja, pengurangan pengangguran, dan
pengurangan secara bertahap jumlah penduduk miskin.
Meningkatkan Akses Rakyat Terhadap Pendidikan
Kami akan meningkatkan akses rakyat terhadap pendidikan.
Program dan kebijakan yang akan kami lakukan adalah: meningkatkan
pelaksanaan wajib belajar 9 tahun; memberikan akses yang lebih
besar kepada kelompok masyarakat yang selama ini kurang dapat
terjangkau oleh layanan pendidikan, seperti masyarakat miskin,
masyarakat yang tinggal di daerah terpencil, masyarakat di daerah-
daerah konfik, ataupun masyarakat penyandang cacat; meningkatkan
penyediaan pendidikan keterampilan dan kewirausahaan ataupun
pendidikan nonformal yang bermutu; meningkatkan penyediaan
dan pemerataan sarana-sarana pendidikan dan tenaga pendidik;
meningkatkan kompetensi dan profesionalisme tenaga pendidik;
meningkatkan kesejahteraan tenaga pendidik agar lebih mampu
Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK
Bagian Dua
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l25
mengembangkan kompetensinya; menyempurnakan manajemen
pendidikan dan meningkatkan partisipasi masyarakat dalam proses
perbaikan mutu pendidikan pendidikan; meningkatkan kualitas
kurikulum dan pelaksanaannya yang bertujuan membentuk karakter
dan kecakapan hidup, sehingga peserta didik mampu memecahkan
berbagai masalah kehidupan secara kreatif dan menjadi manusia
produktif.
Meningkatkan Akses Rakyat Terhadap Layanan Kesehatan
Kami akan meningkatkan akses rakyat terhadap layanan
kesehatan yang lebih berkualitas. Program dan kebijakan yang akan
kami lakukan adalah: meningkatkan jumlah, jaringan dan kualitas
pusat kesehatan masyarakat; meningkatkan kuantitas dan kualitas
SDM tenaga medis; mengembangkan sistem jaminan kesehatan,
terutama bagi rakyat miskin; meningkatkan sosialisasi kesehatan
lingkungan dan pola hidup sehat; meningkatkan pendidikan
kesehatan kepada masyarakat yang dimulai sejak usia kanak-kanak;
meningkatkan pemerataan dan kualitas fasilitas kesehatan dasar.
Menghapus Ketimpangan
Kami akan melakukan penghapusan ketimpangan dalam
berbagai bentuknya.Tindakan-tindakan yang akan kami ambil
adalah: memperbaiki pemerataan kesejahteraan rakyat desa-kota,
Jawa-Luar Jawa, dan Kawasan Timur Indonesia - Kawasan Barat
Indonesia; meningkatkan pemerataan dan memperbaiki kuantitas
dan kualitas infrastruktur antar daerah; memperbaiki akses
petani dan penduduk pedesaan terhadap sumberdaya ekonomi;
meningkatkan akses UMKM terhadap sumber permodalan, dan
mendukung kerjasama yang sinergi dan adil dengan usaha skala
Bagian Dua
Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK
l26
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
besar; memastikan bahwa pembangunan tidak mengorbankan
keberlanjutan daya dukung lingkungan dan mengurangi kesempatan
yang dapat dinikmati oleh generasi yang akan datang; meningkatkan
pemerataan dan meningkatkan peluang dan daya tarik investasi
antar daerah; memperbaiki kualitas proses pelaksanaan otonomi
dan desentralisasi desentralisasi; meningkatkan penghormatan
terhadap hak-hak perempuan dan anak anak; secara sistematis
mengurangi beban utang negara melalui pengelolaan utang yang
bertanggungjawab; serta melindungi produsen Indonesia yang
efsien dan kompetitif dari persaingan usaha yang tidak adil.
Memperbaiki Pengelolaaan Sumberdaya Alam
Kami akan melakukan perbaikan pengelolaaan sumberdaya
alam dan pelestarian mutu lingkungan hidup. Program dan kebijakan
yang akan kami tempuh antara lain: menegakkan hukum dan
menyerasikan aturan mengenai pengelolaan sumberdaya alam dan
lingkungan: menciptakan sistem insentif dan disinsentif yang tegas
dalam pengelolaan sumberdaya alam dan lingkungan; memperbaiki
koordinasi lintas departemen dalam pengendalian pengelolaan
sumberdaya alam dan lingkungan; melibatkan masyarakat lokal dan
gerakan masyarakat sipil (civil society) secara sistemik dalam upaya
pengelolaan sumberdaya alam dan lingkungan; menindak secara
tegas dan efektif praktik-praktik penyelewengan pengawasan dan
pengendalian pengelolaan sumberdaya alam dan lingkungan yang
dilakukan oleh aparat birokrasi.
Merevitalisasi Pertanian dan Pedesaan
Kami akan merevitalisasi pertanian dan pedesaan. Untuk
itu, program yang akan kami canangkan antara lain: meningkatkan
kesejahteraan dan kualitas hidup petani dan rumah tangga petani;
meningkatkan akses petani terhadap sumber daya produktif dan
Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK
Bagian Dua
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l27
permodalan; meningkatkan produktivitas dan kualitas petani dan
pertanian; mengembangkan diverifkasi aktivitas ekonomi pedesaan;
mengembangkan industrialisasi pedesaan; melaksanakan reforma
agraria; dan membangun infrastruktur pertanian dan pedesaan.
(SUMBER: Naskah Visi, Misi, dan Program SBY-JK: Membangun
Indonesia yang Aman, Adil, dan Sejahtera).
Bagian Dua
Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK
l28
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l29
Bagian Tiga
Data dan Angka
Sebagai Indikator Janji
Data dan Angka
Media Massa
D
ata dan angka di bawah ini sempat terekam dan
terpublikasikan oleh media massa sejak awal hingga
menjelang akhir 2004. Artinya, pada saat SBY
melontarkan janji-janji dan komitmennya, data dan angka di bawah
ini adalah nyata. Jadikan data dan angka ini sebagai indikator. Jika
hingga akhir masa jabatannya (tahun 2009 nanti), lebih dari 50 persen
data dan angka ini berubah ke arah membaik, itu berarti SBY-JK
telah berhasil membuktikan janj-janji perubahan yang selama ini
mereka dengung-dengungkan.
= Sejak tahun 2002 hingga 2004 ada 1000 kasus korupsi yang
diajukan ke pengadilan. Tapi jumlah pelaku yang dipenjara
bisa dihitung dengan jari.
= Hingga awal tahun 2004, kasus BLBI belum terselesaikan.
Dari 58 perkara, baru 16 kasus yang telah diproses. Sisanya
dibiarkan mengendap. Ada yang diperlambat, ada juga yang
dihentikan penyidikannya. Sepuluh pelaku telah lari ke luar
negeri.
= Administrasi pengiriman TKI ke luar negeri masih sangat
amburadul. Tak ada kordinasi dan sinkronisasi antara Depdagri,
Depkeh, Depnaker, Deplu, dan PJTKI. Akibatnya, banyak
Data dan Angka Sebagai Indikator Janji
Bagian Tiga
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l3l
Bagian Tiga
Data dan Angka Sebagai Indikator Janji
l32
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
terjadi KKN dan manipulasi. Pemalsuan identitas seperti
yang dialami dua TKI -- Casingkem dan Istiqomah-- yang
disandera di Irak adalah salah satu contoh.
= Data terakhir dari Bappenas menyebutkan, tahun 2004 jumlah
pengangguran terbuka mencapai 10.83 juta orang. Dengan
asumsi pertumbuhan ekonomi 5,03 persen, dalam setahun
diperkirakan angka ini akan mencapai 11,19 juta orang. Belum
terhitung jumlah pengangguran tak kentara yang jumlahnya
40 juta orang.
= Tiap tahun, jumlah pencari kerja di Indonesia mencapai 3, 16
juta jiwa sementara lapangan kerja yang tersedia hanya cukup
untuk diisi 1,75 juta orang.
= 53 persen masyarakat miskin di Indonesia adalah petani dan
nelayan. Padahal Indonesia terkenal sebagai negara agraris dan
negara maritim terbesar di dunia.
= Dalam banyak kebijaksanaan pengadaan bahan pangan,
Indonesia sering lebih memilih melakukan impor. Padahal,
Indonesia merupakan penghasil beras terbesar ke-3 di dunia,
penghasil kopi nomor 4 di dunia, penghasil coklat nomor 4 di
dunia, dan penghasil nomor 1 lada putih di dunia.
= Daya saing Indonesia, menurut World Economic Forum dalam
laporan Te Global Competitivenes Report tahun 2004, berada
pada peringkat ke-69 dari 104 negara di dunia. Bandingkan
dengan Malaysia yang berada di posisi 31, Tailand yang
berada di posisi 34 atau Singapura yang berada di posisi 7.
Data dan Angka Sebagai Indikator Janji
Bagian Tiga
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l33
= Menurut Indeks potensi tambang, Indonesia berada di ututan
ke-16 dari 47 negara. Ini berarti dunia telah mempelajari
Indonesia memiliki potensi tambang yang bagus. Lucunya,
aktivitas eksplorasi di Indonesia justru mandeg sejak empat
tahun lalu. Akibatnya, 10 persen dari 7.000 ahli geologi
Indonesia banting profesi menjadi karyawan bank atau
wartawan. Bahkan banyak di antaranya yang kemudian menjadi
pengacara (pengangguran cari acara).
= Nilai ekspor produk perikanan Indonesia yang hanya 1,49
miliar dolar AS menempatkan Indonesia pada posisi ke-12
negara pengekspor produk perikanan dunia, jauh di bawah
Tailand (posisi ke-2) yang memiliki sumber daya terbatas
dan jauh di bawah potensi yang dimiliki Indonesia.
= Indonesia, menurut data Business Software Alliance (BSA),
menduduki peringkat keempat dari 20 besar negara dengan
tingkat pembajakan piranti lunak (software) tertinggi di
dunia. Indonesia hanya dikalahkan oleh Cina, Vietnam, dan
Ukraina. Tingkat pembajakan peranti lunak di Indonesia
mencapai 88 persen. Itu artinya, dari 100 persen komputer
yang menggunakan software, 88 di antaranya menggunakan
software tidak berlisensi alias bajakan.
=Dalam banyak kebijakan, Indonesia masih berorientasi pada
sektor daratan. Sektor bahari sering terabaikan. Akibatnya,
setiap tahun bermiliar dollar ikan dicuri nelayan asing.
Maklum, sebanyak 60 persen transpor laut domestik dilakukan
oleh perusahaan asing.
= Kasus-kasus pelanggaran HAM banyak yang belum
Bagian Tiga
Data dan Angka Sebagai Indikator Janji
l34
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
terselesaikan atau proses pengadilannya belum tuntas. Misalnya,
peristiwa Mei, peristiwa Trisakti dan Semanggi, penyerangan
kantor PDI-P tahun 1996, masa DOM di Aceh dan Papua,
Tanjung Priok dan Talangsari Lampung, peristiwa ‘petrus’, dan
lain-lain.
= Berdasarkan survei Biro Kosultan Resiko Politik dan Ekonomi
(PERC), Indonesia adalah negara terkorup di Asia dengan
nilai (skala 1 sampai 10 dari yang paling bersih hingga yang
paling kotor) 9,25 persen. Bandingngkan dengan Singapura
yang hanya mencapai 0,50 persen atau Jepang 3,50 persen..
= Angka kematian ibu melahirkan di Indonesia tercatat paling
tinggi di Asia Tenggara, yakni 470 per 100 ribu persalinan.
Kematian terjadi karena tiga hal yang berhubungan dengan
kesehatan: tekanan darah tinggi pada ibu mengandung,
terjadinya pendarahan saat persalinan, dan infeksi sebelum dan
sesudah persalinan.
= Penduduk miskin Indonesia telah mencapai 37 juta jiwa atau
15 juta keluarga. Dari jumlah itu, 3 juta jiwa terdiri dari anak
terlantar yang lari ke jalanan. Anak terlantar ini yang kemudian
menjadi baik hanya sejumlah 25 persen.
=Di Indonesia, menurut data terakhir Unicef, ada sekitar 2,1
juta pekerja anak yang terdiri atas 1,2 juta anak laki-laki dan
871 ribu anak perempuan. Mereka adalah anak yang harus
bekerja dengan jam kerja panjang dan tanpa perlindungan yang
memadai. Sebagian dari mereka ini adalah anak putus sekolah.
Bahkan ada yang tidak pernah bersekolah sama sekali.
Data dan Angka Sebagai Indikator Janji
Bagian Tiga
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l35
= Transparency International pada akhir tahun 2004
menempatkan Indonesia pada posisi ke-5 negara terkorup
dari 146 negara yang disurvei. Posisi ini sama dengan Angola,
Republik Demokratik Kongo, Pantai Gading, Georgia,
Tajikistan, dan Turkmenistan. Padahal sebelumnya Indonesia
berada pada posisi ke-6.
=Penyelewengan uang negara yang terjadi di Indonesia antara
1999-2004, menurut BPK, mencapai Rp 166,5 triliun. Jumlah
itu, belum termasuk hasil-hasil pemeriksaan atas perhitungan
APBD propinsi/kabupaten/kota yang dimanfaatkan DPRD
dalam pengawasan pelaksanaan APBD itu Pelanggaran BLBI
merupakan yang terbesar, yakni Rp 144 triliun. Lembaga
negara yang paling tinggi tingkat penyelewengannya adalah
Kejaksaan Agung, dengan persentase 51,8 persen.
=Dari nilai APBN 2004 sebesar Rp584 triliun, sebanyak Rp23
triliun telah dikorupsi. Namun, banyak kasus korupsi itu yang
sulit diungkap.
=Departemen Pendidikan Nasional diduga telah melakukan
korupsi sebesar Rp 150 milyar selama tahun 2003. Korupsi
dilakukan sehubungan dengan pengadaan buku2 pelajaran
matematika. Menurut Lembaga Swadaya Masyarakat Peduli
Pendidikan Bangsa yang melaporkan kasus ini ke penyidik
Mabes Polri, korupsi seperti ini sering terjadi dan akan makin
sering terjadi jika terus dibiarkan.
=Setiap perusahaan Indonesia harus mengalokasikan dana
mereka 50 persen untuk bahan baku, 15 persen untuk tenaga
kerja, 10 persen untuk biaya lain-lain, dan 15 persen lainnya
Bagian Tiga
Data dan Angka Sebagai Indikator Janji
l36
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
untuk biaya yang tidak bisa dipertanggungjawabkan alias
pungutan liar.
=Survei terhadap 100 anak jalanan yang dilakukan Data
Informasi Anak/YKAI menunjukkan hanya 10 persen anak
jalanan yang pernah terjangkau oleh program penanganan,
baik yang dilaksanakan oleh pemerintah maupun oleh lembaga
swadaya masyarakat.
=Salah satu masalah kesehatan lingkungan yang belum
terakomodasi adalah ketersediaan air bersih. Hingga kini
cakupan nasional baru mencapai sekitar 60 persen. Artinya
masih ada 40 persen atau sekitar 90 jutaan rakyat Indonesia
terpaksa mempergunakan air yang tak layak secara kesehatan
untuk kehidupan sehari-hari.
=Bank Dunia mengakui, 30 persen dari kredit mereka ke
Indonesia, telah dikorup oleh pihak-pihak tertentu di
Indonesia. Jika nilai 30 persen ini diasumsikanberlaku pada
semua pinjaman ke Indonesia hingga kini, nilainya akan sangat
luar biasa.
=Menurut peringkat Human Development Index (HDI)
2004 yang dikeluarkan oleh United Nations Development
Programme (UNDP), Indonesia berada di peringkat 111 dari
175 negara. Ini berarti, kualitas manusia Indonesia dari segi
ekonomi, pendidikan, dan kesehatan berada pada posisi yang
sangat jauh terbelakang. Bandingkan dengan Malasya (58).
Atau Brunei (33), Singapura (25), dan Filipina (83).
Data dan Angka Sebagai Indikator Janji
Bagian Tiga
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l37
=Laut Indonesia sangat luas. Tetapi pulau-pulaunya tidak terawat.
Dari 17.504 pulau, 9634 ribu tidak bernama. Bagaimana kita
bisa mempertahankan pulau kita sementara nama saja kita tak
punya.
=Di tengah pertumbuhan ekonomi yang hanya 4 persen dan
penerimaan negara yang pas-pasan seperti keadaan saat ini,
justru impor mobil mewah terus mengalir, pembangunan
apartemen mewah terus menjamur, rumah-rumah mewah
tumbuh di mana-mana bak cendawan di musim hujan.
Distribusi kekayaan telah berlangsung tidak adil, ada jalan
tikus yang hanya bisa dilewati oleh orang-orang tertentu dan
tidak bisa dilewati oleh orang kebanyakan.
=Tingkat pengangguran di Indonesia sepanjang tahun 2004
sudah berada pada batas mengkhawatirkan, yakni 10.2 persen.
Lebih tinggi dari tingkat pengangguran setahun sebelumnya
yang hanya 9.8 persen. Angka tersebut akan lebih mengerikan
bila kita memasukkan jumlah pengangguran terselubung, atau
mereka yang bekerja kurang dari 40 jam seminggu.
=Indonesia sebagai salah satu negara dengan kondisi ekonomi
miskin tengah ‘dibantu’ oleh lembaga-lembaga keuangan
internasional (misalnya, IMF). Negara-negara miskin seperti
Kenya dan Ethiopea juga sudah ‘dibantu’ oleh IMF dengan
memaksakan perdagangan bebas. Negara-negara tersebut
memang ‘terbantu’, tapi bukan menuju kemakmuran, melainkan
menuju keterpurukan ekonomi yang panjang.
=Data terakhir menunjukkan, penderita AIDS di Indonesia
Bagian Tiga
Data dan Angka Sebagai Indikator Janji
l38
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
berjumlah 1.413 orang, sedangkan positif HIV 2.746 orang.
Jumlah total orang dengan HIV/AIDS (ODHA) menjadi
4.159 orang. Namun karena fenomena AIDS/HIV ini seperti
gunung es, maka diperkirakan jumlah sebenarnya berkisar
antara 90.000 sampai 130.000. Jumlah ini diperkirakan terus
akan bertambah.
=Setelah bom di Kuta Bali 12 Oktober 2002, Hotel Mariott
Jakarta 5 Agustus 2003, dan di depan Kedutaan Besar
Australia di Jakarta 9 September 2004, banyak orang yang
mengkhawatirkan akan ada bom susulan yang sama, lebih
besar atau bahkan lebih luar biasa besar dari bom yang pernah
ada.
=30 juta dollar AS dari 105 miliar dollar AS yang pernah
disalurkan Bank Pembangunan Asia (ADB) sejak lembaga
tersebut terbentuk tahun 1996, dikorupsi oleh negara-negara
penerima, salah satunya oleh Indonesia yang merupakan
peminjam terbesar.
=Dibanding negara lain di Asia, angka kematian ibu di Indonesia
masih relatif tinggi, yaitu 37 orang persepuluh ribu penduduk.
Sedangkan Sri Lanka hanya delapan persepuluh ribu, dan
RRC hanya tujuh. Tiap tahun angka kematian ibu Indonesia
mencapai angka 20.000.
=Syarat lingkungan yang sehat bagi makhluk hidup di perkotaan
semakin sering diabaikan. Di Jakarta, misalnya. Ada 10 juta
penduduk dengan 2,3 juta mobil dan 1,5 juta motor yang
berkeliaran setiap hari menyebarkan zat beracun CO2, CO,
Data dan Angka Sebagai Indikator Janji
Bagian Tiga
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l39
HC, NOX, SPM dan debu dengan jumlah yang makin lama
makin meningkat.
=Memperoleh pendidikan adalah hak asasi setiap warga bangsa
yang dijamin konstitusi. Namun, hingga kini akses memperoleh
pendidikan belumlah merata. Data terakhir dari Survei Sosial
Ekonomi Nasional menyebutkan, APM (angka partisipasi
murni) hanya tinggi pada jenjang SD (92,5 persen), sementara
pada jenjang SMP dan SMA masih sangat rendah. Yakni
63,5 persen (SMP) dan 40,6 persen (SMA). Survei ini juga
membuktikan, masyarakat di perkotaan angka partisipasinya
lebih tinggi dari masyarakat pedesaan. Yakni, 71,9 persen
(SLTP) dan 56,1 persen (SLTA) sementara di pedesaan hanya
54,1 persen (SLTP) dan 28,7 persen (SLTA).
=Menurut Asosiasi Pengerah Jasa Tenaga Kerja Indonesia
Cianjur (APJATIC) hampir 70 persen tenaga kerja di lima
negara Timur Tengah seperti Abu Dhabi, Oman, Jordania,
Bahrain, dan Qatar (kecuali Kuwait dan Arab Saudi) merupakan
tenaga kerja yang diberangkatkan secara nonprosedural.
Artinya, paspor dan identitas yang mereka pakai memang asli,
tapi fotonya sudah diganti dengan foto orang lain.
=Kemiskinan masih menjadi faktor hambatan utama untuk
mengakses pendidikan. Masyarakat miskin di Indonesia
jumlahnya 38,4 persen atau 17,6 persen dari total jumlah
penduduk
=Menurut Komisi Penanggulangan HIV/Aids Daerah (KPAD),
propinsi Papua menduduki ranking ke tiga terbanyak penderita
Bagian Tiga
Data dan Angka Sebagai Indikator Janji
l40
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
HIV/Aids di Asia dengan jumlah angka mencapai 1689 kasus.
Rangking lainnya diduduki oleh Cina dan India.
=World Investment Report 2004 menempatkan Indonesia di
urutan ke-139 dari 144 negara yang paling diinginkan sebagai
negara tujuan investasi di dunia. Indonesia hanya lebih baik
daripada beberapa negara di Amerika Tengah serta Suriname.
Negara yang paling diminati para penanam modal adalah
Belgia, Luksemburg, dan Brunei Darussalam.
=Hasil riset Indonesia Corruption Watch (ICW) dan
Greenomics menyimpulkan, hampir semua perusahaan HPH
dan HTI terlibat korupsi eksploitasi kayu. Korupsi dilakukan
dengan 44 modus operandi dan melibatkan oknum pemerintah
dan aparat. Akibat korupsi tersebut, hutan menjadi rusak dan
negara dirugikan triliunan rupiah.
=Pemberlakuan otsus di Propinsi Papua dinilai telah gagal karena
sejak digulirkan dengan kucuran dana mencapai triliunan
rupiah, 2,4 juta rakyat Papua masih hidup terbelakang, miskin,
dan bodoh. Otsus hanya dimanfaatkan oleh para pejabat Papua
sebagai alat legitimasi melakukan KKN dengan mengobjekkan
kemiskinan rakyat. Pernyataan tersebut dikeluarkan oleh Papua
Wacth dan Front Pemuda Papua.
=Berdasarkan hasil survei nasional terhadap pelajar dari tingkat
SLTP hingga tinngkat perguruan tinggi, Badan Narkotika
Nasional menyimpulkan 3,9 persen pelajar Indonesia terlibat
narkoba. Dari tingkat pendidikan, kelompok yang paling banyak
mengonsumsi narkoba adalah kalangan mahasiswa (9,9 persen),
SLTA (4,8 persen), dan SLTP (1,4 persen). Sementara itu
Data dan Angka Sebagai Indikator Janji
Bagian Tiga
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l4l
temuan Tim Kelompok Kerja Pemberantasan Penyalahgunaan
Narkoba Depdiknas tahun 2004 menyimpulkan, 70 persen
dari 4 juta pecandu narkoba tercatat sebagai anak usia sekolah,
yakni berusia 14 hingga 20 tahun.
=Dari segi mutu, perguruan tinggi di Indonesia tidak ‘dihitung’
di tingkat dunia, bahkan di tingkat Asia sekalipun. Berdasarkan
peringkat universitas terbaik di Asia versi majalah Asiaweek,
tidak satu pun perguruan tinggi di Indonesia masuk dalam 20
terbaik.
=Banyak guru pegawai negeri sipil yang beralih profesi sementara
Indonesia masih kekurangan tenaga guru. Guru SD yang
beralih mencari pekerjaan lain mencapai jumlah 50,6 persen,
guru SMP 28,4, dan guru SMA sebanyak 16,3 persen.
=Menurut Indonesia Corruption Watch (ICW), ada 153 kasus
korupsi, yang melibatkan legislatif dan eksekutif di sejumlah
daerah. Pelaku terbanyak adalah pihak eksekutif daerah (67
persen) dan anggota DPRD (33 persen). Dari 153 kasus
tersebut, Jawab Barat berada di peringkat pertama dengan 26
kasus disusul Jawa Timur (21 kasus), Jawa Tengah (15 kasus)
dan Nanggroe Aceh Darussalam (15 kasus).
=Pendidikan pada anak-anak usia dini terkesan diabaikan.
Padahal, dunia internasional sudah menyepakati perlunya
untuk memberikan perhatian terhadap masalah pendidikan
pada anak-anak usia dini sebagaimana ditegaskan dalam
komitmen Education for All di Jomtien, Tailand, 1990 yang
dipertegas lagi melalui Deklarasi Dakar-Sinegal (2000) dan
komitmen World Fit for Children (New York, 2002). Saat ini
Bagian Tiga
Data dan Angka Sebagai Indikator Janji
l42
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
baru sekitar 28 persen anak usia dini, 0-6 tahun yang terlayani
pendidikannya. Mereka terlayani di Bina Keluarga Balita (9,6
persen), Taman Kanak-Kanak (6,5 persen), Raudhatul Athfal
(1,4 persen), Kelompok Bermain (0,13 persen), dan di Taman
Penitipan Anak (0,05 persen), lainnya (9,9 persen) terlayani di
SD.
=Belum ada Keppres atau peraturan tegas yang melarang guru
menjual buku pelajaran di sekolah. Padahal, kegiatan seperti
ini sudah berlangsung lama. Akibatnya, buku teks wajib yang
disubsidi pemerintah setiap tahun dengan dana ratusan miliar
menjadi mubazir alias tidak berguna.
=Berdasarkan hasil penelitian Efektivitas Pendekatan Keluarga
Dalam penanganan Anak Jalanan Balitbang Departemen
Sosial RI, jumlah anak jalanan yang tersebar di kota-kota besar
di seluruh Indonesia diperkirakan mencapai lebih dari 40.000
orang.
=Karena tidak puas dengan penanganan rumah sakit di
Indonesia, setiap tahun WNI menghabiskan biaya sekitar 600
juta dolar AS atau senilai Rp 5,4 triliun untuk berobat ke luar
negeri. Padahal di Indonesia terdapat 1.000 lebih rumah sakit
swasta dan 600 lebih rumah sakit pemerintah.
= Salah satu hal yang sering dituding sebagai penyebab rendahnya
mutu pendidikan di Indonesia adalah rendahnya gaji pengajar.
Gaji profesor di Indonesia hanya Rp 2,4 juta, hampir sama
dengan gaji seorang supir busway di Jakarta yang Rp 2 juta per
bulan.
Data dan Angka Sebagai Indikator Janji
Bagian Tiga
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l43
= Indonesia adalah negara yang banyak bertumpu pada bidang
pertanian, namun jumlah sekolah pertanian dari tahun ke tahun
terus menurun. Pada tahun 1996 jumlah sekolah pertanian di
seluruh Indonesia tercatat 200 sekolah. Namun, di tahun 2004
jumlahnya menurun hingga tinggal 116 sekolah.
= Hasil pemeriksaan BPK tahun anggaran 2004 terhadap
lembaga atau departemen menyimpulkan, penyalahgunaan
uang negara paling banyak terjadi di lembaga Kejaksaan Agung
RI. Jumlahnya mencapai 51,80 persen dari cakupan anggaran
yang diperiksa (Rp 618 miliar), yakni sebesar Rp 320 miliar.
= Dari hari ke hari jumlah kasus malpraktik kedokteran di
Indonesia semakin meningkat. Salah satu penyebabnya adalah
belum ditetapkannya prosedur standar operasional (Standard
Operational Procedure/SOP) pelayanan kesehatan di rumah
sakit. Penyebab lain, tenaga medis tidak melengkapi pasiennya
dengan medical record sehingga komunikasi dapat tetap
terbangun antara dokter dan pasiennya. Menurut Bank Dunia,
70 persen dokter Indonesia tidak membuat medical record atau
catatan medik perkembangan penyakit serta terapi yang pernah
diberikan pada pasiennya.
=Indonesia memiliki sekitar 8.000 jenis ikan hias air tawar dan
laut atau 60 persen dari seluruh jenis ikan hias yang ada di
dunia. Akan tetapi, Indonesia hanya mampu menutup 6 persen
dari seluruh perdagangan ikan hias dunia atau senilai 182,67
juta dollar AS.
=Indonesia memiliki sumber daya hayati yang melimpah, yakni
Bagian Tiga
Data dan Angka Sebagai Indikator Janji
l44
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
sebesar 16,7 persen dari kekayaan dunia. Namun kekayaan
tersebut belum memberikan kontribusi yang signifkan untuk
ketahanan pangan.
= Menurut Komnas Perempuan, kekerasan berbasis gender yang
menimpa perempuan mengalami peningkatan dari tahun ke
tahun. Pada tahun 2001 terdapat 3.169 kasus yang dilaporkan
ke Lembaga Bantuan Hukum APIK. Pada tahun 2002 angka
itu meningkat menjadi 5.163 kasus dan tahun 2003 ada 5.934
kasus. Dari jumlah tersebut, 54 persen terjadi di lingkungan
komunitas, termasuk di dalamnya di daerah konfik bersenjata,
dan sisanya berlangsung di lingkungan korban. Dari jumlah
itu, pengaduan paling banyak menyangkut kasus-kasus tekanan
terhadap perempuan berkenaan dengan masalah ekonomi,
psikis, fsik dan seksual.
= Dalam bidang efsiensi bisnis, Indonesia terus mengalami
penurunan. Pada tahun 2004, Indonesia berada di peringkat
58 di antara 60 negara. Penyebabnya antara lain, peraturan
yang berbelit, tingginya pajak, pungutan liar di mana-mana,
dan keamanan yang tidak kondusif.
= Di bidang teknologi informasi, Indonesia masih terpuruk.
Dalam bidang penggunaan internet misalnya, penetrasi
penggunaan internet di Indonesia kurang dari 4 persen
dibandingkan total jumlah penduduk. Bandingkan dengan
Malasya, jumlah pengguna internetnya telah mencapai 34
persen dari total jumlah penduduknya yang berjumlah 25,6
juta orang.
Data dan Angka Sebagai Indikator Janji
Bagian Tiga
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l45
= Jumlah dokter di Indonesia masih kurang. Untuk melayani
penduduk yang jumlahnya 220 juta orang Indonesia hanya
memiliki dokter sejumlah 45 ribu orang. Bandingkan dengan
Kuba yang penduduknya hanya 12 juta, tetapi memiliki dokter
sebanyak 67 ribu orang.
= Utang luar negeri Indonesia kini sudah mendekati Rp 1.500 triliun
atau sekira 150 miliar dolar AS, baik utang pemerintah maupun
swasta. Dengan jumlah utang sebesar itu, setiap bayi yang baru
lahir pun sudah memiliki beban utang sekira Rp 7 juta.
= Berdasarkan data Badan Planologi Departemen Kehutanan,
luas kerusakan hutan dan lahan di seluruh Indonesia, mencapai
46,3 juta hektar (ha). Di Sumatera 16,2 juta ha, Kalimantan
14,6 juta ha, Sulawesi 4,3 juta ha, Jawa 4,2 juta ha, Bali, Nusa
Tenggara, Maluku, dan Papua 7,0 juta ha. Dari luasan tersebut,
22,6 juta ha merupakan kawasan hutan, dan sisanya di luar
kawasan hutan. Seluas 16,8 juta ha di antaranya terletak di
kawasan hutan produksi, terdiri atas hutan produksi seluas
7,8 juta ha, hutan produksi terbatas 3,3 juta ha, serta hutan
produksi yang dapat dikonversi 5,7 juta ha.
= Perhatian pemerintah terhadap pendidikan anak usia dini
terkesan rendah. Dari sekitar 5.000 unit lembaga pendidikan
anak usia dini yang ada saat ini, seperti Taman Kanak-Kanak,
Kelompok Bermain, Bina Keluarga Balita, atau Taman
Penitipan Anak, hampir seluruhnya disediakan, dikelola
dan dibiayai oleh masyarakat sendiri. Pemerintah hanya
menyediakan sebagian kecilnya, yakni kurang dari 300 unit.
Bagian Tiga
Data dan Angka Sebagai Indikator Janji
l46
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
= Menurut data WHO, angka kebutaan di Indonesia menduduki
peringkat kedua dari 11 negara Asia. Jumlah penduduk
Indonesia yang mengalami kebutaan kini berkisar 1,6 juta jiwa
atau 1,5 persen dari jumlah penduduk, dan setiap satu menit
diperkirakan terjadi satu kasus kebutaan baru.
= Ada sejumlah kasus korupsi di Kejaksaan Agung yang
dihentikan penyelidikannya atau tersangkanya terkatung-
katung terkatung-katung tanpa ada penyelesaian dan kejelasan.
Contohnya, kasusBLBI, kasus pipanisasi di Pulau Jawa, kasus
proyek Hutan Tanaman Industri di Sumatera Selatan, kasus
Kanindotex, proyek Technical Assitance Contract (TAC)
antara Pertamina dan Perta Oil, kasus dana pinjaman Bahana
Pembinaan Usaha Indonesia, kasus pendistribusian minyak
goreng, dan masih banyak lagi.
= Masalah TBC masih menjadi problema serius di Indonesia.
Menurut data Rumah Sakit “Prof DR Sulianti Saroso”, setiap
tahun, dari 583 ribu kasus TBC di Indonesia, 140 ribu di
antaranya meninggal dunia. Jika dihitung rata-ratanya, hampir
setiap hari ada 425 orang meninggal akibat TBC. Seandainya
1 orang pasien bisa menularkan ke 10 orang, pada tahun
berikutnya jumlah yang tertular TBC adalah 5,8 juta orang.
= Data terakhir menyebutkan, kasus perdagangan perempuan di
Indonesia mengalami lonjakan sebanyak 880 persen. Dari 32
kasus pada tahun 2002 menjadi 283 kasus pada tahun 2003. Ini
belum termasuk kasus yang langsung dilaporkan pada polisi
atau merupakan temuan kepolisian. Sebuah LSM di Batam
menemukan 166 kasus perdagangan perempuan, sementara di
Solo dilaporkan ada 15 kasus perdagangan anak untuk tujuan
seksual komersial.
Data dan Angka Sebagai Indikator Janji
Bagian Tiga
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l47
Data dan Angka
Warisan Megawati
M
egawati yang menjadi Presiden RI selama tiga tahun
sejak 21 Juli 2001 dalam pidatonya di depan Sidang
MPR (23 September 2004) mewariskan data dan
angka berikut untuk SBY. Akankah akan ada perubahan dalam masa
pemerintahan SBY-JK? Kita lihat saja nanti:
• Jumlah penduduk miskin: 37,3 juta orang (17,4 persen dari
seluruh penduduk Indonesia).
• Jumlah kematian bayi: 35 per seribu kelahiran hidup
• Jumlah kelahiran: 2,6 anak per wanita usia produktif
• Jumlah kematian balita: 46 per seribu kelahiran hidup
• Jumlah kematian ibu: 307 per seratus ribu kelahiran hidup
• Angka harapan hidup: 66 tahun
• Jumlah perempuan yang “melek” huruf: 87 persen
• Angka partisipasi sekolah kelompok umur 7-12 tahun: 95
persen
• Angka partisipasi sekolah kelompok umur 13-15 tahun: 80
persen
• Cadangan devisa: 36,3 miliar dollar AS
• Pertumbuhan ekonomi: 4,1 persen
• Nilai tukar rata-rata rupiah: Rp 8.572 per dollar AS
Bagian Tiga
Data dan Angka Sebagai Indikator Janji
l48
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
• Defsit APBN: 2,1 persen dari produk domestik bruto (PDB)
• Stok Utang Pemerintah: 69 persen dari produk domestik bruto
(PDB)
• Pertumbuhan ekspor: 5,1 persen
• Pertumbuhan impor: 5 persen
• Nilai ekspor 61,1 miliar dollar AS
• Nilai impor: 32,6 miliar dollar AS
• Pendapatan per kapita : 1.000 dollar AS
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l49
Darl Mereka yang
Menunggu Realisasi
Janji
Bagian Empat
Bagian Empat
Dari Mereka yang Menunggu Realisasi Janji
l50
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Dari Mereka yang Menunggu Realisasi Janji
Bagian Empat
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l5l
Dari Mereka yang
Menunggu Realisasi Janji
”Apa yang ada harapkan dari janji dan komitmen SBY-JK?”
ini adalah pertanyaan yang saya lontarkan di berbagai mailing list
internet maupun pertanyaan secara langsung. Hasilnya, sungguh di
luar dugaan, komentar dan opini yang masuknya jumlahnya mencapai
angka ribuan. Untungnya, dengan bantuan Studio KataKata (Pusat
Informasi dan Data Bisnis), saya berhasil mendatanya secara detail.
Berikut adalah beberapa komentar dan opini pilihan yang saya
anggap layak untuk dimuat di sini.
Kasihan Dong…!
Saya cuma berharap, SBY tidak jadi pemimpin yang otoriter
nantinya. Di berbagai negara, banyak pemimpin yang pada masa
kampanye berjanji membela rakyat dengan mulut yang berbusa-
busa. Tapi begitu terpilih, kebalikannya yang terjadi. Rakyat yang
ditekan dan diperas. Tentu saja rakyat tak biasa berbuat apa-apa. Di
saat rakyat memaksa diri untuk berbuat apa-apa, pemimping akan
bersikap otoriter. Nanti setelah ada pemilu dan dia mencalonkan
diri lagi, ia akan kembali melontarkan janji-janjinya membela
rakyat dengan mulut yang berbusa-busa. Kalau mulut terus-terusan
berbusa-busa, kasihan dong dia.
Aru Sagala
arusagala@yahoo.com
Pengamat, Gorontalo
Bagian Empat
Dari Mereka yang Menunggu Realisasi Janji
l52
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Sepotong Surat
Pak SBY-JK, saya sering dengar, sering baca semua janji-
janjimu. Itulah sebabnya, saya menulis surat ini.
Nama saya Heidy Prameswari Suharto, biasa dipanggil
Memez. Sekarang umur saya 21 tahun. Saya bekerja sebagai reporter
infotainment (Pak SBY pernah nonton infotainment ga sih?). Saya
belum lulus kuliah, jadi saya hanya bekerja sesuai dengan kemampuan
minimal saat ini. Syarat standar pekerjaan adalah memiliki ijazah S1.
Saya cuma SMA, saya sempat kuliah tapi karena ketidakadaan biaya,
terpaksa saya berhenti dan kemudian bekerja.
Terus terang, waktu pemilu kemarin saya golput. Soalnya,
saya pesimis akan ada pemimpin yang benar-benar perduli soal
pendidikan.
Harapan saya dari janji-janji Pak SBY-JK, hanya satu.
Tolonglah pendidikan benar-benar diperdulikan seperti janji-janjimu.
Saya adalah salah satu orang yang tidak bisa menikmati pendidikan
sampai selesai. Malu loh Pak, kalau ngobrol dengan teman-teman
yang kuliah di luar negeri. Mereka lebih bangga dengan pendidikan
di Malaysia, Singapura, Amerika, dan lain-lain. Padahal, waktu dulu,
Malaysia belajarnya dari indonesia ya, Pak?
Sekian saja harapan saya. Semoga bapak berkenan
membacanya.
Heidy Prameswari Suharto
heidy_suharto@yahoo.com
Bukan Cuma Retorika
Moga-moga tekad SBY soal perubahan bukan cuma retorika
doang. Harus ada bukti kongkrit. Rakyat yang sudah mendukungnya
Dari Mereka yang Menunggu Realisasi Janji
Bagian Empat
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l53
ingin bukti, bukan sekedar janji. Perlu adanya pemaparan
perencanaan yang detil dan jelas. Janji-janji yang tidak didukung
dengan perencanaan yang konkrit, biasanya akan dengan mudah
tertiup angin. Berputar-putar di udara dan kemudian terhempas di
suatu tempat yang entah di mana. Pada akhirnya, rakyat yang kecewa.
Jangan sampai rakyat dibegitukan deh.
Kurnia Bintang
kurniabintang@yahoo.com
Makassar
Tak Banyak Berharap
Tak banyak harapan saya dari janji-janji SBY-JK. Tapi
masih ada setitik harapan: semoga semakin tinggi penghargaan
dan komitmen seluruh bangsa atas nilai-nilai dasar ketuhanan,
kemanusiaan, persatuaan dan kesatuan, kebenaran dan keadilan.
Resweet Kurniawan
resweet@linuxmail.org
Demi Kepercayaan
Menyimak janji-janji Pak SBY-JK, aku cuma berharap,
pemerintah yang baru hasil demokrasi yang jujur dan adil ini,
dapat mengatasi pengangguran dengan cepat dan tepat. Gunakan
sumber daya yang ada, jangan terlalu berharap pada negara lain. Kita
mempuyai SDM dan SDA yang melimpah ruah. Jika tidak bisa
mengoptimalkannya dalam lima tahun pertama, maka akan sangat
disayangkan. Sebab, kepercayaan yang telah kami (rakyat) berikan
besar sekali. Demi pemerintahan yang sehat, kami percayakan
Bagian Empat
Dari Mereka yang Menunggu Realisasi Janji
l54
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
kepadamu wahai presiden dan segenap wakil rakyat. Berjuang
dengan berlandaskan hati nurani.
Juta
july_910000@yahoo.co.uk
Pekerja web design dan multimedia
Denpasar
Bidang Keamanan
Saya banyak berharap janji-janji di bidang keamanan, agar
pembakaran dan pengrusakan rumah ibadah tidak terjadi lagi.
Konfik bisa dan akan terus terjadi jika tak ada Undang-undang
atau Keppres yang mengatur hal ini secara tegas. Saya tunggu janji-
janjimu, Pak SBY-JK.
Yakub Sulistyo. S.T. MA
yakub@indo.net.id
Pendeta, Ambarawa
Kami Mencatat
Saya menaruh harapan kepada Bapak SBY-JK. Kami
mencatat janji-janjimu. Jadi, jangan mengecewakan rakyat yang
telah memilih.
Saya, sebagai lulusan di bidang hukum dan kini bekerja
sebagai legal ofcer di salah satu perbankan, menaruh harapan
serius atas janji-janji di bidang hukum. Jangan sampai kita mencari
keadilan tetapi yang kita dapat malah ketidakadilan. Jangan karena
melaporkan kehilangan kambing, kita malah kehilangan sapi.
Selain itu, mohon hendaknya diperhatikan soal penerimaan
PNS. Di situ sering terjadi sogok menyogok. Setelah diterima, si
Dari Mereka yang Menunggu Realisasi Janji
Bagian Empat
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l55
pegawai akan melakukan korupsi untuk mengganti uang sogokan
yang telah ia berikan. Itu saja.
Reynhard Parulian
traja661973@yahoo.com
Pegawai Swasta, Jakarta
Manis Waktu Kampanye, Pahitlah Sesudahnya
Janji-janji harus ditepati. Jangan hanya manis waktu
berkampanye saja, sesudah itu pahitlah yang kita dapat. Perhatikan
rakyat kecil. Jangan dulu berkeliling dunia untuk menghambur-
hamburkan uang rakyat. Usahakan mengurangi hutang-hutang
negara sehingga rakyat tidak menderita menanggung beban hutang-
hutang itu. Segala macam bentuk korupsi harus ditumpas. Buktikan
terlaksananya pendidikan berbiaya murah. Turunkan harga sembako
agar rakyat kecil bisa hidup dengan penuh gizi.
Leo
Leo@dprin.go.id
Tidak Mungkin
Untuk memberantas korupsi, seperti janji SBY-JK, rasanya
tidak mungkin. Yang mungkin adalah meminimalisasi seminim
mungkin terjadinya korupsi. Di negera-negara lain, hal ini pun
berlaku. Sekuat apapun upaya yang mereka lakukan, korupsi akan
tetap ada.
Dalam upaya memberantas eh meminimalisasi korupsi, saya
berharap SBY-JK berhati-hati dengan muka-muka manis yang berada
di sekelilingnya. Kelompok lingkaran dalam (inner circle) ini sering
Bagian Empat
Dari Mereka yang Menunggu Realisasi Janji
l56
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
saya lihat dalam tayangan-tayangan televisi selalu berada di sekitar
SBY-JK dalam berbagai acara. Pengalamana sudah membuktikan,
salah satu presiden kita terjungkal gara-gara adanya lingkaran
dalam seperti itu. Jika tak hati-hati, mereka bisa jadi penghambat
terwujudnya janji-janji SBY-JK kepada rakyat. Waspadalah!
Noval Alamrie
novalalamrie@yahoo.com
Bekasi
Realisasi Janji
Ada dua hal realisasi dari janji-janji Pak SBY yang akan
selalu saya tunggu:
Pertama, saya sedih sekali jika melihat berita-berita di TV seputar
dunia kriminal. Semakin hari semakin banyak kejahatan khususnya
pemerkosaan dan pembunuhan terhadap anak dibawah umur. Dan
tersangka paling-paling dijerat hukuman maksimum lima tahun
penjara. Apakah itu adil ? Setelah diperkosa lalu dibunuh secara
sadis?Apakah hukum di Indonesia hanya sebatas itu ?
Kedua, mengenai kasus bom yang sedang melanda
Indonesia...di beritakan di televisi, tersangka Bom Marriot hanya
dihukum tga sampai 10 Tahun. Saya berpikir...enak sekali, setelah
keluar pasti mereka akan melakukan hal serupa.
Saya berharap, di masa kepemimpinan Pak SBY hukum
akan benar-benar ditegaskan sehingga akan mengurangi berbagai
tindak kejahatan. Orang akan berpikir dua kali untuk melakukan
tindak kejahatan apabila ada hukum yang tegas.
Eunike Tina Astuti
tina@beringin.co.id
Salatiga
Dari Mereka yang Menunggu Realisasi Janji
Bagian Empat
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l57
Penegakan Hukum dan Penyakit Kronis
Dari janji-janji SBY-JK, saya hanya berharap: penegakan
hukum bisa segera direalisasikan. Jika itu terwujud, berbagai
hal akan menjadi baik. Aparat negara tidak bisa lagi seenaknya
menyelewengkan kekuasaannya dalam mejalankan wewenangnya.
Kalangan bisnis akan mempunyai keyakinan lebih dalam berinvestasi.
Bidang ketenagakerjaan pun perlahan tapi pasti akan bisa teratasi.
Mengenai korupsi, semua pasti tahu bahwa KKN adalah
salah satu penyakit kronis di republik tercinta ini. Sudah tidak
terhitung lagi kerugian yang diakibatkannya. Jadi, sudah selayaknya
dibasmi. Yang penting, mentalitas dan moralitas aparat penegak
hukum harus diluruskan dulu. Jangan bersandar pada materialitas.
Jarot Mulyawan
jarot@danwood.co.id
Karyawan di Semarang
Kehidupan Beragama
Saya menunggu janji SBY-JK untuk menghapus kebijakan
yang bersifat diskriminasi. Apakah janji ini juga menyangkut
penghapusan diskriminasi dalam kehidupan beragama? Soalnya,
saya melihat diskriminasi yang identik dengan minoritas, khususnya
di bidang kehidupan beragama, ternyata masih menjadi satu bagian
yang tidak bisa dilepas oleh masyarakat Indonesia. Padahal, bahwa
agama adalah hak setiap manusia, hak setiap individu. Semoga
dengan penghapusan hal-hal yang berbau diskriminasi, kita bisa
hidup rukun dan damai walaupun berbeda agama. Tanggung jawab
pemerintalah untuk menciptakan kondisi yang tidak memihak.
Bagian Empat
Dari Mereka yang Menunggu Realisasi Janji
l58
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Sebagai pemimpin, tugas merekalah untuk memberi teladan kepada
masyarakat Indonesia.
Ririn Teguh Setyowati
ritesnts@yahoo.com
Sekretaris, Surabaya
Supremasi Hukum
Tak perlu terlalu banyak berharap dari janji-janji. Yang
penting, tegakkan terlebih dahulu supremasi hukum di Indonesia.
Pertama-tama, di lingkungan peradilan, Kejaksaan Agung dan
Mahkamah Agung termasuk juga di kepolisian. Pilih orang-orang
yang track recordnya bagus, taat beragama, berani, nonpartisan (di
luar orang partai), tidak mementingkan dunia (bisa dilihat dari
kehidupan sehari-harinya termasuk harta yang dimiliki).
Kalau hukum sudah tegak, baru kita bicara yang lain.
Penuntasan korupsi lemah karena hukum yang tidak berjalan.Begitu
pula dengan ekonomi, pendidikan, kesehatan, dsb..........Berapa
banyak dana bantuan yang bocor...bahkan di Departemen Agama?
Maka wajar jika kita mengalami krisis yang berkepanjangan...Allah
telah menghukum kita, karena kita tidak berani menindak orang
yang salah.
Sunaryadi
Sunaryadi@conocophillips.com
Karyawan, Bandung
Dulu Juga Begitu
Saya jadi ingat jaman dulu. Sekitar 36 tahun silam Soeharto
berjanji akan memberangus korupsi yang disisakan rezim Soekarno.
Dari Mereka yang Menunggu Realisasi Janji
Bagian Empat
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l59
Kita pun menunggu penuh harap. Yang terjadi kemudian adalah
korupsi menjadi lebih ‘aman’ dilakukan sepanjang kekuasaan
Soeharto.
Tiga presiden sesudahnya juga menjanjikan hal yang sama.
Andai saja masa jabatan ketiga presiden itu sepanjang masa jabatan
Soeharto pula, entah apa yang akan terjadi.
Kini SBY-JK naik ke tampuk kekuasaan, hendaklah harapan
yang tersisa 36 tahun silam itu diwujudkan. Sehingga 36 tahun
berikutnya, tak perlu ada anak cucu yang menulis seperti saya ini.
Eko Yanche Edrie
ekoyanche@yahoo.com.sg
Padang
Perempuan dan Anak
Perempuan dan anak-anak adalah korban yang paling
menderita karena adanya konfik yang terjadi di beberapa daerah
di Indonesia. Di Aceh, Kalimantan Barat, Poso, Maluku Utara,
Maluku dan Papua. Tidak jarang para isteri kehilangan suami dan
kemudian menjadi orang tua tunggal dalam kondisi yang tidak siap.
Kekurangan pendidikan dan keterampilan, kehilangan harta benda
untuk modal usaha, dan menderita trauma pasca konfik. Semua itu
dapat menghambat hubungan psikososialnya yang dapat berakibat
ketidakmampuan mengasuh anak-anaknya dengan baik.
Sesuai janji, kami mengharap agar dalam 100 hari pertama
pemerintahan SBY-JK ada kebijakan dan program pemulihan
trauma pasca konfik. Khususnya bagi perempuan dan anak,
termasuk pemberdayaan perempuan serta dukungan permodalan
tanpa agunan. Sehingga ibu-ibu, khususnya yang terpaksa berfungsi
Bagian Empat
Dari Mereka yang Menunggu Realisasi Janji
l60
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
sebagai orang tua tunggal, mampu bekerja dan berusaha untuk
kehidupan keluarganya.
Kepada anak-anak di daerah konfik mohon diberikan
pendidikan khusus tanpa biaya sehingga mereka tidak menjadi ‘lost
generation’, tetapi tetap menjadi anak Indonesia yang cerdas dan
ceria, siap sebagai generasi penerus bangsa.
Parjoko Midjan
parjoko_m@yahoo.com
Depok
Tiga Aturan
Demi terwujudnya janji-janji perubahan, ada tiga aturan
yang saya harap bisa dilakukan oleh SBY-JK. Yakni, pertama, SBY-
JK harus takut kepada Allah SWT, dengan menjalankan semua
perintah dan laranganNya. Kedua, SBY-JK harus berani memberi
contoh kepada kita rakyat Indonesia, tentang bagaimana hukum
ditegakkan tanpa pandang bulu, bahkan kalau perlu anak presiden
pun jika bersalah harus dihukum. Ketiga, SBY-JK harus berani
memberikan contoh tentang penerapan pola hidup sederhana
dan kehidupan yang bersih dari KKN, sehingga semua anggota
kabinetnya akan mengikuti langkah mereka.
Firman Z. Camil
frman_camil@singgar-mulia.co.id
Pegawai, Jakarta
Sedikit Masukan
Saya ada sedikit masukkan sehubungan dengan janji-janji
SBY-JK. Saya sangat berharap pemerintah akan benar-benar dapat
Dari Mereka yang Menunggu Realisasi Janji
Bagian Empat
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l6l
membantu perekonomian masyarakat secara merata, terutama
masyarakat golongan menengah ke bawah. Mungkin bisa dengan
cara penyediaan lapangan kerja yang seluas-luasnya atau dengan
pemberian modal untuk berwirausaha, sehingga mereka bisa
terlepas dari ketergantungan orang lain. Modal itu sendiri bukan
hanya berupa uang ataupun barang, tetapi bisa berupa pendidikan
keterampilan ataupun tempat usaha. Dan sebaiknya pemberian modal
ini tidak hanya diberikan begitu saja, harus ada pengembangannya,
misalkan jika pemerintah memberikan modal berdagang, maka
para pedagang tersebut harus terus dibimbing hingga akhirnya ia
mampu mengembangkan usahanya dan tidak berketergantungan
pada pemerintah lagi.
Semoga saja suatu saat nanti, ketika saya berangkat di pagi
hari ataupun pulang di malam hari tidak ada lagi anak-anak dijalanan
yang mengamen dan meminta-meminta untuk mencari makan dan
untuk membayar sekolah mereka sendiri. Semoga negara ini suatu
saat nanti dapat melaksanakan amanat UUD ‘45 dan memiliki
pemerintahan yang sungguh-sungguh bekerja untuk melayani dan
melindungi masyarakatnya.
Hary
hary_jkt@yahoo.com
Jakarta
Lebih Merata
Ada janji berarti ada harapan. Saya hanya berharap agar
pembangunan bisa lebih merata. Tidak hanya di Jakarta saja, tetapi
juga di seluruh kota lain di Indonesia. Saya juga berharap agar
pemerintah menggunakan uang pajak dengan bijaksana sehingga
Indonesia menjadi lebih maju dan masyarakatnya tidak lagi segan
membayar pajak.
Andre Prasetya
saikyo_kun@yahoo.com.sg
Programmer, Jakarta
Bagian Empat
Dari Mereka yang Menunggu Realisasi Janji
l62
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Masalah Perbukuan
Guna terwujudnya janji-janji SBY-JK, saya berharap
pemerintahan mereka juga memperhatikan masalah perbukuan.
Buku mahal karena harga kertas mahal, karena penerbit harus
memberikan diskon yang besar ke toko buku. Sementara itu,
penerbit kesulitan untuk memberikan royalti yang pantas untuk
pengarang, karena hal itu akan menambah mahal biaya produksi dan
ujung-ujungnya harga buku menjadi lebih mahal lagi. Malangnya,
semua itu akan menyebabkan kaum cerdik pandai kita malas untuk
sungguh-sungguh menulis sesuai bidang ilmunya untuk dijadikan
sebuah buku.
Saeno M. Abdi
sae24x@yahoo.com
Karyawan Perusahaan Penerbitan
Jakarta
Harus Independen
Tak ada lagi yang kami inginkan selain terjadinya perubahan.
Siapa yang berjanji, dialah yang merubah. Jangan sampai, orang
seenaknya berjanji, kami rakyat kecil yang menderita. Untuk itu, saya
menyarankan, lepaskan baju, celana, cincin, topi, pakaian dalam --
atau apapun yang bisa dilepaskan -- yang ada hubungannya dengan
partai atau golongan. Semuanya -- presiden, wakil presiden, ketua
MPR, wakil ketua MPR, anggota kabinet, dan lain-lain-- haruslah
independen dan senantiasa profesional. Dengan begitu, “confict of
interest” yang selama ini menjadi cikal bakal lahirnya KKN dapat
dihindari.
Dalam setiap kebijakan dan keputusan, selalu (3X)
pikirkanlah akibatnya dari kacamata rakyat kecil. Apa untungnya,
apa ruginya. Kalau bisa, biarlah rakyat yang menanggung untung,
Dari Mereka yang Menunggu Realisasi Janji
Bagian Empat
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l63
dan pejabatlah yang menanggung ruginya. Jangan sampai yang
terjadi justru sebaliknya seperti yang selama ini kami alami.
RozalMaas
Rozal.Maas@petrochina.co.id
Jakarta
Tidak Muluk
Saya tidak muluk-muluk mengharapkan janji yang muluk-
muluk. Saya cuma berharap perekonomian kita bisa normal lagi
sehingga pengangguran menjadi berkurang dan kejahatan menurun,
Indonesia bebas dari KKN, supremasi hukum tidak pandang bulu,
keamanan terkendali, agar nasib rakyat kecil seperti saya dan yang
lainnya bisa menjadi makmur, tenang, aman, dan damai. Hanya itu,
tak ada harapan yang muluk-muluk!
Trisna Mukti Andri
precon@telkom.net
Programmer, Karawang
Sedang Terpekur
Saya adalah seorang pengangguran yang kini sedang
terpekur menanti bukti dari janji-janji. Jauh sebelum cahaya
kehidupan (yang masih berupa janji-janji itu) datang, saya memang
sudah menganggur. Sudah lima tahun deh predikat itu saya emban.
Padahal umur saya sudah hampir 30 tahun. Capek memang, tapi apa
mau dikata. Berbagai jurus lamaran sudah saya keluarkan, berbagai
cara sudah saya lakoni, tapi setiap diterima bekerja, saya hanya
ditempatkan sebagai sales. Padahal, saya sama sekali tidak berbakat di
situ. Sebagai sales, maka saya harus mencari pelanggan. Dan ini dia,
Bagian Empat
Dari Mereka yang Menunggu Realisasi Janji
l64
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
banyak orang tak tahu susahnya mencari pelanggan sama susahnya
dengan mencari pekerjaan itu sendiri. Akibatnya, ya saya kembali
lagi jadi pengangguran. Terus-terusan jadi pengangguran deh.
Sebenarnya, saya menaruh harapan banyak pada era
presiden-presiden sebelumnya. Tapi apa mau dikata, uang negara
yang bertrilyun2 rupiah hanya habis untuk membiayai berbagai
perseteruan antarsaudara kita sendiri. Untuk rapat MPR-DPR saja
bisa habis bermilyar-milyar rupiah. Belum lagi untuk biaya berbagai
kunjungan kerja yang kita sendiri tak tahu untuk apa dan apa
hasilnya. Alangkah bijaknya jika anggaran sebanyak itu diberikan
saja kepada kaum pengangguran seperti saya untuk dijadikan modal
memulai sebuah usaha mandiri.
Pak SBY-JK, janji-janji untuk menuntaskan masalah
pengangguran dan membuka lapangan kerja baru, merupakan cahaya
bagi saya, bagi 40 juta rakyat Indonesia yang sama statusnya seperti
saya. Kami tunggu.
Romi Irwanto
tom_irawan@yahoo.com
Kebebasan Pers
Terima kasih untuk janji kebebebasan pers. Ibarat anjing
pengawas, pers akan mengawasi jalannya pemerintahan, pers akan
menggonggong jika ada kebijakan yang menyimpang dari janji dan
komitmen. Dan sebagaimana lazimnya anjing, pers juga adalah
makhluk yang setia...setia pada kebenaran.
M. Idris Azmi
jogloku@yahoo.com
Mahasiswa dan aktivis kampus
Semarang
Dari Mereka yang Menunggu Realisasi Janji
Bagian Empat
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l65
Mutu Pendidikan
Mencermati janji-janji SBY-JK mengenai mutu pendidikan,
saya ingin menceritakan pengalaman saya. Saya bukanlah pemerhati
masalah pendidikan, namun saya berpengalaman dalam proses
seleksi penerimaan dan evaluasi karyawan. Saya merasa dari tahun
ke tahun belum ada peningkatan mutu secara nyata lulusan sekolah
Indonesia, baik SMU, akademi, maupun universitas.
Seringkali saya menemui kondisi di mana calon karyawan
sama sekali tidak mengetahui tuntutan dunia kerja. Jika diwawancara,
jawaban yang diberikan terkesan sangat pasrah dan pasif. Kalimat
klise yang paling sering diucapkan adalah, “Saya tidak berpengalaman,
tapi saya bersedia belajar.”
Cukup banyak lulusan baru berpikiran bahwa bekerja/
berusaha di dunia nyata membutuhkan keahlian dan pengetahuan
yang sangat khusus, sehingga untuk keahlian dan pengetahuan umum
pun mereka tidak berusaha untuk mencari tahu atau belajar sendiri.
Apapun yang mereka pelajari di sekolah, terkesan hanya untuk tujuan
nilai ujian saja. Padahal dunia kerja/usaha lebih membutuhkan orang
untuk mengerjakan pekerjaan rutin dasar semacam peng-arsip-an
yang efsien (baik secara manual maupun komputerisasi), pencatatan
dan pengumpulan data yang akurat dan cepat, berhitung sederhana
(tambah, kurang, kali, bagi dan persentase), kontrol monitor jadwal,
menulis memo/instruksi dengan bahasa sesederhana dan sesingkat
mungkin, dll, yang memang lebih mengutamakan pengalaman
praktis daripada penghapalan dalil.
Sesudah beberapa saat bekerja, jika orang tersebut
memang mampu, maka ia akan masuk ke tingkat yang lebih tinggi,
yang membutuhkan ketrampilan analisa data dan pengambilan
keputusan untuk memecahkan masalah. Analisa data bahkan tidak
membutuhkan ketrampilan canggih dengan komputer, cukup
Bagian Empat
Dari Mereka yang Menunggu Realisasi Janji
l66
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
mengerti arti angka-angka terhadap kinerja bagiannya.
Yang sungguh saya tidak mengerti untuk ketrampilan
semacam ini kenapa tidak pernah mereka dapatkan dari masa sekolah
yang bertahun-tahun itu? Apa sebenarnya yang dititik-beratkan di
dalam pembelajaran di sekolah? Tidak adakah tuntunan dari para
guru agar siswa mampu belajar sendiri? Bukankah seharusnya
pembelajaran yang baik menunjukkan jalan bagaimana seseorang
bisa menimba ilmu/ketrampilan dari berbagai sumber? Sungguh
saya tidak mengerti. Saya tidak ingin mendengar janji yang muluk-
muluk sebelum ketrampilan dasar lulusan sekolah kita (menghitung,
menulis, menyampaikan pikiran secara lisan) belum juga bisa
dibenahi.
Karsa Nugraha
karsa_nugraha@yahoo.com
Manager di sebuah perusahaan
Tidak Sakit
Pak SBY-JK yang suka berjanji,
Kami rakyat kecil mengharapkan agar Bapak sehat lahir
dan bathin, sehingga dalam memimpin bangsa yang sakit ini, Bapak
tidak sakit dan kaget-kagetan, seperti kami rakyat kecil yang sering
terkaget-kaget oleh perilaku para politikus.
Setiap waktu mohon kiranya Bapak membawa neraca atau
timbangan, sehingga dalam memutuskan sesuatu dapat menimbang
untung ruginya bagi bangsa ini, demi adil dan meratanya apa yang
bapak putuskan.
Rajin berdoa ya Pak, agar bapak tidak tersesat atau
menyesatkan diri, sehingga kami yang dipimpin juga dapat keluar
dari kesesakan hidup yang semakin membelit, jangan kompromi
Dari Mereka yang Menunggu Realisasi Janji
Bagian Empat
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l67
dengan membagi-bagikan kekuasaan yang kami berikan hanya
untuk Bapak berdua. Jangan gentar oleh ancaman dan bujuk rayu
para politikus dan pengusaha yang meminta jatah.
Ingatlah, menitipkan masa depan anak cucu kami hanya ke
tangan Bapak, jadi Bapak-lah yang berhak memutuskan siapa dan
apapun yang harus dilakukan untuk bangsa ini.
Rudy Ismail
rudyismail@yahoo.com
Bumi Serpong Damai
Belum Cukup Terjanjikan
Rasanya, soal kelautan belum cukup terjanjikan. Tapi saya
tetap berharap, bapak SBY-JK bisa menyediakan anggaran untuk
menjaga lautan kita agar terhindar dari pencurian ikan dan hasil laut
oleh nelayan asing. Beli pesawat untuk melakukan pengintaian, juga
kapal dan peralatan yang memadai untuk lautan kita yang begitu
luas. Dan jangan lupa, didiklah personil agar benar-benar terampil
dalam bidangnya (bukan terampil dalam bidang-bidang yang tak
diridhoi Tuhan).
Hal lain, kembangkan industri pertanian, berdayakan petani
(bukan petani berdasi) sambil mengembangkan koperasi. Kelola
hutan dengan baik, hijaukan gunung dan bukit. Eksploitasi hutan
hendaknya dengan mempertimbangan kelestarian lingkungan. Stop
ekspor hasil hutan (khususnya dalam bentuk kayu gelondongan
atau barang mentah). Targetkan bahwa ekspor kita di masa depan
hanya dari hasil laut dan pertanian serta industri, termasuk industri
rumahan/kerajinan tangan (bukan industri yang mengotori alam).
Jadikan alam kita pusat konservasi dunia. Kita “tukar” oksigen
Bagian Empat
Dari Mereka yang Menunggu Realisasi Janji
l68
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
dengan komoditi yang berguna (bukan barang mewah).
Di atas itu semua, budayakan hidup sederhana, jadilah
panutan dan contoh bagi bawahan dan rakyat banyak, pilih pejabat
yang berintegritas tinggi (highest integrity).
A.Salam
Asalam@exspan.co.id
Depok
Saling Menyayangi
Janji-janji SBY-JK soal diskriminasi pembelaannya terasa
lebih menyentuh ke kalangan minoritas. Padahal kami yang mayoritas
pun sering mengalami hal yang sama, bahkan teramat memedihkan.
Di tempat kerja saya misalnya, gaji kami yang mayoritas lebih
kecil daripada yang minoritas. Begitupun masalah fasilitas dan
penghargaan, kami yang mayoritas selalu mendapat bagian yang
lebih kecil. Dalam kehidupan sehari-hari, kami yang mayoritas
kebanyakan berada pada level ekonomi kelas menengah ke bawah.
Teramat banyak anak jalanan, kuli, buruh tani, dan sebagainya yang
berasal dari golongan kami yang masyoritas. Padahal, seandainya
tak ada diskriminasi, betapa indahnya hidup ini. Saling menghargai,
saling menyayangi, saling tolong-menolong tanpa melihat status,
agama, suku....duh betapa indahnya!
l;p’[
Hanya Ini
Guna membantu SBY-JK membuktikan janji-janjinya,
hanya ini yang bisa saya sarankan:
Dari Mereka yang Menunggu Realisasi Janji
Bagian Empat
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l69
Bidang pendidikan: utamakan kaum yang tidak mampu
untuk mendapatkan pendidikan gratis. Pendidikan harus murah,
jika pun mahal, hal itu hanya diberlakukan bagi kaum yang mampu.
Kesejahteraan para guru harus juga harus diperhatikan mengingat
jasa-jasa dan pengabdian mereka yang tidak kecil.
Bidang sosial: buka lapangan kerja seluas-luasnya. Hilangkan
sistem kontrak bagi WNI, kontrak untuk pekerja diberikan bagi
WNA.
Bidang transportasi: Kurangi kendaraan umum. Angkot,
kopaja, metromini, taksi, dan lainnya diwajibkan untuk mengikuti
uji kelayakan, baik dari segi keamanan kendaraan, ijin mengemudi
para supirnya, dan disiplin pada saat di jalan raya, terutama untuk
wilayah Jabotabek.
Bidang hukum: tegakkan hukum setegak-tegaknya. Bangsa
takkan maju jiku hukumnya tidak ditegakkan secara benar dan arif.
Untuk maling-maling alias koruptor, beri ganjaran yang setimpal. Jika
memang terbukti korupsi dan sangat merugikan rakyat, hukuman
mati pun pantas dijalankan seperti halnya hukuman mati untuk para
pengedar narkoba.
Semoga SBY-JK dapat menjalankan pemerintahannya
sesuai dengan aspirasi Rakyat Indonesia yang telah jatuh lunglai
selama ini.
Fuad El Khair
jagoanlontonk@yahoo.com
Wiraswasta, Jakarta
Harapan Besar
Saya adalah salah satu dari 60 persen masyarakat Indonesia
yang menaruh harapan besar pada janji-janji SBY-JK. Saya berharap,
Bagian Empat
Dari Mereka yang Menunggu Realisasi Janji
l70
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Indonesia benar-benar bisa bangkit dari keterpurukan. Saya tidak
ingin bangsa Indonesia dicap oleh masyarakat internasional sebagai
bangsa yang tidak berbudaya, bangsa yang tidak beretika. Saya
sangat menaruh harapan agar roda pemerintahan berjalan dengan
benar, tidak ada lagi kolusi, tidak ada nepotisme, dan tidak ada lagi
korupsi.
Sungguh saya tidak ingin mendengar dan melihat yang
kaya semakin kaya dan yang miskin semakin miskin. Jadikanlah
kesejahteraan yang adil dan merata sebagai nuansa keseimbangan
sehari-hari. Jangan ada lagi keberpihakan penguasa secara tidak adil.
Kalau ternyata semua itu tidak terjadi, yaaaa ternyata pak SBY kagak
ada bedanya dengan presiden-presiden RI terdahulu.
Syafril Nusyirwan
msnusyirwan@yahoo.com
Konsultan Manajemen, Yogyakarta
Ingin Bukti
Wahai pencetus janji! Kami ingin bukti, bukan janji. Buatlah
landasan yang kuat bagi Indonesia secara ekonomi dan militer. Buatlah
rakyat bersatu padu menghadapi penjajahan, apapun bentuknya.
Buatlah Indonesia berlandaskan hukum dengan masyarakatnya yang
mematuhi hukum, baik hukum negara maupun hukum agama yang
dianutnya. Hapus kemiskinan dan ciptakanlah masyarakat yang
berkecukupan dan berpendidikan. Ciptakanlah lapangan kerja baru
dengan mengembangkan industri kecil rakyat untuk mendukung
tersedianya lapangan kerja. Jangan lupa, bangkitkanlah nasionalisme
bangsa. Ajak masyarakat untuk menghargai dan memakai produk
dalam negeri sendiri. Jangan cuma janji lagi, kami mohon bukti.
Joko Lelono
joko@sulfndo.co.id
Banten
Dari Mereka yang Menunggu Realisasi Janji
Bagian Empat
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l7l
Hak Anak
Saya tidak memperdulikan janji-janji atau komitmen
apapun. Yang penting bagi saya, SBY-JK bisa memperhatikan
hak anak. Kini sudah waktunya hak mereka dipenuhi, hak untuk
mendapat perhatian sebagai penerus cita-cita bangsa dan sebagai
pewaris kekayaan sekaligus berlimpahnya hutang negeri ini.
Kini, saatnya untuk mengajari mereka bekerja keras,
berpandangan luas, menghargai kebersamaan, kesetiakawanan,
tenggang rasa, mandiri dan bertanggung jawab. Beri mereka
pendidikan berkualitas yang terjangkau, terutama bagi kaum
berkekurangan. Sebab pendidikan yang layak itu hak semua anak
dari kelas, strata dan golongan apapun. Beri mereka pendidikan
iman dan budi pekerti sebagai landasan moral dan etika bangsa.
R. Haryono
rubby_harijono@bca.co.id
Karyawan
Jakarta
Korban Tragedi
Harapan saya, SBY-JK benar-benar bisa membuktikan
janji-janjinya. Harapan dan sekali lagi harapan. Rakyat kecil seperti
kami ini bisa bertahan hidup salah satunya adalah berkat ‘hope’
tersebut. Banyak sekali harapan yang kami pelihara dalam sanubari
kami, sekalipun setelahnya berkali-kali pula harapan-harapan itu
teranggas. Dalam hal ini, penguasalah yang paling rajin meranggas
harapan-harapan itu kian jauh dari kenyataan. Diikuti pencabutan-
pencabutan hak politik, hak ekonomi, hak sosial, hak budaya, dan
hak asasi.
Bagian Empat
Dari Mereka yang Menunggu Realisasi Janji
l72
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Lihatlah, ribuan korban Tragedi ‘65 yang pada hari ini telah
beranjak sepuh dan terserak di luar negeri masih juga terhalang
pulang. Bayangkanlah, puluhan tahun mereka begitu merindukan
pulang ke tanah air sampai sekian dari mereka meninggalpun masih
juga harus membawa kerinduan itu sampai ke kuburnya. Sejak awal
mereka diperlakukan sungguh tak adil. Tanpa pengadilan, sebagian
orang dari mereka yang kebetulan sedang di luar negeri karena sebuah
keperluan ini tiba-tiba mendapat surat dari Jakarta yang sudah
dalam kendali Orde Baru supaya menghujat Soekarno. Sebagian
besar dari mereka tak tahu-menahu konspirasi apa yang sedang
dimainkan penguasa, yang pasti mereka menolak untuk ditarik dalam
permainan hujat-menghujat itu sebab mereka tak percaya ‘ Soekarno
Jahat ‘ dan begitu saja buntut dari penolakan tersebut hak sebagai
Warga Indonesia pun dicabut. DICABUT. Betapa menyakitkan,
mendengarkan hati sendiri untuk memutuskan sesuatu kok tidak
boleh. Bukankah suara hati tak pernah salah? Sebab di dalamnya
bersemayamlah Ia. Ia pemilik hati, setiap hati dari penghuni jagad
semesta ini. Ia kebenaran itu sendiri.
Berilah kebahagiaan di usia senja mereka, mengabulkan
harapan mereka. Allah SWT pastilah menyayangi Anda. Saya
percaya itu. Pasti.
Rida Fitria
bunsyke@telkom.net
Seorang penulis dan ibu dua anak
Memberikan Contoh
Apalah artinya janji. Tetapi saya tetap berharap agar mereka
yang duduk di pemerintahan memberikan contoh serta teladan
kepada rakyat. Sangat tidak mendidik jika mereka mengharapkan
banyak perubahan, tetapi dirinya sendiri jauh dari perubahan.
Dari Mereka yang Menunggu Realisasi Janji
Bagian Empat
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l73
Alangkah baik dan indahnya jika semua itu dimulai dari bapak SBY-
JK sendiri.
Iswahyudi
yudie_matta@yahoo.com
Mahasiswa, Jombang, Jawa Timur
Butuh Perubahan
Buktikan janji-janji! Tingkatkan mutu pendidikan,
perhatikan rakyat kecil, tindaklanjuti kasus-kasus korupsi, kurangi
naik mobil mewah, perkecil perbedaan antara si kaya dan si miskin,
perhatikan abdi negara, tambah gaji guru, polisi, hakim, dll. Kita
memang butuh perubahan. Buktikan!
A Felly Pasla
fels97@yahoo.com
Amurang, Minahasa
Merasa Bangga
Pak SBY dan JK yang saya kagumi, saya selalu merindukan
momen di mana bulu kuduk saya berdiri diiringi linangan air mata
kebahagiaan tatkala senandung lagu Kebangsaan Indonesia Raya
berkumandang dengan gegap gempita di arena olah raga dunia.
Saat-saat seperti itulah yang bisa membuat saya merasa bangga
sekali sebagai bangsa Indonesia. Harapan saya, bangkitkanlah
kembali prestasi olah raga bangsa Indonesia demi menyehatkan
jasmani, rohani dan mental bangsa Indonesia dari keterpurukan
berkepanjangan.
Samuel Rismana Sugandi
mu4ever@indo.net.id
Tangerang
Bagian Empat
Dari Mereka yang Menunggu Realisasi Janji
l74
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Usia Dini
Saya hanya ingin berpesan, perhatikanlah masalah
pendidikan terutama pendidikan di usia dini. Sebab, di usia dini
inilah segala problema negeri ini biasanya bermula. Pada usia dini
inilah watak dan kepribadian orang dibentuk secara awal. Saya tak
yakin bahwa seseorang “sudah berbakat koruptor dari sononya”
atau “sudah berbakat jahat dari sononya”. Saya lebih yakin bila
kata “sononya” diganti dengan “usia dini”. Artinya, bakat kejahatan
seseorang bukan dibentuk sebelum mereka dilahirkan, melainkan
sejak usia dini.
Hal lain yang saya anggap perlu juga dibina sejak usia dini,
adalah olahraga. Berilah kesempatan kepada anak-anak yang tidak
mampu untuk mendapat pembinaan olahraga sejak usia dini. Niscaya,
pada saatnya nanti mereka akan mengharumkan nama Indonesia di
kancah olahraga internasional.
Dian Anggraeni
dian@icma.or.id
Sekertaris, Jakarta
Kepercayaan Rakyat
Kami menunggu janji-janji SBY-JK. Basmilah para koruptor.
Hanya dengan begitu kepercayaan rakyat terhadap pemerintahan
baru bisa ditumbuhkan.
Eny Dwi S.
ds_eny@telkom.net
Karyawan, Tangerang
Dari Mereka yang Menunggu Realisasi Janji
Bagian Empat
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l75
Paling Banyak
Kata apa yang paling banyak disebut-sebut calon presiden
dalam pemilu dan paling banyak dilupakan setelah pemilu?
Jawabannya, “ralyat”. Memang belum ada survei tentang ini. Tapi
coba simaklah kata-kata calon presiden yang di berbagai media:
“Saya Pembela Rakyat”, “Saya Akan Berada di Pihak Rakyat”, “Saya
Selalu Mengutamakan Kepentingan Rakyat”, dan sebagainya. Lalu
tunggu satu tahun setelah ia memerintah kemudian hitung berapa
banyak kata rakyat yang ia gunakan dalam pidato-pidatonya. Saya
yakin akan jauh berbeda kalau tak boleh mengatakan tidak ada sama
sekali. Saya berharap SBY-JK tidak begitu.
Suharjono
Suharjono2000@yahoo.com
Pengusaha, Singapura
Gaya Hidup
Apa yang membuat orang melakukan korupsi? Pastilah
bukan karena ketiadaan keuangan seperti yang banyak dialami oleh
masyarakat kebanyakan. Penyebab yang paling pasti adalah karena
gaya hidup: keinginan untuk hidup berlebihan. Misalnya, keinginan
untuk tinggal di perumahan elit Pondok Indah daripada di
perumahan kumuh di Jakarta Utara, keinginan untuk menggunakan
mobil mewah daripada mobil kijang biasa, keinginan untuk berlibur
ke luar negeri daripada liburan di dalam negeri. Semuanya sudah
dimiliki, tapi karena gaya hidup ia ingin memiliki yang lebih. Jadi,
kalau SBY ingin memberantas korupsi seperti janji-janjinya, langkah
penting yang tidak boleh dilupakan adalah merubah persepsi gaya
hidup. Dan itu harus dimulai dari dirinya agar bisa diteladani oleh
yang lain. Beranikah SBY menggunakan mobil kijang sebagai
Bagian Empat
Dari Mereka yang Menunggu Realisasi Janji
l76
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
mobil dinasnya? Beranikah SBY belanja di pasar rakyat daripada di
supermarket terkenal? Saya masih kurang begitu yakin.
Yoseae
yoseae@yahoo,com
Seniman, Jakarta
Masalah Penggusuran
Satu hal yang mungkin SBY-JK lupa dalam janji-janjinya
adalah masalah penggusuran. Ia berjanji akan mensejahterakan
rakyat, meningkatkan anggaran pendidikan dan kesehatan,
menegakkan hukum, membasmi KKN, mengurangi pengangguran,
tapi rasanya belum ada janji-janjinya yang mengatakan bahwa ia
akan mengurangi atau meniadakan penggusuran. Yang sudah dijanji
pun kadang sulit ditepati, apalagi yang nggak pernah dijanjiin sama
sekali. Jadi, siap-siap sajalah buat yang merasa bakal digusur untuk
menerima nasib sebagai rakyat kecil.
Lady Andini
Lady1805@yahoo.com
Pekerja Sosial, Jakarta
Kurang Yakin
Terus terang, saya kurang yakin SBY-JK bisa memberantas
korupsi. Soalnya dari dulu Indonesia terkenal sebagai negara paling
korup, bahkan data terakhir nomor lima terkorup didunia, tapi tak
pernah ada koruptornya. Buktinya, tak ada koruptor di Indonesia
yang tertangkap.
Amir Kiat, SH
amirkiatposo@yahoo.com
Pegawai, Poso
Dari Mereka yang Menunggu Realisasi Janji
Bagian Empat
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l77
Setelah
Terhembus Angin
B
erikut adalah berbagai pendapat dan pandangan mengenai
SBY-JK, janji SBY-JK, dan buku saya yang berjudul “Janji-
janji & Komitmen SBY-JK”. Pendapat dan pandangan ini
saya kumpulkan dari berbagai kalangan pada saat usia pemerintahan
SBY-JK memasuki tahun ketiga. Isi pendapat adalah penilaian dan
pandangan subyektif dari pemberi pendapat.
Ada tiga cara yang saya gunakan untuk mengumpulkan
pendapat: bicara langsung, melalui email, dan via SMS. Yang
menarik, hampir semua orang yang saya mintai pendapat berusaha
memberi pendapat dan pandangan mereka dengan sangat antusias,
tanpa tedeng aling-aling, dan berani. Hanya sebahagian kecil yang
menolak termasuk beberapa tokoh yang dari luarnya saja kelihatan
berani padahal di dalamnya nyalinya banci.
Keberanian memberi pendapat dan pandangan dengan isi
yang beragam setidaknya menandakan bahwa suasana demokratis
makin terasa di negeri ini. Berikut pendapat mereka yang sedapat
mungkin saya muat apa adanya:
Saya Tidak Merasakan
Saya sendiri tidak tahu rinciannya janji-janji politik SBY-
JK. Tetapi sebagai buruh pabrik di LG Electronics, saya tidak
merasakan dampak peningkatan apapun kecuali hal-hal yang sejak
Bagian Empat
Dari Mereka yang Menunggu Realisasi Janji
l78
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
presiden-presiden lalu pun memang sudah secara reguler dilakukan.
Misalnya, kenaikan upah setiap tahun yang kisarannya jauh di bawah
nilai infasi.
Yang saya lihat malah kehidupan makin berat, pajak makin
tinggi, kendaraan makin tak terbeli, bahan bakar dan listrik serta
air makin mahal, pabrik-pabrik elektronik lain tutup atau pindah
ke luar negeri. Saya jadi was-was jangan-jangan LG Electronics
pindah juga ke Vietnam. Apalagi saat ini, secara berkala selalu ada
pengurangan karyawan.
Soal keamanan jangan ditanya deh. Hanya dalam waktu
sebulan saya dua kali harus mengelus dada karena barang-barang
berharga dan uang disikat maling. Soal kesehatan juga luar biasa,
seandainya tidak ada asuransi dari perusahaan (ini banyak dialami
kawan-kawan yang dari “out sourcing”) rasanya setengah penghasilan
harus disisihkan untuk berobat saya dan keluarga karena luar
biasa mahalnya pelayanan kesehatan. Kalau setengah penghasilan
disisihkan, artinya dalam sehari hanya boleh makan satu setengah
kali, betapa “puasa”nya.
Bidang pendidikan sudah lumayan, lumayan bikin pusing
tak karuan. Anak saya di SD Negeri, SPP sih memang gratis, tapi
lain-lainnya….woooww..geleng-geleng kepala deh. Uang buku
ratusan ribu, alat kebersihan, ekstra kurikuler, berenang, ini, itu, eta,
itu…. Hiks..
Politik luar negeri…??? Hehehehe…. Saya sih lihat
kenyataan jadi kacung di negeri sendiri, jadi jongos di luar negeri.
Hampir semua barang produksi pemilik perusahaannya orang luar
negeri, cari jarum made in Indonesia aja susahnya bukan main.
Dikentutin Malaysia dan Singapura malah tertawa.. halaaah...
Pemberantasan korupsi..?? hehehe... buruh pabrik kaya saya
taunya apa....?
Kalau mau berubah total, Indonesia ini harus dibalik
dulu, kepulauannya jadi lautan, lautannya jadi daratan baru. Atau,
Setelah Terhembus Angin
Bagian Lima
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l79
musnahkan spesies manusia Endonesa dari tiga generasi, biarlah
yang sekarang masih bayi dididik yang bener oleh peri gigi.
(seramnya…)
Kalau 2009 masih orang-orang ini juga di jabatan publik….
saya tak tahu harus ngomong apa lagi.
Sopian
R & D – AV, LG Electronics Indonesia
Cikarang Barat, Bekasi 17520
Cambuk Bagi Penegak Hukum
Perang terhadap korupsi sudah dikumandangkan oleh SBY-
JK. Secara kuantitas, penyelesaian tindak pidana korupsi semakin
meningkat, penyelamatan uang negara semakin bertambah. Bagi
warga masyarakat kinerja aparat penegak hukum mungkin dianggap
masih memble. Tapi kita harus fair melihat kenyataan yang ada di
lapangan bahwa janji-janji SBY-JK tidak hanya manis di bibir saja
Kalau toh ada yang merasa kurang puas, itu menjadi semacam
cambuk bagi penegak hukum untuk bekerja lebih baik lagi , atau bisa
juga hanya konsekwensi politik untuk mengkritisi terhadap kinerja
SBY-JK. Penyelesaian kasus tindak pidana korupsi tidak semudah
membalikkan tangan. Apalagi jika calon tersangkanya pejabat
pemerintahan dimana kasusnya sudah terjadi beberapa tahun yang
lewat, sehingga penegak hukum kesulitan dalam mencari alat bukti
maupun barang bukti.
Semoga dengan akan munculnya rancangan KUHAP yang
baru, akan semakin memudahkan penegak hukum dalam mencari
alat bukti terhadap penyelesaian perkara tindak pidana korupsi.
Abd. Farid, SH
Jaksa pada Kejaksaan Negeri Cikarang
Bekasi
Bagian Lima
Setelah Terhembus Angin
l80
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Bung Rudy, Saya Ingin…
Bung Rudy, saya harap buku Anda ini dapat mengajarkan
guru dan anak didik tentang kejujuran, sehingga guru tidak lagi
disalahkan karena banyak melahirkan pejabat yang korup. Pejabat
pasti pernah sekolah, Anda pasti sekolah. Mereka, Anda, dan saya
bisa baca tulis dan pintar karena guru. Lalu mengapa begitu banyak
orang yang tidak dapat menghargai guru, mengapa berbagai kebijakan
yang muncul tidak untuk mensejahterakan guru? Mengapa SBY-JK
menjadi lupa akan janji-janji mereka kepada guru?
Saya ingin tulisan Anda dan buku-buku Anda benar-
benar menyentuh rasa nasionalisme yang berkepribadian timur dan
bertanggung jawab untuk meluruskan moral para pejabat.
Bung Rudy, mungkin Anda akan berpikir apakah saya juga
dapat menulis? Saya berani katakan “ya!”. Hanya saja keadaan saya
saat ini tidak memungkinkan untuk menulis. Saya adalah mantan
guru honorer yang dipandang sebelah mata. Keadaan ekonomi saya
morat-marit: rumah tak punya, kendaraan tahun 87 (butut) lalu
bagaimana saya dapat fokus menulis sehebat Anda jika keadaan saya
seperti itu? Cuma, saya selalu dapat memberikan masukan kepada
penulis profesional seperti Anda. Saya ingin agar Anda lebih berani
mengungkap fakta dan data di negara kita ini demi anak bangsa.
Bung Rudy, saya juga ingin Anda memperjuangkan “dokrin
keguruan yang hilang” dengan tidak adanya SPG, SGO dan SMOA.
Saya tak percaya dengan guru sekarang yang sarjana namun tidak
mengerti doktrin keguruan sehingga tidak memiliki jiwa guru yang
sebenarnya. Hal ini juga pernah saya angkat di sebuah milis (mailing
list) namun tak ada satu pun yang berani menanggapi.
Di zaman sekarang, banyak guru yang tidak memiliki jiwa
keguruan. Mereka jadi guru bukan karena panggilan hati melainkan
karena terpaksa (daripada nganggur). Sekarang ini banyak yang jadi
guru harus pakai duit. Untuk naik pangkat, mereka juga harus rajin
Setelah Terhembus Angin
Bagian Lima
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l8l
ngirim upeti. Saya yakin sebenarnya Anda tahu hal ini. Saya harap
Anda bisa membuat buku tentang ini dan saya akan membantu
Anda menunjukkan fakta-fakta.
Bung Rudy, saya tidak mau lagi menunggu janji-janji,
berharap realisasi janji-janji dari siapapun bahkan dari orang nomor
satu di republik ini. Saya hanya ingin Anda membangkitkan rakyat
melalui tulisan-tulisan Anda, membangkitkan para guru, dan para
guru akan membangkitkan anak didiknya. Dengan begitu, saya rasa
kehidupan kita akan menjadi lebih baik.
Sutarman
Mantan guru honorer
Balikpapan, Kalimantan Timur
Perpustakaan, Kebudayaan, dan Komposisi Kabinet
Janji SBY-JK mendorong anak didik untuk membaca dan
memperkaya perpustakaan masih jauh dari harapan rakyat Indonesia.
Meskipun UU Perpustakaan sudah disahkan, buktinya kondisi
perpustakaan sekolah khususnya perpustakaan sekolah negeri dan
perpustakaan umum di setiap daerah saat ini sangat mengenaskan.
Padahal perpustakaan adalah pondasi dari pendidikan, meminjam
kalimat dari sebuah iklan, Tanya Kenapa?
Komitmen SBY-JK untuk mengembangkan kebudayaan
dianggap gagal, banyak hasil dan karya Indonesia dijiplak/diklaim
oleh negara lain. Pemerintah Indonesia juga diangap gagal karena
tidak dapat mengontrol budaya ketimuran, dalam hal ini masalah
konten acara televisi yang kebanyakan merusak budaya ketimuran.
Ada beberapa kesalahan komposisi kabinet yang dilakukan
SBY-JK, diantaranya pemilihan Prof. Dr. Meutia Farida Hatta-
Bagian Lima
Setelah Terhembus Angin
l82
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Swasono sebagai Meneg Pemberdayaan Perempuan bukannya
sebagai Menteri Pariwisata & Kebudayaan. Disamping itu, terlalu
eksklusif-nya Presiden Yudhoyono dalam hal humas kepresidenan
dengan mempekerjakan dua jubir kepresidenan dan satu sekretaris
kabinet.
Ardian Arda
Sekretaris Umum
DPD I HMPII (Himpunan Mahasiswa Perpustakaan & Informasi
Indonesia)
Terkesan Setengah Hati
SBY-JK belum sepenuhnya menepati janji-janji yang pernah
mereka ucapkan saat kampanye. Misalnya, soal pemberantasan
korupsi yang terkesan setengah hati. Mereka belum berani menyentuh
koruptor-koruptor kelas kakap seperti para penggemplang BLBI
dan orang-orang dekat SBY-JK. Pemerintahan SBY-JK juga belum
mampu mensejahterahkan rakyat Indonesia karena banyak kebijakan
SBY-JK yang tidak berpihak pada rakyat kecil.
Hal yang positif dari pemerintahan SBY-JK adalah ketika
mereka berhasil menciptakan suasana damai di Aceh dan Poso.
Semoga kedamaian di Aceh dan Poso tetap terjaga.
Bernad Ndawu
Koordinator Poso-Morowali Watch
Jakarta
Janji Sudah Terbukti
Saya berpendapat, janji-janji SBY-JK untuk memajukan
bangsa dan negara belum ada realisasinya. Kenaikan harga BBM
Setelah Terhembus Angin
Bagian Lima
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l83
tak mengenal waktu. Akibatnya, harga-harga kebutuhan pokok
dari hari ke hari semakin naik. Untuk membeli minyak tanah saja
orang harus antri. Mereka dulu berjanji akan membawa perubahan
bagi bangsa ini. Janji mereka sekarang sudah terbukti: harga-harga
kebutuhan pokok selalu berubah naik. Memang terjadi perubahan,
tapi bukannya menjadi baik, malah membuat rakyat kecil seperti
saya jadi menderita.
Aminuddin
Sopir Taksi
Jakarta
Pandai dan Cerdas Memaknai Gejala Buruk
SBY- JK adalah pasangan presiden dan wapres yang pandai
dan cerdas memaknai gejala buruk dari respon masyarakat (lebih
tepatnya pers, peneliti atau pemerhati) atas segala aksi pembaharuan
yang dilakukannya. Lihat komentar JK yang menyatakan bahwa
demokrasi adalah cara untuk mencapai tujuan kehidupan berbangsa
beberapa waktu yang lalu. Lihat pula komentar SBY tentang upaya
perlawanan terhadap pemberantasan korupsi. Komentar SBY -
JK, bagi saya, tidak lebih impossible is nothing, but some things are
impossible.
Wahyu Kuncoro, S.H
Konsultan Hukum
Tangerang
Tak Ada Keberpihakan
Coba bayangkan, apa yang terjadi dengan tenaga kerja kita
jika PHK terus berlangsung di mana-mana? Yang pasti, pengangguran
akan semakin meningkat. Tingkat kejahatan pun sudah pasti akan
Bagian Lima
Setelah Terhembus Angin
l84
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
ikut naik. Saya melihat tak ada keberpihakan pihak penguasa kepada
tenaga kerja. Mereka lebih berpihak kepada pengusaha. Lihat saja,
sistem kontrak yang ada sekarang cenderung melemahkan posisi
tenaga kerja dan menguntungkan pengusaha. Mana janji-janji itu?
Fatimah
Resepsionis
Ciledug, Tangerang
Tidak Perlu Teramat Kecewa
Di Indonesia, janji-janji kampanye politik sejatinya bukanlah
komitmen yang bisa ditagih. Lebih banyak omong kosong untuk
menarik simpati masyarakat. Bukankah kata-kata politisi itu sulit
dipegang? Salah kalau rakyat terlalu mengingat janji-janji kampanye
Susilo Bambang Yudhoyono (SBY).
Sejak awal saya melihat SBY ini berkarakter lembek. Tidak
bisa tegas, selalu bimbang, bukan tipe get things done. Karena terlalu
banyak perhitungan, keputusannya tidak bisa cepat dan tepat. Ingat
bagaimana alotnya SBY bikin kabinet. Ingat bagaimana susahnya
dia mengganti menteri.
Ingat kasus lumpur lapindo di Sidoarjo yang berlarut-
larut, sehingga 20.000 orang kehilangan rumah dan tempat tinggal.
Andai saja bulan September atau Oktober 2006 SBY dengan tegas
menyatakan lumpur dibuang ke Kali Porong, maka bencana lumpur
panas tidak sedahsyat sekarang.
SBY juga lemah di manajemen. Lihat saja di lumpur lapindo.
Seharusnya menteri-menteri koordinator atau menteri senior bisa
menuntaskan itu tanpa harus SBY berkantor di Lanudal Juanda,
Sidoarjo, selama tiga hari. Tapi, sekali lagi, SBY ini tidak berani
dengan Aburizal Bakrie, menko kesra, yang erat kaitannya dengan
Lapindo Brantas Inc.
Lha, kalau setiap ada masalah presiden turun langsung, apa
Setelah Terhembus Angin
Bagian Lima
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l85
gunanya menteri-menteri yang banyak itu? Manajer kan mestinya
hanya koordinasi saja, tidak perlu terlibat dalam urusan remeh-
temeh. Payah manajemen SBY!
Tapi ini bisa dimaklumi karena secara politis SBY sangat
lemah. Ia dikelilingi oleh menteri-menteri berlatar belakang politisi,
yang nota bene, rivalnya.SBY tahu Partai Demokrat masih kecil
sehingga dia perlu menjaga kelangsungan kekuasaannya dengan
memelihara banyak menteri yang sebenarnya tidak kapabel.
Dari sini saja, siapa pun maklum mengapa SBY sulit sekali
menunaikan janji-janji kampanye pada 2004. Kita, bangsa Indonesia,
tidak perlu teramat kecewa karena politik di Indonesia masih dalam
taraf segitu. Rakyat harus lebih kritis, tidak terpukau oleh trik-trik
kampanye ala pesolek politik.
Lambertus L. Hurek
Redaksi Berita di Radar Surabaya
Baru Sebahagian Kecil
Menurut saya, SBY-JK sudah mewujudkan janji-janjinya
tapi baru sebahagian kecil. Misalnya, janji pendidikan gratis,
memang sudah terwujud tapi belum merata ke seluruh Indonesia.
Begitupun dengan janji memberantas korupsi. Baru yang kecil-kecil
saja diberantas sementara yang kakap sengaja ditarik ulur.
Di bidang pendidikan, saya melihat banyak gedung sekolah
yang harus dibangun kembali sesuai standar agar proses belajar
mengajar berjalan dengan sempurna dan nyaman. Pemberantasan
narkoba juga harus lebih diintensifkan karena tampaknya pengguna
narkoba sudah semakin banyak. Semoga di masa depan keadaan
akan semakin membaik.
Efy
Karyawan Bank BCA cabang Graha Inti Fauzi
Jakarta
Bagian Lima
Setelah Terhembus Angin
l86
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Narkoba dan Kejahatan Jalanan
Buku ini memuat janji SBY-JK mengenai prioritas
pemberantasan narkoba dan kejahatan jalanan. Janji tersebut sudah
terlaksana dengan baik namun belum sesuai dengan harapan
masyarakat. Ada perbedaan antara hasil dan pandangan masyarakat.
Data menunjukkan adanya kenaikan yang tinggi angka pengguna
narkoba. Penyuplainya meningkat, narkoba jadi mudah diperoleh di
mana-mana sementara masyarakat semakin “masabodo”.
Menurut saya, SBY-JK akan sulit memenuhi janji-janjinya
memberantas penggunaan narkoba jika sebentar-sebentar pejabat
yang menanganinya diganti. Sindikat narkoba umumnya menjadi
kuat setelah beroperasi di atas 5 tahun dengan tingkat solidaritas
dan kepercayaan yang tinggi di antara sesama anggotanya. Sindikat
semacam ini hanya bisa dilawan oleh organisasi yang juga solidaritas
dan kepercayaan di antara sesama anggotanya sudah lebih dari 5
tahun. Jika sebentar-sebentar orang yang menanganinya diganti,
pemberantasan pun akan tidak maksimal.
Mungkin ada baiknya juga bila BNN (Badan Narkotika
Nasional) menjadi semacam LPND (Lembaga Pemerintah Non-
Departemen) yang independen dan langsung di bawah Presiden,
tidak dalam bayangan Polri atau departemen manapun, seperti KPK.
Semoga apa yang saya sarankan ini bisa bermanfaat.
Dr. Anwar Wardy W, Sp.S, DFM
Badan Narkotika Nasional
Jakarta
Jangan hanya Sekedar Retorika
Sebagai rakyat biasa, saya hanya berharap terjadinya
perubahan dalam hal jumlah kemiskinan. Dari hari ke hari jumlah
Setelah Terhembus Angin
Bagian Lima
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l87
rakyat miskin di Indonesia semakin bertambah. Rakyat jadi menderita
dikarenakan lapangan kerja untuk mencar nafkah tidak ada.
Masyarakat miskin di desa pun akhirnya berurbanisasi besar-
besaran ke kota. Untuk itu, upaya pemberantasan korupsi harus
benar benar serius dilaksanakan. Terutama dalam hal hukuman yang
dijatuhkan, jangan hanya sekedar retorika saja....Semoga.
Indra Darma
Warga Jati Asih
Bekasi
Tidak Sistematis Lagi
Makanya kita jangan suka berjanji. Makin banyak janji
makin sulit kita merealisasikannya. Makin banyak janji makin sering
rakyat dikecewakan. Akhirnya, pembangunan di Indonesia menjadi
tidak sistematis lagi. Lihat saja, harga melonjak-lonjak tanpa jelas
arahnya. Pembangunan berada pada titik nol bahkan minus dengan
munculnya berbagai musibah akibat kemarahan alam. Saya tak tahu
mau dibawa kemana bangsa dan negara ini.
Edi Sofyan
Wiraswasta percetakan
Jakarta
Mari Menakar
Mencatat janji dan komitmen seorang pemimpin tentu
saja banyak dilakukan orang. Sama halnya dengan menagih janji
dan komitmen itu sendiri. Tetapi membukukannya secara tertulis
mungkin hanya sedikit dari tidak banyak dilakukan orang. Salah satu
Bagian Lima
Setelah Terhembus Angin
l88
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
di antaranya, dilakukan Rudy S Pontoh melalui bukunya Janji-janji
dan Komitmen SBY-JK yang cetakan pertamanya dirilis Desember
2004.
Dokumentasi tertulis seperti buku ini sangat penting
untuk memudahkan kita menakar keberhasilan seorang pemimpin
menunaikan janjinya. Dan, yang tidak kalah pentingnya adalah
menakar seberapa besar dan banyak janji sang pemimpin itu mampu
dipenuhi. Cara ini, merupakan salah satu bentuk akses untuk
menagih akuntabilitas seorang pemimpin ke depan.
Jika menilik isi buku Jankomit ( Janji-janji dan Komitmen)
SBY-JK, banyak sekali yang harus dibayar duet ini untuk mewujudkan
janji-janjinya. Baru setahun memangku jabatan, SBY-JK memang
dihadapkan kepada musibah yang luar biasa, yakni Gempa Bumi
dan Tsunami di Provinsi Nanggroe Aceh Darussalam (NAD) yang
menyita dan menumpahkan hampir seluruh perhatian republik.
Musibah dan bencana demi bencana pun muncul seolah susul
menyusul. Dari Aceh ke Yogya, hingga munculnya musibah lumpur
lapindo di Sidoarjo, Jawa Timur.
Para pengeritik SBY-JK tetap menuntut jankomit mereka,
walau ada kejadian luar biasa yang harus mereka beri perhatian. Saya
mengibaratkan, kedua pemimpin ini melayarkan ‘’kapal republik’’
di tengah gempuran gelombang besar kiri kanan. Menjaga jangan
sampai kapal mogok hingga ke tujuan. Meski keduanya harus
mengganti beberapa kelasi yang dianggap bermasalah dan susah
menyesuaikan irama pekerjaan sang nakoda.
Kita tidak menafkan bahwa selama memimpin bangsa ini,
SBY-JK terkadang sering dibenturkan. Ada-ada saja pihak yang
menilai keduanya tidak akur. Tidak kompak. Jalan sendiri. Seolah-
olah keduanya mulai pasang kuda-kuda sendiri. Belum lagi, beberapa
kelompok di luar organisasi pemerintahan sudah mulai melakukan
manuver.
Setelah Terhembus Angin
Bagian Lima
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l89
Tiga tahun sudah berlalu. Saatnya kita menagih dan
menakar jankomit SBY-JK. Secara kasat mata, jankomit SBY-
JK yang menguat menjadi wacana publik adalah pemberantasan
korupsi. Saya tidak punya data resmi berapa banyak di antara kasus
korupsi yang ada sudah tuntas di pengadilan. Tetapi ada geliat yang
nyata untuk memberantas korupsi, koneksi, dan nepotisme (KKN).
Buktinya adalah pemerintah membentuk beberapa institusi yang
memberantas KKN. Saking banyaknya lembaga yang menangani
korupsi ini ada kesan tugas dan wewenang lembaga tersebut tumpang
tindih.
Bukti lain dalam penegakan hukum, Presiden SBY juga
mengganti pejabat Jaksa Agung, beberapa menteri, dan pembantunya.
Ini menunjukkan komitmen yang besar terhadap perbaikan roda
pemerintahan, meski sulit menutup kesan adanya istilah ‘bongkar
pasang’ kabinet yang berujung kepada kurangnya konsistensi dalam
kesinambungan program menteri yang bersangkutan.
Saya kira, memasuki tahun keempat masa pemerintahannya,
ada baiknya kita mulai menakar seberapa jauh jankomit kedua
pemimpin bangsa mampu dipenuhi. Buku Bung Rudy dalam edisi
kedua ini ada baiknya juga menakar sejumlah janji yang mampu
dipenuhi SBY-JK, sehingga dapat menjadi acuan bagi publik untuk
menagihnya.
M.Dahlan Abubakar
Staf Pengajar Fakultas Sastra Unhas
Makassar
Ajang Bisnis
Saya tak tahu harus bilang apa. Janji pendidikan murah
ternyata yang terjadi biaya pendidikan makin mahal saja. Bahkan
banyak anak putus sekolah karena tidak mampu lagi membayar uang
Bagian Lima
Setelah Terhembus Angin
l90
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
sekolah. Begitu juga halnya di bidang kesehatan. Harga obat semakin
mahal, rumah sakit pun sekarang makin tidak berpihak kepada rakyat
kecil. . Penderita kekurangan gizi dan busung lapar tampaknya makin
meningkat saja. Penguasa tidak lagi memperhatikan rakyat kecil tapi
sibuk mejadikan negara ini sebagai ajang bisnis.
Soleh Sutisna
Satpam. Ciledug
Tangerang
Antara Mulut dan Janji
Mulutmu adalah harimaumu bukanlah isapan jempol belaka.
Apalagi bagi mereka yang sedang berkuasa. Mulut adalah salah satu
senjata sakti yang bisa membuat mereka terpilih, dielu-elukan, dan
disanjung. Namun di sisi lain, mulut juga bisa membuat mereka
dibenci, dicibir, didemo, diprotes dan dijatuhkan.
Secara garis besar, ada dua fase inti penggunaan mulut oleh
penguasa atau calon penguasa ini. Pertama, fase umbar mulut atau
umbar janji yang biasanya dilakukan pada masa kampanye. Kedua,
fase berkelit lidah yang berupa upaya-upaya pengingkaran janji yang
dilakukan pada masa setelah berkuasa.
Mungkin pada zaman dulu (sebelum masa reformasi)
fenomena umbar mulut dan diakhiri berkelit lidah ini merupakan
hal yang sangat galib dan tak beresiko apa-apa. Pasalnya, penguasa
pada waktu itu begitu berkuasanya sehingga tak ada seorang pun
yang bisa mempertanyakan pelaksanaan janji-janji mereka.
Tetapi di zaman sekarang ini, penguasa tak bisa lagi dengan
gampang berkelit lidah. Mulut mereka semasa kampanye benar-
benar menjelma sebagai harimau mereka yang bisa membuatnya
tampak gagah dan disegani bila memegang janji, atau akan tampak
Setelah Terhembus Angin
Bagian Lima
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l9l
garang dan berpotensi memangsa dirinya sendiri bulat-bulat jika
janji-janji masa kampanyenya tak ada yang ditepati.
Sayangnya menagih janji penguasa tidaklah mudah.
Kebanyakan janji mereka dilontarkan dalam bahasa lisan yang tidak
terdokumentasi secara sistematis. Memang liputan-liputan media
bisa menjadi sumber dokumentasi. Tapi tak banyak kliping media
yang tertata secara sistematis dan gampang diakses. Akibatnya,
banyak janji-janji kampanye penguasa yang terlupakan dan terlewat
untuk ditagih oleh masyarakat.
Untungnya ada Rudy S Pontoh yang rela bersusah payah
untuk mengumpulkan data-data janji penguasa khususnya Presiden
Susilo Bambang Yudhoyono dan Wakil Presiden Jusuf Kalla
(SBY-JK) pada satu buku yang gampang dibaca. Hadirnya buku
“Janji-janji & Komitmen SBY-JK” ini benar-benar suatu berkah
bagi masyarakat Indonesia. Melalui buku ini masyarakat dengan
gampang bisa mengevaluasi secara terinci apa yang telah dijanjikan
presiden, apa yang telah dipenuhi dan apa yang belum. Benar-benar
sebuah buku yang akhirnya dijadikan pegangan oleh para politikus,
para pengamat, peneliti, jurnalis, dan semua kalangan yang hidup di
negara ini tanpa terkecuali.
Setiap merasakan adanya sebuah ketidakadilan, dengan
gampang masyarakat bisa membuka buku ini, melihat apa yang
pernah dijanjikan presiden dan akhirnya mempertanyakan apakah
janji tersebut sudah dipenuhi? Buku ini benar-benar menjadi buku
pedoman bagi seluruh warga Indonesia.
Sepintas memang kehadiran buku ini seperti mengancam
gerak langkah SBY-JK, namun kalau dicermati, buku ini pun juga
menjadi buku yang sebenarnya menguntungkan bagi sang presiden
beserta pembantu-pembantunya. Cukup dengan membaca buku ini,
maka SBY-JK dengan gampang bisa melakukan introspeksi, berhati-
hati dan menjaga langkah agar tidak terperosok oleh pengingkaran
atas janji-janji yang pernah mereka ungkapkan sebelumnya. Dengan
Bagian Lima
Setelah Terhembus Angin
l92
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
begitu hadirnya buku ini justru membantu mereka untuk bisa
menjadi pimpinan yang dielu-elukan rakyatnya dengan perwujudan
janji-janji mereka yang tertulis di buku ini. Tak perlu mengumbar
janji baru. Cukup baca buku ini dan laksanakan janji-janji yang
tertulis di dalamnya.
WA Wicaksono
Senior Copywriter Creative Network Communications
Istilah dan Singkatan
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l93
Istilah dan Singkatan
AIDS : Acquired Immunodefcient Syndrome
Angkot : Angkutan Kota
APBD : Anggaran Pendapatan dan Belanja Daerah
APBN : Anggaran Pendapatan dan Belanja Negara
Apjati : Asosiasi Perusahaan Jasa Tenaga Kerja Indonesia
ASEAN : Association of Southeast Asian Nations
Askes : Asuransi Kesehatan
Bappenas : Badan Perencanaan Pembangunan Nasional
BBM : Bahan Bakar Minyak
BIN : Badan Intelijen Negara
BLBI : Bantuan Likuiditas Bank Indonesia
BPK : Badan Pemeriksa Keuangan
Bulog : Badan Urusan Logistik
BUMN : Badan Usaha Milik Negara
Calih : Calon Terpilih
Capres : Calon Presiden
Cawapres : Calon Wakil Presiden
Istilah dan Singkatan
l94
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
DEN : Dewan Ekonomi Nasional
Depdagri : Departemen Dalam Negeri
Depdiknas : Departemen Pendidikan Nasional
Depkeh : Departemen Kehakiman
Deplu : Departemen Luar Negeri
Depnaker : Departemen Tenaga Kerja
DKN : Dewan Keamanan Nasional
DOM : Daerah Operasi Militer
DPP : Dewan Pengurus Pusat
DPR : Dewan Perwakilan Rakyat
DPRD : Dewan Perwakilan Rakyat Daerah
DVD : Digital Video Disc
Ed. : Editor
GAM : Gerakan Aceh Merdeka
GOR : Gedung Olahraga
GPSP : Gerakan Pemberdayaan Suara Perempuan
HAM : Hak Asasi Manusia
HPH : Hak Pengelolaan Hutan
HTI : Hutan Tanaman Industri
Istilah dan Singkatan
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l95
IDI : Ikatan Dokter Indonesia
IMF : International Monetary Fund
Irjen : Inspektur Jenderal
Jabotabek : Jakarta-Bogor-Tangerang-Bekasi
Jamsostek : Jaminan Sosial Tenaga Kerja
Jankomit : Janji-janji dan Komitmen
JK : Jusuf Kalla
Kadin : Kamar Dagang dan Industri
Kapolri : Kepala Polisi Republik Indonesia
KB : Keluarga Berencana
Keppres : Keputusan Presiden
KKN : Korupsi Kolusi dan Nepotisme
Komnas : Komisi Nasional
Kosgoro : Kesatuan Organisasi Sosial Gotong Royong
KPK : Komisi Pemberantasan Korupsi
KPU : Komisi Pemilihan Umum
KTI : Kawasan Timur Indonesia
LSM : Lembaga Swadaya Masyarakat
Menkopolkam : Menteri Koordinator Politik dan Keamanan
Istilah dan Singkatan
l96
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
MPR : Majelis Permusyawaratan Rakyat
MUI : Majelis Ulama Indonesia
NAD : Nanggroe Aceh Darusalam
NKRI : Negara Kesatuan Republik Indonesia
NTT : Nusa Tenggara Timur
NU : Nahdlatul Ulama
Otoda : Otonomi Daerah
Otsus : Otonomi khusus
PB IDI : Pengurus Besar Ikatan Dokter Indonesia
PDB : Produk Domestik Bruto
PDI-P : Partai Demokrasi Indonesia Perjuangan
Pemilu : Pemilihan Umum
PJTKI : Penyalur Jasa Tenaga Kerja Indonesia
PNS : Pegawai Negeri Sipil
Polri : Polisi Republik Indonesia
PT : Perguruan Tinggi
Puskesmas : Pusat Kesehatan Masyarakat
RI : Republik Indonesia
RUU : Rencana Undang-undang
Istilah dan Singkatan
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l97
SARA : Suku, Agama, Ras dan Antargolongan
SBY : Susilo Bambang Yudhoyono
SBY-JK : Susilo Bambang Yudhoyono-Jusuf Kalla
SD : Sekolah Dasar
SDA : Sumberdaya Alam
SDM : Sumber Daya Manusia
Sembako : Sembilan Bahan Pokok
SIUPP : Surat Izin Usaha Penerbitan Pers
SJSN : Sistem Jaminan Sosial Nasional
SLTA : Sekolah Lanjutan Tingkat Atas
SLTP : Sekolah Lanjutan Tingkat Pertama
SMA : Sekolah Menengah Atas
SMP : Sekolah Menengah Pertama
SMU : Sekolah Menengah Umum
Taspen : Tabungan dan Asuransi Pegawai Negeri
TBC : Tuber Colosis
TKI : Tenaga Kerja Indonesia
TNI : Tentara Nasional Indonesia
TV : Televisi
Istilah dan Singkatan
l98
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
UKM : Usaha Kecil Menengah
UMKM : Usaha Mikro, Kecil, dan Menengah
UU : Undang-undang
UUD : Undang-undang Dasar
UUD ‘45 : Undang-undang Dasar 1945
VCD : Video Compact Disc
Wantanas : Dewan Ketahanan Nasional
WHO : World Health Organization
WNA : Warga Negara Asing
WNI : Warga Negara Indonesia
Daftar Rujukan
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? l99
Daftar Rujukan
Antara
http://www.antaranews.net
Bali Post
http://www.balipost.co.id
Banjarmasin Post
http://www.indomedia.com/bpost
BBC Indonesia
http://www.bbc.co.uk/indonesian
Berita Sore
http://www.beritasore.com
Bisnis Indonesia
http://www.bisnis.com
Blog Pemilu 2004
http://pemilu2004.goblogmedia.com
China Radio International
http://id.chinabroadcast.cn
CNN
http://www.cnn.com
Daftar Rujukan
200
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
CyberNews
http://cybernews.cbn.net.id
Daftar Alamat
http://www.geocities.com/daftaralamat
Detik Portal
http://www.detikportal.com
Detikcom
http://www.detik.com
Direktori Indonesia
http://www.geocities.com/direktoriindonesia
Equator Online
http://www.equator-news.com
Gatra
http://www.gatra.com
Harian Berita Sore
http://www.beritasore.com
Harian Suara Merdeka
http://www.suaramerdeka.com
Himpunan Alumni Institut Pertanian Bogor
http://www.alumni-ipb.or.id
Daftar Rujukan
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 20l
Hukum Online
http://www.hukumonline.com
Ikatan Cendekiawan Muslim se-Indonesia
http://www.icmi.or.id
Indonesia Interactive
http://www.i2.co.id
Indosiar
http://news.indosiar.com
Info Menuju RI Satu
http://www.dnet.net.id/infori
Jamanpro-SBY
http://www.jamanpro-sby.com
Jaminan Pemeliharaan Kesehatan Masyarakat
http://www.jpkm-online.net
Jatim.go.id
http://www.jatim.go.id
Jawa Pos
http://www.jawapos.co.id
Kaltim Post
http://www.kaltimpost.web.id
Daftar Rujukan
202
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Kapanlagi.com
http://www.kapanlagi.com
Kebangkitanbangsa.org
http://www.kebangkitanbangsa.org
Koalisi Media
http://www.koalisimedia.org
Koalisi untuk Indonesia Sehat
http://www.koalisi.org
Komisi Hukum Nasional
http://www.komisihukum.go.id
Komisi Pemilihan Umum
http://www.kpu.go.id
Kompas
http://www.kompas.com
Kompas Cyber Media
http://www.kompas.co.id
Lampung Online
http://www.lampungonline.com
Lampung Post
http://www.lampungpost.com
Daftar Rujukan
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 203
Liputan 6 SCTV
http://www.liputan6.com
Lombok Network:
http://www.lombok-network.com
Media Indonesia
http://www.mediaindo.co.id
Mediacorp Radio
http://rsi.mediacorpradio.com
Mega-Hasyim
http://www.megahasyim.com
Pantau Pemilu
http://www.pantaupemilu.or.id
Partai Golkar:
http://partai-golkar.or.id
Pemerintah Kota Pagar Alam
http://www.pagaralam.go.id
Perpustakaan Bappenas
http://perpustakaan.bappenas.go.id
Pikiran Rakyat
http://www.pikiran-rakyat.com
Daftar Rujukan
204
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Pontianak Post
http://www.pontianakpost.com
PresidenRI
http://www.presidenri.or.id
Pusat Data & Analisa Tempo
http://www.pdat.co.id
Radio Republik Indonesia
http://www.rri-online.com
Rakyat Merdeka
http://www.rakyatmerdeka.co.id
RCTI
http://www.rcti.tv
Republika
http://www.republika.co.id
Riau Pos
http://www.riaupos.com
SBY & JK Untuk Indonesia
http://www.sby-oke.com
SBY Untuk President RI 2004-2009
http://prosby.com
Daftar Rujukan
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 205
Sbyudhoyono
http://www.sbyudhoyono.com
Sekitar Kita
http://www.sekitarkita.com
Sinar Harapan
http://www.sinarharapan.co.id
Sinar Indonesia Baru
http://www.hariansib.com
Sriwijaya Post
http://www.indomedia.com/sripo
Suara Karya
http://www.suarakarya-online
Suara Pembaruan
http://www.suarapembaruan.com
Sumatera Ekspres
http://www.sumeks.co.id
Surya
http://www.surya.co.id
TEMPO interaktif
http://www.tempointeraktif.com
Daftar Rujukan
206
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
Trans TV
http://www.transtv.co.id
TV7
http://www.tv7.co.id
Voice of America
http://www.voanews.com
Warta Ekonomi
http://www.wartaekonomi.com
Lampiran
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 207
LAMPIRAN
Kisah Biru:
Ada Apa, Sih? Kok, Semua Pada
Nolak?
Dari Balik Penerbitan Buku
Janji-Janji & Komitmen SBY-JK
Edisi Pertama
Buku saya “Janji-janji dan Komitmen SBY-JK edisi pertama
ternyata amat laris. Dari laporan yang saya terima, buku tersebut
menduduki peringkat pertama penjualan di hampir semua toko
buku terkemuka di Indonesia. (ceillehh...!). Padahal, keberadaan
buku tersebut belum pernah diiklankan secara terbuka di media
cetak, televisi, atau radio manapun. Juga belum pernah diadakan
acara promosi semacam peluncuran buku, resensi atau sejenisnya
sebagaimana buku-buku lainnya.
Karena penasaran, saya pun turun langsung ke lapangan
untuk melakukan survei kecil-kecilan. Beberapa toko buku di Jakarta
yang sempat saya kunjungi (tentu saja saya tak sempat mengunjungi
semua toko buku) menempatkan buku tersebut di tempat yang
paling diidam-idamkan oleh semua penulis buku: best seller. Bahkan
di sebuah toko buku besar di Matraman Jakarta, buku tesebut dengan
gagahnya menduduki singgasana itu. Saya bilang singgasana, karena
Lampiran
208
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
buku lokal yang bisa mendapat predikat itu di toko buku tersebut
jumlahnya amatlah minim. Selain buku saya, ada juga buku fksi
berjudul Supernova, juga buku tentang tumbuhan merah yang bisa
mengobati HIV, dan satu buku lokal lainnya (tak ingat judulnya
dan tak sempat baca dalamnya). Yang banyak adalah buku-buku
terjemahan (sekitar 10 judul).
Kok, Alergi?
Buat saya, predikat “best seller” amatlah luar biasa mengingat
buku tersebut belum cukup dua minggu beredar. Saya jadi teringat
saat-saat sebelum buku itu diterbitkan. Sebenarnya, sebelum selesai
ditulis, sudah ada penerbit terkemuka yang bersedia menerbitkannya
(buku saya lainnya diterbitkan oleh penerbit ini). Tapi begitu buku
selesai ditulis dan melihat isinya, mereka jadi kehilangan nyali.
Mereka tak menyangka saya bisa merekam semua janji SBY-JK
dan fakta nyata dengan begitu lengkapnya. Lagipula selama ini
kan belum pernah ada di Indonesia (bahkan di dunia) buku yang
merekam dengan jelas janji-janji seorang politikus, apalagi seorang
calon Presiden dan Wakil Presiden yang kemudian terpilih.
Penerbit lain yang juga saya tawarkan (juga penerbit yang
akan menerbitkan buku saya lainnya) tiba-tiba tampak seperti
kehilangan nafsu. Mereka mengatakan “Oke” tapi dengan suara
rendah dan ludah tertahan di tenggorokan. Bagi saya, ini artinya
mereka setuju tapi dengan terpaksa dan tidak pasti kapan akan
menerbitkannya. Saya malah jadi kasihan pada mereka.
Saya sendiri tak tahu mengapa orang-orang jadi pada alergi
menerbitkan buku itu. Padahal berulang-ulang saya katakan, buku
ini tak punya pretensi politik apapun. Apalagi sekarang kan kita
hidup di alam demokrasi. Malah SBY-JK sendiri dalam berbagai
Lampiran
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 209
forum berulang-ulang meminta agar mereka dikritik. Mengapa?
Ya, supaya mereka tahu sudah sejauh mana mereka melangkah dan
sudah sejauh mana mereka belum melangkah. Kok, kita semua jadi
pada takut, jadi pada banci sih?
Buku ini bukanlah buku kritikan, tapi punya tujuan yang
sama. Isinya adalah janji dilengkapi fakta dan data di Indonesia
saat mereka mengucapkan janji. SBY-JK jika sempat membacanya
pun saya yakin pasti senang. Dengan adanya buku ini mereka akan
terbantu untuk mengingat apa-apa saja yang sudah mereka janjikan
(soalnya, boss-boss kita kalau bikin janji kan biasanya suka lupa) dan
apa aja yang tidak mereka janjikan. Jangan sampai mereka sudah
bersusah memenuhi janji, rakyat malah menganggap mereka tidak
memenuhi janji karena rakyat sendiri tidak tahu apa yang pernah
dijanjikan kepada mereka.
Wah, jadi kemana - mana. Tapi selanjutnya, setelah itu
saya berpikir untuk menerbitkannya sendiri. Kenapa tidak? Selama
ini saya sudah menulis dan menerbitkan sendiri 41 (empat puluh
satu) judul buku direktori bisnis, dan 3 judul buku musik (ini hobi
sampingan saya). Dan semuanya laku dijual bahkan di pasar luar
negeri. Tapi setelah saya instropeksi diri (ceilehhh..!), saya ternyata
belum berpengalaman dalam menerbitkan buku untuk dikonsumsi
masyarakat umum. Dengan kata lain, saya belum begitu menguasai
jalur-jalur pemasaran di dalam negeri. Ya, mau tidak mau saya harus
mencari penerbit lain.
Bejibun SMS dan Telepon
Maka mulailah saya berjuang dengan mengirimkan
penawaran melalui faks dan email ke berbagai penerbit. Dari
Lampiran
2l0
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
10 penerbit, hanya dua yang antusias dan bersedia langsung
menerbitkannya dalam waktu dekat, tiga akan pikir-pikir dulu,
sementara sisanya bahkan untuk menjawab saja tak berani. Tapi saya
belum langsung menjawab karena sebelumnya saya sudah terlanjur
mengirim surat pembaca ke beberapa media cetak. Di sini juga
saya tak habis pikir. Dari sembilan surat pembaca yang saya kirim
untuk mencari mitra penerbit buku tersebut, hanya dua yang berani
memuatnya. Yakni, Tabloid Kontan dan Harian Bisnis Indonesia,
dua media yang menjadi favorit saya selama ini.
Begitu surat pembaca dimuat, saya menerima bejibun
telepon dan SMS dari pembaca (maklum, dalam surat pembaca
saya sertakan nomor hape saya). Semuanya berisi dukungan dan
kesediaan untuk menerbitkan. Bahkan ada yang langsung berniat
membeli hak cipta buku tersebut dengan angka berapa saja, tapi
bukan untuk diterbitkan melainkan untuk dimusnahkan (hehehe...
yang ini mungkin dari kelompok atau partai tertentu).
Hanya butuh dua hari, saya akhirnya berhasil memilih satu
penerbit yang saya anggap track record-nya selama ini sangat baik.
Dan benar sesuai janji, hanya sekitar 2 minggu kemudian buku
tersebut sudah beredar di pasaran. Sungguh luar biasa.
Sekarang, saya mencoba menerbitkan kembali buku ini
secara self-publishing, tentu saja setelah saya menerima kembali
hak terbit dari penerbit sebelumnya. Tak banyak yang berubah
kecuali berbagai tambahan komentar dari mereka yang telah pernah
membaca buku ini cetakan pertama.
O,ya, kisah ini saya sebut kisah biru karena waktu menulisnya
saya menggunakan kacamata dengan lensa biru penahan terik
matahari. Huruf-huruf yang tampak semuanya jadi biru. Bener, deh.
Kalau tak percaya, coba deh buktikan. Kalau Anda membacanya
Lampiran
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 2ll
sambil menggunakan kacamata berlensa ungu, Anda bisa merubah
judulnya menjadi Kisah Ungu. Terserah...suka-suka Anda-lah ! Ini
kan jamannya perubahan!
CATATAN: Kisah biru ini saya tulis kembali berdasarkan tulisan
saya dengan judul yang sama yang banyak beredar di
internet.
Terima kasih khusus saya ucapkan kepada
MODERATOR dan AKTIVIS milis (mailing
list) di bawah ini yang telah banyak membantu
upaya menerbitkan kembali buku ini:
agromania, bacayo, bandung_pusatbuku,
bhinneka_tunggal_ika, bmmi, buku-islam,
bukukita, cfbe (centre for the betterment of
education), cikeas, dastanbooks, dikmenjur,
diskusi-pembebasan, ebookmaniak, ekonomi-
islami, eramuslim, escaevabookclub,
indonesia-online, indotalks, info_madani,
islamic_discussion_via_internet, jaker,
jardiknas, jelajahbudaya, junior_trader,
jurnalisme, kajian_lepaskerja, katasibijak,
kebumian, kolbu, komunitashistoria, lintaseni,
mediacare, media-indonesia, milis-kammi,
mobilemaniak, nasional-list, pakguruonline,
pantau-komunitas, pasarbuku, pendidikan,
penulislepas, ppiindia, proletar, referensi_
maya, relasimania, resensibuku, rezaervani,
sukasukamu, sulteng, tauziyah, tou-kawanua,
wanita-muslimah, wartawanindonesia, yok_
bacabuku, zamanku
BIODATA PENULIS
RUDY S. PONTOH. Lahir di Poso,
Sulawesi Tengah, 18 Mei 1964. Kuliah di
FK - Unhas (1983-1992) lalu terjun sebagai
wiraswasta. Pernah menjabat sebagai salah
seorang direksi sebuah perusahaan properti
di Yogyakarta, lalu sejak 1994 pindah ke
Jakarta dan bekerja sebagai direktur di sebuah perusahaan swasta
terkenal.
Antara tahun 1983 hingga 1986 ia aktif menulis masalah hukum
dan internasional, dua bidang kepenulisan yang paling diminatinya.
Juga masalah psikologi dan kesehatan (sesuai latar belakang
pendidikanya) di berbagai media cetak Ibukota. Di bidang hukum,
ia pernah berpolemik keras dan berkepanjangan dengan Achmad
Ali (kini salah seorang tokoh hukum di Indonesia). Pada masa itu, ia
juga tergolong penulis aktif angkatan kedua setelah angkatan Hamid
Awaluddin (mantan Menteri Hukum dan HAM) di Identitas, koran
kampus Universitas Hasanuddin Makassar. Keaktifannya menulis di
berbagai media membuat ia kemudian diangkat sebuah Ketua FPM
(Forum Penulis Makassar), salah satu organisasi kepenulisan paling
elite yang pernah ada di Makassar.
Kini, di samping kesibukan bisnis, sejak 2005 ia juga aktif sebagai
Ketua Umum Forum Poso Bersatu, sebuah organisasi kaum
pemberani yang selama ini bertindak sebagai kontra provokator
guna menghentikan dan meredam berulangnya konfik Poso. Alamat
Email: rudypontoh@gmail.com
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin? 2l3
Janji-janji dan Komitmen SBY-JK | (Edisi 2)
Ternyata Hanya Angin?
v
MenciptakanKesempatanKerja............................................... 122
MeningkatkanKinerjadanStabilitasEkonomiMakro............ 123
MenghapusKemiskinan........................................................... 124
MeningkatkanAksesRakyatTerhadapPendidikan................. 124
MeningkatkanAksesRakyatTerhadapLayananKesehatan.... 125
MenghapusKetimpangan........................................................ 125
MemperbaikiPengelolaaanSumberdayaAlam........................ 126
MerevitalisasiPertaniandanPedesaan..................................... 126
BAGIAN TIGA :
Data dan Angka Sebagai Indikator Janji
DatadanAngkaMediaMassa................................................. 131
DatadanAngkaWarisanMegawati......................................... 147
BAGIAN EMPAT :
Dari Mereka yang Menunggu Realisasi Janji......................... 151
BAGIAN LIMA:
Setelah Terhembus Angin .................................................. 177
ISTILAH DAN SINGKATAN............................................. 193
DAFTAR RUJUKAN............................................................ 199
LAMPIRAN: Kisah Biru....................................................... 207
BIODATA PENULIS........................................................... 213

Komentar dan Testimoni
“Yang saya soroti dari buku ini adalah janji SBY untuk membangun demokrasi melalui kebijakan antidiskriminasi. Akan tetapi, di masa SBY, kebijakan yang diskriminatif dan antipluralisme sangat menonjol, khususnya dalam bidang agama. Terutama terhadap penganut agama dan kepercayaan minoritas. Indikator: Pengabaian hak-hak sipil para penghayat kepercayaan, penyerangan terhadap Ahmadiyah, penutupan gereja-gereja Kristen, dan penangkapan para pimpinan aliran-aliran baru: Lia Eden, Al-Qiyadah, dan lainlain. Akibatnya, timbul konflik horisontal: kelompok mayoritas menyerang minoritas dengan dalih fatwa MUI. Sepanjang sejarah RI, baru SBY presiden yang tunduk pada fatwa MUI. Padahal, fatwa MUI tidak punya tempat dalam struktur hukum di Indonesia. Mestinya dia hanya berpedoman pada Pancasila dan UUD ‘45 yang menjamin kemerdekaan setiap warga untuk menganut agama dan kepercayaan masing-masing. “ Prof. Dr. Siti Musdah Mulia, M.A Jakarta “Walau saya pernah dekat dan bekerja sama – namun saya tidak pernah bisa menebak, membaca, dan memprediksi apa yang ada dalam benak dan apa yang akan dilakukan seorang SBY. Yang dapat saya pastikan, menurut pendapat pribadi saya, bahwa SBY adalah
Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 

seorang politisi ulung, tangguh, dan sabar. Beliau pandai memainkan manajemen waktu, lihai mengatur emosi kawan maupun lawan, dan amat cerdas menggiring atmosfir di setiap tempat dan komunitas. Beliau juga sangat tangkas menjadikan dirinya sebagai magnet dalam seketika. Dalam keadaan serba normal, beliau memang pas dan pantas menjadi presiden bagi negeri ini. “ Sys NS Ketua Umum DPP Partai NKRI (Negara Kesatuan Republik Indonesia) Jakarta “Kritik Rudy S. Pontoh dalam buku ini memperjelas kita bahwa kritik bukan saja sebuah keinginan dari warganegara untuk bebas bicara, tapi juga sebuah kebutuhan dari pemerintah negara agar berbuat lebih baik.” Usman Hamid Koordinator Kontras Menteng, Jakarta Pusat “Adanya hasrat dari kalangan SBY-JK untuk berpaket kembali atau pun secara terpisah menunjukkan keyakinan bahwa janji-janji dan komitmen mereka seperti yang saya baca dalam buku ini rasanya telah ditebus secara perlahan. Proses demokratisasi, desentralisasi, dan pemberdayaan ekonomi masyarakat relatif baik dan terbebas dari IMF. Pemberantasan korupsi belum memuaskan masih bertumpu pada penguatan institusional. Yang menonjol adalah pelaksanaan demokrasi di Indonesia jauh lebih baik dari Singapura 

Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?

dan Malaysia. Kabinet ekonominya belum “menggigit” menangani makroekonomi.” Prof. Dr. Amran Razak, SE, M.Sc Guru Besar FKM Universitas Hasanuddin Makassar “Seseorang yang tidak mampu menepati janji tidak layak jadi pemimpin. Secara pribadi, saya masih ingin percaya dan berharap pada SBY. Tapi hampir semua seniman dari berbagai propinsi yang hadir di Kongres Dewan Kesenian se-Indonesia di Papua Agustus 2005 lalu menganggap SBY pembohong / tidak bisa memegang kata-kata. Pada penutupan kongres dimaksud SBY berjanji membangun kesenian Indonesia dengan sungguh – sungguh, salah satunya dengan mensahkan DKI (Dewan Kesenian Indonesia) sebagai keputusan kongres. Dua setengah tahun Tim Formatur DKI melakukan berbagai cara menagih janji, NIHIL. Kalau janji resmi dan ditayangkan TVRI ke seluruh negeri saja tidak ditepati…sekarang silahkan rakyat menilai. Sebab dalam hal tidak kunjung disahkannya DKI, SBY hanya memberi kita dua pilihan kemungkinan: SBY tidak mampu atau SBY tidak bisa dipegang kata-katanya. Dua-duanya tidak dibutuhkan rakyat Indonesia.” Ratna Sarumpaet Aktivis dan Seniman Jakarta

Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 

Kadang pemimpin sering melupakan apa yang dijanjikan dan membuat janji-janji baru untuk mempertahankan kepemimpinannya. Negeri ini tidak butuh janji. SH Basmar. SE Pimpinan Pondok Pesantren Annur Kota Bekasi v Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Mampang Jakarta Selatan “Lebih baik saya tidak mengomentari buku ini karena apapun komentar saya justru akan dipermasalahkan orang. tapi kerja nyata yang dikawal oleh visi dan moralitas sejati. Farhat Abbas.” Ahmad Ushtuchri. Biarlah kawankawan pengamat yang berkomentar. “Agar diungkapkan juga mengenai apa yang tidak/belum pernah dijanjikan SBY-JK kepada rakyat.” Andi Alfian Malarangeng Juru Bicara Presiden RI Jakarta “Buku ini mudah-mudahan jadi pelajaran moral nomor satu bagi siapa saja yang mengaku pemimpin atau siapa saja yang mau terjun ke dunia politik. “ M.

Jika ke depan. bangsa Indonesia sangat membutuhkan pemimpin yang berjuang membawa perubahan positif bagi rakyat. “ Ratih Sanggarwati Jakarta “Buku ini sangat dibutuhkan oleh sebagian besar rakyat Indonesia.D Founder CFIS (Center For Interregional Study) Jepang Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? v . Sampai kapan pun dan oleh siapapun hutang akan tertagih. “ Prof. “ Dr. Di era globalisasi. Dr. serta disegani oleh bangsa-bangsa di dunia dalam percaturan internasional. M. “Membaca buku ini saya merasakan pancaran ketulusan dari Bapak SBY. untuk periode 2009-2014 pasangan SBY-JK masih ingin terpilih lagi. Ph. Maizar Rahman Gubernur OPEC Peneliti Utama Teknologi Minyak & Gas “Kita semua sepakat janji adalah hutang.. yang telah dengan ikhlas menjatuhkan pilihannya kepada pasangan SBY-JK. masih ada sisa waktu untuk membuktikan implementasi janji dan komitmennya terhadapat rakyat. dalam menggapai cita-cita Indonesia sebagai negara yang maju dan sejajar. bangsa dan negara. Taruna Ikrar.Pharm. Kalau sudah terlontar sebaiknya ditepati supaya selamat nanti di “sana”. Janji-janji beliau memberikan optimisme yang besar.

” Wimar Witoelar PT InterMatrix Indonesia Jakarta Selatan “Buku ini adalah wujud upaya cerdas guna mencerdaskan anak bangsa. “Buku ini telah memberikan kontribusi berharga karena sudah melayani kepentingan masyarakat untuk memantau mereka yang berkuasa (SBY-JK) agar bertanggung jawab pada setiap perilaku. Kita lihat saja nanti. keputusan.” Muhammad Ikbal. “ Josephine Mathilda Aktivis Persaudaraan Poso Palu. SH General Manager PT BBS Jakarta & Kendari “Saya yakin buku ini menarik dan berguna untuk banyak orang. dan kebijakannya. Dan saya yakin SBY-JK akan terus berusaha menepati janji-janjinya. Sulteng “Buku ini telah merekam semua janji SBY-JK pada masa kampanye dulu dengan sangat lengkap dan jelas. Hanya soal waktu. Jika suatu saat nanti politisi ini hendak kembali naik ke podium Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? v . Keberadaannya jelas memberikan efek positif pembelajaran. Namun saya tidak merasa mampu untuk menulis komentar.

Hukum UNSRI Ogan Ilir. terutama kalangan pendidikan dan aktivis serta kalangan HAM.” Mulyani Hasan Penulis dan Wartawan Bandung Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? v . Berulangkali ingkar janji. Semoga SBY-JK atau mungkin para politisi lain di pentas daerah atau nasional menjadikan ini sebagai barometer. Sebab. maka setidaknya ia akan berpikir ulang untuk tidak mengumbar janji-janji politik secara sembarangan. Jakarta Selatan “Penyebaran ide dan gagasan dalam buku ini sangat perlu diketahui khalayak umum. bahkan untuk kajian kajian hukum lebih dalam.kampanyenya.” Mohammad Aqil Ali. menjajikan perubahan dan kesejahteraan. SH HWS & Partners Wisma Kemang. Buku ini akan menjadi sumber rujukan bagi kita untuk mengkritisi sudah sejauh mana janji-janji tersebut terwujudkan. sekarang ia tahu ucapannya tersebut tidak lagi terbang bersama angin tapi dicetakbukukan menanti pertanggungjawaban dalam bentuk nyata. padahal rakyat sudah mencatatnya. ada saatnya melawan dan menagih bakul berisi janji-janji itu. Sumsel “Para politisi itu mengekploitasi kaum miskin.” Dedeng Z Staf Pengajar Fak.

integritas serta kehidupan perekonomian. Janji-janji yang diumbar pada saat Pemilu 2004 lalu seharusnya sudah dapat kita rasakan sekarang. terpadu & terukur demi mencapai Indeks Pembangunan Manusia (IPM) yang ideal. “ Yudan S Perum Graha Sengkaling Dau – Malang. SH Kantor Pengacara Vera Tobing & Patners Jakarta “Semoga buku ini tersedia banyak di toko buku manapun dan dijual dengan harga terjangkau sehingga semua orang bisa memilikinya hingga ke masyarakat kalangan menengah ke bawah. Dengan kehadiran buku ini diharapkan SBY-JK menyadari bahwa yang dibutuhkan masyarakat Indonesia saat ini adalah realisasi terhadap setiap komitmen yang mereka buat.” Vera T. “Buku ini cukup mewakili tuntutan masyarakat Indonesia yang sangat mengharapkan realisasi terhadap mimpi-mimpi yang diberikan para pemimpin bangsa ini ketika mereka menginginkan dukungan untuk menduduki tahta kekuasaan di negara ini. Yang terjadi justru sebaliknya. bertahap. Jawa Timur “Setelah membaca buku ini saya berpendapat: yang terpenting adalah janji-janji dan komitmen itu dapat terlaksana secara komprehensif.” Zikroen Habibie Jakarta Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? v . dimana keadaan semakin menuju ke jurang kesengsaraan baik dari sudut moralitas. kontinyu. Tobing.

Janji-janji & Komitmen SBY-JK Ternyata (edisi 2) Hanya Angin? .

atau menjual kepada umum suatu cptaan atau barang hasl pelanggaran hak cpta atau hak terkat sebaga dmaksud pada Ayat (1) dpdana dengan pdana penjara palng lama 5 (lma) tahun dan/atau denda palng banyak Rp500.000.000.000.000. atau pdana penjara palng lama 7 (tujuh) tahun dan/atau denda palng banyak Rp5. mengedarkan. Barangsapa dengan sengaja melanggar dan tanpa hak melakukan perbuatan sebagamana dmaksud dalam Pasal 2 Ayat (1) atau Pasal 49 Ayat (1) dan Ayat (2) dpdana dengan pdana penjara masngmasng palng sngkat 1 (satu) bulan dan/atau denda palng sedkt Rp1.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Barangsapa dengan sengaja menyarkan. memamerkan.00 (satu juta rupah).000.00 (lma ratus juta rupah).000.00 (lma mlar rupah). 2.000.Sanksi Pelanggaran Pasal 72 Undang-undang Nomor 19 Tahun 2002 Tentang Hak Cipta 1.

Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

com © 2008 Rudy S.Janji-janji dan Komitmen SBY-JK (Edisi 2) Ternyata Hanya Angin? Oleh Rudy S. Jakarta 2008 Email: bokicipta@gmail. Pontoh Hak cipta dilindungi oleh undang-undang ISBN 978-979-17267-0-2 Didistribusikan oleh Boki Cipta Distributor Jakarta Dicetak oleh Percetakan Imagraph Isi di luar tanggung jawab percetakan  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Pontoh Desain Sampul & Penata Letak: Ad Sketch Art Sampul: Ledi Raja Diterbitkan oleh Penerbit Boki Cipta Media.

Taruna Ikrar. buku ini juga saya persembahkan buat Cheche — kucing saya tercinta yang kini sudah tiada. dan juga juga teman aktivis dari Forum Poso Bersatu: Farhat Abbas. Sese. Vera T. Kaimana Lapian. Anwar Wardy W. Didin P. Tak lupa juga saya ucapkan terima kasih kepada temanteman “tim sukses” yang dulu suka ngumpul di Graha Anugrah: Sys NS. Dahlan Abubakar. Moelawarman. dan semuanya. Hatta. Om Ismail. Amalia Th. Terima kasih juga saya ucapkan kepada keluarga besar saya di Poso. kota kelahiran saya. Petty S. Yulita yang setia mengawal si kecil. dan lain-lain. Nil Syeban. Adam Riyanto. Ratna Sarumpaet. Buku ini saya persembahkan untuk Kinanti Syandini Pontoh (Syasa) — putri tercinta yang selalu meramaikan hari-hari saya. yang hingga kini nasih setia bertahan di antara puing-puing kerusuhan: Hary. Juga saya ucapkan terima kasih kepada Pak Syarifudin — konsultan penerbitan yang rajin menasehati saya. Ambardini. Rita (Nona). Tobing. Marlini Hasan —istri saya tercinta yang selalu setia mendampingi saya. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Sustin. Elen Tandawuya. Camelia Latjuba. Taswin. teman-teman aktivis yang suka ketemu di Kontras: Usman Hamid. dan Pak Idi — sopir yang selalu siaga setiap saat. Ma’u. Fat Alamrie. Bernard Ndawu. Netty. M. Mbak Amalia Damaiyanti — kakak ipar yang suka meramaikan suasana. Yati Utoyo Lubis. Juga…di luar semua itu. Zein Suweleh dan masih banyak lagi mbak-mbak dan masmas yang tidak mungkin saya sebutkan satu persatu di sini. Papa Dedi. Darma Tongku. Amran Razak. Mbok Marsiyah yang rajin menyiapkan kopi panas di meja kerja saya. Syamsul Hilal Salam.Iqbal Miad. M. Ritha Mananri. M. Tak lupa saya sampaikan cium sayang buat Ledi dan Gege yang senantiasan menemani saya dengan segala kesabarannya. serta teman-teman dalam karir kepenulisan saya: Belinda Gunawan. Mbak Dewi Dewo — sahabat setia yang selalu memberi inspirasi baru. Fatimah. Elvira (Pico). Mohtar.

v Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .

Anda juga akan menemukan data bahwa buku ini. ternyata buku ini telah menjadi referensi dan daftar pustaka berbagai tesis ilmiah serta koleksi perpustakaan di berbagai belahan dunia termasuk perpustakaan kepresidenan RI. Setelah mengalami berbagai penolakan. Saat saya menulis surat pembaca ke media cetak untuk mencari mitra penerbit. Sekarang. Namun jejak-jejak keberadaan buku ini bisa dengan mudah Anda cari di internet.Kata Pengantar Edisi 2 Ketika saya menawarkan ke penerbit. Kini tak ada satupun buku tersebut yang tersisa di toko buku. Jika Anda menulis di Google “janji SBY” – tanpa tanda kutip – maka situs promosi buku ini yang muncul berada paling di atas. banyak penerbit yang menolak dengan berbagai alasan. hingga edisi keduanya diterbitkan. terus menjadi pembicaraan hangat di internet. termasuk tambahan komentar dari orang-orang yang saya sebut Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? v . Dengan meng-gogling (melakukan pencarian dengan Google). buku ini (baca: buku “Janji-Janji & Komitmen SBY-JK” edisi pertama) akhirnya berhasil diterbitkan untuk pertama kali dan meledak di pasaran. Data lain yang bisa Anda temukan. buku ini saya terbitkan kembali dengan isi yang hampir sama persis dengan buku edisi pertama Hanya penampilannya sedikit diperbaharui dengan beberapa tambahan penting di sanasini. banyak media cetak bahkan takut memuat surat pembaca saya.

Tapi bagaimana jika ternyata janji-janji dan komitmen mereka hanyalah angin? Akhirnya pesan saya. dan pion. v Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . masih terlalu dini untuk memberi penilaian berhasil tidaknya SBY-JK mewujudkan janjijanji mereka. Karena ibarat bermain catur. Jangan ragu-ragu untuk membelinya. sebelum skak mat.“pemberani” dan “pemerhati” negeri ini. raja. Tetap saja masih ada waktu. belilah buku ini pada kesempatan pertama ketika Anda melihatnya. Mungkin benar kata orang. Visi dan misi awal buku ini untuk tetap tampil polos (tanpa pretensi dan keberpihakan kepada siapapun) tetap saya pertahankan. kita sulit memprediksi apakah seseorang akan kalah atau tidak bahkan meski batu yang ada tinggal benteng. Keragu-raguan hanya akan membuat Anda menyesal seperti banyak dialami orang dengan edisi pertama.

Masih ada ratusan jankomit lain yang menunggu bukti hingga lima tahun ke depan.Kata Pengantar Edisi 1 Saat buku ini ditulis. mereka memberi empat posisi menteri kepada wanita. Berbekal rasa penasaran plus keinginan untuk menagih atau lebih tepat menunggu janji. dan kapan jankomit diucapkan berusaha saya penuhi. masyarakat bisa menagihnya”. Untuk itu. mengumpulkan berbagai berita dan informasi apa saja yang berhubungan dengan SBY-JK. Nyatanya yang terpilih adalah seorang partisan salah satu parpol. mungkin juga “lupa-lupa ingat”. saya melakukan pelacakan media guna menelusuri keberadaan sang jankomit. “Saya setuju jika janji-janji calon presiden dan calon wakil presiden dicatat. Antara lain. Pada tahap ini semua arsip Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? v . di mana. ada juga yang tidak terbukti. tapi bisa dipastikan sebahagian besar akan menjawab “tidak”. Namun. Dalam komposisi kabinet misalnya. juga memilih putra Papua untuk duduk di kabinet sesuai janji. ada tiga tahap yang saya gunakan: Pertama. Adakah Anda mencatatnya? Mungkin “ya”. ada beberapa janji dan komitmen (selanjutnya saya singkat jankomit) Presiden RI Susilo Bambang Yudhoyono (SBY) dan Wakil Presiden RI Jusuf Kalla ( JK) yang sudah terbukti. Kaidah-kaidah sebuah data seperti apa. agar jika terpilih nanti. Padahal. janji akan memilih menteri BUMN dari kalangan nonpartisan. simaklah apa kata Jusuf Kalla saat berbicara di depan peserta Rakernas Badan Komunikasi Pemuda Remaja Masjid Indonesia (BKPRMI) di Balai Diklat Srondol Semarang (17 Juni 2004).

saat jankomit diucapkan. Jika fakta dan data pada saat itu ternyata banyak berubah dari fakta dan data dalam buku ini. mengecek ulang dengan menggunakan sumber lain seperti itu saya lakukan pada tahap terakhir. Selanjutnya. radio. hanya tempat dan waktunya yang berbeda. Tidak semua jankomit bisa saya telusuri. Penulusuran saya batasi pada berita dan informasi yang dipublikasikan sejak bulan Mei 2004 (masa persiapan pencalonan) hingga akhir Oktober 2004 (seusai pelantikan calon presiden dan calon wakil presiden terpilih). bulletin. Banyak jankomit yang diucapkan berulang. bukalah kembali fakta dan data ini. buku ini juga saya lengkapi dengan komentar dan opini dari mereka yang menunggu bukti jankomit. Selamat membaca! Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? v . Langkah memilih. Lima tahun mendatang. Agar pembaca tidak terlalu banyak “memakan” janji.koran. Sebagai indikator apakah SBY-JK memenuhi jankomit mereka. pada bagian lain buku ini saya sertakan fakta dan data keadaan Indonesia saat ini. Jankomit seperti ini saya singkirkan. Namun apa yang termuat dalam buku ini saya anggap bisa mewakili jankomit lainnya yang tidak berhasil saya lacak. majalah. televisi yang saya anggap bonafid (lihat rujukan) saya telusuri baik secara online maupun penelusuran langsung. berita dan informasi yang terkumpul saya pilahpilih kembali untuk memilih berita dan informasi yang berhubungan dengan jankomit. Hasilnya. Komentar dan opini saya kumpulkan dengan menyebarkan pertanyaan “apa yang ada harapkan dari janji dan komitmen SBY-JK?” di berbagai mailinglist maupun pertanyaan secara langsung. sunggguh luar biasa: jankomit yang terkumpul jumlahnya mencapai angka ribuan. Begitupun dengan jankomit yang saya anggap emosional atau diplesetkan oleh pembuat berita/informasi untuk tujuan-tujuan tertentu. bisa dipastikan SBY-JK telah memenuhi janji-janji perubahan yang selalu mereka dengungdengungkan.

Antara Janji SBY-JK dan Angin PENDAHULUAN: Waktu pemilu dulu. saya adalah pendukung independen SBY-JK (Susilo Bambang Yudhoyono - Jusuf Kalla). empat atau lima generasi mendatang. Saya yakin orang seperti saya ada jutaan jumlahnya di negeri ini. atau 10 tahun? Jika anda menjawab ya. Bahkan hingga saya merasa pesimis dengan janji-janji yang kerap dilontarkan SBYJK pada masa kampanye dulu. Bahkan jika masa pemerintahannya ditambah berlipatlipat kali pun masih ada janji yang masih sulit untuk dibuktikan. Bertanyalah pada seorang ulama. Lalu apa arti sebuah janji? Itu tergantung bagaimana. saya tetap mendukung mereka. Pernahkah Anda membayangkan negeri yang konon mewarisi budaya korup dari “sononya” dan selalu menduduki peringkat kelima atau keenam terkorup di dunia ini benar-benar bersih dari koruptor hanya berkat program pemberantasan korupsi yang 100 hari. itu berarti Anda sama optimisnya dengan generasi tiga. dalam waktu lima tahun masa pemerintahnya pun banyak janji yang menurut saya akan sulit dibuktikan. Jangankan diberi waktu 100 hari. siapa. empat atau lima dekade yang lalu dan sama akan kecewanya Anda dengan tiga. dan ia akan menjawab bahwa seorang muslim yang baik seharusnya menepati janji-janji yang ia ucapkan baik kepada sesama manusia maupun kepada Allah SWT. Kita pun diajarkan untuk melafazkan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . lima tahun. dan untuk apa janji itu diucapkan.

lagi-lagi mereka harus menghirup angin tak sedap karena pengumuman baru bisa dilaksananakan beberapa menit menjelang tengah malam. sah saja jika kemudian saya berpendapat bahwa apa yang diucapkan SBY-JK dulu memang bukanlah janji atau komitmen melainkan angin yang keluar dalam bentuk suara melalui sebuah proses di tenggorokan. banyak lagi indikator lain yang bisa membuktikan bahwa ucapan mereka dulu itu hanyalah angin. Sesudahnya. Sejak malam pengumuman kabinet tanggal 20 Oktober 2004 lalu. Pada mulanya pengumuman kabinet dijanjikan akan berlangsung pukul 20.“insya Allah” saat mengucapkan janji.00. dan cause (penggerak). Bertanyalah kepada seorang penyanyi. Dan jika kita bertanya kepada SBY-JK apakah mereka pernah mengucapkan janji saat kampanye dulu.00 WIB. Ketika waktu yang dijanjikan tiba. mereka pun mungkin akan berpendapat bahwa apa yang mereka ucapkan dulu itu bukanlah janji melainkan rencana. Ekspektasi masyarakat Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . ia mungkin akan berkata bahwa janji adalah sesuatu yang enak untuk didendangkan tapi tidak untuk dibuktikan. obligation (kewajiban). Jadi. Bertanyalah kepada seorang ahli filsafat. Ternyata para wartawan yang menunggu mewakili jutaan pemirsa di depan televisi terpaksa cuma menghirup angin karena waktu pengumuman ditunda hingga pukul 23. aroma angin sebenarnya sudah mulai terasa di Istana. Dalam riuh-rendah masa kampanye dulu mereka mengatakan akan melakukan shock therapy dalam bidang pemberantasan KKN pada masa 100 hari pertama pemerintahan mereka. maka ia akan mengaitkan masalah janji itu dengan tanggung jawab atau responsibility yang diartikan sebagai accountabiliy (perhitungan). Kenyataan pertama yang bisa kita jadikan indikator bahwa apa yang mereka katakan hanyalah angin tak perlu harus dibuktikan dengan menunggu waktu 100 hari atau hingga lima tahun ke depan.

Fakultas Ilmu Sosial dan Ilmu Politik (FISIP) Unhas. Masyarakat pun baru sadar bahwa mereka telah menerima angin. Untungnya ia tak langsung masuk angin begitu tahu pembentukan komisi independen untuk membongkar kasus Munir ketika itu ternyata hanyalah angin. masih terngiang-ngiang di telinga waktu kampanye dulu SBY-JK dengan lantang dan merdu menyuarakan bahwa kebijakan yang akan diambil dalam mengantisipasi kenaikkan minyak dunia tidak akan membebani rakyat kecil. rakyat terpaksa berteriak ketika Pertamina menaikkan harga petramax dan elpiji. ‘Citra Indonesia di Luar Negeri. masyarakat kita hanya bisa menerima kenyataan itu dengan lapang hati. Mengapa? Karena kita adalah bangsa yang selalu atau terpaksa menjadi mafhum.000 per liter. Suatu Analisis Diplomasi Publik dalam 100 Hari Pemerintahan SBY-JK’. beberapa waktu setelah pelantikan SBY-JK menjadi presiden dan wakil presiden RI. meski tahu bahwa itu hanyalah angin. Toh. Padahal. Suciwati. Ketika SBY berkunjung ke luar negeri saat kematian Yasser Arafat dan pertemuan APEC di Chile. Pasalnya. istri almarhum Munir juga sempat terkena angin ketika berkunjung ke istana. Kenaikkan ini diikuti dengan pencabutan subsidi bahan bakar minyak (BBM) yang mengakibatkan harga minyak tanah yang Rp 700 per liter menjadi Rp 2. Ternyata yang tertangkap hanyalah koruptor kelas teri sekelas Puteh dan Gubernur Sumbar yang saya sendiri bahkan lupa namanya karena tidak begitu dikenal. dalam masa kampanye dulu SBY pernah mengatakan bahwa tiga bulan pertama masa Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Indikator lain. Dalam bidang Hak Asasi Manusia (HAM).menjadi begitu tinggi karena mereka berharap shock terapy itu akan berwujud penangkapan koruptor kelas kakap. Jurusan Politik Pemerintahan buru-buru menggelar diskusi bertajuk. Ini juga ternyata hanyalah angin.

kita akan dengan segera mencari pembenaran agar kita bisa Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . kita menunggu terjadinya angin “keajaiban” sehingga kita bisa keluar dari genggaman rezim otoriter. Kita suka mendengar janji-janji. Sebuah rezim. kita akan dengan setia menunggu meski kita tahu apa yang kita tunggu itu adalah angin. jauh di dalam hati. Dan ketika janji itu memang tidak terbukti. sebuah orde. Alhasil? Ya. sebuah pemerintahan sebenarnya adalah sebuah janji meski janji itu tidak pernah diucapkan atau ditandatangani. Kita pun menunggu kapan perubahan akan terjadi. Setelah dada terasa sesak menunggu. adalah bangsa yang selalu bisa dengan mudah memaklumi dan bisa dengan sabar menunggu janji meski kita tahu apa yang kita tunggu itu adalah angin.pemerintahannya ia akan lebih memfokuskan diri pada masalahmasalah di dalam negeri ketimbang luar negeri. perbaikan rasanya tak kunjung datang jua. Ketika rezim Soeharto berkuasa. harus dilakukan perubahan. Hasil diskusi? Kunjungan SBY ke luar negeri masih bisa dimaklumi karena berhubungan dengan citra Indonesia di luar negeri. Hingga hidung terasa sengak untuk bernapas karena banyaknya angin. Jadi. Kita akan senantiasa menikmati apapun yang dijanjikan tak perduli apakah janji itu bisa terbukti atau tidak. kita menikmati saat-saat penantian itu sebagaimana kita menikmati angin ketika sedang duduk di tepi pantai. Kita adalah bangsa yang menanti. sejak dulu. Maka datanglah angin perubahan. Kita juga menikmati saat-saat menunggu bukti dari janji-janji itu karena di situ bergulir sebuah ketegangan. Lima tahun ke depan setelah perubahan tak kunjung terasa dan dada kita semakin sesak karena banyaknya angin yang masuk mungkin akan berhembus angin baru yang bernama angin pelurusan. Soeharto berhasil dimundurkan dan datanglah angin reformasi. Sadar atau tidak. Kita. karena di dalam janji-janji itu terkandung sebuah harapan. Kita pun menunggu terjadinya perbaikan.

Di bidang ini mungkin mereka sama buruknya dengan kita. Saya melihat. Mereka adalah sebuah konfigurasi dari struktur pembuat janji yang baik dan kita adalah masyarakat yang tersusun atas unsur-unsur pendengar janji yang baik. Rudy S. Saya merasa puas sebagai penikmat angin sejati. Mereka adalah baik dan kita masyarakat sama baiknya dengan mereka. Dari pada berdebat berkepanjangan. Mengapa? Karena sejak awal saya tidak pernah berharap banyak dari apa yang mereka janjikan. Pontoh rudypontoh@gmail. masalah angin bukanlah indikator baik-buruknya sebuah pemerintahan.com CATATAN: Tulisan ini saya tulis kembali berdasarkan tulisan saya sebelumnya dengan judul yang sama yang saya buat atas permintaan Jurnal Madani pada awal pemerintahan SBY-JK Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . bukankah akan lebih baik kita menikmati angin? Salam.tetap menikmati angin-angin yang baru. Lalu masih perlukah kita memperdebatkan soal angin sementara kita sendiri menikmati apa yang akan kita perdebatkan? Saya adalah pendukung SBY-JK bahkan ketika saya yakin janji-janji mereka hanyalah angin. Mereka buruk dalam menepati janji dan kita buruk dalam menuntut janji. Jadi tak usahlah kita terlalu berharap mereka akan menepati janji mereka persis sama seperti apa yang mereka katakan saat kampanye dulu.

v Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .

... 68 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? v ........ 12 Perlindungan dan Pemberdayaan Perempuan ...... 23 Penegakkan Hukum ...................................................................................... 62 Kesejahteraan Rakyat ............... Seputar Kepemimpinan ..............DAFTAR ISI KOMENTAR DAN TESTIMONI ...................................................................... 19 ......................................................................................................... KATA PENGANTAR EDISI 2 .................................................................... 3 7 Perbaikan Pendidikan .............................................. DAFTAR ISI ... 31 ................................................................ 58 Budaya dan Seni ......... 65 Hubungan dan Kerjasama Internasional .............................................................................. Pemulihan dan Peningkatan Ekonomi .. 52 Pelayanan Kesehatan ... 49 Keamanan dan Pertahanan .......................................................................................................................... xvii xv PENDAHULUAN: Antara Janji SBY-JK dan Angin ................ Keperdulian Terhadap Rakyat ....................................................... xvii x BAGIAN SATU : Pelantikan Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pemberantasan KKN ................................... 39 Kebijakan dan Pembangunan Daerah .................................. 43 Masalah Ketenagakerjaan ................... xxi ..................................................................................... i KATA PENGANTAR EDISI 1 .................

.............................................. 102 ........................................................................................................... 110 .... 117 Menegakkan Hukum dan Ketertiban ........... 117 Mencegah dan Menanggulangi Separatisme ........................................................ 79 Bisnis dan Usaha ... 121 Meningkatkan Peran Perempuan ......................................................... Laut.Nelayan dan Petani ............................................................................................................. Menciptakan Tata Pemerintahan yang Bersih ............... 121 Menjamin Penghormatan dan Pengakuan Atas HAM ......................................................................... BAGIAN DUA : Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK Meningkatkan Saling Percaya ...... 89 Ajakan dan Kebersamaan ...... 74 Kebebasan Pers ...... 120 Mengembangkan Kebudayaan ........................................................................................ 86 Hutan................................ 117 Mencegah Terorisme ........................................................... 120 Meningkatkan Kualitas Proses Desentralisasi dan Otonomi .................................................... 97 Agenda Kerja ....................................................................................................................................... 92 Seputar Kabinet ..... 118 Memantapkan Politik Luar Negeri .................... 119 Menghapus Diskriminasi ................... 118 Membenahi Sistem dan Politik Hukum .. dan Lingkungan .... 118 Meningkatkan Kemampuan Pertahanan ...................................... 76 Pornografi dan Narkoba ... 119 ..................................... 71 Otonomi Daerah ................................... 121 v Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? ............................. 82 Indonesia Masa Depan ................ Nonkategori ...................................................................................................................................................

Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Bagian Satu Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

Pemberantasan KKN
Kontrak Politik
aya akan mengadakan kontrak politik dengan rakyat dalam menanggulangi pemberantasan korupsi. Satu rupiah pun uang negara harus dipertanggungjawabkan dan diaudit. Pemeriksaan harus trasnparan. Rakyat harus mengetahui apa yang sudah dilakukan, apa yang belum dilakukan, dan apa yang akan dilakukan ke depan. (SBY, dalam acara dialog “Visi dan Strategi Kebudayaan Calon Presiden 2004” di Graha Bhakti Budaya, Taman Ismail Marzuki, Jakarta, Senin 14 Juni 2004).

S

Mengkaji Ulang
Saya akan mengkaji ulang semua kasus KKN. Langkah konkrit pertama saya dalam memberantas korupsi adalah mengkaji ulang semua proses hukumnya. Untuk itu, saya akan memanggil Jaksa Agung guna membicarakan apa yang telah dan yang sedang ia kerjakan. Langkah selanjutnya, saya akan melakukan pengawasan yang ketat melalui lembaga-lembaga yang ada seperti BPK, Irjen serta dengan keterlibatan masyarakat. Berikutnya, melibatkan KPK untuk melakukan pengawasan. Semua pejabat negara harus diaudit sehingga ketahuan berapa penambahan nilai kekayaannya, apakah penambahan nilainya masuk akal atau tidak. Jika tidak masuk akal, harus diadakan penyelidikan lanjutan. Faktor berikutnya
Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

yang menjadi sangat penting dalam pemberantasan KKN adalah faktor pemimpin. Jika pemimpin melakukan pengawasan terusmenerus terhadap KKN, dampaknya akan sangat baik bagi upaya pemberantasan korupsi. (SBY, pidato politik pada penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Kamis 1 Juli 2004).

Resep Ajaib
Tidak ada resep ajaib dalam memberantas korupsi. Namun perjuangan ini harus dilakukan sekuat tenaga. Kita harus memberikan contoh teladan dari pimpinan tertinggi sampai terendah. Ini merupakan tantangan yang harus saya hadapi. (SBY, di Hotel Permata, Pacitan, Selasa 8 Juni 2004).

Pilar Utama
Kita harus selalu mengawasi usaha pemberantasan korupsi dengan memperkuat wewenang lembaga-lembaga antikorupsi dan peraturan-peraturannya. Saya akan berikhtiar untuk meyakinkan bahwa rule of law akan mengalahkan rule of powerful interests. Keadilan dan menghormati hak asasi manusia, bagi saya merupakan pilar utama demokrasi. (SBY, dalam acara seminar Institut Kajian Pertahanan dan Strategi Singapura, Singapura, Rabu 26 Mei 2004).

Membatasi Kekuasaan

Saya sangat komit untuk memberantas korupsi dan menegakkan hukum. Menerapkan power concept untuk membatasi munculnya penyalahgunaan kekuasaan di daerah. Jika kekuasaan tidak dibatasi, korupsi akan muncul. Jadi harus dibatasi oleh
Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

undang-undang supaya tidak muncul penyimpangan, terutama sejak diberlakukannya otonomi daerah. (SBY, dalam pertemuan dengan Pengurus Besar Persatuan Guru Republik Indonesia di Bumi Perkemahan Tawangmangu, Solo, Sabtu, 14 Agustus 2004).

Kekayaan Diumumkan
Meski dalam undang-undang laporan kekayaan pejabat negara tidak harus diumumkan, saya setuju jika hal itu diumumkan. Ini akan berguna untuk mengatasi korupsi. Kalau bisa, di masa mendatang ada klarifikasi kekayaan pejabat setiap tahun sekali. (SBY, saat mengunjungi kantor Komisi Pemberantasan Tindak Pidana Korupsi, Jakarta, Selasa 31 Agustus 2004).

Memberikan Keteladanan
Pemberantasan korupsi menjadi keharusan. Kita jalankan dengan memberikan keteladanan yang bersifat top down, harus dimulai dari pemimpin tertinggi di negara ini. Terus, keteladanan dan engagement ini mengalir ke pimpinan yang lebih rendah sampai tingkat kepemimpinan terendah dalam masyarakat kita. Upaya ini harus dibarengi dengan upaya-upaya hukum yang tegas dan adil. Dan, secara bertahap mengembangkan sistem hukuman dan ganjaran atas korupsi i. (SBY, pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Selasa 1 Juni 2004). Memimpin Langsung Saya akan memimpin langsung pemberantasan korupsi di negeri ini.Ini adalah masalah serius.Untuk mengetahui pemberantasan yang dilakukan sudah sejauh mana, kami akan mengadakan rapat

Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

secara terus menerus. Pengauditan kekayaan pejabat harus dilakukan setiap tahun. Semua lembaga yang dibangun untuk pemberantasan KKN seperti BPK, KPK akan saya dayagunakan dengan terpadu agar langkah yang diambil efektif. Pengawasan lebih ketat akan saya lakukan terhadap pos-pos rawan korupsi seperti bea cukai dan bagian pengadaan lainnya. Jika presiden memberikan perhatian yang sungguh-sungguh terhadap pemberantasan korupsi, saya yakin lima tahun ke depan praktek korupsi dan berbagai penyimpangan dapat berkurang. (SBY, dalam acara “Dialog Penajaman Visi, Misi, dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton, Jakarta, Selasa 14 September 2004). Tekad Tak Cukup Tekad saja tak cukup dalam melakukan pemberantasan korupsi. Diperlukan contoh dari atas, contoh dari pemimpinnya. (JK, dalam acara “Dialog Penajaman Visi, Misi, dan Program CapresCawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton, Jakarta, Selasa 14 September 2004). 

Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?

Jumat 18 Juni 2004). keamanan semakin pulih. Harapan rakyat yang telah disampaikan kepada calon presiden lain (calon presiden yang tidak terpilih. demokratis. dalam silaturahmi dengan sejumlah ulama dan cendekiawan muslim di Asrama Haji Masyhur. tanpa ada rekayasa. Bertemu Langsung Saya akan mendengar langsung dari rakyat permasalahan mereka. Medan. damai. K Harapan Rakyat Banyak hal penting yang mesti kita pikirkan bersama: agar demokrasi semakin mekar.) akan merupakan amanah bagi saya. Bogor.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Keperdulian Terhadap Rakyat Kalangan Bawah ami akan memprioritaskan upaya penanggulangan masalah perekonomian bagi masyarakat kalangan bawah. dan sejahtera. adil. Saya ingin tahu apa yang mereka harapkan. (SBY. dalam acara open house di kediamannya. Puri Cikeas. keadilan semakin tegak. Senin 27 September 2004). (SBY. Gunung Putri. Saya akan bertemu langsung dan mendengarkan apa adanya. Mereka selama ini belum mendapat hak-haknya secara proporsional. Ed. Pemerintah harus terus menerus membantu kaum dhuafa dan masyarakat miskin dalam upaya mewujudkan Indonesia yang aman. dan kesejahteraan meningkat. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

saat bertemu dan berdialog dengan sejumlah petani dan pedagang jamu serta buruh jamu di Bawen. Bandarlampung. (JK. Kebutuhan Pokok Untuk kepentingan konsumen. Jika mereka sudah tahu persoalannya. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . dibutuhkan kondisi aman dan perlakuan adil bagi masyarakat. Itu menjadi program kami dalam mesejahterakan rakyat. usai mengadakan rapat dengan tim suksesnya di Hotel Shangrila. saat bertemu dan berdialog dengan sejumlah petani dan pedagang jamu serta buruh jamu di Bawen.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan (SBY. Surabaya. mereka bisa memperbaikinya bersama-sama rakyat. Senin 28 Juni 2004). Ungaran. Saya akan meminta para pejabat sebagai pemimpin di daerahnya untuk sering-sering turun langsung bertemu rakyat. saat bertemu dengan para nelayan di tempat pelelangan ikan Lempasing. Turun Langsung Saya siap berkeja keras bersama-sama rakyat untuk memperbaiki taraf kehidupan rakyat. (SBY. kaum buruh dan rakyat miskin. Ungaran. Senang Mendengar Saya senang mendengar langsung suara rakyat. Setiap orang diperlakukan sama. Selasa 29 Juni 2004). Lampung. Sabtu 5 Juni 2004). Pemimpin harus senang mendengar suara rakyat. (SBY. Selasa 29 Juni 2004). Pemimpin harus tahu masalah rakyat. Dengan begitu mereka bisa melihat secara langsung berbagai persoalan yang dihadapi rakyat. Agar hal tersebut bisa terlaksanan. saya akan memperhatikan kebutuhan pokok dan menjamin harga murah dan stabil.

Selasa 1 Juni 2004). Puri Cikeas.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Pelayanan Publik Kita akan membangun sistem politik penyadaran atas hak dan kewajiban ekonomi dan politik rakyat. Jakarta. Selasa. Kita ingin rakyat menyadari dan mengontrol bahwa yang dimaksud pelayan publik berarti pelayanan untuk seluruh rakyat. menjawab pertanyaan masyarakat di kediamannya. kami akan melakukan operasi pasar. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Hari Besar Adalah lazim jika harga kebutuhan pokok naik saat menghadapi hari-hari besar keagamaan seperti Lebaran dan Natal. Tidak ada satu orang pun yang berada di atas hukum. Gunung Putri. gubernur. Yang penting adalah menjaga distribusi agar tidak terjadi kelangkaan. Bukan hanya untuk sebagian kecil masyarakat. Saya akan meminta agenda mereka. Yakni. (SBY. mengutamakan kebutuhan rakyat. Bogor. Namun jika kenaikan itu menyulitkan rakyat kecil. Kalau untuk pembangunan gedung dan fasilitas sekolah. 28 September 2004). bukan mengutamakan kebutuhan konsumtif pribadi. melalui kepala daerah. Untuk daerah miskin dan tidak mendapat perhatian dari kepala daerah. Upaya perbaikan ekonomi harus Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . pembangunannya harus disesuaikan dengan aturan yang ada. (SBY. Rakyat berhak memperoleh lebih dari yang didapatkan sekarang. Sesuai Aturan Pajabat daerah. Pembangunan yang dilakukan harus diprioritaskan untuk kebutuhan rakyat banyak. bupati harus bekerja sesuai aturan. rakyat bisa melakukan usulan langsung kepada presiden.

(SBY. Harus Diantisipasi Saya akan mengambil kebijakan yang tidak membebani rakyat kecil dalam mengatasi kenaikan harga BBM. Selasa 15 Juni 2004). Selasa 15 September 2004). percayalah kebijakan yang akan saya ambil tidak akan memberatkan rakyat kecil. Karena kita tidak bisa lagi menanggung subsidi yang sangat besar. Kalau kenaikan terus berlanjut. dalam acara “Dialog Penajaman Visi. (SBY. dan menganggu APBN tentu harus ada penyesuaian kebijakan. kita akan menetapkan subsidi terarah kepada kelompok yang menjadi target. kita akan memberikan subsidi hanya untuk solar dan minyak tanah. dan Program Capres-Cawapres yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. Jakarta. Wujud dari keadilan sosial itu harus tampak pada upaya peningkatan hak dasar rakyat. Namun. dalam kampanyenya di Jambi. Misi. Selasa 15 September 2004). Tetap Stabil Saya akan memperjuangkan berbagai kebutuhan pokok masyarakat (sembako) agar tetap stabil dan terjangkau. Kenaikan harga minyak dunia yang terjadi saat ini harus diantisipasi oleh pemerintah dengan melakukan penyesuaian terhadap subsidi maupun harga bahan bakar minyak di dalam negeri. dalam acara “Dialog Penajaman Visi. Jakarta. dan Program Capres-Cawapres yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. Misi. (JK. Dalam hal ini. karena itulah yang paling banyak digunakan oleh rakyat kecil. 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan menyentuh pada keadilan sosial.

Saya akan terus mendorong jajaran kepala daerah: gubernur. Gunung Putri. Puri Cikeas. walikota. Tapi saya akan terjun langsung ke lapangan. dan kepala dinas untuk bersamasama bekerja keras. (SBY. Bogor. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Rabu 22 September 2004).Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Terjun Langsung Permasalahan di daerah tidak hanya akan saya pantau melalui laporan. bupati. Saya akan terjun langsung untuk mengatahui permasalahan-permasalahan yang dialami masyarakat. saat berdialog dengan sejumlah guru SMAN I Cileunsi di kediamannya.

pembangunan gedung-gedung baru. dan Program CapresCawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. Biaya pendidikan sangat dibutuhkan untuk meningkatkan mutu pendidikan itu sendiri. Artinya. (JK. Misalnya. saya tidak menjanjikan pendidikan gratis. Tapi. Dana untuk itu akan kami lakukan dengan melakukan pembatasan dan penundaan di sektor-sektor tertentu. sementara yang tidak mampu akan mendapat keringanan. Juga melakukan pengaturan pajak yang lebih baik serta pemberantasan korupsi yang sangat keras. (SBY. D Menaikkan Anggaran Dalam lima tahun pemerintahan. Lampung. alokasi dari belanja barang. dalam acara “Dialog Penajaman Visi. Senin 28 Juni 2004). Misi.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Perbaikan Pendidikan Pendidikan Berkeadilan alam bidang pendidikan. Kamis 16 September 2004). Itu artinya bekeadilan. pendidikan sangat penting artinya untuk kemajuan bangsa dan negara. Sebab. biaya perjalanan dinas.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . saya akan mengusahakan pendidikan yang berkeadillan bagi rakyat. saya akan menaikkan anggaran pendidikan menjadi 20 persen dari APBN. saat kampanye di GOR Saburai. Bandarlampung. pemberian mobil mewah untuk pejabat negara. Jakarta. masyarakat dari golongan mampu tetap membayar biaya pendidikan sebagaimana aturan yang ada.

Kamis 16 September 2004). Bisa Gratis Mereka yang tidak mampu akan diupayakan mendapatkan pendidikan gratis. Ini agar mereka yang miskin bisa gratis mendapatkan pendidikan. Pertama. Jakarta.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Memperbaiki Sistem Kami akan memperbaiki pendidikan di Indonesia dengan dua cara. Pada saat pendidikan di negara-negara tetangga maju dengan pesat. kami akan memperbaiki sistemnya. Jangan seperti sekarang ini. (JK. Relatif Tertinggal Pembangunan pendidikan di Indonesia relatif tertinggal dari negara-negara lain. mereka yang mampu harus tetap membayar. (JK. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . di hadapan sejumlah santri Pondok Pesantren Modern As Salam Sukoharjo. pembangunan pendidikan di Indonesia berjalan di tempat. orang begitu mudah lulus padahal sebetulnya mereka kurang belajar. Di antara 500 perguruan tinggi terkemuka di dunia. Solo. Cara kedua adalah dengan meningkatkan anggaran pendidikan secara bertahap hingga mencapai 20 persen sesuai yang digariskan undang-undang. Saya berusaha keras untuk meningkatkan berbagai upaya dan kebijakan yang nyata dan sungguh-sungguh untuk memeratakan dan meningkatkan kualitas pendidikan di Indonesia. Misi.Tetapi. ternyata tidak terdapat perguruan tinggi dari Indonesia. dan Program CapresCawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. Sabtu 21 Agustus 2004). dalam acara “Dialog Penajaman Visi. terutama yang berhubungan dengan cara masuk dan sistem ujian di masingmasing tingkat pendidikan.

dan menyempurnakan manajemen pendidikan dan partisipasi masyarakat. Output dari pondon pesantren bisa menjadi sumberdaya manusia yang tidak hanya memahami ilmu agama Islam. Keperdulian ini harus direspons positif.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . tapi juga peduli terhadap lingkungan bangsa dan negara. Jika tak ada keperdulian dari pemerintah. Peningkatan mutu pendidikan akan saya dorong dengan melakukan upaya-upaya : pengembangan sarana dan prasarana pendidikan yang baik dan berkualitas. (SBY. dan peningkatan prasarana pendidikan dasar di seluruh pelosok negeri. dan menyediakan sarana dan prasarana pendidikan serta tenaga pendidikan. Selasa 8 Juni 2004). Jakarta. Madura. akan sangat banyak alumni pondok pesantren yang kesulitan mencari pekerjaan. meningkatkan kesejahteraan guru dan tenaga pendidik lainnya agar lebih mampu mengembangkan kompetensinya. lulusannya tentu saja sangat banyak. meningkatkan pendidikan nonformal yang bermutu bagi masyarakat yang putus sekolah. pidato politik pada penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Jumlah pesantren sangat banyak. meningkatkan kompetensi dan profesionalisme guru dan tenaga pendidik lainnya.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Pemerataan pendidikan yang saya maksudkan akan kita lakukan melalui program-program sebagai berikut : memberikan akses yang lebih besar kepada kelompok masyarakat miskin. sesaat setelah berkunjung ke sejumlah pondok pesantren. peningkatan kualitas guru. Bersamaan dengan ini kami memberikan perhatian pada peningkatan kesejahteraan guru. (SBY. Menjadi Konstruktif Pondok pesantren harus dikelola dengan baik agar bisa menjadi konstruktif. Kamis 1 Juli 2004).

Banyak pihak menganggap. Bengkulu. Minggu 30 Mei 2004). Pondok pesantren sudah seharusnya mendapat bantuan termasuk buku dan gedung. Jadi harus diperlakukan sama. status lembaga yang cikal bakalnya sudah ada di Indonesia sejak tahun 1900-an ini sudah dianggap setingkat dengan pendidikan umum (SD. Selasa 29 Juni 2004). (JK. kita akan mampu mewujudkan SDM yang handal di masa depan. pondok pesantren mendidik anak-anak yang kurang mampu selama 24 jam. Oleh karena itu. sama-sama bertujuan mencerdaskan bangsa. Padahal dengan UU no. CATATAN: Mutu lembaga pendidikan agama yang populer dengan sebutan pesantren atau madrasah memang sering digugat. SMA. Bengkulu. kepada wartawan. saya akan mengalokasikan dana dari APBN untuk dunia pendidikan informal sesuai kebutuhan. Sebab. SMP. Dengan begitu. dan PT). salah satu penyebab rendahnya mutu lulusan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Kualitas Sejajar Saya akan memprogamkan kebijakan agar kualitas pendidikan di pondok pesantren sejajar dengan sekolah negeri dan sekolah swasta lainnya. peranannya sama dengan sekolah negeri. (JK. saat berkunjung ke Pondok Pesantren Al Qur’an Hartal Lakun.20 tahun 2003 tentang sistem pendidikan nasional. Sebab.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Pendidikan Informal Saya akan memberikan perhatian yang lebih besar terhadap dunia pendidikan informal seperti sekolah swasta dan pesantren.

Abdurahman  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Pendidikan harus menyentuh mereka yang sangat sangat miskin. Kamis 16 September 2004). Selama ini. CATATAN: Saat ini. Tentu saja tidak serta merta. Gaji Guru Saya berharap agar suatu saat gaji guru bisa mencapai dua juta rupiah per bulan. Gunung Putri. saat berdialog dengan sejumlah guru SMAN I Cileunsi di kediamannya.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan pesantren adalah tidak adanya kesejahteraan guru. Bogor. anggaran dan tanggung jawab untuk meningkatkan mutu pendidikan di pesantren berada di bawah Departemen Agama dengan segala keterbatasan dana dari pemerintah. selebihnya digaji oleh yayasan. Dari 500.5 juta per bulan. Mereka yang miskin perlu mendapat proteksi dan bantuan termasuk dalam bidang pendidikan. Negara ke depan harus bisa membantu membayar sekolah mereka yang tidak mampu. dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. Jakarta. Pada masa pemerintahannya. Puri Cikeas.gaji guru golongan IV A dengan masa kerja 24 tahun hanya Rp 1. Rabu 22 September 2004). dalam acara “Dialog Penajaman Visi. Misi. (SBY. tetapi harus menunggu hingga penerimaan negara lebih baik. hanya sekitar 20 persennya berstatus PNS. Proteksi dan Bantuan Saya akan mengupayakan pendidikan murah. (SBY.000 total jumlah guru pesantren.

Untuk menjadi bangsa yang belajar. Beasiswa dan Subsidi Sejalan dengan peningkatan kemampuan negara. Lomba Baca Untuk menjadi bangsa yang maju. kita harus menjadi bangsa yang membaca. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Isyarat lain. dedikasi. kita akan tingkatkan kualitas kurikulum pendidikan. titik tolak anggaran dana pendidikan akan diarahkan pada kesejahteraan guru sebagai kunci utama pendidikan. Saya berharap. dan mendorong anak didik untuk membaca dengan meningkatkan dan memperkaya perpustakaan sekolah. Di samping itu. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Begitupun keinginan Megawati. Jakarta. Yang juga tidak kalah pentingnya adalah pengembangan ekonomi komunitas dan ekonomi rumah tangga masyarakat miskin. Selasa 1 Juni 2004). tingkatkan rasio guru terhadap murid.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Wahid juga pernah menjanjikan kenaikan 300 persen tunjangan fungsional guru. kita harus menjadi bangsa yang belajar. dan kualifikasi. kita akan tingkatkan beasiswa dan subsidi pendidikan bagi kelompok masyarakat miskin. Namun yang tercapai hanya 150 persen. Ada isyarat bahwa gaji guru untuk masa mendatang akan dikaitkan dengan kompetensi. Masalah kesejahteraan guru saat ini memang sedang dicarikan jalan keluarnya oleh berbagai pihak. (SBY.

 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Misi. Juga mengadakan penyelenggaraan lomba baca maupun lomba mengarang: prosa maupun puisi. Kamis 16 September 2004). dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. Jakarta.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan sekolah menyediakan perpustakaan dan mendorong muridmuridnya membaca. dibutuhkan peranan lembaga masyarakat untuk menyediakan taman bacaan. dalam acara “Dialog Penajaman Visi. (SBY. Selain itu.

khususnya di daerah konflik. Hal kedua. Senayan. Salah satu hal yang mesti disoroti adalah masalah keselamatan kaum perempuan dari tindak kejahatan dan kekerasan. persoalan perempuan dan kemiskinan serta pendidikan. S Kesenjangan Partisipasi Masalah kesenjangan partisipasi politik kaum perempuan sebenarnya bersumber dari struktur sosio-kultural yang ada pada masyarakat kita. Senin 30 Agustus 2004). Dalam konteks sosial yang lebih luas. tingkat pendidikan yang lebih tinggi. Menghadapi kondisi demikian. masalah pelayanan secara layak dan manusiawi untuk kaum perempuan. (SBY. diperlukan tindakan pemihakan yang jelas dan kongkrit guna menyeimbangkan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . dalam pertemuan dengan aktivis Gerakan Pemberdayaan Suara Perempuan di Hotel Atlet Century Park. Saya melihat dewasa ini ada tiga hal fundamental yang terkait dengan permasalahan perempuan. Misalnya. dan keterlibatan dalam kegiatan publik yang lebih luas. kesenjangan ini mencerminkan masih terbatasnya akses sebagian besar perempuan terhadap pelayanan kesehatan yang lebih baik. khususnya lagi mencegah agar perempuan tidak jadi obyek kekerasan. Jakarta.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Perlindungan dan Pemberdayaan Perempuan Obyek Kekerasan aya akan berusaha mengurangi penderitaan rakyat.

(SBY. maka struktur sosial politik yang lebih egaliter akan tercipta dan kaum perempuan bisa tampil dalam pentas kehidupan politik secara setara. Dalam jangka pendek. jangan sampai anak mereka tidak bersekolah dan tidak memperoleh pelayanan kesehatan yang baik. Negara harus memberikan proteksi dan pelayanan sebaik mungkin kepada mereka. Hal ini merupakan prioritas dalam aspek 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan kesenjangan tersebut. Proteksi dan Layanan Saya akan memberi perhatian khusus terhadap masalah perempuan. saat diwawancarai TV7. Hal lain. jangan sampai mereka dijadikan komoditas perdagangan perempuan. ada hal penting yang menjadi perhatian saya. Dalam hal ini. (SBY. Juli 2004). pidato politik pada penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Kamis 1 Juli 2004). Namun dalam jangka panjang. penyelundupan kaum perempuan. dan sebagainya. memberikan proteksi dan layanan yang baik bagi mereka dalam situasi pasca krisis. Penyelundupan Perempuan Saya akan memberikan keperdulian yang sangat tinggi terhadap pemberantasan kejahatan transnasional. penyelundupan. Yakni. Jakarta. beberapa bentuk affirmative actions barangkali diperlukan untuk memajukan tingkat keterlibatan perempuan dalam proses politik. lebih penting lagi untuk meningkatkan taraf pendidikan dan layanan kesehatan serta program-program lain untuk mempertinggi kualitas hidup dan sumberdaya kaum perempuan. Hanya apabila yang terakhir ini dapat diwujudkan. Di daerah pengungsian. utamanya bagi mereka yang berada di daerah konflik. sehingga mereka tidak mengalami kesulitan hidup yang sangat berat.

baik dalam undang-undang maupun kebijakan-kebijakan politik. dalam acara “Perempuan dan Pemilu” di Metro TV. semua berkesempatan yang sama. Untuk itu. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Sabtu 26 Juni 2004). prosentase jumlah perempuan di negeri ini besar. Lebih Teliti Saya menilai.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan penegakan hukum. yakni 50 persen. disiplin. Sudah saatnya jumlah itu ditingkatkan menjadi 10 persen lebih. Harus kita pastikan pemberantasannya dilakukan dengan lebih serius dan nyata dengan melibatkan semua pihak. (SBY. Pada akhirnya. juga menyangkut keadilan. dalam acara “Perempuan dan Pemilu” di Metro TV. Sabtu 26 Juni 2004). Tinggal bagaimana mereka memanfaatkan peluang dengan memacu drinya untuk tumbuh dengan baik dan mempunyai daya saing yang sama dengan kaum laki-laki. dan gigih dalam mengemban tugas-tugasnya. Dalam catatan saya. Tak ada lagi diskriminasi. kontrol. (SBY. umumnya kaum perempuan lebih teliti. (SBY. Pemantauan. Kesetaraan Gender Saya memandang kesetaraan gender sebagai amanah demokrasi. ke depan kesetaraan gender harus betul-betul menjadi paradigma politik yang kemudian dituangkan. Sabtu 26 Juni 2004). Ada banyak pos politik di kabinet yang saya nila tepat jika diduduki oleh kaum perempuan. dalam acara “Perempuan dan Pemilu” di Metro TV. sebelumnya presentase perempuan di dalam kabinet kurang dari 10 persen. Apalagi mengingat. tinggal terpulang pada kaum perempuan sendiri. dan perlindungan terhadap kaum perempuan dan anak harus lebih ditingkatkan dan dilaksanakan secara simultan.

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .

Antara lain. ekonomi.6 juta orang pada tahun 2002. pertumbuhan ekonomi yang saat ini 4.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Pemulihan dan Peningkatan Ekonomi Ekonomi Sebagai Prioritas residen Indonesia yang baru akan dihadapkan pada berbagai program.1 persen. masalah penyediaan lapangan kerja. hukum. budaya. lima tahun ke depan angka ini akan menjadi 5. Lalu menjadi 8. CATATAN: Menurut ILO (International Labour Organization) jumlah pengangguran (berdasarkan publikasinya tahun 2003) di Indonesia terus meningkat dari tahun ke tahun. Tapi harus ada prioritas. Sementara itu. Selasa 24 Agustus 2004). Pada tahun 2003 P Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . hingga pemulihan di bidang budaya.3 persen harus ditingkatkan menjadi 6. Angka pengangguran saat ini sudah mencapai angka 10. Dari pemulihan di bidang pertahanan dan keamanan. Tahun 2001 jumlahnya hanya 6. Harapan saya.1 juta orang. Jika saya yang memimpin. sosial.6 persen. Surabaya. di depan peserta acara “Dialog Interaktif Menuju Indonesia Masa Depan” yang diadakan oleh Forum Rektor Indonesia Jawa Timur. masalah ekonomi yang akan menjadi prioritas saya.3 persen. (SBY.

19 juta orang (9. di samping. Dan. kita perlu melakukan revitalisasi sektor ekonomi padat karya. situasi di mana pertumbuhan ekonomi terus membaik.3 juta jiwa.32 persen dari angkatan kerja) dan diperkirakan akan terus berlanjut pada tahun 2005 menjadi 11. Pada sektor-sektor ini. Yakni. tetapi angka pengangguran justru terus meningkat. untuk mengatasi pengangguran.83 orang (10.85 persen dari angkatan kerja). secara khusus. Saat ini banyak negara maju di eropa mengalami situasi yang disebut unemployment recovery. Pertumbuhan ekonomi tidak selalu menjamin penurunan jumlah pengangguran.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan angka ini sudah mencapai 10. usaha kecil dan menengah di perkotaan. dengan melakukan pengawasan guna menyelamatkan hasil laut kita dari usaha-uasaha illegal.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . dan pengelolaan sumberdaya alam secara berkelanjutan. Dan. perikanan dan kelautan. Di antara sektor ekonomi yang penting adalah pertanian dan industri perdesaan. Revitalisasi Ekonomi Sejalan dengan pengembangan kebijakan peningkatan daya saing internasional dari industri manufaktur. Semua ini harus kita lakukan dengan tetap memperhatikan kelestarian fungsi ekosistem. investasi publik akan ditingkatkan. Berdasarkan proyeksi Bappenas pada tahun 2004 angka ini mencapai 10. saya juga ingin memberikan perhatian pada perlunya kita melakukan keseimbangan pembangunan dengan lebih mendayagunakan sumberdaya kelautan yang kita miliki.

Ada yang kemudian kembali lagi secara perlahan.6 persen. Pertumbuhan Berkualitas Kita butuh pertumbuhan yang lebih tinggi dan lebih adil. saat acara silaturahmi dengan sejumlah tokoh masyarakat Sulawesi Selatan di Ballroom Hotel Sahid Jaya Makassar. masyarakat panik. pidato politik pada penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Banyak dana yang dilarikan ke luar negeri. kami berharap modal dari luar negeri . Rehabilitasi dan Restrukturisasi Kami akan melakukan rehabilitasi dan restrukturisasi ekonomi sehubungan dengan terjadinya krisis tahun 1997/1998 lalu.1 persen menjadi 5. (SBY. ada juga yang disimpan di bawah bantal dan lemari besi.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan tentunya. dengan tingkat pertumbuhan sekitar 5. Makassar.2 persen pada tahun 2009.4 persen pada tahun 2003 menjadi 8. Ketika itu. Rabu 2 Juni 2004).lima tahun ke depan pertumbuhan ekonomi rata-rata per tahun diharapkan sebesar 6. dengan tingkat pertumbuhan yang ditetapkan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Dan. investasi dari luar negeri bisa kita tarik kembali. Tingkat kemiskinan dalam periode lima tahun ke depan diharapkan turun dari 17. Pendapatan masyarakat yang ditandai oleh pendapatan per kapita akan meningkat dari 968 dollar AS pada tahun 2003 menjadi 1731 dollar AS pada tahun 2009. Dengan sumber-sumber pertumbuhan yang lebih berkualitas. Dengan rehabilitasi dan restrukturisasi ekonomi. Kamis 1 Juli 2004).5 persen pada tahun 2005 dan sekitar 7. (SBY. kita akan mampu menurunkan tingkat pengangguran dari 10.1 persen pada tahun 2009. Jakarta. Dalam periode ini.6 persen per tahun pada tahun 2009kita bisa menciptakan kesempatan kerja baru. untuk pendidikan dan kesehatan.

pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 20042009.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan tersebut berbagai indikator kualitas hidup manusia Indonesia juga akan meningkat. meliputi jalan. Selasa 1 Juni 2004). Ekonomi yang Kuat Saya akan menciptakan ekonomi bangsa yang kuat dan adil bagi seluruh rakyat Indonesia. (JK. jembatan. ekonomi Indonesia kuat. pembangunan infrastruktur penunjang. pelabuhan. Oleh karena itu. Stimulasi yang saya pandang efektif adalah stimulasi yang bersifat kick start untuk mendorong bergulirnya sektor riil. Yang menikmatinya hanya orang Jakarta saja. Hal itu tak boleh terjadi lagi. Hal ini yang harus menjadi perhatian utama kita lima tahun ke depan. Jakarta. energi. Senin 9 Agustus 2004). Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Namun tak adil. Pengembangan infrastruktur penunjang ini akan memberikan lapangan kerja baru dan sekaligus mendukung percepatan pengembangan sektor riil. listrik. yang pertama. pembangunan infrastruktur pertanian. (SBY. pasar. Dan. dan ekonomi pedesaan lainnya. yang kedua. Dulu. Pertumbuhan ekonomi kita saat ini masih belum memungkinkan untuk menekan kedua persoalan penting ini. saat berdialog dengan Kosgoro-Pengurus Daerah Kabutan Brebes. Brebes. saya akan arahkan kebijakan fiskal kita untuk bisa memberikan stimulus bagi berkembangnya perekonomian kita. Kebijakan Fiskal Kita menghadapi masalah pengangguran dan kemiskinan yang tidak ringan sifatnya. agroindustri. Ekonomi bangsa haruslah kuat namun juga harus bisa memberikan kesejahteraan dan kemakmuran bagi rakyat semua. dan air. Simulasi ini akan dilakukan melalui.

1 persen. saya mencanangkan tiga langkah penting.4 persen menjadi 8. (SBY. pidato politik pada penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Kamis 1 Juli 2004). Jakarta.2 persen. Jakarta. saya akan mengurangi tingkat pengangguran dari 10. serta pengembangan lembaga keuangan mikro serta lembaga keuangan pertanian dan perdesaan. menurunkan angka kemiskinan dari 17.731 dollar AS. saya menargetkan peningkatan pendapatan per kapita hingga dua kali lipat dari 968 dollar AS menjadi 1. Baik untuk meningkatkan daya beli maupun untuk menciptakan lapangan kerja dan menurunkan kemiskinan. Agar tercapai kesejahteraan sosial. Sektor Riil Pembangunan sektor riil sungguh sangat saya beri penekanan. peningkatan intermediasi perbankan. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Jakarta. Senin 2 Agustus 2004). Di samping itu. Berkembangnya sektor riil inilah yang dibutuhkan masyarakat.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan (SBY. pidato politik pada penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009.1 persen tahun ini menjadi 5. Dua Kali Lipat Untuk menanggulangi kemiskinan dan memperbaiki sosial ekonomi rakyat. Kamis 1 Juli 2004). (SBY. Untuk secara efektif mengembangkan sektor riil ini. yaitu : pengembangan investasi. dalam acara dialog ekonomi dengan anggota Kadin bertajuk “Indonesia Menuju Era Baru” di Balai Sidang Senayan. sektor riil inilah yang merupakan jembatan yang mengaitkan antara ekonomi makro dan ekonomi mikro yang selama ini seperti tidak nyambung.

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Penjualan Aset Saya berpendapat. Mengangkat Pertumbuhan Ekonomi Saya optimis untuk mengangkat pertumbuhan ekonomi kita menjadi lebih baik. sehingga. Bangsa Indonesia mempunyai hutang banyak. Penjualan aset. Jika pada tahun 2003 pertumbuhan ekonomi kita berkisar 4. melakukan penjualan aset negara sebagai solusi mengatasi krisis bukanlah langkah yang bijak. Senin 2 Agustus 2004). Makassar. ada kongkalikong sehingga rakyat dan bangsa mengalami kerugian dalam jumlah yang sangat banyak. bukanlah proses yang benar. Keyakinan Investor Stabilitas makro dan moneter merupakan syarat keharusan untuk pembangunan ekonomi Indonesia. (SBY. kondisi makro yang stabil akan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . dalam acara dialog ekonomi dengan anggota Kadin bertajuk “Indonesia Menuju Era Baru” di Balai Sidang Senayan. devisitnya jumlahnya besar sekali. lalu fiskal yang ada sangat berat.6 persen dengan pertumbuhan ratarata 6.1 persen. privatisasi. Stabilitas makro memberikan harapan tumbuh dan berkembangnya ekonomi. BLBI. Menjual aset saat harganya sedang jatuh dan dengan harga murah. Bersama dengan perbaikan iklim usaha. Ada manipulasi.6 persen setiap tahun. saya optimis untuk meningkatkannya hingga 7. Rabu 2 Juni 2004). (SBY. dan sebagainya pada saat itu mestinya dihentikan dulu sambil kita melakukan review. saat acara “Talk Show Calon Presiden RI 2004” di Kampus Universitas Hasanuddin. Jakarta. dapat mendorong perbaikan kinerja sektor riil.

(SBY. Stabilitas makro akan membuat para pelaku usaha dapat merencanakan investasi dan kegiatan usahanya dengan tingkat kepastian yang memadai.6 persen dengan rata-rata tahunan sebesar 6. semakin cepat sektor riil bergulir. Jakarta. Hal ini akan membuat pertumbuhan ekonomi kita meningkat secara bertahap. pada akhir tahun 2009 diharapkan pertumbuhan ekonomi bisa mencapai 7. Kamis 1 Juli 2004). Kamis 1 Juli 2004). terdistribusikan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Semakin cepat pemenuhan hak dasar rakyat serta semakin cepatnya pembangunan infrastruktur. diperlukan stimulus fiskal untuk mempercepat pergerakan ekonomi. Jakarta. Tentu.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan meningkatkan minat dan keyakinan investor untuk menanamkan modalnya.5 persen pada tahun 2005. yaitu sebesar 5. kita akan memulainya dengan tingkat pertumbuhan yang belum terlalu tinggi. Ke depan. Pertumbuhan Berkualitas Untuk mewujudkan masyarakat Indonesia yang lebih sejahtera tentu ekonomi kita harus tumbuh.6 persen selama lima tahun ke depan. Tetapi pertumbuhan yang kita tuju adalah pertumbuhan yang berkualitas. dan. (SBY. pidato politik pada penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. serta untuk pembangunan dan pemeliharaan infrastruktur sosial dan ekonomi. pidato politik pada penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Stimulus fiskal harus memenuhi empat syarat bagi terciptanya prakondisi bagi pergerakan sektor riil yang telah saya sebut di atas. Pergerakan Ekonomi Untuk membangun kembali ekonomi kita pasca krisis. kita butuh kerjasama yang baik antara otoritas moneter dan otoritas fiskal sehingga stabilitas makro dapat dikelola secara baik.

pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Selasa 1 Juni 2004). Meningkatkan kemakmuran bersama.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan secara adil. (SBY. tetapi pertumbuhan hendaklah kita pandang hanya sebagai wahana. 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Tujuannya adalah meningkatkan kesejahteraan rakyat. dan berkelanjutan. Meski ekonomi kita harus tumbuh. Jakarta.

Francesco Maria Greco (Italia). Ia datang bersama beberapa duta besar: Yutaka Iimura ( Jepang). dan keadilan bagi mereka. pemimpin negeri -. Ralph L Boyce (AS). (SBY. Bukan hanya masalah keamanan. Menjadi tugas kita semua -. Lhokseumawe. Sabtu 4 September 2004).dalam menyelesaikan kasus Aceh. di depan masyarakat Aceh dalam acara perayaan Isra Mi’raj Nabi Muhammad SAW di halaman Masjid Bujang Salim Krueng Geukueh. Saya akan berusaha memulihkan kembali perekonomian di Aceh yang sempat terhenti. pemimpin masyarakat.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Kebijakan dan Pembangunan Daerah Masalah Aceh Prioritas Utama aya akan mencari solusi terbaik -.untuk mewujudkan hal itu secara bersama-sama. Aceh Utara. CATATAN: SBY adalah salah satu pejabat yang sangat perduli dengan masalah Aceh.pemimpin agama.dengan cara damai dan bermartabat -. SBY pernah ke Banda Aceh (13 Januari 2003). Kepala Perwakilan Bank Dunia di Indonesia Andrew Steer dan Rini MS Soewandi S Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . pendidikan. tapi juga masalah harkatmartabat. Saat menjabat sebagai Menkopolkam. Penyelesaian masalah Aceh akan menjadi prioritas utama saya.

khususnya di Yogyakarta tak kalah menariknya dibanding tempat lain. Kalah Populer Saya sangat setuju jika di Yogyakarta ada pusat layanan informasi seni dan budaya. rekonsiliasi. Hal ini Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . SBY menyerukan agar mesin perdamaian tak boleh berhenti di Aceh. Amnesti untuk GAM Saya akan memberikan amnesti kepada anggota GAM yang betul-betul secara sukarela kembali ke NKRI. aksi kemanusiaan dan rehabilitasi sosial. Mereka datang untuk melihat kondisi Aceh serta mempelajari dan merancang pemulihan Aceh pasca konflik. dalam pertemuan dengan Dewan Perwakilan Daerah se-Sumatera di Hotel Regent Jakarta. pelaksanaan proses politik yang demokratis.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan (Menteri Perindustrian dan Perdagangan waktu itu) juga ikut dalam rombongan. rekonstruksi ekonomi. Dalam kesempatan tersebut. dan society building. pemeliharaan dan penguatan perdamaian. Sangat disayangkan. Ia juga mengingatkan pentingnya menjalankan lima agenda yang telah ada. Obyek wisata dan seni budaya di Indonesia. banyak obyek wisata serta seni dan budaya di Indonesia kalah populer di mancanegara. Penyelesaian masalah Aceh harus dilakukan secara komprensif dengan segala daya dan upaya yang dimiliki. (SBY. Pemerintah daerah juga bisa ikut berperan. Rabu 15 September 2004). Yakni.

saya sudah mengagendakannya sebagai prioritas untuk diselesaikan. untuk mengembalikan pendidikan agar setara dengan propinsi-propinsi lain di Indonesia. diperlukan kerja ekstra semua pihak. Namun. dalam kampanye dialogis yang dihadiri sejumlah perwakilan Badan Eksekutif Mahasiswa sePropinsi Nanggroe Aceh Darussalam. Jumat 11 Juni 2004). dalam dialog dengan masyarakat adat di Lembaga Musyawarah Dayak Daerah Kalimantan Tengah. Kondisi Pendidikan di Aceh Saya prihatin dengan kondisi pendidikan di Aceh yang menurun akibat konflik. (SBY. Banda Aceh. (SBY. Oleh karena itu. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Banda Aceh.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan dikarenakan kurangnya informasi serta publikasi yang ditujukan untuk masyarakat internasional secara luas. akan menjadi salah satu prioritas saya. di hadapan sejumlah seniman dan budayawan. kita bisa bersaing di dunia internasional. Jika itu dilakukan. Yogyakarta. dalam kampanye dialogis yang dihadiri sejumlah perwakilan Badan Eksekutif Mahasiswa se-Propinsi Nanggroe Aceh Darussalam. wilayah Timur termasuk Kalimantan. Jumat 18 Juni 2004). Wilayah Timur Di bidang pendidikan. Saya akan berusaha agar pendidikan bisa lebih murah. Contohnya di NTT dan Aceh. Jumat 18 Juni 2004). mutu pendidikan dan penyelenggaraan pendidikan di sini bisa lebih baik. (SBY. Senin 21 Juni 2004). (JK. Masalah Pengungsi Banyak masalah pengungsi di sejumlah daerah di Indonesia yang belum terselesaikan hingga kini.

Usaha rakyat berupa kerajinan  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . damai. Guna meniju Indonesia yang lebih aman. ekonomi rakyat harus tumbuh dan berkembang dengan baik. seusai acara dialog dengan tokoh-tokoh masyarakat. Kupang. Agar ekonomi tumbuh baik. Kondisi Pariwisata Bali Saya akan memulihkan kembali kondisi pariwisata Bali. dan pemuda di Hotel Sasando. Prioritas Untuk NTT Kami akan memprioritaskan pembangunan sektor pendidikan dan infrastruktur di Propinsi NTT. rakyat Papua harus mau bekerja keras untuk membangun daerahnya. Senin 6 September 2004). dan sejahtera. Oleh sebab itu.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Agar Papua Makmur Agar rakyat Papua bisa hidup lebih makmur. adil. sehingga tidak lagi selalu berada di urutan belakang dalam sektor pembangunan. dari dalam negeri maupun dari luar negeri. Perekonomian dan kesejahteraan rakyat akan membaik jika pariwisata bisa dibangkitkan dari keadaan terpuruk akibat berbagai tragedi yang berhubungan dengan keamanan dan ketertiban. (SBY. tokoh agama. (JK. dalam kampanye di lapangan Trikora. Dibanding kawasan barat Indonesia. Abepura. Jayapura. harus ada modal yang ditanam di Papua: modal dari daerah lain. ketersediaan anggaran dan SDM pendidikan perlu diupayakan agar memadai. NTT dan KTI kondisi sektor pendidikannya sangat merosot. Oleh karena itu. Tapi investor baru akan ke Papua jika Papua aman. dunia pariwisata harus lebih terkendali dan maju. Jumat 4 Juni 2004). dan bebas dari korupsi. khusus untuk KTI.

membuat Bali berbeda di banding tempat wisata lainnya. keramahan masyarakatnya. baik lokal maupun asing. Wisatawan domestik dan mancanegara harus kembali berkunjung ke Bali. Keadaan ini lebih diperparah lagi dengan isu SARS (Severe Acute Respiratory Syndrome -. Dan itu semua harus kita jaga. Padanggalak. Bali telah menjadi salah satu tujuan wisata dunia.sindrom pernapasan akut parah) pada bulan April 2003. keindahan alamnya. Begitupun halnya dengan narkoba. yang menjadi enggan berkunjung ke Bali. Banyak wisatawan. tidak ada lagi. saat menggelar kampanye terbuka di Lapangan Kapten Japa. Tapi sejak tragedi bom Bali (12 Oktober 2002) perekonomian Bali menjadi terpuruk. Tapi. Kamis 24 Juni 2004). Untuk itu. semua usaha takkan ada artinya Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Membangun Bali Saya akan memperbaiki perekonomian masyarakat Bali. Belum lagi dampak yang diakibatkan oleh berbagai tragedi kekerasan serta pemboman di berbagai tempat di Indonesia.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan dan usaha-usaha rakyat kecil lainnya harus ditumbuhkan kembali. Sudah lebih 20 tahun perekonomian Bali sangat bergantung dari industri pariwisata. CATATAN: Selama ini. sektor pariwisatalah yang menjadi unggulan perputaran ekonomi masyarakat Bali. Tindakan kekerasan dan terorisme tidak akan terjadi lagi. jaminan keamanan akan menjadi poin penting. Keragaman dan keunikan budayanya. Bali. (SBY. Denpasar.

Sabtu 5 Juni 2004). Maluku. Jika Bali berkembang. Saya mengajak semua pihak : pemerintah propinsi. pemuda.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan tanpa didukung oleh semangat kebersamaan dari semua unsur dan komponen masyarakat. (SBY. Jangan sampai saudara-saudara saya di Papua hidup miskin. tokoh masyarakat. Terutama dalam bidang keamanan. Negara memberi  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Abepura. (SBY. dan masyarakat dari berbagai elemen untuk sama-sama menjaga dan memelihara Pulau Bali. Kami berdua bertekad. kesehatan terjamin serta bisa sekolah dengan baik. proses penyelesaian Maluku akan menjadi prioritas di bidang keamanan. Denpasar. ke depannya akan menjadi lebih baik. Papua dan Otonomi Khusus Saya ingin sekali memajukan Papua. Kamis 24 Juni 2004). kami (ia dan Jusuf Kalla) telah melakukan langkah panjang secara bersama-sama. Memelihara Bali berarti memelihara kesejahteraan bangsa Indonesia. (SBY. Padanggalak. niscaya kesejahteraan rakyat Indonesia juga akan ikut membaik. Konflik Maluku Saya akan mengutamakan penyelesaian konflik Maluku. Papua yang Lebih Baik Saya akan meningkatkan perekonomian Papua. kepada wartawan dalam rangkaian acara kampanye di Ambon. saat menggelar kampanye terbuka di Lapangan Kapten Japa. Akan membawa perbaikan pada Papua. Jayapura. Bila anak-anak bisa didik dengan baik dan sehat. Dulu. Negara kita sudah menetapkan Papua sebagai daerah otonomi khusus. Tapi tidak berlanjut atau terganggu oleh keadaan. Jumat 4 Juni 2004). dalam kampanye di lapangan Trikora. Saya akan menghantarkan rakyat Papua pada kehidupan yang lebih baik.

Papua diberikan anggaran yang lebih besar. Dibanding daerah lain. baik pemerintah propinsi. Ketiga. Masa Depan Pengungsi Saya akan memperbaiki masa depan eks-pengungsi Timor Timur di wilayah Timor Barat NTT. dalam pertemuan dengan Dewan Perwakilan Daerah se-Sumatera di Hotel Regent Jakarta. Mereka adalah rakyat Indonesia juga. (SBY. menyerukan menyerugan agar GAM kembali untuk tidak memerangi saudaranya sendiri. Mari kita jalankan dengan benar otonomi khusus itu. harus bersikap jujur dan mau bersama-sama bekerja keras untuk memakmurkan Papua.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan perhatian dengan memberikan ruang yang luas agar Papua bisa mengatur dirinya sendiri. melakukan usaha-usaha untuk meningkatkan kesejahteraan masyarakat. Papua memiliki sumber daya alam yang melimpah. adanya pembagian bagi hasil sumberdaya alam dengan NAD bisa digunakan meningkatkan kesejahteraan masyarakat. (SBY. Jayapura. Mereka juga harus mendapat sentuhan kehidupan yang layak seperti juga rakyat Indonesia lainnya. kabupaten maupun masyarakatnya. Kedua. Abepura. Saya bertekad Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Aceh Bukan Hanya GAM Persoalan Aceh bukan hanya persoalan GAM. Jumat 4 Juni 2004). semua pihak. Saya akan terus menyelesaikan masalah NAD sedamai mungkin. Oleh sebab itu. Langkahlangkah penyelesaian bisa dilakukan dengan: pertama. Saya masih optimis masalah Aceh dapat diselesaikan secara baik dalam kerangka NKRI. meneruskan pendekatan komprehensif. dalam kampanye di lapangan Trikora. Untuk itu. Persoalan Aceh juga menyangkut masalah kesejahteraan masyarakat. Adalah wajib jika rakyat Papua menikmati hasilnya. Rabu 15 September 2004). kota.

(SBY. dalam kampanye terbuka di GOR Oepoi Kupang. Jumat 25 Juni 2004). wilayah yang berbatasan langsung dengan negara Timor Leste.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan untuk melaksanakan ini. Berbagai laporan pandangan mata dari para pemberi bantuan kemanusiaan menggambarkan kondisi hidup mereka yang tidak layak dengan tingkat kesehatan yang mengkhawatirkan.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . CATATAN: Setelah jajak pendapat pada bulan Agustus 1999. banyak eks-pengungsi yang memilih menjadi WNI bermukim di Kabupaten Belu NTT.

posisi ini sering dijabat oleh orang yang terpilih berdasarkan hasil kompromi. disebut-sebut hanya ada dua mantan Jaksa Agung yang bisa dijadikan K Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Sampai saat ini. Tapi. (SBY. ia juga perlu dibekali borgol agar tetap konsisten terhadap penegakan hukum serta tidak melakukan jual-beli perkara serta berbagai aksi korupsi lainnya. saya akan memberikan Keppres (Keputusan Presiden) dan borgol. Setelah masa jabatannya habis lima tahun kemudian. Jangan sampai borgol itu dipakai sendiri sebelum masa jabatannya berakhir. Sebagai pejabat. CATATAN: Posisi Jaksa Agung diyakini oleh banyak kalangan merupakan posisi kunci dan merupakan indikator utama arah politik penegak hukum suatu pemerintahan. Senin 14 Juni 2004). borgol itu harus dikembalikan. ia perlu diberi keputusan presiden. Jakarta. bukan karena kredibilitas dan loyalitasnya terhadap kebenaran. dalam acara dialog “Visi dan Strategi Kebudayaan Calon Presiden 2004” di Graha Bhakti Budaya. Dalam pemerintahan sebelumnya.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Penegakkan Hukum Keppres dan Borgol epada Jaksa Agung. Taman Ismail Marzuki.

agama. namanya. Misi. tetapi berdasarkan perilaku. Antara lain. Itu akan memudahkan tercapainya kesejahteraan dan kedamaian. Kita tidak mengenal diskriminasi dalam pengertian asal-usul. saya memandang penting perbaikan di aspek keadilan. Siapapun yang merusak bangsa ini. menyederhanakan sistem serta memastikan bahwa hukum benar-benar diterapkan dengan adill dan memihak pada kebenaran. dalam acara “Dialog Penajaman Visi. Jumat 11 Juni 2004). menghormati serta memperkuat kearifan dan hukum adat yang bersifat lokal. negara membutuhkan keadaan tertib dengan menjalankan hukum yang baik. dan kroniisme. Tanpa Pandang Bulu Jika ingin maju. Siapapun yang bersalah harus 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Saya memiliki sejumlah rencana program guna meningkatkan penegakan hukum serta ketertiban di masa mendatang. Soeprapto ( Jaksa Agung masa pemerintahan Presiden Soekarno) dan Baharuddin Lopa ( Jaksa Agung masa pemerintahan Presiden Abdurrahman Wahid). dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. agamanya.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan teladan. Manado. siapapun yang membawa lari uang bangsa ini. nepotisme. Kamis 16 September 2004). (SBY. siapapun orangnya. (JK. Berdasarkan Perilaku Setiap orang punya kewajiban mencintai bangsanya. Yakni. ia harus ditindak. Jakarta. Aspek Keadilan Saya akan memperkuat upaya-upaya pemberantasan korupsi. Untuk itu. meningkatkan profesionalisme dan kualitas sistem peradilan. kolusi. saat berkampanye di lapangan Sario.

(SBY-JK. Law enforcement akan diprioritaskan pada pemberantasan korupsi juga memberantas penyelundupan. Sama di Hadapan Hukum Kami akan kembali memeriksa Soeharto. Jadi. akan diperiksa lagi agar mendapatkan keadilan yang seadil-adilnya. Makin Kredibel dan Bersih Kami akan meningkatkan budaya hukum. Sabtu 21 Agustus 2004). kalau kita ingin menegakan hukum. orang yang sakit tidak bisa dibawa ke pengadilan. Saya akan memberikan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Sabtu 21 Agustus 2004). di hadapan sejumlah santri Pondok Pesantren Modern As Salam Sukoharjo. meningkatkan kualitas dan profesionalitas para penegak hukum. kita harus memiliki Jaksa Agung yang jujur dan tegas dalam bertindak. Jika ia sudah sehat. Sebab.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan diperiksa kesalahannya. (JK. Jakarta. hukum harus tetap ditegakkan. Selasa 14 September 2004). pengadilan akan memutuskan salah dan benarnya tanpa pandang bulu. Selanjutnya. Siapapun orangnya. Misi. Semua orang sama di hadapan hukum. pemaparan dalam acara “Dialog Penajaman Visi. Solo. Solo. di hadapan sejumlah santri Pondok Pesantren Modern As Salam Sukoharjo. Tentu saja setelah ia sehat. pendidikan politik dan penciptaan sistem pengadilan yang makin kredibel dan makin bersih. (JK. Ujung Tombak Jaksa Agung adalah ujung tombak dalam penegakan hukum. dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. pemberantasan narkoba dan kejahatan jalanan.

jika ia tak dapat melaksanakan tugasnya dengan baik. (JK. Bengkulu. kepada wartawan. ia akan diberi hukuman.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan kekuasaan penuh kepadanya untuk melaksanakan kewenangannya. Namun konsekwensinya. Minggu 30 Mei 2004).  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .

satu persatu masalah itu. bisa kita atasi bila ada perubahan. Kita harus kompak dan mengutamakan kebersamaan.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Seputar Kepemimpinan Bekerja Keras angsa Indonesia harus bangkit kembali demi masa depan yang terhormat. Jakarta. hukum. Senin 21 Juni 2004). Namun. Ia harus didukung pemerintahan yang bersih. (SBY. Dan yang tak kalah penting. dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. Sleman. berkemampuan dan dekat dengan rakyat. dalam acara “Dialog Penajaman Visi. Tidak ada penyelesaian instan karena masalahnya sangat kompleks dan saling kait-mengkait: isu-isu di bidang politik. Untuk itu diperlukan pemimpin yang jujur. dengan pemim. (SBY. Selasa 14 September 2004).pin yang akan bekerja bersama rakyat. B Lebih Efektif Kita memerlukan perubahan. keamanan. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . dan otonomi daerah. terbuka serta tanggap terhadap berbagai permasalahan. dalam kampanye di lapangan Deggung. pemimpin harus mau bekerja keras. yakni dengan menciptakan pemerintahan dan kepemimpinan yang lebih efektif dengan program konkrit dan prioritas yang jelas. Misi. Yogyakarta.

Memperbaiki Kehidupan Berbekal pengalaman selama berada di Jakarta dan menjadi menteri. dimensi kepribadian dan kepemimpinan. Rabu 2 Juni 2004). saat berkampanye di lapangan Karebosi. (SBY. Oleh sebab itu. Jakarta. bangsa Indonesia haruslah dipimpin oleh orang yang benar. Dari dimensi kepemimpinan. Sebagai bangsa yang besar. Kamis 20 Mei 2004) Hilang Kebesaran Bangsa Indonesia adalah bangsa yang besar. Rasul adalah sosok yang jujur. Rasul memiliki akhlak yang mulia. Jika salah memilih pemimpin. dapat dipercaya. Yakni. Dari dimensi kepribadian. saya ingin memperbaiki kehidupan bangsa dan  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . (JK. cerdas. saya yakin bisa menjadi wakil presiden. Indonesia butuh pemimpin yang meneladani Rasul. Insya Allah pada masa mendatang kita bisa sejajar dengan negara-negara maju di dunia. Saat mengenang Rasul. Dengan menjadi wapres.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Mencontoh Rasul Marilah kita mencontoh Rasul dan mengaplikasikannya dalam kehidupan berbangsa dan bernegara. ada dua dimensi yang mesti kita pelajari dan teladani. Pemimpin yang patut diteladani dan memikirkan rakyatnya. bisa berbuat lebih baik dari yang pernah dilakukan wakil presiden lain. sabar dan senantiasa santun dalam bicara. maka bangsa yang besar ini akan hilang kebesarannya. kita harus menghargai dan menjunjung tinggi hukum sehingga keamanan dan keadilan dapat ditegakkan di bumi Indonesia. dalam acara Maulid Nabi Muhammad SAW di Masjid Arriyah Kwitang.dengan umatnya. dan bijak dalam berkomunikasi. Bahkan. Makassar.

Sebuah awal yang dimulai dengan kerja keras akan membawa hasil yang baik. dan aspiratif. Babak Baru Mengawali babak baru. Anda telah membuat Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Mohon doa restu agar saya bisa memperbaiki kehidupan bangsa dan bisa mengangkat harkat dan martabat orang Bugis. Gunung Putri. maka persoalan seberat apapun bisa dicarikan jalan keluar bersama. H A Abdullah Puang Ralla. serta meningkatkan kehidupan keagamaan. di hadapan pendukung dan simpatisannya di lapangan Simpang Lima. Puri Cikeas. selain peduli dan bersatu dengan rakyat. Minggu 9 Mei 2004) Harus Bersatu Pemimpin harus bersatu dengan rakyat. Senin 27 September 2004). saat berkunjung di ruamah Pimpinan tertinggi tarekat Halwatiah Samman. Pattene. Setelah dilantik. Saya tak ingin masyarakat terkotak-kotak menurut partai atau calon presiden pilihannya. (SBY. Jika pemimpin peduli dan bersatu dengan rakyat. terbuka. (JK. melainkan presiden bagi seluruh bangsa Indonesia. Semarang. Selasa 29 Juni 2004).Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan kesejahteraan rakyat. saya bukan lagi presiden bagi konstituen saya. suka mendengar suara rakyat. saya ingin suasana yang baik. (SBY. Bogor. Pattene Maros. Dengan memilih SBY-JK. Pemimpin yang baik. serta peduli terhadap persoalan yang terjadi di tengah rakyat. Sesuai Aspirasi Saudaraku sebangsa dan se-tanah air. perubahan kini berada di tangan rakyat. dalam acara open house di kediamannya. dia juga harus jujur.

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan perubahan besar. Jakarta. Setiap Insan Saya bertekad bukan saja untuk menjadi Presiden Republik Indonesia. mengemban kewajiban. Pemimpin yang melakukan apa yang dijanjikan. dan waktu yang saya miliki akan saya dedikasikan untuk memajukan dan melindungi setiap insan Indonesia. saat menyampaikan pidato politik pertamanya sebagai presiden Republik Indonesia ke-6 di Istana Merdeka. Pemimpin yang mampu berkata dan bertindak yang benar. Pikiran. berilah kami kesempatan untuk mewujudkan Indonesia yang lebih baik dengan memilih kami. Rabu 20 Oktober 2004). (SBY-JK. Saudaraku. Selasa 1 Juni 2004). (SBY. namun juga menjadi presiden seluruh rakyat Indonesia. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. apa pun risikonya. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . apabila kami dipercaya rakyat. Merasa Terhormat Saya dan Pak Jusuf Kalla merasa terhormat diberi kepercayaan menjadi calon presiden dan wakil presiden yang akan dipilih rakyat secara langsung. Rakyat memerlukan pemimpin yang bersih. yang sejuk. tentu. (SBY. dalam iklan berjudul “Berilah kami kesempatan untuk Memimpin Negeri Ini” yang dimuat di berbagai media cetak terbitan Jakarta dan daerah menjelang pemilihan 20 September 2004). Saya akan terus menjaga kontrak politik yang mulia dengan rakyat. Jakarta. tenaga. yang dapat diandalkan. yang sejalan kata-kata dan perbuatannya. Insya Allah. Kewajiban untuk menjalankan amanah rakyat. kami tidak akan menyia-nyiakan kesempatan untuk melakukan perubahan yang sesuai dengan aspirasi rakyat. Ini.

itulah yang mesti dilakukan. dalam pidato peringatan Nuzul Al Quran tahun 1425 Hijriah di Masjid Istiqlal. Saya hanyalah hamba Allah yang dhaif. Kamis 16 September 2004). yang tidak terlepas dari kekurangan dan kesalahan. Apa yang dikatakan. diperlukan pemimpin yang baik. dan transparan. semoga Dia senantiasa menunjuki saya ke jalan yang lurus. dan saudara Muhammad Jusuf Kalla selaku wakil presiden. akan menjalankan amanah yang diberikan oleh rakyat dengan sebaik-baiknya. dalam acara “Dialog Penajaman Visi.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Menjalankan Amanah Saya selaku presiden RI. Jakarta. Dari Diri Sendiri Semua pemimpin harus memperlihatkan keteladanan di hadapan rakyat. Dengan sumpah itu kami berjanji. teguran. (SBY. Jangan sampai terjadi keretakan antara kata dan tingkah laku (SBY. dan Program CapresCawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. dengan menyebut Asma Allah. telah mengucapkan sumpah di hadapan Majelis Permusyawaratan Rakyat. Misi. Diperlukan pemerintahan yang Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . tapi juga dipraktekkan. jujur. Karena itu. sepanjang saya berada di jalan yang benar. selurus-lurusnya dan seadil-adilnya. Keteladanan harus dimulai dari diri sendiri. Agama menduduki posisi penting untuk tak sekedar dijadikan simbol. Sabtu 30 Oktober 2004). saya pun memohon kritik. Saya pun memohon dukungan segenap rakyat. kalau-kalau saya melakukan kekeliruan dan kealpaan. Efisien dan Terbuka Untuk melakukan perubahan. Jakarta. Sebaliknya. saya selalu bermohon ke hadirat Allah SWT. dan saran yang konstruktif.

siapapun yang menjadi pemimpin. di hadapan sejumlah santri Pondok Pesantren Modern As Salam Sukoharjo. Diperlukan pemimpin yang aspiratif. maka akan gagal pula pemimpinnya. Mereka telah berusaha keras untuk mewujudkan tujuan nasional dengan segala kelebihan dan kekurangannya.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan efisien dan terbuka. Jumat 11 Juni 2004). Bukan Kesalahan Masa Lalu Kita harus menempatkan masa lalu. bertanggung jawab. Pemimpin Gagal Masalah di Indonesia adalah masalah korupsi. Manado.. Jakarta. masa kini. Pemimpin tidak boleh setengah hati menyelesaikan persoalan. (SBY. Jika gagal memerangi korupsi. Solo. Belum tercapainya tujuan nasional Indonesia hingga kini bukanlah diakibatkan kesalahan pemimpin di masa lalu. (SBY. Rabu 18 Agustus 2004). Dan saya tidak mau dianggap gagal. Saya tidak akan berani mencalonkan diri sebagai wakil presiden jika saya tidak berani memberantas KKN. Sabtu 21 Agustus 2004). Pemimpin harus terlibat langsung bersama-sama masyarakat untuk menyelesaikan berbagai persoalan. serta mau bekerja keras. Kita tak boleh begitu saja menyalahkan pendahulu kita. dalam acara renungan proklamasi di Monumen Proklamasi. dekat dengan masyarakat. dan masa depan secara adil. saat berkampanye di lapangan Sario. (JK.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Diperlukan perjuangan yang terus menerus dan berkelanjutan.

Kamis 16 September 2004).saya. 10 Juni 2004). Mereka harus bisa kita persiapkan dengan baik agar berdaya saing. Banten. dalam acara “Dialog Penajaman Visi. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Sepatutnya kita berterimakasih kepada mereka. Saya akan memilih menteri tenaga kerja yang mau bekerja kerasa dan mau melindungi kaum pekerja. Jakarta. (SBY. (SBY. dan berpenghasilan tinggi. Mulai dari kemanusiaan hingga hak-haknya. profesional. Selayaknyalah kita melindungi mereka. dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. U Buruh Migran Saya akan tetap melanjutkan kebijakan yang mengakomodasi buruh migran hingga saatnya nanti lapangan kerja makin terbuka untuk mereka.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Masalah Ketenagakerjaan Standar Upah paya meningkatkan taraf hidup kaum pekerja terutama upaya meningkatkan standar upah di Indonesia akan saya jadikan prioritas utama. saat melakukan dialog dengan kalangan pekerja di kawasan industri Balaraja. pengangguran begitu tinggi. Misi. Tangerang. Di saat lapangan kerja belum terbuka luas. mereka dapat menghidupi keluarganya.

Penempatan dan perlindungan terhadap mereka harus ditata dengan baik. Bukan apa-apa. dan Meksiko. Cina. melainkan juga oleh megara-negara lain yang memiliki pendapatan relatif rendah. dalam acara dialog dengan Musyawarah Nasional V Apjati. kita kembangkan iklim usaha dan investasi yang baik dan kita dorong sektor swasta menjadi pilar dari dinamika perekonomian. Saya berharap negara dan pemerintah. tanpa meninggalkan kepedulian dan bantuan kepada golongan ekonomi lemah. mereka juga adalah pahlawan bangsa.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Menyiapkan Pengacara Masalah tenaga kerja merupakan salah satu hal terpenting untuk segera diselesaikan. 26 Agustus 2004). serta agen-agen pemberangkatan TKI ke luar 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Contohnya. (SBY. Masalah tenaga kerja ilegal bukan hanya dialami oleh kita. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Untuk menanggulangi kemiskinan. Kamis. Sumberdaya Manusia Untuk menciptakan kesempatan kerja baru. sebagai perwujudan dari keadilan ekonomi dan keadilan sosial. (JK. Selasa 1 Juni 2004). misalnya. Dengan menyiapkan pengacara. Mampu Melindungi Saya akan memperhatikan nasib TKI. Bandung. kita terutama akan melakukan investasi yang akan terus meningkat untuk rakyat kita melalui pendidikan. Jakarta. Pengembangan sumberdaya manusia menempati prioritas utama sebagaimana halnya pengembangan infrastruktur yang lebih baik dan kebijakan ekonomi yang berorientasi pasar (market-friendly policies). India. dengan memperhatikan gaji yang diberikan dan memberikan perlindungan terhadap mereka di luar negeri.

(SBY. Kita kembangkan kebijakan yang ramah terhadap usaha kecil. terbukti bahwa selama ini mereka menjadi mesin pemulihan perekonomian Indonesia. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Usaha Mikro Untuk mendorong penciptaan lapangan kerja. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Jakarta. Semua pihak yang terkait harus mampu melindungi TKI yang mendapat perlakuan tidak manusiawi atau ketidakadilan. Selasa 1 Juni 2004). Kita perlu memberikan saluran kredit yang lebih baik kepada mereka dan mendorong pemerintah daerah untuk meningkatkan fasilitas pelatihan bagi para pekerja. lebih lanjut. dan menengah-baik yang masuk dalam sektor formal maupun sektor informal.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan negeri bisa lebih bertanggung jawab. Jakarta. dalam acara Dialog Terbatas Civitas Akademika Universitas Indonesia. kita kembangkan terutama usaha mikro. kecil. Kamis 10 Juni 2004). (SBY. Hak dasar mereka harus bisa dipenuhi. karena.

serta bekerja selama 24 jam. intelejen tak bisa bekerja sendiri. Diperlukan kerjasama dengan kepolisian. Misi. dan Program Capres-Cawapres” yang Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . tugas-tugas saya. (SBY. Jakarta. Misi. Selasa 14 September 2004). Juga diperlukan kerjasama masyarakat sebagai mata dan telinga intelejen. Untuk itu. imigrasi.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Keamanan dan Pertahanan Deteksi Dini aya berkomitmen untuk memerangi terorisme. serta negara sahabat. Tak ada satu pun yang harus didekati dengan keamanan semata. S Pendekatan Keamanan Meski saya berlatarbelakang militer. saya tidak akan mengedepankan pendekatan keamanan yang mengurangi hak sipil dan HAM. dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. saya jalankan dengan undang-undang dan menghormati otoritas sipil. harus ada upaya untuk terus menerus melakukan operasi yang efektif. (SBY. Dalam hal ini. Terorisme adalah ancaman serius dan tidak mudah terdeteksi dengan sistem apapun dan oleh negara manapun. Selama berada di pemerintaha. Saya pelaku reformasi internal TNI. memodernisasi peralatan. dalam acara “Dialog Penajaman Visi. meningkatkan kerjasama. kemampuan deteksi dini harus ditingkatkan. Kapasitas intelejen harus ditingkatkan dengan cara: melakukan operasi yang lebih efektif. Namun. dalam acara “Dialog Penajaman Visi.

di Jakarta. militer bisa lebih demokratis dari sipil. mengokohkan integrasi nasional.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. Dalam tahun-tahun terakhir karier militer. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Latar belakang militer yang saya miliki justru sangat berguna untuk memberi perspektif bagaimana menata kekuatan militer ke depan. Indonesia yang Aman Indonesia yang lebih aman dan damai mengharuskan kita untuk menjaga keutuhan NKRI. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. ia dari militer tapi bisa lebih demokratis dari presiden sipil. Jakarta. saya sempat menyusun cetak biru reformasi militer. sebab bagaimanapun militer adalah bagian penting dari bangsa ini. martabat. Reformasi Militer Jangan memandang rendah militer. kehormatan. perwakilan dagang. Contohnya. dan rasa keadilan saudarasaudara kita di kedua propinsi ini. Presiden Fidel Ramos. Rabu 9 Juni 2004). kita memberikan perhatian penuh pada tiga hal berikut. (SBY. Selasa 1 Juni 2004). Kita lakukan hal ini dengan meningkatkan pelaksanaan otonomi khusus secara konsisten. dan eksekutif perusahaan asing. Selasa 14 September 2004). (SBY. Jakarta. di depan sejumlah duta besar. Gerakan Separatis Dalam jangka pendek. kita harus mengakhiri gerakan separatis bersenjata di Aceh dan Papua. Proses ini dilakukan dengan tetap menjaga hak. Saya yakin. Yang pertama.

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan dan membangun hubungan internasional dengan mengedepankan tegaknya kedaulatan negara. Memang bukan upaya mudah. Kita akan perangi sampai ke akar-akarnya. (SBY. Begitu juga dengan kejahatan transnasional khususnya narkoba dan perdagangan anak. Korban Terorisme Kita adalah korban terorisme. Menghentikan separatisme bersenjata. Melihat korban terorisme di berbagai wilayah Indonesia. Cukup. Menghabiskan waktu-waktu saya untuk menjaga keselamatan seluruh masyarakat kita. Memerangi kejahatan. dan meninggalkan luka yang pedih bagi keluarga korban. kita harus terus meningkatkan upaya pemberantasan tindak pidana terorisme. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Saya telah menghabiskan tahun-tahun saya di pemerintahan memerangi terorisme ini. Memperkuat harmoni dan integrasi sosial serta toleransi kehidupan beragama. tetapi. Cukup yang telah terjadi. Tindakan terorisme yang menghancurkan kehidupan. membuat saya berjanji pada diri sendiri bahwa saya tidak ingin terjadi lagi tindakan terorisme di negeri ini. Juga. Jakarta. Mengakhiri konflik-konflik komunal. (SBY. Selasa 1 Juni 2004). termasuk kejahatan transnasional dan terorisme. Upaya pemberantasan terorisme ini akan kita perkuat dengan pengembangan kerangka dan perangkat hukum yang memadai dan secara terus menerus meningkatkan infrastruktur keamanan kita. pidato politik pada  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . memelihara dan meningkatkan keamanan dalam negeri. menghancurkan nilainilai kemanusiaan. Memantapkan keamanan publik.

Tidak hanya menyelesaiakn tetapi juga akan berusaha keras agar hal ini tidak terulang lagi. kita akan kesulitan untuk bangkit. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. dan daerah-daerah lain di Indonesia. Selasa 1 Juni 2004). Untuk keamanan negara. yang lebih penting kita akan bersama-sama masyarakat di wilayah ini untuk menemukan dan mengatasi penyebab utama konflik. Dan. dan bertanggung jawab. pemimpin bangsa haruslah besikap adil. Sabtu 12 Juni 2004). jujur. Samarinda. Kita harus menciptakan harmoni sosial untuk mencegah kerusakan yang lebih besar di kemudian hari. Penyebab Utama Kita harus mengakhiri konflik-konflik komunal yang terjadi di Maluku. TNI dan Bisnis Saya akan melanjutkan agenda reformasi internal TNI di bidang bisnis. Berusaha Keras Saya akan berusaha menyelesaikan masalah-masalah keamanan seperti yang terjadi di Poso. Papua. transparan. (SBY. dan beberapa daerah lainnya. (JK.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. komando teritorial. Saat berkampanye di halaman parkir GOR Segiri. Hal ini penting untuk stabilitas. Bila itu tidak dijaga. Poso. Jakarta. dan military impunity (kekebalan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Akibatnya. terjadilah kemunduran. Selasa 1 Juni 2004). Kita bangun infrastruktur untuk mengembalikan masyarakat dalam kehidupan yang normal. Jakarta.

Ancaman Nyata Saya tidak akan memberikan ruang kepada teroris untuk beraksi lagi di Indonesia. dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. Ed. pendekatan keamanan dalam pemerintahan saya tetap akan menjaga iklim demokrasi di Indonesia. Misi. Jangan sampai ada alasan keamanan tetapi mengancam demokrasi. dan sebagainya. Bagi saya. Ingat. dan Program CapresCawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. dalam acara “Dialog Penajaman Visi. asalkan tidak tergoda untuk bermain politik. Saya mengutuk aksi-aksi yang tidak bertanggung jawab dan merenggut korban orang-orang yang tidak berdosa.). (SBY. (SBY. Undang-undang Antiterorisme adalah contoh yang sangat jelas untuk mencegah adanya penyalahgunaan kekuasaan. separatisme. Iklim Demokrasi Saya menjamin. Misi. Jakarta. Mari sama-sama kita kawal demokrasi. Harus dicari akar permasalahan sehingga mereka bisa diperangi secara efektif. gangguan nasional. Soal komando teritorial. Selasa 14 September 2004). Jakarta. dalam acara “Dialog Penajaman Visi. Ini Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan hukum militer. Kami tidak akan bersikap represif. mereka harus dihukum seberat-beratnya dan sekeras-kerasnya. Selasa 14 September 2004). tanpa harus represif sepanjang dikembalikan kepada aturan main. Teman-teman di TNI akan senang jika tidak lagi berbisnis sementara anggaran terpenuhi. teroris itu ancaman nyata. Jangan pernah berhenti untuk mencegah dan memberantas mereka. Kita bisa mengatasi terorisme. akan di dorong ke depan sehingga menyentuh mereka yang bersalah. Sementara mengenai military impunity.

Jakarta 9 September 2004). kesehatan. Anggarannya tentunya harus disinkronkan dengan prioritas-prioritas lainnya. intelejen serta semua pihak untuk meningkatkan langkah-langkah pencegahan yang efektif. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . (SBY. anggaran pertahanan dan keamanan dari APBN sangat kecil. di atas pesawat dalam perjalanan Denpasar-Kupang. saat menjenguk korban Bom Kuningan di Rumah Sakit MMC. TNI dan Polri harus diberi anggaran yang cukup untuk menyelesaikan konflik-konflik di dalam negeri. Saya berharap agar kepolisian TNI. Kekuatan pertahanan harus terus menerus dibangun serta dialokasikan anggaran yang cukup untuk jangka menengah dan panjang. Sistem persenjataan yang dimiliki TNI dan Polri bisa dikatakan sudah tertinggal. kita harus tegakkan hukum demi menjaga kemanan di negeri kita. dan sebagainya. Sistem Persenjataan Saya bertekad akan meningkatkan anggaran pertahanan dan keamanan. seperti pendidikan. (SBY. Oleh karena itu. Saat ini.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan semua menyangkut masalah hukum. Jumat 25 Juni 2004).

berolahraga cukup. Hal yang tak kalah pentingnya juga adalah pendidikan perilaku hidup bersih dan sehat kepada masyarakat. tidak mengkonsumsi alkohol dan narkoba. seperti Askes.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Pelayanan Kesehatan Asuransi Sosial aya setuju untuk memberlakukan asuransi sosial kesehatan bagi seluruh rakyat. dalam acara “Dialog dan Silaturahmi Capres RI dan Calih Profesi Kesehatan DPR RI dengan Masyarakat Profesi Kesehatan. Hanya kurang dari 20 persen yang mampu mendapatkannya. Tujuannya.” Jakarta. mengkonsumsi makanan dengan gizi seimbang. dan Jamsostek. Minggu 29 Agustus 2004). Contohnya. (SBY. CATATAN: Data terakhir menunjukkan bahwa saat ini lebih dari 80 persen rakyat Indonesia tidak mampu mendapat jaminan kesehatan dari lembaga atau perusahaan di bidang pemeliharaan kesehatan. Taspen. Golongan masyarakat yang dianggap ‘teranaktirikan’ dalam hal jaminan kesehatan adalah mereka dari golongan masyarakat Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? S  . tidak merokok. selalu mencuci tangan sebelum makan dan minum. Ini perlu terus ditingkatkan agar masyarakat mampu mencegah penyakit. agar masyarakat bisa mendapatkan pelayanan kesehatan gratis di rumah sakit.

obat dan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . meningkatkan subsidi kesehatan untuk mereka.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan kecil dan pedagang. diukur dari rasio per jumlah penduduk. Solusinya. Indonesia memiliki 7.237 puskesmas pada tahun 2000 dan 21. Jakarta. dan meningkatkan pengetahuan mereka untuk pencegahan. (SBY. Daya jangkau masyarakat terhadap obat-obatan juga masih rendah. Kita harus menyediakan pelayanan kesehatan dasar dengan secara bertahap membangun lebih banyak klinik. penurunan angka kematian ibu dan anak. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 20042009. meskipun telah terjadi perbaikan yang berarti. Hak Dasar Layanan kesehatan merupakan bagian dari hak dasar masyarakat yang harus terpenuhi. Lebih Banyak Dana Kita harus mengalokasikan lebih banyak dana untuk membantu mereka yang sangat membutuhkan. sebagai proses pemenuhan hak dasar rakyat. Selasa 1 Juni 2004). saat ini tengah digodok RUU untuk memberlakukan SJSN.267 puskesmas pembantu. Meskipun fasilitas pelayanan dasar seperti puskesmas relatif telah tersedia di hampir seluruh wilayah Indonesia. dan peningkatan kualitas fasilitas kesehatan dasar. Tenaga kesehatan yang tersedia. saya mendorong untuk terus dilakukannya peningkatan pencegahan penyakit menular. pemerataan. peningkatan kualitas dan ketersediaan petugas kesehatan. Untuk itu. peningkatan upaya imunisasi. masih belum mencukupi.namun keterjangkauan pelayanan dan mutu pelayanan yang diberikan masih belum merata.

hanya berkisar di antara angka 2. perbaikan pengawasan obat dan makanan. selama 50 tahun sejak Indonesia merdeka.5 persen. (SBY. dalam acara “Dialog dan Silaturahmi Capres RI dan Calih Profesi Kesehatan DPR RI dengan Masyarakat Profesi Kesehatan. perlu dihitung dulu secara menyeluruh agar tidak muncul ketimpangan. (SBY.” Jakarta. Jakarta. Sebelumnya. Tidak Muncul Ketimpangan Saya akan menaikkan presentase anggaran bidang kesehatan dalam APBN menjadi 10 hingga 15 persen. Di dalamnya sudah termasuk pengurangan angka kemiskinan dan pengangguran serta peningkatan daya beli masyarakat. Kalau hal itu sampai terjadi. Jadi. anggaran pembangunan kesehatan masyarakat dalam APBN tidak pernah lebih dari empat persen. Selain bidang pendidikan. Fasilitas Puskesmas Saya prihatin terhadap rendahnya tingkat kesehatan masyarakat. Minggu 29 Agustus 2004). saya sudah berkunjung ke beberapa daerah 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan perbekalan kesehatan. Tapi saya bisa pastikan . bidang kesehatan merupakan prioritas program kesejahteraan rakyat.5 hingga 3. bisa menimbulkan masalah serius. CATATAN : Menurut data terakhir dari Pengurus Besar IDI. Kamis 1 Juli 2004). pidato politik pada penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. mendorong berkembangnya industri obat di Indonesia. Akan ada kajian mendalam tentang beberapa aspek terkait. presentase pengeluaran pemerintah akan ada kenaikkan untuk bidang kesehatan.

betapa kurangnya fasilitas di berbagai puskesmas. dalam acara “Dialog dan Silaturahmi Capres RI dan Calih Profesi Kesehatan DPR RI dengan Masyarakat Profesi Kesehatan. (SBY. Padahal. (SBY. fasilitas rawat inap dan obat-obatan juga kurang. Minggu 29 Agustus 2004). petugas kesehatan mereka mengendarai motor besar di jalan. Saya mengamati. Bogor. Saya menyaksikan di Inggris. mereka bisa leluasa bergerak di jalan-jalan yang macet sekalipun. Selasa 15 Juni 2004). saya berpikir perlu adanya petugas kesehatan yang mengendarai motor besar berkeliling jalan raya. Puskesmas merupakan tempat berobat masyarakat kebanyakan dengan standar ekonomi kelas bawah.” Jakarta. Jumlah tenaga medisnya tak mencukupi.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan di Jawa Timur. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Mereka bekerja 24 jam di jalan untuk mempercepat pertolongan bagi warga yang menjadi korban kecelakaan atau warga yang sakit untuk segera dibawa ke rumah sakit. Ciawi. Puskesmas harusnya perlu mendapat perhatian yang lebih serius. Dengan motor besar. saat acara pengobatan gratis yang diadakan oleh Gerakan Pro-SBY. Motor Besar Untuk mempercepat pertolongan kesehatan ke rumah sakit.

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Budaya dan Seni Kebebasan Berekspresi aya sangat menghormati kebebasan berekspresi dan ekspresi kebebasan. S Departemen Kebudayaan Saya akan mempertahankan departemen kebudayaan dan pariwisata. Seniman atau bukan. (SBY. Taman Ismail Marzuki. Melalui pendidikan. Jakarta. banyak persoalan di negeri ini yang tidak dapat terselesaikan. berbagai persoalan bisa diselesaikan dengan baik. Aktivitas seni dan budaya akan mampu mendorong meningkatnya SDM. Saya yakin budayawan punya potensi untuk itu. seharusnya orang dididik untuk menghargai dan meletakkan posisi budaya pada tempatnya. Berkat kearifan budaya yang dimiliki masing-masing daerah. dalam acara dialog “Visi dan Strategi Kebudayaan Calon Presiden 2004” di Graha Bhakti Budaya.Tujuannya agar kegiatan budaya dan kesenian berkembang pesat. saya sangat menghormati usulan agar seniman masuk kabinet. Senin 14 Juni 2004). Yogyakarta. (SBY. silahkan masuk kalau memang mampu. Posisi Budaya Karena selama ini kita banyak mengabaikan masalah budaya. Juga akan mempermantap perdamaian dan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Karena itu. Senin 21 Juni 2004). di hadapan sejumlah seniman dan budayawan.

di hadapan sejumlah seniman dan budayawan. seusai menyaksikan pertunjukan debus pada acara kunjungan silahturahmi memperingati Mi’raj Nabi Muhammad SAW di Serang. saya melihat menjadi tidak tepat jika sektor budaya dijadikan satu dengan pariwisata dalam satu departemen. Banten. Jakarta. termasuk masalah etnis dan agama. (SBY. Senin 14 Juni 2004).Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan toleransi di berbagai daerah di Indonesia. Saya bertekad mendorong terciptanya wadah yang terbuka dan demokratis bagi terlaksananya dialog kebudayaan. melainkan direpresi dengan dalih masalahg SARA. Yogyakarta. Kehidupan masyarakat akan lebih sejuk dan damai jika bisa mengapresiasi seni nasyid sepanjang waktu. Peran Budaya Melihat potensi dan peran budaya yang begitu besar sebagai pemersatu bangsa. (JK. Senin 21 Juni 2004). Benturan-benturan mengenai budayabudaya lokal. Saya setuju jika budaya dan pariwisata dipisah. dalam acara dialog “Visi dan Strategi Kebudayaan Calon Presiden 2004” di Graha Bhakti Budaya. Minggu 12 September 2004). (SBY. Yogyakarta. dialog-dialog budaya terhambat akibat tertutupnya ruang demokrasi. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Ini bertujuan agar benturan-benturan yang terjadi tidak sampai melebar menjadi konflik sosial. Kesenian ini mestinya mendapat perhatian lebih banyak dari masyarakat. (SBY. di hadapan sejumlah seniman dan budayawan. Dialog Budaya Di masa lalu. Taman Ismail Marzuki. Seni Nasyid Saya menaruh perhatian pada seni nasyid. Senin 21 Juni 2004). tidak diselesaikan melalui dialog budaya.

kami berkomitmen untuk mendukung kampanye itu. (SBY. Waktu itu. Jaksa Agung serta aparat penegak hukum lainnya. Untuk menuntaskannya.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan CATATAN: Nasyid adalah salah satu jenis seni islami yang telah berkembang sejak lama. bersama Kapolri. saat silaturahmi dengan tokoh masyarakat Sumatera Barat di Padang. pembajakan kaset jadi menurun. Hasilnya memang ada. Mereka harus diberi sanksi seberat-beratnya sesuai kesalahan yang mereka perbuat. bersama 11 seniman nasional. Bentuknya berupa. Tapi belum tuntas.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Minggu 20 Juni 2004). harus terus disosialisasikan pemahaman bahwa pembajakan adalah suatu tindakan melanggar hukum dan karya cipta yang dilindungi oleh undang-undang. syair-syair pujian dan dakwah yang dibawakan dengan lagu yang terkadang diiringi alat musik seperti perkusi. Contoh nasyid yang terkenal adalah selawat Badar yang dibawakan penduduk Madinah saat menyambut kedatangan Nabi Muhammad SAW. Saat saya masih menjabat Menkopolkam. saya memonitori perlawanan terhadap pembajakan kaset. Dalam forum pemerintahan. saya berkampanye di banyak tempat guna memerangi pembajakan kaset. Pembajakan Kaset Saya menaruh perhatian pada upaya memerangi pembajakan kaset. awal tahun 2003.

mencegah kebocoran dan memperkecil adanya korupsi. Kita tahu. Saya akan berusaha mensejahterakan rakyat dengan berupaya keras memperbaiki ekonomi. Ukurannya adalah kesejahteraan rakyat. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. meningkatkan pendapatan negara. Jakarta. Tapi kita juga tahu. Namun kita tahu. lebih banyak lagi yang masih harus diperjuangkan. kita masih harus berjuang lebih keras lagi. Dengan begitu. sekolah. Kita tahu. Ukurannya adalah. B Kesetiakawanan Sosial Dalam program membantu rakyat kecil. yang penting ke depan kesejahteraan rakyat harus makin baik. perlu adanya kesetiawanan sosial dan antidiskriminasi. kita bisa melakukannya. Tidak boleh miskin terus. semua ini belum terwujud. krisis-krisis yang pernah kita alami tidak terulang lagi. ingin berobat tidak punya uang atau ingin sekolah tidak punya uang. dan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Dari dulu banyak teori yang dikemukakan. Ukurannya adalah terjaminnya rasa keadilan masyarakat. Ukurannya adalah rasa aman masyarakat. apapun teorinya. Selasa 1 Juni 2004). (SBY.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Kesejahteraan Rakyat Rakyat Ukurannya erbagai kemajuan telah kita capai. di masa datang. uang negara dapat digunakan untuk membangun jalan. Namun.

dalam acara seminar Institut Kajian Pertahanan dan Strategi Singapura. Keluarga Miskin Pemerintahan saya akan mengalokasikan lebih banyak dana untuk membantu keluarga yang miskin. menyediakan fasilitas kesehatan yang dasar dengan membangun lebih banyak klinik. Kesejahteraan juga tidak mungkin tanpa berkembangnya rasa keadilan. Namun demikian. Kami juga akan membangun dan meningkatkan prasarana-prasarana penting di sektor pedesaan dan pertanian seperti juga halnya prasarana penghubung antara pedesaaan dan perkotaan. Jakarta. Bogor. kesejahteraan rakyat mengharuskan berkembangnya rasa aman. Gunung Putri. Tinggi dan Berkualitas Membangun kesejahteraan rakyat mengharuskan kita untuk membangun ekonomi secara baik. Untuk keluar dari Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Puri Cikeas. Menanam Modal Saya akan memerangi kemiskinan yang menyengsarakan rakyat dengan menanam modal besar-besaran kepada rakyat Indonesia sendiri melalui pendidikan dan pengembangan sumberdaya manusia sebagai prioritas utama. resisten terhadap goncangan dan terdistribusikan secara adil.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan sarana kesehatan. Senin. Kamis 1 Juli 2004). (SBY. 29 September 2004). memperbesar anggaran subsidi kesehatan. Bangun ekonomi yang baik yang saya maksudkan adalah bangun ekonomi yang memiliki pertumbuhan yang tinggi dan berkualitas. dalam acara open house di kediamannya. (SBY. pidato politik pada penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Rabu 26 Mei 2004). (SBY. Singapura.

dan meningkatkan rasio murid dan guru. dalam acara seminar Institut Kajian Pertahanan dan Strategi Singapura.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan lingkaran kemiskinan. pencerdasan masyarakat harus dimulai dengan memberikan pendidikan pada anak-anak. (SBY. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Kita harus meningkatkan subsidi bagi sekolah-sekolah di kalangan masyarakat yang termiskin. Rabu 26 Mei 2004). memperbaiki kurikulum nasional. Singapura.

Bank Dunia bukanlah sebagai mandor dan mereka pun tidak boleh meletakkan diri sebagai mandor.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Saya mendukung upaya perjuangan bangsa Palestina dalam upaya mencapai kemerdekaannya. Makassar. yang juga harus menjadi komitmen seluruh bangsa Indonesia. kita tidak boleh mengabaikan dan merugikan kepentingan dalam negeri. Rabu 2 Juni 2004). Itu merupakan prinsip dasar politik luar negeri RI. Dalam visi dan misi saya tidak ada agenda yang berhubungan dengan pembukaan hubungan diplomatik dengan Israel atau agenda lain yang bertentangan dengan keinginan rakyat Indonesia. Keberadaan IMF. D Prinsip Dasar Saya tidak memiliki rencana untuk membuka hubungan dengan Israel. saat acara ‘Talk Show Calon Presiden RI 2004” di Kampus Universitas Hasanuddin.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Hubungan dan Kerjasama Internasional Bukan Mandor alam kerjasama internasional termasuk kerjasama dengan lembaga keuangan asing. (SBY. saat mendatangi kantor DPP PKS di Jakarta. (SBY. Jangan sampai konstitusi dan undang-undang serta kepentingan nasional tersingkirkan karena harus mengadopsi nilai-nilai dan hukum global yang ada. Kamis 26 Agustus 2004).

dan tak pernah lelah untuk memperjuangkan terwujudnya perdamaian dan keadilan. toleran.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Bebas dan Aktif Banyak agenda besar kebangsaan kita yang akan menemukan bentuk terbaiknya melalui kerjasama internasional. saat berdialog dengan sejumlah mahasiswa dan dosen Universitas Indonesia. Saya sadari bahwa kondisi dunia yang kita hadapi ke depan terasa tetap rentan. Kita tidak bisa menyatakan bahwa dunia akan lebih aman. modern. Jakarta. Prinsip Keseimbangan Masuknya modal asing ke Indonesia harus disikapi secara proporsional. dan punya pandangan keluar yang sangat jauh dengan suara yang jelas. Hubungan yang Konstruktif Kita harus membangun hubungan internasional yang konstruktif. Namun hal itu harus dilakukan berdasarkan prinsip keseimbangan. kondisi ASEAN juga akan mengalami perubahan di masa datang. pemulihan ekonomi dan penanganan terorisme misalnya. (SBY. Akan kita temukan tentunya gejolak di berbagai bagian dunia. Dan. dan kebijakan luar negeri yang tepat. Saya akan tetap menjalankan dan mempromosikan kebijakan luar negeri kita yang bebas dan aktif. Kita akan memposisikan Indonesia sebagai negara yang terbuka. Jakarta. 10 Juni 2004). Kamis. (SBY. tegas. Kita tidak mungkin bisa mengelak dari bentuk kerjasama internasional. (SBY. pidato politik Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . demokratis. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Indonesia akan tetap menjadi negara terkemuka dalam perang melawan terorisme dan akan melakukan kerjasama untuk counter-terrorism dengan negara-negara lain. Selasa 1 Juni 2004).

Jumat 15 Oktober 2004). Proaktif untuk Palestina Saya akan bersikap proaktif terhadap permasalahan yang terjadi di Palestina. Minggu 17 Oktober 2004). Saya juga berharap agar pembentukan suatu negara Palestina yang berdaulat. Jakarta. Bogor. sudah selesai tidak ada lagi komitmen kita dengan IMF. Tidak Ada Lagi Komitmen Sudah ada kebijakan dari MPR. merdeka. di hadapan 17 duta besar yang mengunjunginya. Selasa 1 Juni 2004). saat memberikan keterangan kepada pers di pendopo Puri Cikeas. 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . (SBY.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Jadi tak ada pikiran-pikiran kita untuk terus bernaung kembali ke IMF. dan independen bisa diwujudkan dalam waktu dekat. DPR. dan Pemerintah Republik Indonesia untuk mengakhiri program yang disebut dengan Letter of Intens bersama IMF. (SBY. Gunung Putri.

saya akan memberikan akses yang lebih mudah bagi para nelayan untuk mendapatkan pinjaman modal dari bank. CATATAN: Profesi nelayan dianggap sebagai salah satu profesi penting dalam menunjang perekonomian Bandarlampung karena kontribusinya dalam penyediaan protein hewani. Senin 28 Juni 2004). Oleh karena itu. saya juga akan membantu mereka dengan membuka akses pasar yang lebih baik untuk hasil tangkapannya. saat bertemu dengan para nelayan di tempat Pelelangan Ikan Lempasing. Akibatnya. N Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Mereka diwajibkan menjual hasil tangkapannya kepada pemilik modal tersebut dengan harga yang sangat rendah. lembaga-lembaga yang seharusnya menyediakan pinjaman modal. Sayangnya. Bandarlampung. Dalam hal penjualan. banyak di antara mereka ‘terikat kerja’ dengan pemilik modal besar dari perusahaan swasta atau perorangan. (JK. Lampung. sering mempersulit mereka.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Nelayan dan Petani Pinjaman Modal elayan adalah basis ekonomi rakyat.

Jangan sampai kalah oleh para nelayan yang menggunakan perahu berteknologi tinggi. Ini sudah terbukti.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Kepastian Penghasilan Saya akan meningkatkan taraf hidup para nelayan. Ungaran. Kabupaten Serang. Upaya ini terutama dimaksudkan untuk meningkatkan kesejahteraan dan kualitas hidup petani dan nelayan serta rumah tangga petani dan nelayan. akan menjadi program pemerintah lima tahun mendatang. Sektor Unggul Saya akan memperhatikan sektor pertanian. sektor ekonomi yang bisa bertahan adalah ekonomi rakyat serta sektor informal. Di Indonesia sektor pertanian adalah salah satu sektor ekonomi yang unggul. Selasa 29 Juni 2004). Meningkatkan akses petani dan nelayan terhadap sumberdaya produktif dan permodalan. Saya melihat. Meningkatkan produktivitas dan kualitas petani dan nelayan serta meningkatkan produktivitas  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Kehidupan para nelayan saat ini memang penuh dengan ketidakpastian. (SBY. (SBY. Saya sudah meninjau beberapa tempat nelayan. saat bertemu dan berdialog dengan sejumlah petani dan pedagang jamu serta buruh jamu di Bawen. kesehatan. Desa Banten Kecamatan Kasemen. Kualitas Hidup Saya pastikan bahwa kita akan melakukan revitalisasi pertanian dan perdesaan. koperasi. bantuan permodalan. memang harus ada kepastian penghasilan seharihari. enam tahun lalu. Itu sudah menjadi agenda. apalagi jika harga solar tinggi. di depan masyarakat nelayan Kampung Baru Bugis. Di saat perekonomian Indonesia runtuh dilanda krisis. Juni 2004). termasuk pertanian.

Mengembangkan industrialisasi pedesaan. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. (SBY. Mengembangkan diversifikasi aktivitas ekonomi pedesaan. Jakarta.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan dan kualitas pertanian. Dan. Berkembangnya pedesaan dan pertanian akan menjamin perkembangan perkotaan dan industri yang berkelanjutan. melaksanakan reformasi agraria. Selasa 1 Juni 2004). Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Otonomi Daerah Mengevaluasi Kelemahan ita harus meningkatkan dan mendalami proses desentralisasi dan otonomi daerah yang sedang berlangsung. Kita perlu menyeimbangkan kepentingan nasional dengan kepentingan daerah. dan masyarakat. lebih produktif. melakukan pengelolaan yang makin efektif dalam implementasi. dan antarkelompok masyarakat. lebih disiplin. Jakarta. lokal. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. (SBY-JK. antara pemerintah dan masyarakat. sentralisasi dan otoda dengan semangat untuk menata kembali propinsi dan kota.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Misi. kita dari waktu ke waktu akan mampu meningkatkan rasa saling percaya antara pemerintah pusat dan daerah. Jakarta. pemaparan dalam acara “Dialog Penajaman Visi. Selasa 1 Juni 2004). Kita harus dari waktu ke waktu mengevaluasi kelemahan yang terjadi dengan mengangkat ide-ide inovatif yang berkembang di tingkat lokal. (SBY. dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. kinerja yang baik untuk pelayanan kepada publik. Dengan terus mengembangkan saluran-saluran ide yang berkembang di masyarakat. K Menata Propinsi dan Kota Kami akan mendorong peningkatan reformasi birokrasi menjadi lebih efisien. Selasa 14 September 2004).

Jakarta. Tidak mungkin lagi semuanya diatur di tingkat pusat. (SBY. dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. (JK. dalam acara “Dialog Penajaman Visi. Harus ada mekanisme daerah dan pusat untuk duduk bersama guna memecahkan persoalan tentang otonomi daerah dan pemekaran. Juga kami akan memperjelas aturan dan kewenangan bupati/walikota. dan Program CapresCawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. dalam acara “Dialog Penajaman Visi. kultur soasial maupun politik.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Penataan Ulang Kami akan membenahi efektivitas gubernur yang selama ini banyak dipertanyakan orang. Misi. Pemekaran yang telah dilakukan selama ini hanya sebatas pertimbangan politis tanpa dilandasi prinsip-prinsip yang jelas. jumlah penduduk. pertimbangan potensi daerah. Jakarta. Misi. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Pemecahannya. Selasa 14 September 2004). harus ada penataan ulang kewenangan di tiap tingkat pemerintahan. Misalnya. Selasa 14 September 2004). Harus Ada Mekanisme Kami akan meninjau kembali pemekaran yang telah dilakukan terhadap kabupaten/kota.

itu artinya kita kembali ke masa lalu. (JK. Meninjau jauh ke belakang. sudah merupakan way of life. Jakarta. ia lalu dianggap menjadi tidak bersalah. tidak bisa lagi dicabut. D  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Hotel Nikko. tergantung keadaan dan kadarnya. Pada tahun 1978. Kebebasan pers seperti juga demokrasi. harian Prioritas (29 Juni 1987). Namun begitu. dan Majalah Tempo (21 Juni 1994). pada tahun 1974 tak kurang dari 123 media cetak diberangus hanya gara-gara mengungkap kasus korupsi Ibnu Sutowo dan keluarga Soeharto di Pertamina. CATATAN: Di Indonesia telah beberapa kali terjadi pembreidelan atau pembekuan/pencabutan/ pembatalan SIUPP terhadap media cetak Sebut saja harian Sinar Harapan (dicabut SIUPP-nya 9 Oktober 1986). Kamis 5 Agustus 2004). pemerintah siapapun yang berkuasa tidak boleh lagi melakukan pembreidelan atau penyensoran terhadap pers. tugas pers tidak boleh dianggap selalu benar. Tidak boleh karena alasan tugas. dalam pelaksanaannya. tabloid Monitor (23 Oktober 1990). Soal kesalahan wartawan. Sebab. Harus terus dijaga dan dipertahankan.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Kebebasan Pers Tidak Selalu Benar i masa depan. dalam acara dialog ulang tahun Aliansi Jurnalis Independen.

Salah satu indikatornyanya adalah tidak adanya penerbitan yang dibreidel seperti pada jaman Soeharto. Terus Berlanjut Saya akan mendorong kebebasan pers terus berlanjut. Bisa menjembatani dialog antara pemerintah dengan rakyat. kepada wartawan di sela-sela kampanye di Denpasar. organisasi internasional dalam bidang kebebasan pers pernah menempatkan Indonesia sebagai peringkat terbaik di antara negara-negara ASEAN. kebebasan pers dianggap cukup bagus oleh banyak kalangan. Kebebasan pers harus terus berlanjut karena kebebasan pers adalah bagian dari demokrasi. ada beberapa kasus yang kemudian sedikit mengaburkan anggapan itu. kasus Pemimpin Redaksi Majalah Tempo yang divonis satu tahun penjara karena pencemaran nama baik. kasus gugatan Megawati terhadap harian Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan pemberangusan terjadi lagi terhadap 8 media massa lantaran melaporkan bisnisbisnis yang berhubungan dengan keluarga Soeharto. Saya berharap pers ke depan bisa lebih matang. Hanya saja. Bali. CATATAN: Reporters Sans Frontieres (Pewarta Tanpa Batas). rakyat dengan lesgislatif. Kamis 24 Juni 2004). (SBY. Contohnya. atau pemerintah dengan legislatif. Selama pemerintahan Megawati.

Juga kasus gugatan Akbar Tanjung terhadap harian yang sama terkait dengan kasus penyelewengan dana Bulog. (SBY. mendapatkan peran dalam kebebasannya sesuai dengan konstitusi dan aturan main yang berlaku. Senin 2 Agustus 2004). Surabaya. Senin 7 Juni 2004). Terus Berkembang Saya menjamin tidak akan ada lagi pemberidelan terhadap pers. Peran Sentral Saya berkomitmen untuk mendukung kebebasan pers. Saya akan membuat pers terus berkembang. Pers memiliki peran sentral dalam demokrasi sehingga kebebasan pers yang beretika merupakan unsur terpenting untuk membangun demokrasi yang sehat.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Rakyat Merdeka akibat pemberitaan kenaikan harga bahan bakar minyak. (SBY. di kantor redaksi Harian Sore Surabaya News. saat bersilaturahmi ke Kantor Majalah Tempo. Jakarta.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .

alkohol. Harus ada tindakan tegas demi masa depan dan generasi mendatang. saya akan menggunakan tiga langkah. Misi. Melalui pendidikan 12 sampai 16 tahun anak-anak dididik dan diingatkan terus untuk tidak melakukan hal itu. CATATAN: Masalah pornografi dan pornoaksi sering dituding sebagai akar masalah kemerosotan moral di negeri ini. tokoh agama dan tokoh adat.Tingkat kriminalitas akibat pornografi dan pornoaksi sudah mencapai tahap yang memprihatinkan. Misalnya. menggunakan jalur pendidikan dalam dimensi pencegahan dan pembinaan. dan sebagainya.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Pornografi dan Narkoba Kejahatan dan Kemaksiatan aya akan melakukan langkah konkrit untuk menolong bangsa ini dari kejahatan dan kemaksiatan yang implikasinya merusak moral bangsa. Selanjutnya. Langkah ketiga adalah melakukan penegakan hukum. narkoba. Jakarta. dalam acara “Dialog Penajaman Visi. Kamis 16 September 2004). Pertama. dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. Hal-hal yang dapat merusak moral masyarakat. tidak bisa kita anggap biasa-biasa saja. Maraknya S Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . (SBY. Untuk mengatasinya. peredaran video porno. saya melibatkan gerakan orangtua.

akhlak. penyalahgunaan obat-obatan terlarang (narkoba 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . dalam acara “Dialog Penajaman Visi. Budaya Kekerasan Ada tiga cara pendekatan yang akan saya lakukan terhadap budaya kekerasan. Pembatasan Penayangan Saya akan melakukan pembatasan terhadap penayangan adegan pornografi. dan perilaku anak-anak kita di masa mendatang. Namun. goyang ngebor. tabloid/koran panas. Misi. Kamis 16 September 2004). Banyak pakar yang mengatakan. harus ada regulasi yang baik demi moral. Harus ada pembatasan untuk penayangan hal-hal yang menjurus ke tindak kejahatan yang dapat merusak moral. internet. pornografi dan pornoaksi marak di Indonesia diakibatkan kesalahan menerjemahkan arti reformasi.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan peredaran berbagai benda dan aktivitas yang berhubungan dengan pornografi (VCD/ DVD. 10-20 tahun lagi tanpa kita sadari keboborakan dan kemaksiatan telah berkembang luas. dan sebagainya) bisa dijadikan indikator. sadisme di televisi yang bisa ditonton selama 24 jam. Kalau moral bangsa tidak ditangani dari sekarang. Pembatasan itu bukan dimaksudkan mengontrol pikiran dan tidak menghormati HAM. dan Program CapresCawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton. pornoaksi. goyang buldoser. (SBY. goyang ngocok. Hal itu semakin bersemi dengan tidak adanya larangan tegas dengan belum diberlakukannya Undang-undang Pornografi dan Pornoaksi. Jakarta.

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

dan psikotropika), pornografi dan penyakit sosial lainnya. Yakni, pendekatan pendidikan, pendekatan keagamaan , dan pendekatan hukum. Tiga pendekatan ini ampuh untuk memberantas penyakit sosial. Jika masyarakat tetap tidak memperhatikan aturan, norma, dan nilai-nilai yang berkembang, penegakan hukum menjadi alternatif terakhir. (SBY, dalam acara dialog “Visi dan Strategi Kebudayaan Calon Presiden 2004” di Graha Bhakti Budaya, Taman Ismail Marzuki, Jakarta, Senin 14 Juni 2004).

Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

Bisnis dan Usaha
Seluk-beluk Perdagangan
asalah dalam aktivitas perdagangan antardaerah, antarnegara, dan kebijakan harus diperbaiki. Jangan hanya menguntungkan sekelompok orang tapi merugikan kelompok lain. Ini bukan hanya urusan menteri tapi juga direktur jenderal, gubernur, bupati, dan wali kota. Mereka yang menentukan kebijakan perdagangan harus memahami betul selukbeluk perdagangan. Namun, dalam mengambil suatu kebijakan, harus dapat dijelaskan kepada rakyat. Sebelum kebijakan diambil, suara rakyat dan semua kelompok masyarakat harus didengarkan. Namun, setelah keputusan dan kebijakan diambil, semua harus patuh menjalankan keputusan. (SBY, dalam acara open house di kediamannya, Puri Cikeas, Gunung Putri, Bogor, Senin, 29 September 2004).

M

Kontrak Sosial
Saya akan membuat kontrak sosial baru dengan dunia usaha. Kontrak sosial baru ini merupakan kebijakan untuk mendorong dunia usaha agar bisa menggarap peluang-peluang bisnis melalui berbagai kemudahan yang kami berikan. Dengan peluang itu, saya berharap kehidupan bisnis dapat berkembang lebih baik. Sejalan dengan keuntungan mereka, pelaku bisnis bisa membayar pajak dengan benar, menciptakan lapangan kerja, dan berkontribusi untuk community development. Dengan kerangka seperti ini, saya optimis masyarakat kita bisa didorong menjadi modal sosial yang produktif,
Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

disiplin, efisien, dan mampu mendorong terciptanya iklim usaha kondusif. Itulah kontrak sosial yang saya maksud. Saya percaya jika hal itu bisa kita bangun melalui dialog dengan semua pihak, dalam jangka waktu lima tahun dunia usaha kita akan kembali bangkit. (SBY, dalam acara dialog ekonomi dengan anggota Kadin bertajuk “Indonesia Menuju Era Baru” di Balai Sidang Senayan, Jakarta, Senin 2 Agustus 2004).

Kebangkitan ekonomi
Kebangkitan ekonomi jangan hanya diletakkan padan sentra-sentra ekonomi seperti di Jakarta, Surabaya, dan Makassar saja. Tetapi mari kita distribusikan kebangkitan ini ke seluruh tanah air secara merata. Kami akan mencurahkan segalanya terhadap dunia usaha menuju kebangkitan dunia usaha di waktu yang akan datang. (SBY, dalam acara dialog ekonomi dengan anggota Kadin bertajuk “Indonesia Menuju Era Baru” di Balai Sidang Senayan, Jakarta, Senin 2 Agustus 2004).

Hubungan Baik
Saya akan memperioritaskan pembangunan usaha yang perusahaannya mempunyai hubungan baik dengan karyawannya. Semuanya, baik perusahaan maupun karyawan, harus bekerja dengan baik. Jika usahanya maju, maka semuanya secara bersamasama akan menjadi maju. Kita akan mempelajari apakah aturan perusahaanya sudah tepat, sudah bertanggung jawab, akomodatif , apakah karyawannya berkerja baik. (SBY, saat bertemu dan berdialog dengan sejumlah petani dan pedagang jamu serta buruh jamu di Bawen, Ungaran, Selasa 29 Juni 2004).

Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

Pilar Utama Dinamisme
Pemerintahan saya akan menciptakan lapangan kerja dengan cara menciptakan iklim yang ramah terhadap penanaman modal, memberikan stimulasi kepada sektor nonpemerintah agar menjadi pilar utama dinamisme perekonomian. Juga mendorong pertumbuhan usaha kecil menengah formal dan informal, dengan kebijakan yang lebih ramah terhadap UKM, antara lain dengan penyaluran kredit yang lebih baik. (SBY, dalam acara seminar Institut Kajian Pertahanan dan Strategi Singapura, Singapura, Rabu 26 Mei 2004).

Investasi yang Menjanjikan
Saya menargetkan, lima tahun ke depan Indonesia mampu menyerap dana investasi langsung maupun tidak langsung hingga 30 persen dari PDB dalam negeri pada 2009. Saat ini masuknya investasi baru mencapai 16,7 persen dari PDB. Karena itu, tentu saja, ini tak cukup. Dalam hal ini, jika sektor swasta bisa berperan dengan baik, saya pastikan Indonesia akan bangkit kembali dan mendapatkan investasi yang lebih menjanjikan. Saya akan ciptakan kondisi yang lebih baik sehingga partner dari luar negeri mau datang dan bekerjasama dengan kita. (SBY, dalam acara dialog ekonomi dengan anggota Kadin bertajuk “Indonesia Menuju Era Baru” di Balai Sidang Senayan, Jakarta, Senin 2 Agustus 2004).

Penanaman Modal
Saya menganggap, penanaman modal dalam dan luar negeri perlu ditingkatkan. Berdasarkan pengalaman saya sebagai Menteri Pertambangan dan Energi, saya merasa penting untuk memperbaiki tatanan sistim hukum dan keterbukaan terhadap perdangan serta 

Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan investasi global. (SBY. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Juga agar saluran komunikasi antara bisnis dan serikat buruh bisa lebih lancar. Singapura. Peraturan-peraturan hukum mengenai perburuhan juga harus diperbaiki agar majikan maupun buruh mendapat perlindungan. termasuk reformasi birokrasi. dalam acara seminar Institut Kajian Pertahanan dan Strategi Singapura. Rabu 26 Mei 2004).

ekonomi harus pulih. Setelah Indonesia adil dan demokratis. pemimpin harus menegakkan sendi-sendi demokrasi. Selain itu. (SBY. korupsi diberantas. (SBY-JK. pendidikan dan kesehatan rakyat bisa lebih baik. saat berkampanye di lapangan Sario. Jumat 11 Juni 2004). Manado. pemaparan dalam acara “Dialog Penajaman Visi. Jika pendidikan dan kesehatan masyarakat lebih baik. maka generasi berikutnya akan lebih baik. HAM ditegakkan dan dihormati. keadaan ekonomi dan keadilan sosial harus makin baik. rakyat didengar suaranya. Jakarta. Jika ekonomi telah pulih. dan lebih sejahtera dalam lima tahun ke depan. kita wujudkan sejahtera. Untuk itu. demokrasi dikembangkan. adil. Untuk mewujudkannya. perekonomian harus terus tumbuh. selanjutnya kita harus mewujudkan Indonesia yang adil dan demokratis. K Adil dan Demokratis Jika Indonesia telah aman dan damai. demokratis.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . hukum harus ditegakkan secara tegas. Selasa 14 September 2004). sehingga pengangguran dan kemiskinan bisa dikurangi. pemimpin harus terbuka dan aspiratif. Misi.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Indonesia Masa Depan Lebih Aman ami akan membawa Indonesia menjadi lebih aman. lapangan kerja akan lebih banyak. dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton.

Selesaikan Konflik Indonesia lima tahun yang akan datang akan lebih aman bila konflik di berbagai daerah. NKRI yang berdasar Pancasila dan UUD 1945 semakin kokoh dan berkembang. hak rakyat yang berupa harga diri. Poso. dan lebih sejahtera. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. dan. dan penyelundupan terus dilakukan pemberantasannya. Indonesia ke depan mestilah Indonesia yang siap menghadapi perubahan serta yang yakin akan keharusan pergaulan internasional. (SBY. Perampokan. krisis. dan berbagai goncangan perubahan. dan konsensus dasar berdirinya negara Republik Indonesia. Kejahatan terorisme dapat terus diupayakan untuk dicegah dan ditangkal secara efektif. terutama di Aceh. lebih adil dan demokratis. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Inilah Indonesia yang semestinya. dan kesejahteraan dapat terus kita bangun dan kembangkan. Jakarta. pembajakan. Separatisme bersenjata kita hentikan. dan Maluku terselesaikan secara tuntas. Indonesia yang lebih aman dan damai. baik dalam bentuk perdagangan anak dan perempuan maupun narkoba dapat terus diperangi. Papua. semangat. Konflik dan ketegangan antar kelompok dan antar golongan masyarakat dapat diselesaikan. nilai. keadilan. Angka kriminalitas di perdesaan dan di perkotaan dapat diturunkan sampai tingkat yang memberikan rasa aman bagi rakyat. Konflik horisontal terselesaikan dengan sekaligus mengatasi akarakar konfliknya. martabat. Kejahatan lintas batas. Selasa 1 Juni 2004).Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Tahan Resesi Indonesia ke depan mestilah Indonesia yang berkembang berdasarkan jiwa. Indonesia ke depan mestilah Indonesia yang tahan terhadap resesi.

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Kehidupan masyarakat yang majemuk.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Kamis 1 Juli 2004). Jumat 11 Juni 2004). (SBY. pidato politik pada penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. saling menghargai dan toleransi beragama. Palembang. yang plural. saling hormat menghormati. Jakarta. Berjuang Bersama Rakyat Saya akan berjuang bersama rakyat untuk membawa bangsa Indonesia menjadi lebih baik dalam lima tahun ke depan. masyarakat harus bisa hidup harmonis. Minggu 20 Juni 2004). saat berkampanye di lapangan Sario. Manado. di atas kedaulatan sendiri. (SBY. terus berkembang. hubungan internasional dapat terus kita kembangkan secara bermartabat. Hidup Harmonis Untuk mewujudkan Indonesia yang aman dan damai. serta tidak menyuarakan SARA. (SBY. Dan. di depan ribuan pendukungnya di lapangan parkir Stadion Bumi Siliwangi.

Bandung. kita tak usah berdebat terlalu panjang. dan Lingkungan Langkah Nyata aya memandang upaya penting perbaikan lingkungan hidup. karena bisa merusak lingkungan dan menyebabkan banjir di mana-mana. penggundulan hutan yang berlebihan harus dicegah. S Pengelolaan Hutan Saya akan memberantas dan menghapuskan praktek ilegal logging yang sangat merugikan negara bertriliun-triliun rupiah. Masalah pengelolaan hutan harus dilakukan sebaik mungkin. negara tidak boleh dirugikan akibat praktek penebangan hutan secara liar. yang kita butuhkan adalah langkah nyata. Di satu sisi.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Hutan. (SBY. Laut. lingkungan hidup adalah bagian dari pengelolaan kehidupan kita di masa sekarang dan mendatang. Untuk itu. Kondisi lingkungan hidup yang baik merupakan salah satu tujuan pembangunan. Selasa 15 Juni 2004). Ini harus segera diwujudkan. harus ada tindakan nyata yang dilakukan secara Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Sebab. Saya akan menata secara nasional soal bagaimana kebijakan dan pengawasan yang tepat. dalam acara “Diskusi Kearifan Ekologi” di Hotel Grand Hyatt. Keadaan ini tidak bisa dibiarkan terus menerus. Ini sangat penting dan merupakan salah satu prioritas program yang akan segera saya laksanakan. Untuk mengatasinya. Di sisi lain.

saat berdialog dengan para nelayan di perkampungan nelayan Karangatu.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan konprehensif. di antaranya melalui : menegakkan hukum dan menyerasikan aturan mengenai pengelolaan sumberdaya alam dan lingkungan. Penebangan kayu liar pada hutan-hutan produksi dan lindung telah mencapai 50. Sumberdaya Alam Pembangunan Indonesia sangat ditentukan oleh sejauh mana bangsa ini menghargai dan mengelola sumberdaya alam yang dimilikinya dan lingkungan hidup yang melingkupinya. Kamis 10 Juni 2004). Banyak ahli menduga.42 triliun per tahun. TNI dan Polri harus menjadi bagian dalam upaya pemberantasan praktek penebangan hutan secara liar. Pemimpin. Belum terhitung kerugian ekologi akibat hilangnya beberapa spesies keanekaragaman hayati. (SBY. CATATAN: praktek ilegal logging atau penebangan kayu liar adalah salah satu masalah besar di Indonesia. Banten. Serang.7 juta m3 per tahun. keadaan ini bisa tetap berlangsung dikarenakan tidak adanya penanganan hukum yang jelas terhadap pihak-pihak yang terlibat. Kerugian finansial yang diakibatkannya Rp30. Ada diskriminasi hukum untuk melindungi pihak-pihak tertentu. memperbaiki koordinasi lintas departemen dalam pengendalian pengelolaan 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Saya memberikan prioritas pada kebijakan peningkatan fungsi dan kualitas lingkungan. menciptakan sistem insentif dan disinsentif yang tegas dalam pengelolaan sumberdaya alam dan lingkungan.

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan sumberdaya alam dan lingkungan. menindak secara tegas dan efektif praktek-praktek penyelewengan pengawasan dan pengendalian pengelolaan sumberdaya alam dan lingkungan yang dilakukan oleh aparat birokrasi. namun fasilitas untuk menjaganya sangat minim. Bandung. Rasio Daratan Saya berharap. Indonesia lautnya begitu luas. meningkatkan partisipasi masyarakat dalam pengelolaan sumberdaya alam dan lingkungan. Kamis 1 Juli 2004). Jakarta. Tidak ada harmoni jika pembangunan tidak memperhatikan rasio daratan dengan lautan. Selasa 15 Juni 2004). pidato politik pada penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. dalam acara “Diskusi Kearifan Ekologi” di Hotel Grand Hyatt. sumber daya begitu kaya. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . (SBY. (SBY. pembangunan dalam bidang kelautan ke depan bisa lebih ditingkatkan.

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

Ajakan dan Kebersamaan
Melanjutkan Reformasi
ari kita lanjutkan reformasi dengan melakukan penataan, pendalaman, dan penyeimbangan berbagai aspeknya. Mari kita lanjutkan reformasi dengan meletakkannya di dalam kerangka jiwa, semangat, nilai, konsensus, cita-cita, dan tujuan kemerdekaan. Saya tahu dan menyadari sepenuhnya tidak ada jalan yang lunak bagi sebuah reformasi. Reformasi bukanlah bulan purnama. Masa transisi adalah masa yang sulit dan bahkan kritis. Perubahan berbagai tatanan dan nilai yang otoritarian ke tatanan dan nilai yang demokratis juga sesuatu yang tidak mudah. Namun, saya yakin dan percaya apabila tetap teguh dan tidak kehilangan orientasi, reformasi berskala besar yang hendak kita teruskan ini akan mencapai tujuan dan sasarannya. Dengan kerangka ini, kita memasuki Reformasi Gelombang Kedua. Reformasi yang menjadikan semangat perubahan ke dalam sistem kehidupan bersama. (SBY, pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Selasa 1 Juni 2004).

M

Komitmen dan Keja Keras
Untuk membangun Indonesia yang lebih baik, marilah kita sama-sama membuat komitmen dan bekerja keras. Jika Indonesia 

Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

menjadi lebih baik, marilah kita menikmatinya bersama-sama. Jika Indonesia menjadi lebih maju, marilah kita maju bersama-sama. Tapi ingat, membangun Indonesia yang lebih baik memerlukan proses dan kerja keras. (SBY, saat merayakan hari ulangtahun ke-3 Partai Demokrat di Istora Senayan, Jakarta 9 September 2004).

Integrasi Nasional
Enam tahun lalu Indonesia dilanda krisis moneter. Situasi yang sulit itu telah membuat integrasi nasional kita luntur. Keadaan itu tidak boleh berlanjut lagi. Harus ada tekad dan kesatuan guna mengukuhkan kembali rasa nasionalisme. (SBY, saat merayakan hari ulangtahun ke-3 Partai Demokrat di Istora Senayan, Jakarta 9 September 2004).

Momentum Perubahan
Mari kita jadikan demokrasi yang tengah tumbuh dan mekar ini sebagai momentum untuk melakukan perubahan yang kita inginkan. Kita harus cukupkan dan hentikan sikap dan tindakan kita yang terlalu melihat ke belakang, dan yang terlalu saling menyalahkan. Kita cukupkan dan hentikan sikap dan tindakan politik kita yang masih memberikan ruang gerak bagi politik kotor, politik kekerasan, dan politik yang membodohi rakyat. Mari kita katakan untuk semua ini: cukup sampai di sini! Selanjutnya, mari kita katakan: ayo bersama melakukan perubahan untuk kehidupan bersama yang lebih baik! (SBY, pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Selasa 1 Juni 2004).

Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

Mempertahankan Konsensus
Marilah kita memahami dan mempertahankan konsensus dasar yang sudah dibuat oleh para pendiri negara Republik Indonesia, yakni Pancasila dan UUD 1945. Di situ sudah diatur bagaimana masyarakat Indonesia yang plural, hidup rukun dan saling menghargai. (SBY, saat berkampanye di lapangan Sario, Manado, Jumat 11 Juni 2004).

Melakukan Perubahan
Saya mengajak seluruh rakyat untuk secara bersama-sama melakukan perubahan. Perubahan menuju Indonesia yang lebih baik. Kita bersama akan terus berjuang untuk melakukan perubahan ke arah yang lebih baik. Hanya dengan berjuang terus dengan gigih inilah kita akan terhindar menjadi bangsa yang merugi. Inilah amanah reformasi yang harus kita jalankan bersama. Ini juga amanah konstitusi. Dan, yang terutama, inilah suara dan harapan rakyat. (SBY, pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Selasa 1 Juni 2004).

Lima Persen Gaji
Karena minimnya danan APBN untuk bidang pendidikan dan kesehatan, pendanaannya harus kita atasi bersama-sama. Harus ada gerakan melakukan donasi dari mereka yang mampu untuk mereka yang kurang mampu. Mereka yang tidak mampu jangan dipaksa membayar biaya pendidikan dan kesehatan yang tinggi. Namun, jangan hanya ‘diperas’ untuk donatur yang masuk kantong pribadi. Mereka harus diarahkan menjadi donatur untuk mengatasi masalah pendidikan, kesehatan, dan pengangguran. Sebagai langkah 

Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

awal, saya akan memberi contoh dengan memberikan lima persen gaji saya untuk masalah di pendidikan dan kesehatan. (SBY, di depan peserta acara “Dialog Interaktif Menuju Indonesia Masa Depan” yang diadakan oleh Forum Rektor Indonesia Jawa Timur, Surabaya, Selasa 24 Agustus 2004).

Tidak Bisa Sendirian
Saya mengajak masyarakat Indonesia dari seluruh lapisan untuk bersatu dan bergandengan tangan lebih erat membantu pemerintahan mendatang. Saya tidak mempersoalkan apakah dia dulu mendukung saya atau tidak. Marilah kita bersatu kembali. Saya menyadari, saya takkan dapat sendirian menjalankan amanah mensejahterakan rakyat tanpa dukungan penuh seluruh rakyat Indonesia. (SBY, seusai sholat Jumat di Mesjid Al-Istiqomah, Cikeas, Desa Nagrak, Gunung Putri, Bogor, Jumat 24 September 2004).

Menatap ke Depan
Kita perlu menatap ke depan. Kita perlu berbenah menghadapi kehidupan yang berubah secara cepat ini. Mari kita pusatkan perhatian kita untuk menata masa depan. Mari kita pusatkan segala daya kita untuk menjadi bangsa yang berkepribadian dengan tingkat kemandirian yang tinggi. Kini waktunya menatap ke depan. (SBY, pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009, Jakarta, Selasa 1 Juni 2004).

Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 

Sabtu 14 Agustus 2004). dalam pertemuan dengan Pengurus Besar Persatuan Guru Republik Indonesia di Bumi Perkemahan Tawangmangu. kalau dia partisan. dalam pertemuan dengan Pengurus Besar Persatuan Guru Republik Indonesia di Bumi Perkemahan Tawangmangu. juga memperhatikan kebhinekaan tunggal ika dan masalah gender. Seorang menteri agama harus bisa mengayomi semua umat beragama. J Empat Menteri Perempuan Kabinet saya nantinya terdiri dari the dream team paduan politisi dan kaum profesional. Kalau dalam kabinet sekarang hanya ada dua menteri perempuan. dan memiliki kepribadian baik. Sabtu 14 Agustus 2004). (SBY. maka dalam kabinet mendatang bisa empat orang namun harus tetap memperhatikan kualifikasi dan profesionalismenya. seorang muslim yang baik. Harus Bisa Mengayomi Saya akan memilih menteri agama dari NU berdasarkan pertimbangan sosiologis. Solo.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Seputar Kabinet Profesional Nonpartisan abatan Jaksa Agung. Kepala BIN dan Menteri BUMN. (SBY. Andai orang jujur pun mengisi jabatan itu. Pengelolaan  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . akan saya isi dengan orang profesional nonpartisan. berwawasan luas. dia akan dianggap memihak pada politik-politik tertentu. Ini agar tidak menganggu kinerja mereka. Solo.

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

kehidupan beragama, toleransi dan harmoni antarumat beragama akan menjadi tugas dan perannya. (SBY, di hadapan peserta acara “Dialog Wawasan Kebangsaan” di Graha Samudera, Bumimoro, Surabaya, Selasa 24 Agustus 2004).

Tidak Akan Melupakan
Saya tidak akan melupakan putra-putri terbaik Papua. Insya Allah saya akan mengajak putra-putri terbaik Papua ikut dalam kabinet saya. (SBY, dalam kampanye di lapangan Trikora, Abepura, Jayapura, Jumat 4 Juni 2004).

Jika Mampu Bersaing
Saya akan mempertimbangkan putra Dayak dari Kalimantan Tengah untuk menduduki jabatan menteri di kabinet mendatang jika mampu bersaing dengan tokoh-tokoh dari daerah lain. Hal ini demi terjadinya persaingan yang sehat antar semua daerah di Indonesia. (JK, dalam dialog dengan masyarakat adat di Lembaga Musyawarah Dayak Daerah Kalimantan Tengah, Jumat 11 Juni 2004).

Menyingsingkan Lengan
Marilah kita bekerja keras untuk menghadapi segala tantangan berat yang dihadapi bangsa dan negara. Besok pagi, insya Allah saya akan melantik anggota kabinet masa bakti 2004-2009. Setelah itu, kami akan langsung menyingsingkan lengan baju untuk merumuskan dan menjalankan langkah-langkah awal kebijakan dan rencana aksi pemerintah. (SBY, saat menyampaikan pidato politik pertamanya sebagai Presiden Republik Indonesia ke-6 di Istana Merdeka, Jakarta, Rabu 20 Oktober 2004).

Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

Mengundurkan Diri
Apabila anggota kabinet saya terlibat dalam berbagai tindak penyimpangan, termasuk korupsi. Dan apabila dinyatakan bersalah oleh hukum, ia harus siap untuk mengundurkan diri dan menerima sanksi sesuai hukum yang berarti. Sebagai pemimpin tertinggi di pemerintahan, saya pun akan melakukan hal yang sama dengan para menteri, menjadi pejabat yang bersih, bebas dari korupsi dan segala bentuk penyimpangan. (SBY, saat melantik 36 menteri dan pejabat setingkat menteri dalam Kabinet Indonesia Bersatu di Istana Negara, Jakarta, Kamis 21 Oktober 2004).

Bisa Dipertimbangkan
Mengenai kriteria figur yang akan duduk di kabinet, kita akan melihat bagaimana integritas kepribadiannya, kapabilitasnya, track recordnya, serta pengalamannya. Saya tidak melihat seseorang dari latar belakangnya dari mana, tapi jika dia memenuhi kriteria, bisa dipertimbangkan. (SBY, di Hotel Permata, Pacitan, Selasa 8 Juni 2004).

Agar Bisa Lebih Berperan
Saya akan memberikan empat pos menteri bagi perempuan. Ini agar kaum perempuan Indonesia bisa lebih berperan dalam proses politik dan pengambilan kebijakan untuk publik, baik itu di legislatif, eksekutif maupun yudikatif. Hal ini sudah saya sudah pikirkan secara mendalam dan rasiional. Saya terinspirasi setelah melihat perkembangan potensi kaum perempuan di lembaga eksekutif dan legislatif. (SBY, dalam pertemuan dengan aktivis
Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

Gerakan Pemberdayaan Suara Perempuan di Hotel Atlet Century Park, Senayan, Jakarta, Senin 30 Agustus 2004).

Harmoni Kehidupan
Saya akan mengajak kader dari Papua yang kapabilitas, jujur, dan mau bekerja keras untuk masuk dalam kabinet. Ini penting untuk menjaga harmoni kehidupan berbangsa dan bernegara. (JK, saat berdialog dengan tokoh adat dan pemuka masyarakat di Manokwari, Irian Jaya Barat, Rabu 25 Agustus 2004).

Pro Maupun Kontra
Saya memahami, siapapun yang dinominasi untuk menjadi menteri atau pejabat setingkat menteri selalu ada pandangan pro maupun kontra. Saya menyadari, tidak mungkin nama-nama itu disetujui oleh semua kalangan atau memuaskan semua pihak. Namun semua itu telah saya pertimbangkan secara matang dan melihat semua aspek sesuai kriteria yang telah saya tetapkan. Bagi saya bukan setuju atau tidak setuju, bukan pula juga soal pro atau kontra. Tetapi mereka yang akan bertindak sebagai menteri, kinerja mereka, kerja keras mereka, pengabdian mereka agar lima tahun mendatang kondisi Indonesia menjadi lebih baik. Karena itu, kita harus melihat kabinet ini secara utuh, jangan orang per orang. Yakinlah Kabinet Indonesia Bersatu akan bekerja sesuatu tenaga untuk membuat Indonesia menjadi lebih baik. (SBY, saat mengumumkan nama-nama anggota Kabinet Indonesia Bersatu di Istana Negara, Jakarta, Rabu 20 Oktober 2004).

Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan

Karya Nyata
Saya mendengar dan memahami banyak terjadi pro dan kontra pada pengangkatan menteri-menteri Kabinet Indonesia Bersatu ini, bahkan ada kesanksian apakah para menteri termasuk saya dan Pak Jusuf Kalla dapat mengemban tugas yang tidak ringan ini. Dalam suasana demokrasi, dalam nuansa yang positif, anggaplah itu sebagai pemicu, cambuk, dan penantang untuk bisa bekerja dengan baik. Tidak perlu kesanksian atau keragu-raguan rakyat terhadap saudara dijawab dengan kata-kata. Jawablah itu dengan kerja dan karya nyata. (SBY, saat melantik 36 menteri dan pejabat setingkat menteri dalam Kabinet Indonesia Bersatu di Istana Negara, Jakarta, Kamis 21 Oktober 2004).

Melakukan Evaluasi
Sebelum acara pelantikan, para menteri dan jaksa agung telah menandatangani surat pernyataan yang hakekatnya merupakan kontrak politik antara para menteri dengan saya. Hal itu dilakukan dengan sepenuh hati dan penuh kesadaran untuk setia kepada pemerintah dan negara, untuk jujur dan bekerja kerjas, mengutamakan kepentingan pemerintah dan negara diatas kepentingan partai atau golongan. Saya akan melakukan evaluasi atas kinerja dan prestasi mereka. Saya mengajak mereka untuk bekerja keras dan bekerja cerdas. Lima tahun adalah waktu yang cukup untuk kita bisa menyumbangkan sesuatu yang optimal kepada bangsa dan negara kita. (SBY, saat melantik 36 menteri dan pejabat setingkat menteri dalam Kabinet Indonesia Bersatu di Istana Negara, Jakarta, Kamis 21 Oktober 2004). 

00

Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?

sebab mereka tidak bisa memberikan contoh yang baik. saat bertemu pengurus dan kader Partai Keadilan Sejahtera Sumatera Barat di Hotel Bumi Minang.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Segera Dicopot Kami akan memecat anggota kabinet yang terlibat KKN. Itu sudah menjadi komitmen kami. Orang yang melakukan KKN harus segera dicopot dari jabatannya. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 . (JK. Padang. Sabtu 4 September 2004).

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Agenda Kerja Tema K2A aya akan mengawali 100 hari pemerintahan saya dengan tema Konsolidasi. dalam acara open house di kediamannya. adil. Senin 27 September 2004). Gunung Putri. Konsolidasi artinya. tema ini akan jalan dengan baik. melaksanakan misi pemerintahan dan program kerja kabinet secara konsisten dan konsekwen. Bogor. dan sejahtera dengan komitmen dan kerja keras. (SBY. Kedua. dan Aksi (K2A). maka agenda pasca krisis kami adalah menjadikan Indonesia lebih aman.karena perbedaan kubu dan dukungan dalam Pemilu -. Jakarta 9 September 2004). (SBY. Aksi. Konsiliasi. setelah Indonesia krisis. Pertama. mempertegas program-program yang utama dan mendesak bagi rakyat sebagai landasan untuk program kerja selanjutnya. saat merayakan hari ulangtahun ke3 Partai Demokrat di Istora Senayan. menjalin dan mempererat kembali hubungan dengan pihak-pihak yang -. menyelamatkan kehidupan bernegara sesuai dengan konsensus dasar negara. 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . S Negara Modern Ada dua agenda utama yang menjadi prioritas program saya. Saya yakin. Puri Cikeas.telah berjarak. Konsiliasi. Indonesia harus menjadi negara modern tetapi jangan sampai modernitas menghilangkan akar budaya.

Sementara itu. Wantannas yang semula bernama Dewan Pertahanan Negara dibentuk tahun 1946 (berdasarkan Undang-Undang Nomor 6/1946). Reformasi birokrasi bukan hanya menyangkut Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 . Tugasnya antara lain merumuskan kebijakan pemerintah di bidang ketahanan nasional. akan menghasilkan sesuatu yang baik. Namun. Saya juga akan memberdayakan Dewan Ekonomi Nasional dan Dewan Keamanan. Ini adalah tantangan berat. Yang ada saat ini adalah Dewan Ketahanan Nasional (Wantanas). Jika kedua lembaga tersebut diperdayakan secara penuh dan efektif. CATATAN: Dewan Ekonomi Nasional atau biasa disebut DEN pernah ada pada masa kepemimpinan Presiden Abdurrahman Wahid yang diwujudkan dengan Keppres RI No. Dewan Keamanan Nasional (DKN) belum dikenal di Indonesia. Bogor. mempercepat pemulihan ekonomi nasional dari krisis. Gunung Putri. Dengan tugas utama. 144 Tahun 1999. Tujuannya. (SBY.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Dewan Ekonomi dan Dewan Keamanan Staf kepresiden selama ini belum bekerja efektif. memberi nasehat kepada presiden mengenai kebijakan ekonomi. Reformasi Birokrasi Saya akan melakukan reformasi birokrasi. Meskipun membutuhkan waktu lama. Senin 27 September 2004). DEN banyak dikritik karena tugasnya dianggap tumpangtindih dengan peran serta tugas menteri. Puri Cikeas. tapi tetap harus dilakukan. saat bertemu dengan warga Jawa Timur dari berbagai profesi. Saya akan memberdayakannya.

pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Dengan reformasi birokrasi. Kedua. menata kembali sistem pemerintahan dan kenegaraan. Menghormati Kemajemukan Ada dua agenda besar saya demi kesejahteraan rakyat. yang menghormati kebhinekaan. UUD 1945. serta menghormati kemajemukan. Agenda Besar Kita kembangkan dua agenda besar kebangsaan kita ke depan. dan konsensus dasar berdirinya negara kita. kinerja dan out put yang dihasilkan bisa lebih baik. dan sistem kelembagaan tata negara. rasa aman. Jakarta. Hal ini dibutuhkan untuk mengembangkan sistem sosial politik yang berkelanjutan. Selasa 8 Juni 2004). serta pemerintahan yang tahan menghadapi guncangan. kesehatan. pendidikan. Agenda besar pertama ini dimaksudkan untuk mengembangkan : (a) sistem sosial-politik Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 . Yang pertama. keutuhan NKRI. Untuk ini. Dengan pemerintahan yang efisien. dan pembangunan sesuai dengan jiwa. Harus dilakukan secara menyeluruh di departemen-departemen dan lembaga pemerintahan lainnya. terutama Pancasila. membangun kembali Indonesia pasca krisis. menata kembali sistem kenegaraan. (SBY. Pacitan. Jangan sampai uang negara dikeluarkan secara tidak efisien sehingga pemasukannya tidak sepadan. pengeluaran anggaran yang tidak penting bisa ditiadakan. dan keamanan. Selasa 1 Juni 2004). dan terjaminnya rasa keadilan masyarakat. pemerintahan. saya akan melakukan penyediaan dan pemenuhan hak-hak dasar rakyat meliputi pangan.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan struktural. melainkan juga kultural. dan berkembangnya kehidupan masyarakat yang majemuk. Pertama. (SBY. semangat. di Hotel Permata.

banyak persoalan yang harus menjadi perhatian sejak awal pemerintahan saya. Gunung Putri.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan yang berkelanjutan. sosial. tetapi juga masalah pendidikan dan kesejahteraannya. Untuk ini. (SBY. Selama tiga bulan pertama masa pemerintahan saya. kita harus memastikan bahwa setiap warga Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 . seminim mungkin saya tidak akan bepergian ke luar negeri. mengunjungi berbagai daerah dan melihat langsung berbagai masalah di dalam masyarakat. saat berdialog dengan sejumlah guru SMAN I Cileunsi di kediamannya. Saya ingin mempelajari secara langsung pada masyarakat berbagai persoalan yang mereka hadapi. Di dalam negeri. nelayan. Diskriminasi Harus Dihapus Kita harus memastikan bahwa diskriminasi harus dihapus di bumi pertiwi. hukum dan HAM. buruh. Saya akan berkeliling. Bogor. Konflik di Poso. Agenda besar kedua ini akan kita mulai dengan agenda khusus : membangun kembali Indonesia pasca krisis. Rabu 22 September 2004). dan (b) sistem dan kelembagaan ketatanegaraan. politik. Jika mungkin. dan berbagai golongan masyarakat lainnya. sebulan sekali. pemerintahan. Bukan hanya masalah keamanannya. Bertemu dengan petani. termasuk ekonomi. Inilah yang menjadi inti agenda dari reformasi gelombang kedua yang kita canangkan. serta pertahanan dan keamanan. Jakarta. melakukan pembangunan di segala bidang. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. budaya. Yang kedua. dan pembangunan yang tahan menghadapi guncangan. Fokus di Dalam Negeri Saya akan lebih memfokuskan waktu saya untuk persoalanpersoalan di dalam negeri. Aceh. (SBY. Maluku dan Atambua harus segera diselesaikan secara komprehensif. Selasa 1 Juni 2004). Puri Cikeas.

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan negara memiliki kedudukan yang sama di hadapan hukum. Tali Persaudaraan Saya akan senantiasa menjaga tali persaudaraan dengan Ibu Megawati Soekarnoputri dan Bapak Hamzah Haz yang saya 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . meningkatkan kesadaran warga negara atas hak dan kewajibannya. serta pendapatan per kapita rakyat Indonesia yang rendah. Jakarta. Kualitas sumberdaya manusia merupakan tujuan dan sekaligus faktor utama yang menentukan keberhasilan di berbagai bidang. Selasa 1 Juni 2004). Dan. lingkungan. Rendahnya angka HDI yang diperoleh Indonesia mengindikasikan bahwa angka harapan hidup. Juga. profesionalisasi setiap pihak yang menangani hukum. Indeks pembangunan manusia (HDI) menempatkan Indonesia pada urutan 112 dari 175 negara. (SBY. Indeks tersebut mencerminkan keadaan harapan hidup. Kamis 1 Juli 2004). Jakarta. pidato politik pada penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. kesehatan. serta pendapatan per kapita tergolong rendah. Indeks Pembangunan Manusia Saya akan memberikan perhatian yang seksama pada pendidikan. Berdasarkan indeks pembangunan manusia. Menghapus peraturan yang bersifat diskriminatif dan yang melanggar prinsip keadilan. partisipasi jenjang pendidikan dasar sampai pendidikan tinggi. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 20042009. angka melek aksara. dan peningkatan peran dan kualitas perempuan dan keluarga. (SBY. kemampuan literasi dan tingkat pendidikan. bangsa Indonesia berada di peringkat bawah di antara bangsa-bangsa di dunia.

Tidak ada rasa aman tanpa keadilan dan kesejahteraan. Jakarta. (SBY. Saya keluar dari kabinet agar nanti bisa menyelesaikan permasalahanpermasalahan itu. saat menyampaikan pidato politik pertamanya sebagai presiden Republik Indonesia ke-6 di Istana Merdeka. di dalam perceraian kita runtuh. penegakan supremasi hukum.). Kamis 1 Juli 2004). Tidak terbangun rasa keadilan tanpa meningkatnya kesejahteraan dan rasa aman. Jakarta. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 . Kita perlu menjunjung tinggi petuah Presiden Soekarno yang pernah mengingatkan. banyak hal yang tidak bisa saya kerjakan. dan yang lebih sejahtera. yang lebih adil dan demokratis. Saling terkait. (JK. Ed. perbaikan ekonomi. (SBY. Yakni. Sewaktu saya menjabat dulu. Dan. pidato politik pada penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. dan peningkatan kualitas pendidikan. tentu kesejahteraan rakyat tidak akan terwujud tanpa berkembangnya rasa aman dan rasa adil dalam masyarakat. Tiga hal yang tak terpisahkan. berbagai persoalan itu tak bisa terselesaikan. saat berdialog dengan Kosgoro Pengurus Daerah Kabutan Brebes. Brebes. Saya tahu persis berbagai permasalahan yang dihadapi. Tiga Hal Penting Platform kami adalah mewujudkan Indonesia yang lebih aman dan damai. Tiga Perubahan Dasar Ada tiga perubahan dasar yang akan saya lakukan.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan hormati sebagai tokoh nasional. di dalam persatuan kita berdiri. Ketiga fondasi itu belum tampak pada pemerintahan sekarang (pemerintahan Megawati. namun karena masalah kepemimpinan. Senin 9 Agustus 2004). Rabu 20 Oktober 2004).

Menegakkan sistem hukum.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Saling Percaya Perlu tindakan nyata untuk menghilangkan ketidakadilan dan mengembalikan rasa saling percaya di antara komponen masyarakat. atau golongan masyarakat. transparan. tanggap. Program yang akan kami lakukan adalah memperkuat dan mengartikulasikan identitas bangsa. efisien. Menciptakan sitem pemerintahan dan birokrasi yang bersih. kerukunan antarumat beragama. dan antara pusat dan daerah. Menjamin keadilan gender dalam berbagai produk perundangan. Menghapuskan seluruh peraturan dan praktek kehidupan yang bersifat diskriminatif terhadap warga negara. dan berwibawa. Lebih Adil Mewujudkan Indonesia yang lebih adil lima tahun ke depan. akan terbentuk civil society (masyarakat sipil) yang kokoh. antarwilayah. kelompok. dan kebijakan publik. Berkembangnya sistem demokrasi yang menjamin kedaulatan rakyat. Dengan begitu. Untuk membina rasa saling percaya. Berkembangnya kebebasan beragama bagi setiap warga negara sesuai dengan keyakinannya. (JK. harmoni antaretnis dan integrasi sosial. Meningkatkan partisipasi masyarakat dalam pengambilan keputusan publik. Saat berkampanye di halaman parkir GOR Segiri Samarinda. pidato politik pada Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 . program pembangunan. Ketidakadilan inilah adalah akar dari ketidakpercayaan. Masyarakat sering diperlakukan tidak adil sehingga timbullah ketidakpercayaan. Sabtu 12 Juni 2004). Mengembangkan konsistensi peraturan dan kebijakan antarsektor.akuntabel. minimal harus dilakukan melalui pemberantasan korupsi. Bhineka Tunggal Ika. (SBY. kita harus mencegah tindakan-tindakan yang menimbulkan ketidakadilan dan ketidakjujuran. Berkembangnya kebebasan pers. Yakni.

(SBY-JK. mengembangkan politik yang nondiskriminatif sekaligus mengembangkan kehidupan yang lebih harmonis dengan tingkat toleransi yang tinggi. Jakarta. melanjutkan reformasi. memberdayakan perempuan dalam kehidupan politik. Misi. menata hubungan yang sehat antara lembaga eksekutif dan yudikatif. dan Program Capres-Cawapres” yang diselenggarakan oleh Komisi Pemilihan Umum di Hotel Hilton.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. Kehidupan Demokrasi Dalam bidang politik kami akan mengembangkan kehidupan demokrasi partisipasi politik rakyat yang melibatkan publik dalam menetapkan kebijakan publik dan tahun 2009. Jakarta. Selasa 14 September 2004) Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 .Tipe kualitas yang lebih demokratis. mengembangkan kebebasan pers yang sudah terwujud. Kamis 1 Juli 2004). pemaparan dalam acara “Dialog Penajaman Visi.

Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Nonkategori Tinggal di Istana aya akan tinggal di Istana. pengaturan kegiatan kepresidenan dari pagi hingga malam hari akan lebih mudah. Presiden Soeharto dan Habibie. saat menjadi Presiden. dan saya pun tidak perlu mondar-mandir sehingga tidak terlambat karena masalah lalulintas. agar bisa digunakan untuk presiden berikutnya. seusai sholat Jumat di Mesjid AlIstiqomah. sekitar 50 km. tinggal di istana juga akan menghemat pengeluaran. CATATAN: Jarak kediaman SBY di Puri Cikeas Bogor cukup jauh dari pusat pemerintahan RI. memilih menetap di kediamannya. Bogor. Desa Nagrak. Di situ. Yakni. Cikeas. Jika di luar istana . Gunung Putri. Selain itu. sementara Presiden Megawati memilih tinggal di rumah dinas kepresidenan. Jumat 24 September 2004). akan ada penambahan biaya fasilitas. (SBY. Presiden RI yang pernah tinggal di istana kepresidenan Jakarta adalah Presiden Soekarno dan Abdurrahman Wahid. Kan lebih baik bila uang tersebut dipakai untuk memperbaiki fasilitas yang sudah ada. Juga memudahkan pengamanan. tamu-tamu mudah ditata. Istana Kepresidenan adalah tempat resmi kediaman dan kantor presiden. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? S 0 . Sebelumnya.

dalam silaturahmi dengan sejumlah ulama dan cendekiawan muslim di Asrama Haji Masyhur. Ketidakkonsistenan yang dapat membuat rakyat bingung. Jakarta. pidato politik pada penutupan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. tidak pernah diintervensi Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . (SBY. Jumat 18 Juni 2004). proses pengambilan keputusan pemerintah di bawah tanggung jawab dan kewenangan saya. Kamis 1 Juli 2004). Selama ini. tetapi. Kebijakan nasional yang berorientasi pada kepentingan keluarga presiden dan orang-orang dekatnya dapat berakibat buruk. tidak bisa dituntut pertanggungjawabannya. Sesuatu yang semua kita tahu pasti tidak melahirkan manfaat. Tidak Suka Berjanji Kami tidak suka berjanji. Medan. Kami tidak mengkomunikasikan sesuatu yang tidak kami pikirkan secara matang. (SBY. akan menjadi teladan bagi umat Islam lainnya di dunia dengan menampilkan Islam yang ramah dengan ajaran universalnya. Jabaran-jabaran ini. apalagi berjanji tentang hal yang saya tidak mempunyai kewajiban untuk memenuhinya. dan hanya seingat-ingatnya saja. Kami tidak mengkomunikasikan sesuatu yang tidak kami tulis dan serahkan kepada KPU. Bukan Urusan Keluarga Urusan negara jangan dicampuradukan dengan urusan keluarga. saya kira. Saya hanyalah salah satu umatnya saja yang masih terus menerus membutuhkan ‘tausiyah’ dari para ulama dan kiai.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Ajaran Universal Saya ingin melihat umat Islam di Indonesia yang memang mayoritas penduduknya memeluk agama ini. para ulamalah yang lebih mengetahuinya. malah sebaliknya melahirkan ketidakkonsistenan.

Ia sendiri heran bagaiman keberadaan program keluarga berencana. Program ini perlu terus mendapat perhatian dari pemerintah. apakah sudah berkurang atau malah sudah mandeg sama sekali. Jika sekitar 100 meter ada 20 anak yang digendong ibu-ibu. Setinggi apapun pertumbuhan ekonomi. menjawab pertanyaan salah seorang peserta dalam acara bertema ‘‘Berbenah Bersama Membangun Bangsa’’ di Hotel Hyatt Surabaya. Sangat Mencemaskan Saya mempunyai perhatian khusus terhadap program KB. jika jumlah penduduk terus meningkat akan menjadi masalah serius. pengendalian jumlah penduduk mengendur. Istri berurusan dengan urusan rumah tangga. Sabtu 26 Juni 2004). (SBY.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Menurutnya. Hal ini sangat mencemaskan. CATATAN: Kekhawatiran yang sama kemudian juga dikemukakan Megawati mantan Presiden Indonesia. ia tidak bisa membayangkan apa jadinya Indonesia di tahun mendatang jika program KB dihentikan.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan atau dipengaruhi istri. Dalam enam tahun terakhir ini. dan jumlahnya makin bertambah dari hari ke hari. ia tidak dapat membayangkan berapa banyak anak yang akan ia temua sepanjang jalan yang ia lewati. Minggu 29 Agustus 2004). menjelang akhir masa jabatannya.” Jakarta. (SBY. dalam acara “Dialog dan Silaturahmi Capres RI dan Calih Profesi Kesehatan DPR RI dengan Masyarakat Profesi Kesehatan.

Komitmen terhadap negara kesatuan sudah final. Di dalam kerangka konsensus dasar inilah kedirian kita sebagai bangsa dan keindoinesiaan kita menemukan bentuknya. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . dan bernegara yang majemuk dan yang menghargai kebhinekatunggalikaan juga sudah final. Komitmen untuk menumbuhsuburkan kehidupan bermasyarakat. Konstitusi adalah bangun utama keindonesiaan kita. Komitmen terhadap UUD 1945 sudah final. berbangsa.Bagian Satu Janji dan Komitmen: Dari Persiapan Kampanye Hingga Usai Pelantikan Sudah Final Bagi kita bangsa Indonesia. Kita tidak lagi perlu memperdebatkan dan membangun konsensus baru atas konsensus dasar berdirinya negara. jiwa. Amandemen terhadap beberapa pasal dari batang tubuh UUD 1945 harus tetap sejalan dengan isi. Selasa 1 Juni 2004). Jakarta. Di dalam kerangka inilah identitas kebangsaan kita berkembang di antara bangsa-bangsa lain. komitmen terhadap dasar negara Pancasila sudah final. (SBY. dan nilai-nilai yang terkandung dalam Pembukaan UUD 1945.Tetapi yang lebih penting. Amandemen tidak boleh dilakukan untuk kepentingan suatu golongan atau hanya kepentingan politik jangka pendek. pidato politik pada pembukaan masa kampanye putaran pertama Pemilihan Presiden dan Wakil Presiden RI 2004-2009. amandemen atas pasal-pasal dalam batang tubuh haruslah mencerminkan kehendak dan aspirasi seluruh rakyat Indonesia. semangat.

.

Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK Bagian Dua Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .

harmoni antaretnis. Untuk itu. Untuk itu. antar daerah. dan integrasi sosial). memperkuat dan mengartikulasikan identitas bangsa Indonesia (Bhinneka Tunggal Ika. sehingga terbangun masyarakat sipil (civil society) semakin kokoh. serta membangun kembali infrastruktur yang rusak di daerah-daerah yang pernah dilanda kerusuhan. Mencegah dan Menanggulangi Separatisme Kami akan melakukan pencegahan dan penanggulangan terhadap separatisme (gerakan untuk memisahkan diri dari NKRI). membangun kembali kepercayaan sosial antarkelompok masyarakat. meningkatkan mutu pelaksanaan otonomi dan desentralisasi. ataupun antargolongan. Cara yang akan kami tempuh adalah dengan: melakukan pemerataan pembangunan antardaerah. dan hubungan antarpusat dan daerah. meningkatkan kesejahteraan masyarakat di daerah konflik. memperbaiki proses desentralisasi dan otonomi daerah yang dapat memperkuat harmoni antar kelompok masyarakat. Menegakkan Hukum dan Ketertiban Kami akan menegakkan hukum dan ketertiban serta melakukan langkah-langkah pencegahan dan penanggulangan kriminalitas. serta menindak secara tegas separatisme dan sekaligus menghormati hak-hak masyarakat sipil. desa. kami akan: menegakkan hukum dengan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  ..Bagian Dua Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK Meningkatkan Saling Percaya Kami akan meningkatkan rasa saling percaya dan harmoni antarkelompok masyarakat untuk mencegah dan mengatasi terjadinya peristiwa pertikaian antarkampung. kerukunan antarumat beragama.memperbaiki akses masyarakat lokal pada sumberdaya ekonomi. langkah yang akan kami lakukan adalah: memperkuat harmoni yang ada dan mencegah tindakan-tindakan yang menimbulkan ketidakadilan.

menanggulangi dan mencegah tumbuhnya permasalahan yang berkaitan dengan penggunaan dan penyebaran narkoba. meningkatkan kemampuan dan kapasitas kelembagaan antiterorisme. Meningkatkan Kemampuan Pertahanan Kami akan meningkatkan kemampuan pertahanan negara. meningkatkan peran serta masyarakat untuk mencegah kriminalitas dan gangguan keamanan dan ketertiban di tempat tinggalnya masing-masing. Kami akan mencanangkan  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .Bagian Dua Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK tegas. dan meningkatkan kesejahteraan prajurit. serta memperkuat kerjasama internasional untuk memerangi kriminalitas dan kejahatan lintas negara. memperkuat atau meningkatkan kemampuan lembaga keamanan negara. Memantapkan Politik Luar Negeri Kami akan memantapkan politik luar negeri dan meningkatkan kerjasama internasional. menjaga dan memelihara integritas bangsa dan negara Indonesia. Untuk itu. program yang akan kami lakukan adalah: meningkatkan profesionalisme anggota TNI dalam menghadapi ancaman dan gangguan termasuk pencegahan serta penanggulangan separatisme. meningkatkan kesadaran akan hak-hak dan kewajiban hukum masyarakat. memodernisasi peralatan pertahanan negara. Untuk itu kami akan: menyusun dan menerapkan kerangka hukum antiterorisme yang efektif. adil dan tidak diskriminatif. dan meningkatkan kerjasama internasional untuk secara obyektif memerangi terorisme. Mencegah Terorisme Kami akan melakukan pencegahan dan penanggulangan gerakan terorisme.

pertahanan. meningkatkan kapasitas dan kualitas lembaga keamanan. menghormati dan memperkuat kearifan-kearifan dan hukum adat yang ber bersifat sifat lokal untuk memperkaya sistem hukum dan peraturan. melalui keteladanan kepala negara dan jajarannya dalam mematuhi dan menaati hukum. menyederhanakan sistem peradilan dan memastikan bahwa hukum diterapkan dengan adil. dan tanggungjawab dari seluruh kelembagaan negara/pemerintahan. adil dan kondusif untuk meningkatkan kesejahteraan. meningkatkan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . program-program yang akan kami lakukan adalah: mempertegas tugas. wewenang. Langkah yang akan kami lakukan adalah: memperkuat upaya-upaya pemberantasan KKN dan kroniisme. menghormati persamaan setiap warga negara di depan hukum. dan ketertiban.Bagian Dua Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK antara lain: meningkatkan kualitas diplomasi Indonesia dalam rangka memperjuangkan kepentingan nasional. serta melanjutkan komitmen Indonesia terhadap upaya-upaya pemantapan perdamaian dunia. damai. Untuk itu. meningkatkan profesionalisme dan kualitas sistem peradilan. yaitu memihak pada kebenaran. serta meningkatkan kerjasama internasional untuk menciptakan kawasan yang aman. menyelenggarakan pembinaan dan pengembangan aparatur negara/ pemerintahan. melanjutkan komitmen Indonesia terhadap pembentukan identitas dan pemantapan integrasi regional. Menciptakan Tata Pemerintahan yang Bersih Kami akan menciptakan tata pemerintahan yang bersih dan berwibawa (good governance). yang berdasarkan mekanisme checks and balances yang simetris. Membenahi Sistem dan Politik Hukum Kami akan membenahi sistem dan politik hukum yang menjamin penegakan dan kepastian hukum. termasuk anggota TNI dan Polri.

bersih. melalui perbaikan sistem hukum yang profesional.Bagian Dua Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK kesejahteraan aparatur negara/pemerintahan. anggota TNI dan Polri. mewujudkan sistem dan mekanisme kerja aparatur negara/pemerintahan yang efektif. menegakkan hukum dengan adil. dan pensiunan/purnawirawan. termasuk anggota TNI dan Polri. mendorong tuntasnya proses modernisasi yang dicirikan dengan terwujudnya negara kebangsaan Indonesia modern yang berkelanjutan. reaktualisasi nilai-nilai kearifan lokal sebagai salah satu dasar pengembangan etika pergaulan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 . kebijakan yang akan kami ambil adalah: mendorong terciptanya wadah yang terbuka dan demokratis bagi dialog kebudayaan agar benturan-benturan yang terjadi tidak sampai melebar menjadi konflik sosial. meningkatkan pengawasan untuk menjamin akuntabilitas. Langkah-langkah dan kebijakan yang akan kami tempuh adalah: memastikan setiap warga negara memiliki kedudukan yang sama di hadapan hukum. dalam rangka pelayanan kepada publik. Mengembangkan Kebudayaan Kami akan mengembangkan seluas-luasnya kebudayaan yang berlandaskan pada nilai-nilai luhur. dan menguatnya masyarakat sipil (civil society). dan perbaikan kinerja aparatur negara/pemerintahan. dan yang melanggar prinsip keadilan. serta meningkatkan kesadaran warga negara atas hak dan kewajibannya. Untuk itu.efisien dan akuntabel. dan berwibawa. menghapus peraturan yang ber bersifat sifat diskriminatif. Menghapus Diskriminasi Kami akan menghapuskan diskriminasi. transparansi. menciptakan iklim usaha yang mendorong berkembangnya etika usaha yang sehat dan terlaksananya tata kelola perusahaan yang baik (good corporate governance).

Untuk itu. program dan kebijakan yang akan kami ambil adalah: memajukan tingkat keterlibatan perempuan dalam proses Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Untuk itu. Meningkatkan Otonomi Kualitas Proses Desentralisasi dan Kami akan meningkatkan kualitas proses desentralisasi dan otonomi daerah. 22/ 1999 dan No. dan meningkatkan kecintaan masyarakat terhadap budaya dan produk-produk dalam negeri. serta memperkuat dan melakukan konsolidasi demokrasi. menegakkan hukum secara adil. agar mampu saling memahami dan menghormati keyakinan dan pendapat masing-masing. kebijakan yang akan kami lakukan antara lain: menyempurnakan Undang-undang No. menyempurnakan seluruh peraturan pusat dan daerah dalam rangka revitalisasi otonomi daerah. serta mendorong peningkatan kerja sama antar pemerintah daerah. konsekuen. Meningkatkan Peran Perempuan Kami akan meningkatkan kualitas kehidupan dan peran perempuan. 25/1999 untuk menciptakan otonomi daerah yang lebih efektif dan akuntabel serta perimbangan keuangan pusat-daerah yang bertanggung-jawab. Menjamin Penghormatan dan Pengakuan Atas HAM Kami akan menjamin penghormatan dan pengakuan atas HAM.Bagian Dua Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK sosial untuk memperkuat identitas nasional. Langkah-langkah yang akan kami lakukan adalah: meningkatkan profesionalisme lembaga keamanan dan pertahanan negara.meningkatkan kerjasama yang harmonis antarkelompok atau golongan dalam masyarakat. dan tidak diskriminatif.

dan dinamis. kecil. mencapai dan mempertahankan tingkat pertumbuhan ekonomi yang memadai. meningkatkan kuantitas dan kualitas infrastruktur. memperbaiki akses rakyat terhadap layanan kesehatan. Untuk itu. Menciptakan Kesempatan Kerja Kami akan melakukan perbaikan dan menciptakan kesempatan kerja. kebijakan yang akan kami tempuh adalah: menciptakan landasan kuat. revitalisasi pertanian dan aktivitas-aktivitas ekonomi pedesaan. berkualitas. dan menengah (UMKM). menyempurnakan perangkat hukum pidana yang lebih lengkap dalam melindungi setiap individu dari kekerasan dalam rumah tangga. merevitalisasi hubungan industrial tripartit. mengembangkan industri yang memiliki daya saing dan menyediakan kesempatan kerja. revitalisasi sektor kelautan dan aktivitas-aktivitas ekonomi wilayah pesisir.Bagian Dua Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK politik dan jabatan publik. meningkatkan taraf pendidikan dan layanan kesehatan serta program-program lain untuk mempertinggi kualitas hidup dan sumberdaya kaum perempuan. meningkatkan kampanye anti kekerasan terhadap perempuan dan anak-anak. peraturan. yang mendorong terciptanya lapangan kerja yang luas dan menyejahterakan. dan menumbuhkan kepercayaan akan kemampuan bangsa sendiri. meningkatkan daya saing ekonomi pedesaan dan UMKM melalui pengembangan dan penerapan ilmu dan teknologi yang tepat Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . mendorong pelaksanaan reforma agraria. memajukan perekonomian. dan rasa aman untuk berusaha dan bekerja. meningkatkan kualitas dan memperbaiki akses rakyat terhadap pendidikan. menciptakan kepastian hukum. meningkatkan kualitas pendidikan dan pengasuhan anak. menerapkan kebijakan fiskal yang ditargetkan dengan lebih tepat dan bertanggungjawab. dalam rangka mendayagunakan potensi negara kepulauan. mendorong perkembangan usaha mikro.

Langkah-langkah yang akan kami ambil antara lain: memformulasikan APBN yang memberikan prioritas penciptaan lapangan kerja melalui pertumbuhan ekonomi yang berkelanjutan. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . memperbaiki dan meningkatkan peran Indonesia dalam kerjasama ekonomi antarnegara. termasuk pengelolaan utang publik. secara lebih efektif. efisien. memperbaiki dan meningkatkan peran Indonesia dalam kerjasama ekonomi antarnegara. serta mendorong terwujudnya pengelolaan BUMN secara efisien dan bertanggung-jawab. meningkatkan usaha perbaikan akses sektor riil. meningkatkan upaya-upaya penyehatan dan penertiban lembaga keuangan dan perbankan. meningkatkan daya-saing ekonomi melalui peningkatan mutu dan produktivitas. untuk lebih meningkatkan pembangunan ekonomi nasional. mendukung mekanisme pasar yang efisien dan berkeadilan termasuk mengembangkan pasar-pasar tradisional dalam jaringan perdagangan yang sehat. terutama pelaku UMKM. meningkatkan koordinasi kebijakan fiskal dan moneter antara Pemerintah dan Bank Indonesia. meningkatkan kualitas layanan yang dapat meningkatkan daya saing dan perlindungan sumberdaya manusia Indonesia di pasar tenaga kerja internasional. merevitalisasi pengelolaan aset-aset negara. terhadap permodalan/kredit perbankan dan lembaga keuangan lainnya. menciptakan iklim usaha yang sehat dan transparan. dan teknologi. yang antara lain dapat dicapai melalui invensi.Bagian Dua Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK guna. Meningkatkan Kinerja dan Stabilitas Ekonomi Makro Kami akan meningkatkan kinerja dan stabilitas ekonomi makro. dengan tetap menjaga peran masing-masing. mengelola kebijakan fiskal. inovasi. menyempurnakan kebijakan sektor Perminyakan dan Gas Bumi dalam rangka peningkatan penerimaan negara dari sektor migas. dan bertanggung-jawab.

meningkatkan penyediaan pendidikan keterampilan dan kewirausahaan ataupun pendidikan nonformal yang bermutu. meningkatkan kompetensi dan profesionalisme tenaga pendidik. memperbaiki iklim usaha. revitalisasi kelautan dan aktivitas ekonomi daerah pesisir. memperbaiki akses penduduk miskin pada sumberdaya ekonomi. meningkatkan penyediaan dan pemerataan sarana-sarana pendidikan dan tenaga pendidik. ataupun masyarakat penyandang cacat. revitalisasi pertanian dan aktivitas ekonomi pedesaan tempat penduduk miskin banyak bekerja dan bermukim. Program dan kebijakan yang akan kami lakukan adalah: meningkatkan pelaksanaan wajib belajar 9 tahun. meningkatkan kuantitas dan kualitas infrastruktur di pedesaan dan daerah terpencil. seperti masyarakat miskin. pengurangan pengangguran. dan meningkatkan akses penduduk miskin terhadap layanan-layanan tersebut. menerapkan kebijakan APBN dengan target penciptaan lapangan kerja. masyarakat di daerahdaerah konflik. memberikan akses yang lebih besar kepada kelompok masyarakat yang selama ini kurang dapat terjangkau oleh layanan pendidikan. sehingga mampu membuka peluang bekerja.Bagian Dua Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK Menghapus Kemiskinan Kami akan berupaya menghapus kemiskinan. Meningkatkan Akses Rakyat Terhadap Pendidikan Kami akan meningkatkan akses rakyat terhadap pendidikan. Kebijakankebijakan yang akan kami ambil adalah: memperbaiki mutu layanan pendidikan dan kesehatan. meningkatkan ketahanan pangan masyarakat. dan pengurangan secara bertahap jumlah penduduk miskin. meningkatkan akses penduduk untuk memperoleh perumahan yang layak. meningkatkan kesejahteraan tenaga pendidik agar lebih mampu Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . masyarakat yang tinggal di daerah terpencil.

memperbaiki akses petani dan penduduk pedesaan terhadap sumberdaya ekonomi. meningkatkan pemerataan dan memperbaiki kuantitas dan kualitas infrastruktur antar daerah. terutama bagi rakyat miskin. meningkatkan pendidikan kesehatan kepada masyarakat yang dimulai sejak usia kanak-kanak. mengembangkan sistem jaminan kesehatan. dan mendukung kerjasama yang sinergi dan adil dengan usaha skala Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Menghapus Ketimpangan Kami akan melakukan penghapusan ketimpangan dalam berbagai bentuknya.Kawasan Barat Indonesia. Meningkatkan Akses Rakyat Terhadap Layanan Kesehatan Kami akan meningkatkan akses rakyat terhadap layanan kesehatan yang lebih berkualitas. dan Kawasan Timur Indonesia . meningkatkan pemerataan dan kualitas fasilitas kesehatan dasar. meningkatkan akses UMKM terhadap sumber permodalan. sehingga peserta didik mampu memecahkan berbagai masalah kehidupan secara kreatif dan menjadi manusia produktif. menyempurnakan manajemen pendidikan dan meningkatkan partisipasi masyarakat dalam proses perbaikan mutu pendidikan pendidikan. meningkatkan kualitas kurikulum dan pelaksanaannya yang bertujuan membentuk karakter dan kecakapan hidup.Tindakan-tindakan yang akan kami ambil adalah: memperbaiki pemerataan kesejahteraan rakyat desa-kota. Program dan kebijakan yang akan kami lakukan adalah: meningkatkan jumlah.Bagian Dua Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK mengembangkan kompetensinya. jaringan dan kualitas pusat kesehatan masyarakat. Jawa-Luar Jawa. meningkatkan kuantitas dan kualitas SDM tenaga medis. meningkatkan sosialisasi kesehatan lingkungan dan pola hidup sehat.

menindak secara tegas dan efektif praktik-praktik penyelewengan pengawasan dan pengendalian pengelolaan sumberdaya alam dan lingkungan yang dilakukan oleh aparat birokrasi. memastikan bahwa pembangunan tidak mengorbankan keberlanjutan daya dukung lingkungan dan mengurangi kesempatan yang dapat dinikmati oleh generasi yang akan datang. Merevitalisasi Pertanian dan Pedesaan Kami akan merevitalisasi pertanian dan pedesaan. Memperbaiki Pengelolaaan Sumberdaya Alam Kami akan melakukan perbaikan pengelolaaan sumberdaya alam dan pelestarian mutu lingkungan hidup.Bagian Dua Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK besar. Untuk itu. Program dan kebijakan yang akan kami tempuh antara lain: menegakkan hukum dan menyerasikan aturan mengenai pengelolaan sumberdaya alam dan lingkungan: menciptakan sistem insentif dan disinsentif yang tegas dalam pengelolaan sumberdaya alam dan lingkungan. memperbaiki koordinasi lintas departemen dalam pengendalian pengelolaan sumberdaya alam dan lingkungan. serta melindungi produsen Indonesia yang efisien dan kompetitif dari persaingan usaha yang tidak adil. program yang akan kami canangkan antara lain: meningkatkan kesejahteraan dan kualitas hidup petani dan rumah tangga petani. meningkatkan akses petani terhadap sumber daya produktif dan  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . melibatkan masyarakat lokal dan gerakan masyarakat sipil (civil society) secara sistemik dalam upaya pengelolaan sumberdaya alam dan lingkungan. memperbaiki kualitas proses pelaksanaan otonomi dan desentralisasi desentralisasi. meningkatkan penghormatan terhadap hak-hak perempuan dan anak anak. meningkatkan pemerataan dan meningkatkan peluang dan daya tarik investasi antar daerah. secara sistematis mengurangi beban utang negara melalui pengelolaan utang yang bertanggungjawab.

Adil.Bagian Dua Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK permodalan. Misi. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . melaksanakan reforma agraria. mengembangkan diverifikasi aktivitas ekonomi pedesaan. dan Sejahtera). dan membangun infrastruktur pertanian dan pedesaan. meningkatkan produktivitas dan kualitas petani dan pertanian. (SUMBER: Naskah Visi. mengembangkan industrialisasi pedesaan. dan Program SBY-JK: Membangun Indonesia yang Aman.

Bagian Dua Janji dan Komitmen yang Tersirat Dari Visi dan Misi SBY-JK  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .

Bagian Tiga Data dan Angka Sebagai Indikator Janji Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

.

Artinya. baru 16 kasus yang telah diproses. Tapi jumlah pelaku yang dipenjara bisa dihitung dengan jari. Sepuluh pelaku telah lari ke luar negeri. itu berarti SBY-JK telah berhasil membuktikan janj-janji perubahan yang selama ini mereka dengung-dengungkan. lebih dari 50 persen data dan angka ini berubah ke arah membaik. = Sejak tahun 2002 hingga 2004 ada 1000 kasus korupsi yang diajukan ke pengadilan. Deplu. Hingga awal tahun 2004. kasus BLBI belum terselesaikan. Administrasi pengiriman TKI ke luar negeri masih sangat amburadul. Depnaker. Depkeh. data dan angka di bawah ini adalah nyata. Tak ada kordinasi dan sinkronisasi antara Depdagri.Bagian Tiga Data dan Angka Sebagai Indikator Janji Data dan Angka Media Massa ata dan angka di bawah ini sempat terekam dan terpublikasikan oleh media massa sejak awal hingga menjelang akhir 2004. dan PJTKI. Akibatnya. Ada yang diperlambat. ada juga yang dihentikan penyidikannya. Jadikan data dan angka ini sebagai indikator. Sisanya dibiarkan mengendap. pada saat SBY melontarkan janji-janji dan komitmennya. Dari 58 perkara. Jika hingga akhir masa jabatannya (tahun 2009 nanti). banyak D = = Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

penghasil coklat nomor 4 di dunia.03 persen. Indonesia sering lebih memilih melakukan impor. = Daya saing Indonesia. = 53 persen masyarakat miskin di Indonesia adalah petani dan nelayan. berada pada peringkat ke-69 dari 104 negara di dunia. tahun 2004 jumlah pengangguran terbuka mencapai 10.yang disandera di Irak adalah salah satu contoh. Padahal. Padahal Indonesia terkenal sebagai negara agraris dan negara maritim terbesar di dunia. menurut World Economic Forum dalam laporan The Global Competitivenes Report tahun 2004. penghasil kopi nomor 4 di dunia.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .Bagian Tiga Data dan Angka Sebagai Indikator Janji terjadi KKN dan manipulasi. Dengan asumsi pertumbuhan ekonomi 5. dan penghasil nomor 1 lada putih di dunia. = Data terakhir dari Bappenas menyebutkan. dalam setahun diperkirakan angka ini akan mencapai 11.19 juta orang. Thailand yang berada di posisi 34 atau Singapura yang berada di posisi 7. = Tiap tahun. Bandingkan dengan Malaysia yang berada di posisi 31.83 juta orang. Pemalsuan identitas seperti yang dialami dua TKI -.75 juta orang. jumlah pencari kerja di Indonesia mencapai 3. = Dalam banyak kebijaksanaan pengadaan bahan pangan.Casingkem dan Istiqomah-. Belum terhitung jumlah pengangguran tak kentara yang jumlahnya 40 juta orang. Indonesia merupakan penghasil beras terbesar ke-3 di dunia. 16 juta jiwa sementara lapangan kerja yang tersedia hanya cukup untuk diisi 1.

Itu artinya.Bagian Tiga Data dan Angka Sebagai Indikator Janji = Menurut Indeks potensi tambang. dari 100 persen komputer yang menggunakan software. dan Ukraina. Akibatnya. 88 di antaranya menggunakan software tidak berlisensi alias bajakan. Indonesia hanya dikalahkan oleh Cina. Bahkan banyak di antaranya yang kemudian menjadi pengacara (pengangguran cari acara). Sektor bahari sering terabaikan. jauh di bawah Thailand (posisi ke-2) yang memiliki sumber daya terbatas dan jauh di bawah potensi yang dimiliki Indonesia. aktivitas eksplorasi di Indonesia justru mandeg sejak empat tahun lalu. menduduki peringkat keempat dari 20 besar negara dengan tingkat pembajakan piranti lunak (software) tertinggi di dunia. 10 persen dari 7. = Kasus-kasus pelanggaran HAM banyak yang belum  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Lucunya. menurut data Business Software Alliance (BSA). Indonesia masih berorientasi pada sektor daratan. = Dalam banyak kebijakan. Vietnam. Ini berarti dunia telah mempelajari Indonesia memiliki potensi tambang yang bagus. = Nilai ekspor produk perikanan Indonesia yang hanya 1. sebanyak 60 persen transpor laut domestik dilakukan oleh perusahaan asing. Maklum. Akibatnya.49 miliar dolar AS menempatkan Indonesia pada posisi ke-12 negara pengekspor produk perikanan dunia. = Indonesia. Tingkat pembajakan peranti lunak di Indonesia mencapai 88 persen.000 ahli geologi Indonesia banting profesi menjadi karyawan bank atau wartawan. setiap tahun bermiliar dollar ikan dicuri nelayan asing. Indonesia berada di ututan ke-16 dari 47 negara.

Indonesia adalah negara terkorup di Asia dengan nilai (skala 1 sampai 10 dari yang paling bersih hingga yang paling kotor) 9. Bahkan ada yang tidak pernah bersekolah sama sekali. Angka kematian ibu melahirkan di Indonesia tercatat paling tinggi di Asia Tenggara. peristiwa Trisakti dan Semanggi. Dari jumlah itu.25 persen. terjadinya pendarahan saat persalinan. Penduduk miskin Indonesia telah mencapai 37 juta jiwa atau 15 juta keluarga. Tanjung Priok dan Talangsari Lampung.50 persen. dan infeksi sebelum dan sesudah persalinan. Kematian terjadi karena tiga hal yang berhubungan dengan kesehatan: tekanan darah tinggi pada ibu mengandung. peristiwa Mei. yakni 470 per 100 ribu persalinan. penyerangan kantor PDI-P tahun 1996.50 persen atau Jepang 3. Sebagian dari mereka ini adalah anak putus sekolah. 3 juta jiwa terdiri dari anak terlantar yang lari ke jalanan.1 juta pekerja anak yang terdiri atas 1. menurut data terakhir Unicef. peristiwa ‘petrus’. Mereka adalah anak yang harus bekerja dengan jam kerja panjang dan tanpa perlindungan yang memadai. Bandingngkan dengan Singapura yang hanya mencapai 0. Anak terlantar ini yang kemudian menjadi baik hanya sejumlah 25 persen.Bagian Tiga Data dan Angka Sebagai Indikator Janji terselesaikan atau proses pengadilannya belum tuntas. masa DOM di Aceh dan Papua. = = = Di Indonesia. = Berdasarkan survei Biro Kosultan Resiko Politik dan Ekonomi (PERC). dan lain-lain..2 juta anak laki-laki dan 871 ribu anak perempuan.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . ada sekitar 2. Misalnya.

menurut BPK. Namun. = Departemen Pendidikan Nasional diduga telah melakukan korupsi sebesar Rp 150 milyar selama tahun 2003. Padahal sebelumnya Indonesia berada pada posisi ke-6. belum termasuk hasil-hasil pemeriksaan atas perhitungan APBD propinsi/kabupaten/kota yang dimanfaatkan DPRD dalam pengawasan pelaksanaan APBD itu Pelanggaran BLBI merupakan yang terbesar. 15 persen untuk tenaga kerja. = Setiap perusahaan Indonesia harus mengalokasikan dana mereka 50 persen untuk bahan baku. Lembaga negara yang paling tinggi tingkat penyelewengannya adalah Kejaksaan Agung. Georgia. yakni Rp 144 triliun.8 persen. banyak kasus korupsi itu yang sulit diungkap. dengan persentase 51. korupsi seperti ini sering terjadi dan akan makin sering terjadi jika terus dibiarkan. Tajikistan. Republik Demokratik Kongo. = Dari nilai APBN 2004 sebesar Rp584 triliun. Pantai Gading.5 triliun. mencapai Rp 166. Menurut Lembaga Swadaya Masyarakat Peduli Pendidikan Bangsa yang melaporkan kasus ini ke penyidik Mabes Polri. Jumlah itu. 10 persen untuk biaya lain-lain. Posisi ini sama dengan Angola. = Penyelewengan uang negara yang terjadi di Indonesia antara 1999-2004. dan 15 persen lainnya Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . sebanyak Rp23 triliun telah dikorupsi.Bagian Tiga Data dan Angka Sebagai Indikator Janji = Transparency International pada akhir tahun 2004 menempatkan Indonesia pada posisi ke-5 negara terkorup dari 146 negara yang disurvei. Korupsi dilakukan sehubungan dengan pengadaan buku2 pelajaran matematika. dan Turkmenistan.

kualitas manusia Indonesia dari segi ekonomi. pendidikan. telah dikorup oleh pihak-pihak tertentu di Indonesia. = Menurut peringkat Human Development Index (HDI) 2004 yang dikeluarkan oleh United Nations Development Programme (UNDP). Artinya masih ada 40 persen atau sekitar 90 jutaan rakyat Indonesia terpaksa mempergunakan air yang tak layak secara kesehatan untuk kehidupan sehari-hari. = Survei terhadap 100 anak jalanan yang dilakukan Data Informasi Anak/YKAI menunjukkan hanya 10 persen anak jalanan yang pernah terjangkau oleh program penanganan. = Bank Dunia mengakui.Bagian Tiga Data dan Angka Sebagai Indikator Janji untuk biaya yang tidak bisa dipertanggungjawabkan alias pungutan liar. dan Filipina (83). Jika nilai 30 persen ini diasumsikanberlaku pada semua pinjaman ke Indonesia hingga kini. = Salah satu masalah kesehatan lingkungan yang belum terakomodasi adalah ketersediaan air bersih. Atau Brunei (33). Bandingkan dengan Malasya (58). baik yang dilaksanakan oleh pemerintah maupun oleh lembaga swadaya masyarakat. Ini berarti. 30 persen dari kredit mereka ke Indonesia. Hingga kini cakupan nasional baru mencapai sekitar 60 persen. Indonesia berada di peringkat 111 dari 175 negara. dan kesehatan berada pada posisi yang sangat jauh terbelakang.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . nilainya akan sangat luar biasa. Singapura (25).

= Indonesia sebagai salah satu negara dengan kondisi ekonomi miskin tengah ‘dibantu’ oleh lembaga-lembaga keuangan internasional (misalnya.2 persen. penderita AIDS di Indonesia Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Lebih tinggi dari tingkat pengangguran setahun sebelumnya yang hanya 9. Negara-negara tersebut memang ‘terbantu’. yakni 10. = Di tengah pertumbuhan ekonomi yang hanya 4 persen dan penerimaan negara yang pas-pasan seperti keadaan saat ini. Angka tersebut akan lebih mengerikan bila kita memasukkan jumlah pengangguran terselubung.Bagian Tiga Data dan Angka Sebagai Indikator Janji = Laut Indonesia sangat luas.Tetapi pulau-pulaunya tidak terawat.8 persen. atau mereka yang bekerja kurang dari 40 jam seminggu. tapi bukan menuju kemakmuran. rumah-rumah mewah tumbuh di mana-mana bak cendawan di musim hujan. = Tingkat pengangguran di Indonesia sepanjang tahun 2004 sudah berada pada batas mengkhawatirkan. Dari 17. 9634 ribu tidak bernama.504 pulau. melainkan menuju keterpurukan ekonomi yang panjang. pembangunan apartemen mewah terus menjamur. = Data terakhir menunjukkan. IMF). Negara-negara miskin seperti Kenya dan Ethiopea juga sudah ‘dibantu’ oleh IMF dengan memaksakan perdagangan bebas. ada jalan tikus yang hanya bisa dilewati oleh orang-orang tertentu dan tidak bisa dilewati oleh orang kebanyakan. justru impor mobil mewah terus mengalir. Bagaimana kita bisa mempertahankan pulau kita sementara nama saja kita tak punya. Distribusi kekayaan telah berlangsung tidak adil.

dikorupsi oleh negara-negara penerima. = Syarat lingkungan yang sehat bagi makhluk hidup di perkotaan semakin sering diabaikan. salah satunya oleh Indonesia yang merupakan peminjam terbesar.000 sampai 130. sedangkan positif HIV 2.000. Hotel Mariott Jakarta 5 Agustus 2003. = 30 juta dollar AS dari 105 miliar dollar AS yang pernah disalurkan Bank Pembangunan Asia (ADB) sejak lembaga tersebut terbentuk tahun 1996.413 orang.000. dan RRC hanya tujuh. misalnya.159 orang. banyak orang yang mengkhawatirkan akan ada bom susulan yang sama. Tiap tahun angka kematian ibu Indonesia mencapai angka 20. lebih besar atau bahkan lebih luar biasa besar dari bom yang pernah ada.Bagian Tiga Data dan Angka Sebagai Indikator Janji berjumlah 1.5 juta motor yang berkeliaran setiap hari menyebarkan zat beracun CO2.746 orang. dan di depan Kedutaan Besar Australia di Jakarta 9 September 2004. Sedangkan Sri Lanka hanya delapan persepuluh ribu. = Setelah bom di Kuta Bali 12 Oktober 2002. maka diperkirakan jumlah sebenarnya berkisar antara 90. Di Jakarta.3 juta mobil dan 1. Jumlah total orang dengan HIV/AIDS (ODHA) menjadi 4. CO. = Dibanding negara lain di Asia. angka kematian ibu di Indonesia masih relatif tinggi. Jumlah ini diperkirakan terus akan bertambah.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . yaitu 37 orang persepuluh ribu penduduk. Ada 10 juta penduduk dengan 2. Namun karena fenomena AIDS/HIV ini seperti gunung es.

Artinya. Masyarakat miskin di Indonesia jumlahnya 38. Namun. APM (angka partisipasi murni) hanya tinggi pada jenjang SD (92.Bagian Tiga Data dan Angka Sebagai Indikator Janji HC. Oman. Yakni 63. tapi fotonya sudah diganti dengan foto orang lain.9 persen (SLTP) dan 56.4 persen atau 17. Yakni. propinsi Papua menduduki ranking ke tiga terbanyak penderita Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . hingga kini akses memperoleh pendidikan belumlah merata. SPM dan debu dengan jumlah yang makin lama makin meningkat. = Menurut Asosiasi Pengerah Jasa Tenaga Kerja Indonesia Cianjur (APJATIC) hampir 70 persen tenaga kerja di lima negara Timur Tengah seperti Abu Dhabi.1 persen (SLTP) dan 28.5 persen (SMP) dan 40. sementara pada jenjang SMP dan SMA masih sangat rendah.5 persen).7 persen (SLTA).1 persen (SLTA) sementara di pedesaan hanya 54.6 persen dari total jumlah penduduk = Menurut Komisi Penanggulangan HIV/Aids Daerah (KPAD). dan Qatar (kecuali Kuwait dan Arab Saudi) merupakan tenaga kerja yang diberangkatkan secara nonprosedural. paspor dan identitas yang mereka pakai memang asli. masyarakat di perkotaan angka partisipasinya lebih tinggi dari masyarakat pedesaan. Bahrain. Jordania. Survei ini juga membuktikan. = Memperoleh pendidikan adalah hak asasi setiap warga bangsa yang dijamin konstitusi. = Kemiskinan masih menjadi faktor hambatan utama untuk mengakses pendidikan.6 persen (SMA). 71. Data terakhir dari Survei Sosial Ekonomi Nasional menyebutkan. NOX.

9 persen pelajar Indonesia terlibat narkoba. kelompok yang paling banyak mengonsumsi narkoba adalah kalangan mahasiswa (9. dan bodoh. hampir semua perusahaan HPH dan HTI terlibat korupsi eksploitasi kayu. 2.Bagian Tiga Data dan Angka Sebagai Indikator Janji HIV/Aids di Asia dengan jumlah angka mencapai 1689 kasus. dan SLTP (1. = Pemberlakuan otsus di Propinsi Papua dinilai telah gagal karena sejak digulirkan dengan kucuran dana mencapai triliunan rupiah.4 juta rakyat Papua masih hidup terbelakang. Negara yang paling diminati para penanam modal adalah Belgia. Rangking lainnya diduduki oleh Cina dan India. Otsus hanya dimanfaatkan oleh para pejabat Papua sebagai alat legitimasi melakukan KKN dengan mengobjekkan kemiskinan rakyat. hutan menjadi rusak dan negara dirugikan triliunan rupiah. Luksemburg. Korupsi dilakukan dengan 44 modus operandi dan melibatkan oknum pemerintah dan aparat.9 persen). = Berdasarkan hasil survei nasional terhadap pelajar dari tingkat SLTP hingga tinngkat perguruan tinggi. SLTA (4. Akibat korupsi tersebut. miskin. Dari tingkat pendidikan. = Hasil riset Indonesia Corruption Watch (ICW) dan Greenomics menyimpulkan. Badan Narkotika Nasional menyimpulkan 3. = World Investment Report 2004 menempatkan Indonesia di urutan ke-139 dari 144 negara yang paling diinginkan sebagai negara tujuan investasi di dunia.4 persen).8 persen). Indonesia hanya lebih baik daripada beberapa negara di Amerika Tengah serta Suriname. Sementara itu 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Pernyataan tersebut dikeluarkan oleh Papua Wacth dan Front Pemuda Papua. dan Brunei Darussalam.

= Pendidikan pada anak-anak usia dini terkesan diabaikan. Guru SD yang beralih mencari pekerjaan lain mencapai jumlah 50. yang melibatkan legislatif dan eksekutif di sejumlah daerah. = Menurut Indonesia Corruption Watch (ICW).3 persen. bahkan di tingkat Asia sekalipun. tidak satu pun perguruan tinggi di Indonesia masuk dalam 20 terbaik. guru SMP 28.6 persen. Thailand. Pelaku terbanyak adalah pihak eksekutif daerah (67 persen) dan anggota DPRD (33 persen). perguruan tinggi di Indonesia tidak ‘dihitung’ di tingkat dunia. yakni berusia 14 hingga 20 tahun. = Banyak guru pegawai negeri sipil yang beralih profesi sementara Indonesia masih kekurangan tenaga guru. dan guru SMA sebanyak 16. Berdasarkan peringkat universitas terbaik di Asia versi majalah Asiaweek.Bagian Tiga Data dan Angka Sebagai Indikator Janji temuan Tim Kelompok Kerja Pemberantasan Penyalahgunaan Narkoba Depdiknas tahun 2004 menyimpulkan. 70 persen dari 4 juta pecandu narkoba tercatat sebagai anak usia sekolah. Jawab Barat berada di peringkat pertama dengan 26 kasus disusul Jawa Timur (21 kasus). Padahal. ada 153 kasus korupsi. 2002). 1990 yang dipertegas lagi melalui Deklarasi Dakar-Sinegal (2000) dan komitmen World Fit for Children (New York. dunia internasional sudah menyepakati perlunya untuk memberikan perhatian terhadap masalah pendidikan pada anak-anak usia dini sebagaimana ditegaskan dalam komitmen Education for All di Jomtien. Jawa Tengah (15 kasus) dan Nanggroe Aceh Darussalam (15 kasus). Dari 153 kasus tersebut. Saat ini Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .4. = Dari segi mutu.

6 persen).9 persen) terlayani di SD.4 triliun untuk berobat ke luar negeri. setiap tahun WNI menghabiskan biaya sekitar 600 juta dolar AS atau senilai Rp 5. = Belum ada Keppres atau peraturan tegas yang melarang guru menjual buku pelajaran di sekolah. dan di Taman Penitipan Anak (0. = Berdasarkan hasil penelitian Efektivitas Pendekatan Keluarga Dalam penanganan Anak Jalanan Balitbang Departemen Sosial RI. buku teks wajib yang disubsidi pemerintah setiap tahun dengan dana ratusan miliar menjadi mubazir alias tidak berguna. Kelompok Bermain (0. Gaji profesor di Indonesia hanya Rp 2. = Karena tidak puas dengan penanganan rumah sakit di Indonesia.13 persen).Bagian Tiga Data dan Angka Sebagai Indikator Janji baru sekitar 28 persen anak usia dini. Mereka terlayani di Bina Keluarga Balita (9. jumlah anak jalanan yang tersebar di kota-kota besar di seluruh Indonesia diperkirakan mencapai lebih dari 40.4 persen).000 lebih rumah sakit swasta dan 600 lebih rumah sakit pemerintah.000 orang. Padahal. Padahal di Indonesia terdapat 1. 0-6 tahun yang terlayani pendidikannya. lainnya (9. Akibatnya. = Salah satu hal yang sering dituding sebagai penyebab rendahnya mutu pendidikan di Indonesia adalah rendahnya gaji pengajar. kegiatan seperti ini sudah berlangsung lama.4 juta.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Raudhatul Athfal (1. Taman Kanak-Kanak (6.5 persen).05 persen). hampir sama dengan gaji seorang supir busway di Jakarta yang Rp 2 juta per bulan.

000 jenis ikan hias air tawar dan laut atau 60 persen dari seluruh jenis ikan hias yang ada di dunia. = = = Indonesia memiliki sekitar 8. Dari hari ke hari jumlah kasus malpraktik kedokteran di Indonesia semakin meningkat.80 persen dari cakupan anggaran yang diperiksa (Rp 618 miliar). Hasil pemeriksaan BPK tahun anggaran 2004 terhadap lembaga atau departemen menyimpulkan. Akan tetapi. Menurut Bank Dunia. 70 persen dokter Indonesia tidak membuat medical record atau catatan medik perkembangan penyakit serta terapi yang pernah diberikan pada pasiennya. namun jumlah sekolah pertanian dari tahun ke tahun terus menurun. Jumlahnya mencapai 51. Pada tahun 1996 jumlah sekolah pertanian di seluruh Indonesia tercatat 200 sekolah. yakni sebesar Rp 320 miliar. di tahun 2004 jumlahnya menurun hingga tinggal 116 sekolah. Indonesia hanya mampu menutup 6 persen dari seluruh perdagangan ikan hias dunia atau senilai 182. tenaga medis tidak melengkapi pasiennya dengan medical record sehingga komunikasi dapat tetap terbangun antara dokter dan pasiennya.67 juta dollar AS. Salah satu penyebabnya adalah belum ditetapkannya prosedur standar operasional (Standard Operational Procedure/SOP) pelayanan kesehatan di rumah sakit. = Indonesia memiliki sumber daya hayati yang melimpah. Penyebab lain. yakni Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .Bagian Tiga Data dan Angka Sebagai Indikator Janji = Indonesia adalah negara yang banyak bertumpu pada bidang pertanian. Namun. penyalahgunaan uang negara paling banyak terjadi di lembaga Kejaksaan Agung RI.

dan keamanan yang tidak kondusif. kekerasan berbasis gender yang menimpa perempuan mengalami peningkatan dari tahun ke tahun. psikis.163 kasus dan tahun 2003 ada 5. 54 persen terjadi di lingkungan komunitas. Dari jumlah itu. Pada tahun 2004.934 kasus. dan sisanya berlangsung di lingkungan korban. peraturan yang berbelit. Bandingkan dengan Malasya. Dari jumlah tersebut. Pada tahun 2002 angka itu meningkat menjadi 5. Indonesia terus mengalami penurunan. Dalam bidang efisiensi bisnis. Pada tahun 2001 terdapat 3. fisik dan seksual. Namun kekayaan tersebut belum memberikan kontribusi yang signifikan untuk ketahanan pangan. tingginya pajak.Bagian Tiga Data dan Angka Sebagai Indikator Janji sebesar 16. jumlah pengguna internetnya telah mencapai 34 persen dari total jumlah penduduknya yang berjumlah 25.169 kasus yang dilaporkan ke Lembaga Bantuan Hukum APIK. Indonesia berada di peringkat 58 di antara 60 negara.6 juta orang. Indonesia masih terpuruk. penetrasi penggunaan internet di Indonesia kurang dari 4 persen dibandingkan total jumlah penduduk. Penyebabnya antara lain. pengaduan paling banyak menyangkut kasus-kasus tekanan terhadap perempuan berkenaan dengan masalah ekonomi. termasuk di dalamnya di daerah konflik bersenjata. = =  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Di bidang teknologi informasi. = Menurut Komnas Perempuan. pungutan liar di mana-mana.7 persen dari kekayaan dunia. Dalam bidang penggunaan internet misalnya.

mencapai 46.6 juta ha.7 juta ha. serta hutan produksi yang dapat dikonversi 5. hutan produksi terbatas 3. setiap bayi yang baru lahir pun sudah memiliki beban utang sekira Rp 7 juta. Kelompok Bermain.6 juta ha merupakan kawasan hutan. Untuk melayani penduduk yang jumlahnya 220 juta orang Indonesia hanya memiliki dokter sejumlah 45 ribu orang. terdiri atas hutan produksi seluas 7. dan Papua 7. yakni kurang dari 300 unit. Nusa Tenggara. Seluas 16.Bagian Tiga Data dan Angka Sebagai Indikator Janji = Jumlah dokter di Indonesia masih kurang. Kalimantan 14.500 triliun atau sekira 150 miliar dolar AS. seperti Taman Kanak-Kanak. hampir seluruhnya disediakan. Bina Keluarga Balita. luas kerusakan hutan dan lahan di seluruh Indonesia. Di Sumatera 16. Sulawesi 4. Jawa 4.8 juta ha. Dengan jumlah utang sebesar itu. Bali. Dari luasan tersebut. Perhatian pemerintah terhadap pendidikan anak usia dini terkesan rendah. = = = Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .8 juta ha di antaranya terletak di kawasan hutan produksi.3 juta hektar (ha). atau Taman Penitipan Anak.2 juta ha. dikelola dan dibiayai oleh masyarakat sendiri.2 juta ha.0 juta ha. Dari sekitar 5. Pemerintah hanya menyediakan sebagian kecilnya. 22. Maluku. Berdasarkan data Badan Planologi Departemen Kehutanan. dan sisanya di luar kawasan hutan.3 juta ha. Utang luar negeri Indonesia kini sudah mendekati Rp 1. tetapi memiliki dokter sebanyak 67 ribu orang. Bandingkan dengan Kuba yang penduduknya hanya 12 juta.3 juta ha.000 unit lembaga pendidikan anak usia dini yang ada saat ini. baik utang pemerintah maupun swasta.

Bagian Tiga Data dan Angka Sebagai Indikator Janji = Menurut data WHO. 140 ribu di antaranya meninggal dunia. angka kebutaan di Indonesia menduduki peringkat kedua dari 11 negara Asia. Contohnya.5 persen dari jumlah penduduk.6 juta jiwa atau 1. Dari 32 kasus pada tahun 2002 menjadi 283 kasus pada tahun 2003. Seandainya 1 orang pasien bisa menularkan ke 10 orang. kasus pendistribusian minyak goreng. kasusBLBI. Masalah TBC masih menjadi problema serius di Indonesia. dan masih banyak lagi. kasus proyek Hutan Tanaman Industri di Sumatera Selatan. dari 583 ribu kasus TBC di Indonesia. kasus Kanindotex. sementara di Solo dilaporkan ada 15 kasus perdagangan anak untuk tujuan seksual komersial. kasus perdagangan perempuan di Indonesia mengalami lonjakan sebanyak 880 persen.8 juta orang. Jumlah penduduk Indonesia yang mengalami kebutaan kini berkisar 1. Ini belum termasuk kasus yang langsung dilaporkan pada polisi atau merupakan temuan kepolisian. proyek Technical Assitance Contract (TAC) antara Pertamina dan Perta Oil. pada tahun berikutnya jumlah yang tertular TBC adalah 5. Ada sejumlah kasus korupsi di Kejaksaan Agung yang dihentikan penyelidikannya atau tersangkanya terkatungkatung terkatung-katung tanpa ada penyelesaian dan kejelasan. dan setiap satu menit diperkirakan terjadi satu kasus kebutaan baru. Menurut data Rumah Sakit “Prof DR Sulianti Saroso”. Jika dihitung rata-ratanya. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? = = =  . Data terakhir menyebutkan. hampir setiap hari ada 425 orang meninggal akibat TBC. Sebuah LSM di Batam menemukan 166 kasus perdagangan perempuan. setiap tahun. kasus pipanisasi di Pulau Jawa. kasus dana pinjaman Bahana Pembinaan Usaha Indonesia.

Akankah akan ada perubahan dalam masa pemerintahan SBY-JK? Kita lihat saja nanti: • • • • • • • • • • • • Jumlah penduduk miskin: 37.572 per dollar AS Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Jumlah kematian bayi: 35 per seribu kelahiran hidup Jumlah kelahiran: 2.Bagian Tiga Data dan Angka Sebagai Indikator Janji Data dan Angka Warisan Megawati egawati yang menjadi Presiden RI selama tiga tahun sejak 21 Juli 2001 dalam pidatonya di depan Sidang MPR (23 September 2004) mewariskan data dan angka berikut untuk SBY.3 juta orang (17.3 miliar dollar AS Pertumbuhan ekonomi: 4.6 anak per wanita usia produktif M Jumlah kematian balita: 46 per seribu kelahiran hidup Angka harapan hidup: 66 tahun Jumlah kematian ibu: 307 per seratus ribu kelahiran hidup Jumlah perempuan yang “melek” huruf: 87 persen Angka partisipasi sekolah kelompok umur 7-12 tahun: 95 persen Angka partisipasi sekolah kelompok umur 13-15 tahun: 80 persen Cadangan devisa: 36.1 persen Nilai tukar rata-rata rupiah: Rp 8.4 persen dari seluruh penduduk Indonesia).

6 miliar dollar AS Pendapatan per kapita : 1.Bagian Tiga Data dan Angka Sebagai Indikator Janji • • • • • • • Defisit APBN: 2.1 miliar dollar AS Nilai impor: 32.1 persen Pertumbuhan impor: 5 persen Nilai ekspor 61.000 dollar AS  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .1 persen dari produk domestik bruto (PDB) Stok Utang Pemerintah: 69 persen dari produk domestik bruto (PDB) Pertumbuhan ekspor: 5.

Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

Bagian Empat Dari Mereka yang Menunggu Realisasi Janji 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .

Nanti setelah ada pemilu dan dia mencalonkan diri lagi.com Pengamat. Tentu saja rakyat tak biasa berbuat apa-apa. kasihan dong dia. Kasihan Dong…! Saya cuma berharap. sungguh di luar dugaan. kebalikannya yang terjadi. Hasilnya. Untungnya. banyak pemimpin yang pada masa kampanye berjanji membela rakyat dengan mulut yang berbusabusa. Aru Sagala arusagala@yahoo. Di berbagai negara. ia akan kembali melontarkan janji-janjinya membela rakyat dengan mulut yang berbusa-busa. saya berhasil mendatanya secara detail. Kalau mulut terus-terusan berbusa-busa.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Dari Mereka yang Menunggu Realisasi Janji ”Apa yang ada harapkan dari janji dan komitmen SBY-JK?” ini adalah pertanyaan yang saya lontarkan di berbagai mailing list internet maupun pertanyaan secara langsung. Rakyat yang ditekan dan diperas. komentar dan opini yang masuknya jumlahnya mencapai angka ribuan. Gorontalo Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . pemimping akan bersikap otoriter. Berikut adalah beberapa komentar dan opini pilihan yang saya anggap layak untuk dimuat di sini. dengan bantuan Studio KataKata (Pusat Informasi dan Data Bisnis). Di saat rakyat memaksa diri untuk berbuat apa-apa. Tapi begitu terpilih. SBY tidak jadi pemimpin yang otoriter nantinya.

Malu loh Pak. Saya adalah salah satu orang yang tidak bisa menikmati pendidikan sampai selesai. Mereka lebih bangga dengan pendidikan di Malaysia. Saya cuma SMA. Padahal.com Bukan Cuma Retorika Moga-moga tekad SBY soal perubahan bukan cuma retorika doang. saya menulis surat ini. saya sering dengar. Harus ada bukti kongkrit. waktu pemilu kemarin saya golput. kalau ngobrol dengan teman-teman yang kuliah di luar negeri. Soalnya. dan lain-lain. Saya belum lulus kuliah. jadi saya hanya bekerja sesuai dengan kemampuan minimal saat ini. Semoga bapak berkenan membacanya. Saya bekerja sebagai reporter infotainment (Pak SBY pernah nonton infotainment ga sih?). Harapan saya dari janji-janji Pak SBY-JK. terpaksa saya berhenti dan kemudian bekerja. hanya satu. Tolonglah pendidikan benar-benar diperdulikan seperti janji-janjimu.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Sepotong Surat Pak SBY-JK. Malaysia belajarnya dari indonesia ya. Amerika. saya sempat kuliah tapi karena ketidakadaan biaya. sering baca semua janjijanjimu. Itulah sebabnya. Pak? Sekian saja harapan saya. Terus terang. Syarat standar pekerjaan adalah memiliki ijazah S1. Singapura. biasa dipanggil Memez. Heidy Prameswari Suharto heidy_suharto@yahoo. Sekarang umur saya 21 tahun. Nama saya Heidy Prameswari Suharto. waktu dulu. saya pesimis akan ada pemimpin yang benar-benar perduli soal pendidikan. Rakyat yang sudah mendukungnya Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

persatuaan dan kesatuan. Jangan sampai rakyat dibegitukan deh. biasanya akan dengan mudah tertiup angin. pemerintah yang baru hasil demokrasi yang jujur dan adil ini. Demi pemerintahan yang sehat. rakyat yang kecewa. bukan sekedar janji.org Demi Kepercayaan Menyimak janji-janji Pak SBY-JK.com Makassar Tak Banyak Berharap Tak banyak harapan saya dari janji-janji SBY-JK. Tapi masih ada setitik harapan: semoga semakin tinggi penghargaan dan komitmen seluruh bangsa atas nilai-nilai dasar ketuhanan. Kurnia Bintang kurniabintang@yahoo. Resweet Kurniawan resweet@linuxmail. Sebab. kepercayaan yang telah kami (rakyat) berikan besar sekali. Janji-janji yang tidak didukung dengan perencanaan yang konkrit. Berputar-putar di udara dan kemudian terhempas di suatu tempat yang entah di mana. kebenaran dan keadilan. kemanusiaan. Kita mempuyai SDM dan SDA yang melimpah ruah. aku cuma berharap. dapat mengatasi pengangguran dengan cepat dan tepat. maka akan sangat disayangkan. Pada akhirnya. Jika tidak bisa mengoptimalkannya dalam lima tahun pertama. Gunakan sumber daya yang ada.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji ingin bukti. jangan terlalu berharap pada negara lain. Perlu adanya pemaparan perencanaan yang detil dan jelas. kami percayakan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

Konflik bisa dan akan terus terjadi jika tak ada Undang-undang atau Keppres yang mengatur hal ini secara tegas. mohon hendaknya diperhatikan soal penerimaan PNS. Jadi. si Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . agar pembakaran dan pengrusakan rumah ibadah tidak terjadi lagi. Berjuang dengan berlandaskan hati nurani.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji kepadamu wahai presiden dan segenap wakil rakyat.uk Pekerja web design dan multimedia Denpasar Bidang Keamanan Saya banyak berharap janji-janji di bidang keamanan. Jangan sampai kita mencari keadilan tetapi yang kita dapat malah ketidakadilan. Setelah diterima. jangan mengecewakan rakyat yang telah memilih. Juta july_910000@yahoo.Th.co.id Pendeta. Kami mencatat janji-janjimu. Di situ sering terjadi sogok menyogok. S. sebagai lulusan di bidang hukum dan kini bekerja sebagai legal officer di salah satu perbankan. kita malah kehilangan sapi. Yakub Sulistyo. Jangan karena melaporkan kehilangan kambing. Selain itu. Pak SBY-JK. menaruh harapan serius atas janji-janji di bidang hukum. Saya tunggu janjijanjimu. Saya. MA yakub@indo. Ambarawa Kami Mencatat Saya menaruh harapan kepada Bapak SBY-JK.net.

Reynhard Parulian traja661973@yahoo. sesudah itu pahitlah yang kita dapat. Sekuat apapun upaya yang mereka lakukan. Pahitlah Sesudahnya Janji-janji harus ditepati. Segala macam bentuk korupsi harus ditumpas.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji pegawai akan melakukan korupsi untuk mengganti uang sogokan yang telah ia berikan. Jangan dulu berkeliling dunia untuk menghamburhamburkan uang rakyat. rasanya tidak mungkin.go. korupsi akan tetap ada. Dalam upaya memberantas eh meminimalisasi korupsi.com Pegawai Swasta. Di negera-negara lain. Perhatikan rakyat kecil. Itu saja. Usahakan mengurangi hutang-hutang negara sehingga rakyat tidak menderita menanggung beban hutanghutang itu. Yang mungkin adalah meminimalisasi seminim mungkin terjadinya korupsi.id Tidak Mungkin Untuk memberantas korupsi. saya berharap SBY-JK berhati-hati dengan muka-muka manis yang berada di sekelilingnya. Turunkan harga sembako agar rakyat kecil bisa hidup dengan penuh gizi. Jakarta Manis Waktu Kampanye. Jangan hanya manis waktu berkampanye saja. Leo Leo@dprin. seperti janji SBY-JK. Buktikan terlaksananya pendidikan berbiaya murah. hal ini pun berlaku. Kelompok lingkaran dalam (inner circle) ini sering Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

saya sedih sekali jika melihat berita-berita di TV seputar dunia kriminal. di masa kepemimpinan Pak SBY hukum akan benar-benar ditegaskan sehingga akan mengurangi berbagai tindak kejahatan. tersangka Bom Marriot hanya dihukum tga sampai 10 Tahun.di beritakan di televisi. Semakin hari semakin banyak kejahatan khususnya pemerkosaan dan pembunuhan terhadap anak dibawah umur. Saya berharap.enak sekali. Dan tersangka paling-paling dijerat hukuman maksimum lima tahun penjara.. mengenai kasus bom yang sedang melanda Indonesia. mereka bisa jadi penghambat terwujudnya janji-janji SBY-JK kepada rakyat.co. Orang akan berpikir dua kali untuk melakukan tindak kejahatan apabila ada hukum yang tegas. Eunike Tina Astuti tina@beringin. Pengalamana sudah membuktikan. setelah keluar pasti mereka akan melakukan hal serupa.id Salatiga  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Waspadalah! Noval Alamrie novalalamrie@yahoo. Apakah itu adil ? Setelah diperkosa lalu dibunuh secara sadis?Apakah hukum di Indonesia hanya sebatas itu ? Kedua..Bagian Empat Dari Mereka yang Menunggu Realisasi Janji saya lihat dalam tayangan-tayangan televisi selalu berada di sekitar SBY-JK dalam berbagai acara.com Bekasi Realisasi Janji Ada dua hal realisasi dari janji-janji Pak SBY yang akan selalu saya tunggu: Pertama.. Jika tak hati-hati. Saya berpikir. salah satu presiden kita terjungkal gara-gara adanya lingkaran dalam seperti itu..

Mengenai korupsi.co. saya melihat diskriminasi yang identik dengan minoritas. berbagai hal akan menjadi baik. ternyata masih menjadi satu bagian yang tidak bisa dilepas oleh masyarakat Indonesia. Jangan bersandar pada materialitas. Padahal. Jadi. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . semua pasti tahu bahwa KKN adalah salah satu penyakit kronis di republik tercinta ini. Apakah janji ini juga menyangkut penghapusan diskriminasi dalam kehidupan beragama? Soalnya. Bidang ketenagakerjaan pun perlahan tapi pasti akan bisa teratasi. bahwa agama adalah hak setiap manusia. Semoga dengan penghapusan hal-hal yang berbau diskriminasi. hak setiap individu. Jarot Mulyawan jarot@danwood. Jika itu terwujud. Tanggung jawab pemerintalah untuk menciptakan kondisi yang tidak memihak.id Karyawan di Semarang Kehidupan Beragama Saya menunggu janji SBY-JK untuk menghapus kebijakan yang bersifat diskriminasi. Sudah tidak terhitung lagi kerugian yang diakibatkannya. Aparat negara tidak bisa lagi seenaknya menyelewengkan kekuasaannya dalam mejalankan wewenangnya. mentalitas dan moralitas aparat penegak hukum harus diluruskan dulu. Yang penting. kita bisa hidup rukun dan damai walaupun berbeda agama. Kalangan bisnis akan mempunyai keyakinan lebih dalam berinvestasi. sudah selayaknya dibasmi. khususnya di bidang kehidupan beragama. saya hanya berharap: penegakan hukum bisa segera direalisasikan.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Penegakan Hukum dan Penyakit Kronis Dari janji-janji SBY-JK.

.. berani...bahkan di Departemen Agama? Maka wajar jika kita mengalami krisis yang berkepanjangan. Kejaksaan Agung dan Mahkamah Agung termasuk juga di kepolisian. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  ..Allah telah menghukum kita.. baru kita bicara yang lain.. dsb. Sunaryadi Sunaryadi@conocophillips... tidak mementingkan dunia (bisa dilihat dari kehidupan sehari-harinya termasuk harta yang dimiliki).Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Sebagai pemimpin. taat beragama. Bandung Dulu Juga Begitu Saya jadi ingat jaman dulu.Begitu pula dengan ekonomi. Surabaya Supremasi Hukum Tak perlu terlalu banyak berharap dari janji-janji. Yang penting.com Karyawan.. kesehatan. tegakkan terlebih dahulu supremasi hukum di Indonesia. Pertama-tama. Pilih orang-orang yang track recordnya bagus. di lingkungan peradilan. nonpartisan (di luar orang partai)... pendidikan.Berapa banyak dana bantuan yang bocor.. karena kita tidak berani menindak orang yang salah. tugas merekalah untuk memberi teladan kepada masyarakat Indonesia.com Sekretaris. Kalau hukum sudah tegak. Sekitar 36 tahun silam Soeharto berjanji akan memberangus korupsi yang disisakan rezim Soekarno. Penuntasan korupsi lemah karena hukum yang tidak berjalan. Ririn Teguh Setyowati ritesnts@yahoo.

Tidak jarang para isteri kehilangan suami dan kemudian menjadi orang tua tunggal dalam kondisi yang tidak siap. Sehingga 36 tahun berikutnya. Kalimantan Barat. Eko Yanche Edrie ekoyanche@yahoo. Khususnya bagi perempuan dan anak. Semua itu dapat menghambat hubungan psikososialnya yang dapat berakibat ketidakmampuan mengasuh anak-anaknya dengan baik. tak perlu ada anak cucu yang menulis seperti saya ini. termasuk pemberdayaan perempuan serta dukungan permodalan tanpa agunan.sg Padang Perempuan dan Anak Perempuan dan anak-anak adalah korban yang paling menderita karena adanya konflik yang terjadi di beberapa daerah di Indonesia. Yang terjadi kemudian adalah korupsi menjadi lebih ‘aman’ dilakukan sepanjang kekuasaan Soeharto.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Kita pun menunggu penuh harap. kehilangan harta benda untuk modal usaha.com. Di Aceh. hendaklah harapan yang tersisa 36 tahun silam itu diwujudkan. dan menderita trauma pasca konflik. Maluku dan Papua. Poso. Tiga presiden sesudahnya juga menjanjikan hal yang sama. kami mengharap agar dalam 100 hari pertama pemerintahan SBY-JK ada kebijakan dan program pemulihan trauma pasca konflik. entah apa yang akan terjadi. Sesuai janji. Kini SBY-JK naik ke tampuk kekuasaan. Kekurangan pendidikan dan keterampilan. Sehingga ibu-ibu. Andai saja masa jabatan ketiga presiden itu sepanjang masa jabatan Soeharto pula. Maluku Utara. khususnya yang terpaksa berfungsi Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

Firman Z. ada tiga aturan yang saya harap bisa dilakukan oleh SBY-JK. mampu bekerja dan berusaha untuk kehidupan keluarganya. Saya sangat berharap pemerintah akan benar-benar dapat 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . siap sebagai generasi penerus bangsa.id Pegawai. tentang bagaimana hukum ditegakkan tanpa pandang bulu. Camil firman_camil@singgar-mulia.co. SBYJK harus takut kepada Allah SWT.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji sebagai orang tua tunggal. Kedua. Parjoko Midjan parjoko_m@yahoo.com Depok Tiga Aturan Demi terwujudnya janji-janji perubahan. tetapi tetap menjadi anak Indonesia yang cerdas dan ceria. pertama. Ketiga. sehingga semua anggota kabinetnya akan mengikuti langkah mereka. Yakni. Jakarta Sedikit Masukan Saya ada sedikit masukkan sehubungan dengan janji-janji SBY-JK. bahkan kalau perlu anak presiden pun jika bersalah harus dihukum. dengan menjalankan semua perintah dan laranganNya. Kepada anak-anak di daerah konflik mohon diberikan pendidikan khusus tanpa biaya sehingga mereka tidak menjadi ‘lost generation’. SBY-JK harus berani memberi contoh kepada kita rakyat Indonesia. SBY-JK harus berani memberikan contoh tentang penerapan pola hidup sederhana dan kehidupan yang bersih dari KKN.

Modal itu sendiri bukan hanya berupa uang ataupun barang.sg Programmer. terutama masyarakat golongan menengah ke bawah. Hary hary_jkt@yahoo. Dan sebaiknya pemberian modal ini tidak hanya diberikan begitu saja. Jakarta Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . harus ada pengembangannya. Saya juga berharap agar pemerintah menggunakan uang pajak dengan bijaksana sehingga Indonesia menjadi lebih maju dan masyarakatnya tidak lagi segan membayar pajak. Andre Prasetya saikyo_kun@yahoo. sehingga mereka bisa terlepas dari ketergantungan orang lain. maka para pedagang tersebut harus terus dibimbing hingga akhirnya ia mampu mengembangkan usahanya dan tidak berketergantungan pada pemerintah lagi.com Jakarta Lebih Merata Ada janji berarti ada harapan. tetapi bisa berupa pendidikan keterampilan ataupun tempat usaha. Semoga negara ini suatu saat nanti dapat melaksanakan amanat UUD ‘45 dan memiliki pemerintahan yang sungguh-sungguh bekerja untuk melayani dan melindungi masyarakatnya. misalkan jika pemerintah memberikan modal berdagang. Mungkin bisa dengan cara penyediaan lapangan kerja yang seluas-luasnya atau dengan pemberian modal untuk berwirausaha. ketika saya berangkat di pagi hari ataupun pulang di malam hari tidak ada lagi anak-anak dijalanan yang mengamen dan meminta-meminta untuk mencari makan dan untuk membayar sekolah mereka sendiri. tetapi juga di seluruh kota lain di Indonesia.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji membantu perekonomian masyarakat secara merata. Semoga saja suatu saat nanti. Tidak hanya di Jakarta saja.com. Saya hanya berharap agar pembangunan bisa lebih merata.

orang seenaknya berjanji. pakaian dalam -atau apapun yang bisa dilepaskan -. topi.  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . saya berharap pemerintahan mereka juga memperhatikan masalah perbukuan. Kalau bisa. Abdi sae24x@yahoo. anggota kabinet. Dengan begitu. Sementara itu. ketua MPR. celana. wakil presiden. karena penerbit harus memberikan diskon yang besar ke toko buku. penerbit kesulitan untuk memberikan royalti yang pantas untuk pengarang. apa ruginya. karena hal itu akan menambah mahal biaya produksi dan ujung-ujungnya harga buku menjadi lebih mahal lagi. Untuk itu. Malangnya. Saeno M. dialah yang merubah. selalu (3X) pikirkanlah akibatnya dari kacamata rakyat kecil. Apa untungnya. lepaskan baju.haruslah independen dan senantiasa profesional. semua itu akan menyebabkan kaum cerdik pandai kita malas untuk sungguh-sungguh menulis sesuai bidang ilmunya untuk dijadikan sebuah buku. dan lain-lain-. biarlah rakyat yang menanggung untung. kami rakyat kecil yang menderita. Dalam setiap kebijakan dan keputusan. “conflict of interest” yang selama ini menjadi cikal bakal lahirnya KKN dapat dihindari. Jangan sampai. wakil ketua MPR. Buku mahal karena harga kertas mahal. Semuanya -.presiden.yang ada hubungannya dengan partai atau golongan.com Karyawan Perusahaan Penerbitan Jakarta Harus Independen Tak ada lagi yang kami inginkan selain terjadinya perubahan.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Masalah Perbukuan Guna terwujudnya janji-janji SBY-JK. Siapa yang berjanji. saya menyarankan. cincin.

tenang. Hanya itu. aman.id Jakarta Tidak Muluk Saya tidak muluk-muluk mengharapkan janji yang mulukmuluk. Berbagai jurus lamaran sudah saya keluarkan. keamanan terkendali. Capek memang. Sudah lima tahun deh predikat itu saya emban. agar nasib rakyat kecil seperti saya dan yang lainnya bisa menjadi makmur. Sebagai sales. Jangan sampai yang terjadi justru sebaliknya seperti yang selama ini kami alami. supremasi hukum tidak pandang bulu. tapi setiap diterima bekerja. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Padahal. dan damai. RozalMaas Rozal. Karawang Sedang Terpekur Saya adalah seorang pengangguran yang kini sedang terpekur menanti bukti dari janji-janji. Dan ini dia. saya hanya ditempatkan sebagai sales. saya sama sekali tidak berbakat di situ. Jauh sebelum cahaya kehidupan (yang masih berupa janji-janji itu) datang. saya memang sudah menganggur. tapi apa mau dikata. Indonesia bebas dari KKN.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji dan pejabatlah yang menanggung ruginya.Maas@petrochina. Saya cuma berharap perekonomian kita bisa normal lagi sehingga pengangguran menjadi berkurang dan kejahatan menurun. maka saya harus mencari pelanggan.net Programmer.co. tak ada harapan yang muluk-muluk! Trisna Mukti Andri precon@telkom. Padahal umur saya sudah hampir 30 tahun. berbagai cara sudah saya lakoni.

janji-janji untuk menuntaskan masalah pengangguran dan membuka lapangan kerja baru.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji banyak orang tak tahu susahnya mencari pelanggan sama susahnya dengan mencari pekerjaan itu sendiri.com Mahasiswa dan aktivis kampus Semarang  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .setia pada kebenaran. Sebenarnya. ya saya kembali lagi jadi pengangguran. M. saya menaruh harapan banyak pada era presiden-presiden sebelumnya. pers akan menggonggong jika ada kebijakan yang menyimpang dari janji dan komitmen. Akibatnya. Ibarat anjing pengawas.. Idris Azmi jogloku@yahoo. Dan sebagaimana lazimnya anjing. Romi Irwanto tom_irawan@yahoo. Terus-terusan jadi pengangguran deh. pers akan mengawasi jalannya pemerintahan. Pak SBY-JK. uang negara yang bertrilyun2 rupiah hanya habis untuk membiayai berbagai perseteruan antarsaudara kita sendiri. Alangkah bijaknya jika anggaran sebanyak itu diberikan saja kepada kaum pengangguran seperti saya untuk dijadikan modal memulai sebuah usaha mandiri. Kami tunggu. Untuk rapat MPR-DPR saja bisa habis bermilyar-milyar rupiah.. Tapi apa mau dikata. Belum lagi untuk biaya berbagai kunjungan kerja yang kita sendiri tak tahu untuk apa dan apa hasilnya. merupakan cahaya bagi saya. pers juga adalah makhluk yang setia.com Kebebasan Pers Terima kasih untuk janji kebebebasan pers. bagi 40 juta rakyat Indonesia yang sama statusnya seperti saya.

berhitung sederhana (tambah. saya ingin menceritakan pengalaman saya. Seringkali saya menemui kondisi di mana calon karyawan sama sekali tidak mengetahui tuntutan dunia kerja. Saya bukanlah pemerhati masalah pendidikan.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Mutu Pendidikan Mencermati janji-janji SBY-JK mengenai mutu pendidikan. Kalimat klise yang paling sering diucapkan adalah. Padahal dunia kerja/usaha lebih membutuhkan orang untuk mengerjakan pekerjaan rutin dasar semacam peng-arsip-an yang efisien (baik secara manual maupun komputerisasi). pencatatan dan pengumpulan data yang akurat dan cepat. namun saya berpengalaman dalam proses seleksi penerimaan dan evaluasi karyawan. menulis memo/instruksi dengan bahasa sesederhana dan sesingkat mungkin. Apapun yang mereka pelajari di sekolah. Sesudah beberapa saat bekerja. bagi dan persentase). baik SMU. jika orang tersebut memang mampu. dll. cukup Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . terkesan hanya untuk tujuan nilai ujian saja. kali. kurang. yang membutuhkan ketrampilan analisa data dan pengambilan keputusan untuk memecahkan masalah.” Cukup banyak lulusan baru berpikiran bahwa bekerja/ berusaha di dunia nyata membutuhkan keahlian dan pengetahuan yang sangat khusus. Jika diwawancara. tapi saya bersedia belajar. kontrol monitor jadwal. akademi. “Saya tidak berpengalaman. maupun universitas. sehingga untuk keahlian dan pengetahuan umum pun mereka tidak berusaha untuk mencari tahu atau belajar sendiri. jawaban yang diberikan terkesan sangat pasrah dan pasif. yang memang lebih mengutamakan pengalaman praktis daripada penghapalan dalil. Analisa data bahkan tidak membutuhkan ketrampilan canggih dengan komputer. maka ia akan masuk ke tingkat yang lebih tinggi. Saya merasa dari tahun ke tahun belum ada peningkatan mutu secara nyata lulusan sekolah Indonesia.

demi adil dan meratanya apa yang bapak putuskan. jangan kompromi Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Bapak tidak sakit dan kaget-kagetan. agar bapak tidak tersesat atau menyesatkan diri. sehingga kami yang dipimpin juga dapat keluar dari kesesakan hidup yang semakin membelit. seperti kami rakyat kecil yang sering terkaget-kaget oleh perilaku para politikus. Rajin berdoa ya Pak. Yang sungguh saya tidak mengerti untuk ketrampilan semacam ini kenapa tidak pernah mereka dapatkan dari masa sekolah yang bertahun-tahun itu? Apa sebenarnya yang dititik-beratkan di dalam pembelajaran di sekolah? Tidak adakah tuntunan dari para guru agar siswa mampu belajar sendiri? Bukankah seharusnya pembelajaran yang baik menunjukkan jalan bagaimana seseorang bisa menimba ilmu/ketrampilan dari berbagai sumber? Sungguh saya tidak mengerti. Saya tidak ingin mendengar janji yang mulukmuluk sebelum ketrampilan dasar lulusan sekolah kita (menghitung. menulis.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji mengerti arti angka-angka terhadap kinerja bagiannya. Setiap waktu mohon kiranya Bapak membawa neraca atau timbangan. sehingga dalam memimpin bangsa yang sakit ini. Karsa Nugraha karsa_nugraha@yahoo. sehingga dalam memutuskan sesuatu dapat menimbang untung ruginya bagi bangsa ini. Kami rakyat kecil mengharapkan agar Bapak sehat lahir dan bathin. menyampaikan pikiran secara lisan) belum juga bisa dibenahi.com Manager di sebuah perusahaan Tidak Sakit Pak SBY-JK yang suka berjanji.

Beli pesawat untuk melakukan pengintaian. termasuk industri rumahan/kerajinan tangan (bukan industri yang mengotori alam).Bagian Empat Dari Mereka yang Menunggu Realisasi Janji dengan membagi-bagikan kekuasaan yang kami berikan hanya untuk Bapak berdua. Dan jangan lupa. berdayakan petani (bukan petani berdasi) sambil mengembangkan koperasi. menitipkan masa depan anak cucu kami hanya ke tangan Bapak. Stop ekspor hasil hutan (khususnya dalam bentuk kayu gelondongan atau barang mentah).com Bumi Serpong Damai Belum Cukup Terjanjikan Rasanya. Kelola hutan dengan baik. Ingatlah. Jadikan alam kita pusat konservasi dunia. bapak SBY-JK bisa menyediakan anggaran untuk menjaga lautan kita agar terhindar dari pencurian ikan dan hasil laut oleh nelayan asing. didiklah personil agar benar-benar terampil dalam bidangnya (bukan terampil dalam bidang-bidang yang tak diridhoi Tuhan). soal kelautan belum cukup terjanjikan. Eksploitasi hutan hendaknya dengan mempertimbangan kelestarian lingkungan. Jangan gentar oleh ancaman dan bujuk rayu para politikus dan pengusaha yang meminta jatah. Targetkan bahwa ekspor kita di masa depan hanya dari hasil laut dan pertanian serta industri. Rudy Ismail rudyismail@yahoo. Hal lain. Tapi saya tetap berharap. Kita “tukar” oksigen Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . kembangkan industri pertanian. hijaukan gunung dan bukit. juga kapal dan peralatan yang memadai untuk lautan kita yang begitu luas. jadi Bapak-lah yang berhak memutuskan siapa dan apapun yang harus dilakukan untuk bangsa ini.

Di atas itu semua.p’[ Hanya Ini Guna membantu SBY-JK membuktikan janji-janjinya. agama.. Di tempat kerja saya misalnya.. saling tolong-menolong tanpa melihat status. kami yang mayoritas kebanyakan berada pada level ekonomi kelas menengah ke bawah. pilih pejabat yang berintegritas tinggi (highest integrity). hanya ini yang bisa saya sarankan:  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .co. buruh tani. Begitupun masalah fasilitas dan penghargaan. budayakan hidup sederhana. suku. dan sebagainya yang berasal dari golongan kami yang masyoritas.Salam Asalam@exspan.duh betapa indahnya! l. kuli. seandainya tak ada diskriminasi.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji dengan komoditi yang berguna (bukan barang mewah). gaji kami yang mayoritas lebih kecil daripada yang minoritas.. betapa indahnya hidup ini. saling menyayangi. Padahal. jadilah panutan dan contoh bagi bawahan dan rakyat banyak. kami yang mayoritas selalu mendapat bagian yang lebih kecil. Saling menghargai. A. Teramat banyak anak jalanan. Dalam kehidupan sehari-hari. Padahal kami yang mayoritas pun sering mengalami hal yang sama.id Depok Saling Menyayangi Janji-janji SBY-JK soal diskriminasi pembelaannya terasa lebih menyentuh ke kalangan minoritas. bahkan teramat memedihkan.

hukuman mati pun pantas dijalankan seperti halnya hukuman mati untuk para pengedar narkoba. kontrak untuk pekerja diberikan bagi WNA. beri ganjaran yang setimpal. dan disiplin pada saat di jalan raya. Kesejahteraan para guru harus juga harus diperhatikan mengingat jasa-jasa dan pengabdian mereka yang tidak kecil. taksi. metromini. Untuk maling-maling alias koruptor. Pendidikan harus murah. Fuad El Khair jagoanlontonk@yahoo. Semoga SBY-JK dapat menjalankan pemerintahannya sesuai dengan aspirasi Rakyat Indonesia yang telah jatuh lunglai selama ini. Bangsa takkan maju jiku hukumnya tidak ditegakkan secara benar dan arif. Bidang sosial: buka lapangan kerja seluas-luasnya.com Wiraswasta. dan lainnya diwajibkan untuk mengikuti uji kelayakan. hal itu hanya diberlakukan bagi kaum yang mampu. ijin mengemudi para supirnya. Angkot. Jika memang terbukti korupsi dan sangat merugikan rakyat. Bidang hukum: tegakkan hukum setegak-tegaknya.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Bidang pendidikan: utamakan kaum yang tidak mampu untuk mendapatkan pendidikan gratis. jika pun mahal. Hilangkan sistem kontrak bagi WNI. terutama untuk wilayah Jabotabek. kopaja. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . baik dari segi keamanan kendaraan. Jakarta Harapan Besar Saya adalah salah satu dari 60 persen masyarakat Indonesia yang menaruh harapan besar pada janji-janji SBY-JK. Bidang transportasi: Kurangi kendaraan umum. Saya berharap.

dan tidak ada lagi korupsi. Kalau ternyata semua itu tidak terjadi. Buatlah Indonesia berlandaskan hukum dengan masyarakatnya yang mematuhi hukum. Buatlah landasan yang kuat bagi Indonesia secara ekonomi dan militer. bukan janji. baik hukum negara maupun hukum agama yang dianutnya. kami mohon bukti. apapun bentuknya. Hapus kemiskinan dan ciptakanlah masyarakat yang berkecukupan dan berpendidikan. tidak ada lagi kolusi. Jangan cuma janji lagi. Sungguh saya tidak ingin mendengar dan melihat yang kaya semakin kaya dan yang miskin semakin miskin.id Banten 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Buatlah rakyat bersatu padu menghadapi penjajahan. Jangan ada lagi keberpihakan penguasa secara tidak adil. Saya tidak ingin bangsa Indonesia dicap oleh masyarakat internasional sebagai bangsa yang tidak berbudaya. tidak ada nepotisme. Yogyakarta Ingin Bukti Wahai pencetus janji! Kami ingin bukti. Jadikanlah kesejahteraan yang adil dan merata sebagai nuansa keseimbangan sehari-hari.com Konsultan Manajemen. yaaaa ternyata pak SBY kagak ada bedanya dengan presiden-presiden RI terdahulu.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Indonesia benar-benar bisa bangkit dari keterpurukan. Saya sangat menaruh harapan agar roda pemerintahan berjalan dengan benar. Syafril Nusyirwan msnusyirwan@yahoo. Joko Lelono joko@sulfindo. bangkitkanlah nasionalisme bangsa. Jangan lupa. Ajak masyarakat untuk menghargai dan memakai produk dalam negeri sendiri.co. Ciptakanlah lapangan kerja baru dengan mengembangkan industri kecil rakyat untuk mendukung tersedianya lapangan kerja. bangsa yang tidak beretika.

Rakyat kecil seperti kami ini bisa bertahan hidup salah satunya adalah berkat ‘hope’ tersebut. Banyak sekali harapan yang kami pelihara dalam sanubari kami. Haryono rubby_harijono@bca. Kini sudah waktunya hak mereka dipenuhi. Dalam hal ini. Yang penting bagi saya. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . saatnya untuk mengajari mereka bekerja keras. SBY-JK bisa memperhatikan hak anak. SBY-JK benar-benar bisa membuktikan janji-janjinya. R. strata dan golongan apapun. menghargai kebersamaan.co. Beri mereka pendidikan berkualitas yang terjangkau. hak budaya. Kini. hak ekonomi. sekalipun setelahnya berkali-kali pula harapan-harapan itu teranggas. penguasalah yang paling rajin meranggas harapan-harapan itu kian jauh dari kenyataan.id Karyawan Jakarta Korban Tragedi Harapan saya. hak untuk mendapat perhatian sebagai penerus cita-cita bangsa dan sebagai pewaris kekayaan sekaligus berlimpahnya hutang negeri ini. dan hak asasi. berpandangan luas. Harapan dan sekali lagi harapan. tenggang rasa. mandiri dan bertanggung jawab. Sebab pendidikan yang layak itu hak semua anak dari kelas. Diikuti pencabutanpencabutan hak politik. Beri mereka pendidikan iman dan budi pekerti sebagai landasan moral dan etika bangsa. terutama bagi kaum berkekurangan.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Hak Anak Saya tidak memperdulikan janji-janji atau komitmen apapun. hak sosial. kesetiakawanan.

mendengarkan hati sendiri untuk memutuskan sesuatu kok tidak boleh. Sebagian besar dari mereka tak tahu-menahu konspirasi apa yang sedang dimainkan penguasa. Tetapi saya tetap berharap agar mereka yang duduk di pemerintahan memberikan contoh serta teladan kepada rakyat. Allah SWT pastilah menyayangi Anda. Betapa menyakitkan. Pasti. Tanpa pengadilan. ribuan korban Tragedi ‘65 yang pada hari ini telah beranjak sepuh dan terserak di luar negeri masih juga terhalang pulang. setiap hati dari penghuni jagad semesta ini.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Lihatlah. Bukankah suara hati tak pernah salah? Sebab di dalamnya bersemayamlah Ia. Rida Fitria bunsyke@telkom. yang pasti mereka menolak untuk ditarik dalam permainan hujat-menghujat itu sebab mereka tak percaya ‘ Soekarno Jahat ‘ dan begitu saja buntut dari penolakan tersebut hak sebagai Warga Indonesia pun dicabut. tetapi dirinya sendiri jauh dari perubahan. puluhan tahun mereka begitu merindukan pulang ke tanah air sampai sekian dari mereka meninggalpun masih juga harus membawa kerinduan itu sampai ke kuburnya. sebagian orang dari mereka yang kebetulan sedang di luar negeri karena sebuah keperluan ini tiba-tiba mendapat surat dari Jakarta yang sudah dalam kendali Orde Baru supaya menghujat Soekarno. Ia kebenaran itu sendiri.net Seorang penulis dan ibu dua anak Memberikan Contoh Apalah artinya janji. Ia pemilik hati. DICABUT. Berilah kebahagiaan di usia senja mereka. Saya percaya itu. Bayangkanlah. mengabulkan harapan mereka. Sangat tidak mendidik jika mereka mengharapkan banyak perubahan. Sejak awal mereka diperlakukan sungguh tak adil. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

saya selalu merindukan momen di mana bulu kuduk saya berdiri diiringi linangan air mata kebahagiaan tatkala senandung lagu Kebangsaan Indonesia Raya berkumandang dengan gegap gempita di arena olah raga dunia. Saat-saat seperti itulah yang bisa membuat saya merasa bangga sekali sebagai bangsa Indonesia. perhatikan abdi negara. hakim. bangkitkanlah kembali prestasi olah raga bangsa Indonesia demi menyehatkan jasmani.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Alangkah baik dan indahnya jika semua itu dimulai dari bapak SBYJK sendiri.com Mahasiswa. Jombang. perkecil perbedaan antara si kaya dan si miskin. Samuel Rismana Sugandi mu4ever@indo. rohani dan mental bangsa Indonesia dari keterpurukan berkepanjangan. Kita memang butuh perubahan.com Amurang. kurangi naik mobil mewah.id Tangerang Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Jawa Timur Butuh Perubahan Buktikan janji-janji! Tingkatkan mutu pendidikan. Buktikan! A Felly Pasla fels97@yahoo. Minahasa Merasa Bangga Pak SBY dan JK yang saya kagumi. polisi. perhatikan rakyat kecil. Iswahyudi yudie_matta@yahoo. tindaklanjuti kasus-kasus korupsi. dll. tambah gaji guru. Harapan saya.net.

Berilah kesempatan kepada anak-anak yang tidak mampu untuk mendapat pembinaan olahraga sejak usia dini. adalah olahraga. bakat kejahatan seseorang bukan dibentuk sebelum mereka dilahirkan. Saya lebih yakin bila kata “sononya” diganti dengan “usia dini”. Saya tak yakin bahwa seseorang “sudah berbakat koruptor dari sononya” atau “sudah berbakat jahat dari sononya”. Sebab. Jakarta Kepercayaan Rakyat Kami menunggu janji-janji SBY-JK. Dian Anggraeni dian@icma. Hanya dengan begitu kepercayaan rakyat terhadap pemerintahan baru bisa ditumbuhkan. melainkan sejak usia dini. Artinya. perhatikanlah masalah pendidikan terutama pendidikan di usia dini.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Usia Dini Saya hanya ingin berpesan. Tangerang Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .net Karyawan. Hal lain yang saya anggap perlu juga dibina sejak usia dini. Eny Dwi S. Basmilah para koruptor. di usia dini inilah segala problema negeri ini biasanya bermula. Niscaya.id Sekertaris.or. pada saatnya nanti mereka akan mengharumkan nama Indonesia di kancah olahraga internasional. Pada usia dini inilah watak dan kepribadian orang dibentuk secara awal. ds_eny@telkom.

com Pengusaha.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Paling Banyak Kata apa yang paling banyak disebut-sebut calon presiden dalam pemilu dan paling banyak dilupakan setelah pemilu? Jawabannya. Misalnya. Lalu tunggu satu tahun setelah ia memerintah kemudian hitung berapa banyak kata rakyat yang ia gunakan dalam pidato-pidatonya. kalau SBY ingin memberantas korupsi seperti janji-janjinya. Penyebab yang paling pasti adalah karena gaya hidup: keinginan untuk hidup berlebihan. keinginan untuk berlibur ke luar negeri daripada liburan di dalam negeri. “ralyat”. Saya berharap SBY-JK tidak begitu. Semuanya sudah dimiliki. tapi karena gaya hidup ia ingin memiliki yang lebih. Saya yakin akan jauh berbeda kalau tak boleh mengatakan tidak ada sama sekali. dan sebagainya. Dan itu harus dimulai dari dirinya agar bisa diteladani oleh yang lain. Tapi coba simaklah kata-kata calon presiden yang di berbagai media: “Saya Pembela Rakyat”. “Saya Selalu Mengutamakan Kepentingan Rakyat”. Jadi. Suharjono Suharjono2000@yahoo. Memang belum ada survei tentang ini. keinginan untuk menggunakan mobil mewah daripada mobil kijang biasa. Singapura Gaya Hidup Apa yang membuat orang melakukan korupsi? Pastilah bukan karena ketiadaan keuangan seperti yang banyak dialami oleh masyarakat kebanyakan. keinginan untuk tinggal di perumahan elit Pondok Indah daripada di perumahan kumuh di Jakarta Utara. langkah penting yang tidak boleh dilupakan adalah merubah persepsi gaya hidup. “Saya Akan Berada di Pihak Rakyat”. Beranikah SBY menggunakan mobil kijang sebagai Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

Amir Kiat. siap-siap sajalah buat yang merasa bakal digusur untuk menerima nasib sebagai rakyat kecil. tapi tak pernah ada koruptornya. bahkan data terakhir nomor lima terkorup didunia. Soalnya dari dulu Indonesia terkenal sebagai negara paling korup. membasmi KKN. Jakarta Masalah Penggusuran Satu hal yang mungkin SBY-JK lupa dalam janji-janjinya adalah masalah penggusuran.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji mobil dinasnya? Beranikah SBY belanja di pasar rakyat daripada di supermarket terkenal? Saya masih kurang begitu yakin. Ia berjanji akan mensejahterakan rakyat. Lady Andini Lady1805@yahoo. tapi rasanya belum ada janji-janjinya yang mengatakan bahwa ia akan mengurangi atau meniadakan penggusuran. SH amirkiatposo@yahoo. saya kurang yakin SBY-JK bisa memberantas korupsi. Jakarta Kurang Yakin Terus terang. Yang sudah dijanji pun kadang sulit ditepati.com Pekerja Sosial. mengurangi pengangguran. menegakkan hukum. Buktinya. tak ada koruptor di Indonesia yang tertangkap.com Seniman.com Pegawai. Poso  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Jadi. meningkatkan anggaran pendidikan dan kesehatan. Yoseae yoseae@yahoo. apalagi yang nggak pernah dijanjiin sama sekali.

Berikut pendapat mereka yang sedapat mungkin saya muat apa adanya: Saya Tidak Merasakan Saya sendiri tidak tahu rinciannya janji-janji politik SBYJK.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji Setelah Terhembus Angin B erikut adalah berbagai pendapat dan pandangan mengenai SBY-JK. saya tidak merasakan dampak peningkatan apapun kecuali hal-hal yang sejak Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Tetapi sebagai buruh pabrik di LG Electronics. Hanya sebahagian kecil yang menolak termasuk beberapa tokoh yang dari luarnya saja kelihatan berani padahal di dalamnya nyalinya banci. Pendapat dan pandangan ini saya kumpulkan dari berbagai kalangan pada saat usia pemerintahan SBY-JK memasuki tahun ketiga. tanpa tedeng aling-aling. dan buku saya yang berjudul “Janjijanji & Komitmen SBY-JK”. Ada tiga cara yang saya gunakan untuk mengumpulkan pendapat: bicara langsung. Yang menarik. Isi pendapat adalah penilaian dan pandangan subyektif dari pemberi pendapat. janji SBY-JK. dan berani. Keberanian memberi pendapat dan pandangan dengan isi yang beragam setidaknya menandakan bahwa suasana demokratis makin terasa di negeri ini. dan via SMS. hampir semua orang yang saya mintai pendapat berusaha memberi pendapat dan pandangan mereka dengan sangat antusias. melalui email.

geleng-geleng kepala deh. Atau. Pemberantasan korupsi.. pabrik-pabrik elektronik lain tutup atau pindah ke luar negeri. itu…. Politik luar negeri…??? Hehehehe…. Soal kesehatan juga luar biasa. Uang buku ratusan ribu. lautannya jadi daratan baru. ekstra kurikuler. Yang saya lihat malah kehidupan makin berat. Anak saya di SD Negeri..?? hehehe.woooww. Bidang pendidikan sudah lumayan.. kepulauannya jadi lautan. lumayan bikin pusing tak karuan.. itu.. ini. SPP sih memang gratis. Soal keamanan jangan ditanya deh. pajak makin tinggi. eta.. kenaikan upah setiap tahun yang kisarannya jauh di bawah nilai inflasi. Saya sih lihat kenyataan jadi kacung di negeri sendiri.. Hiks.. tapi lain-lainnya…. secara berkala selalu ada pengurangan karyawan.Bagian Empat Dari Mereka yang Menunggu Realisasi Janji presiden-presiden lalu pun memang sudah secara reguler dilakukan. alat kebersihan.. betapa “puasa”nya. Indonesia ini harus dibalik dulu. cari jarum made in Indonesia aja susahnya bukan main. halaaah..  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . berenang. kendaraan makin tak terbeli. Saya jadi was-was jangan-jangan LG Electronics pindah juga ke Vietnam. Hampir semua barang produksi pemilik perusahaannya orang luar negeri. Hanya dalam waktu sebulan saya dua kali harus mengelus dada karena barang-barang berharga dan uang disikat maling.? Kalau mau berubah total. seandainya tidak ada asuransi dari perusahaan (ini banyak dialami kawan-kawan yang dari “out sourcing”) rasanya setengah penghasilan harus disisihkan untuk berobat saya dan keluarga karena luar biasa mahalnya pelayanan kesehatan. Dikentutin Malaysia dan Singapura malah tertawa. Apalagi saat ini.. Misalnya. artinya dalam sehari hanya boleh makan satu setengah kali. buruh pabrik kaya saya taunya apa. Kalau setengah penghasilan disisihkan. bahan bakar dan listrik serta air makin mahal. jadi jongos di luar negeri.

Semoga dengan akan munculnya rancangan KUHAP yang baru. (seramnya…) Kalau 2009 masih orang-orang ini juga di jabatan publik…. atau bisa juga hanya konsekwensi politik untuk mengkritisi terhadap kinerja SBY-JK. itu menjadi semacam cambuk bagi penegak hukum untuk bekerja lebih baik lagi . sehingga penegak hukum kesulitan dalam mencari alat bukti maupun barang bukti. penyelamatan uang negara semakin bertambah. LG Electronics Indonesia Cikarang Barat. Penyelesaian kasus tindak pidana korupsi tidak semudah membalikkan tangan. Sopian R & D – AV. SH Jaksa pada Kejaksaan Negeri Cikarang Bekasi Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Bekasi 17520 Cambuk Bagi Penegak Hukum Perang terhadap korupsi sudah dikumandangkan oleh SBYJK. Farid. penyelesaian tindak pidana korupsi semakin meningkat. saya tak tahu harus ngomong apa lagi. Secara kuantitas. Abd. akan semakin memudahkan penegak hukum dalam mencari alat bukti terhadap penyelesaian perkara tindak pidana korupsi. Apalagi jika calon tersangkanya pejabat pemerintahan dimana kasusnya sudah terjadi beberapa tahun yang lewat. Tapi kita harus fair melihat kenyataan yang ada di lapangan bahwa janji-janji SBY-JK tidak hanya manis di bibir saja Kalau toh ada yang merasa kurang puas. biarlah yang sekarang masih bayi dididik yang bener oleh peri gigi. Bagi warga masyarakat kinerja aparat penegak hukum mungkin dianggap masih memble.Setelah Terhembus Angin Bagian Lima musnahkan spesies manusia Endonesa dari tiga generasi.

Hanya saja keadaan saya saat ini tidak memungkinkan untuk menulis. banyak guru yang tidak memiliki jiwa keguruan. Bung Rudy. Anda pasti sekolah. Untuk naik pangkat. Saya ingin agar Anda lebih berani mengungkap fakta dan data di negara kita ini demi anak bangsa. dan saya bisa baca tulis dan pintar karena guru. Mereka. Saya tak percaya dengan guru sekarang yang sarjana namun tidak mengerti doktrin keguruan sehingga tidak memiliki jiwa guru yang sebenarnya. Saya adalah mantan guru honorer yang dipandang sebelah mata. saya harap buku Anda ini dapat mengajarkan guru dan anak didik tentang kejujuran. Lalu mengapa begitu banyak orang yang tidak dapat menghargai guru. Pejabat pasti pernah sekolah. mungkin Anda akan berpikir apakah saya juga dapat menulis? Saya berani katakan “ya!”. Di zaman sekarang. Anda. Saya Ingin… Bung Rudy. SGO dan SMOA. saya juga ingin Anda memperjuangkan “dokrin keguruan yang hilang” dengan tidak adanya SPG. Keadaan ekonomi saya morat-marit: rumah tak punya. sehingga guru tidak lagi disalahkan karena banyak melahirkan pejabat yang korup. mengapa berbagai kebijakan yang muncul tidak untuk mensejahterakan guru? Mengapa SBY-JK menjadi lupa akan janji-janji mereka kepada guru? Saya ingin tulisan Anda dan buku-buku Anda benarbenar menyentuh rasa nasionalisme yang berkepribadian timur dan bertanggung jawab untuk meluruskan moral para pejabat. Hal ini juga pernah saya angkat di sebuah milis (mailing list) namun tak ada satu pun yang berani menanggapi. kendaraan tahun 87 (butut) lalu bagaimana saya dapat fokus menulis sehebat Anda jika keadaan saya seperti itu? Cuma. Sekarang ini banyak yang jadi guru harus pakai duit. Mereka jadi guru bukan karena panggilan hati melainkan karena terpaksa (daripada nganggur). Bung Rudy. saya selalu dapat memberikan masukan kepada penulis profesional seperti Anda. mereka juga harus rajin Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 .Bagian Lima Setelah Terhembus Angin Bung Rudy.

diantaranya pemilihan Prof. Meskipun UU Perpustakaan sudah disahkan. Dengan begitu. Meutia Farida Hatta- Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . saya rasa kehidupan kita akan menjadi lebih baik. Padahal perpustakaan adalah pondasi dari pendidikan. saya tidak mau lagi menunggu janji-janji. Tanya Kenapa? Komitmen SBY-JK untuk mengembangkan kebudayaan dianggap gagal. dan para guru akan membangkitkan anak didiknya. Kalimantan Timur Perpustakaan. banyak hasil dan karya Indonesia dijiplak/diklaim oleh negara lain. meminjam kalimat dari sebuah iklan. Pemerintah Indonesia juga diangap gagal karena tidak dapat mengontrol budaya ketimuran. membangkitkan para guru. Kebudayaan. Saya yakin sebenarnya Anda tahu hal ini. Bung Rudy. Dr.Setelah Terhembus Angin Bagian Lima ngirim upeti. Ada beberapa kesalahan komposisi kabinet yang dilakukan SBY-JK. berharap realisasi janji-janji dari siapapun bahkan dari orang nomor satu di republik ini. dalam hal ini masalah konten acara televisi yang kebanyakan merusak budaya ketimuran. buktinya kondisi perpustakaan sekolah khususnya perpustakaan sekolah negeri dan perpustakaan umum di setiap daerah saat ini sangat mengenaskan. Saya hanya ingin Anda membangkitkan rakyat melalui tulisan-tulisan Anda. dan Komposisi Kabinet Janji SBY-JK mendorong anak didik untuk membaca dan memperkaya perpustakaan masih jauh dari harapan rakyat Indonesia. Sutarman Mantan guru honorer Balikpapan. Saya harap Anda bisa membuat buku tentang ini dan saya akan membantu Anda menunjukkan fakta-fakta.

janji-janji SBY-JK untuk memajukan bangsa dan negara belum ada realisasinya. Mereka belum berani menyentuh koruptor-koruptor kelas kakap seperti para penggemplang BLBI dan orang-orang dekat SBY-JK. Misalnya. Disamping itu. Pemerintahan SBY-JK juga belum mampu mensejahterahkan rakyat Indonesia karena banyak kebijakan SBY-JK yang tidak berpihak pada rakyat kecil.Bagian Lima Setelah Terhembus Angin Swasono sebagai Meneg Pemberdayaan Perempuan bukannya sebagai Menteri Pariwisata & Kebudayaan. Kenaikan harga BBM  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Bernad Ndawu Koordinator Poso-Morowali Watch Jakarta Janji Sudah Terbukti Saya berpendapat. terlalu eksklusif-nya Presiden Yudhoyono dalam hal humas kepresidenan dengan mempekerjakan dua jubir kepresidenan dan satu sekretaris kabinet. Hal yang positif dari pemerintahan SBY-JK adalah ketika mereka berhasil menciptakan suasana damai di Aceh dan Poso. Ardian Arda Sekretaris Umum DPD I HMPII (Himpunan Mahasiswa Perpustakaan & Informasi Indonesia) Terkesan Setengah Hati SBY-JK belum sepenuhnya menepati janji-janji yang pernah mereka ucapkan saat kampanye. soal pemberantasan korupsi yang terkesan setengah hati. Semoga kedamaian di Aceh dan Poso tetap terjaga.

Lihat komentar JK yang menyatakan bahwa demokrasi adalah cara untuk mencapai tujuan kehidupan berbangsa beberapa waktu yang lalu.JK adalah pasangan presiden dan wapres yang pandai dan cerdas memaknai gejala buruk dari respon masyarakat (lebih tepatnya pers. Komentar SBY JK. tidak lebih impossible is nothing. Mereka dulu berjanji akan membawa perubahan bagi bangsa ini. malah membuat rakyat kecil seperti saya jadi menderita. but some things are impossible. S. bagi saya. Lihat pula komentar SBY tentang upaya perlawanan terhadap pemberantasan korupsi. Tingkat kejahatan pun sudah pasti akan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Aminuddin Sopir Taksi Jakarta Pandai dan Cerdas Memaknai Gejala Buruk SBY. Untuk membeli minyak tanah saja orang harus antri. Wahyu Kuncoro.Setelah Terhembus Angin Bagian Lima tak mengenal waktu. tapi bukannya menjadi baik. Akibatnya. Memang terjadi perubahan. pengangguran akan semakin meningkat.H Konsultan Hukum Tangerang Tak Ada Keberpihakan Coba bayangkan. harga-harga kebutuhan pokok dari hari ke hari semakin naik. apa yang terjadi dengan tenaga kerja kita jika PHK terus berlangsung di mana-mana? Yang pasti. Janji mereka sekarang sudah terbukti: harga-harga kebutuhan pokok selalu berubah naik. peneliti atau pemerhati) atas segala aksi pembaharuan yang dilakukannya.

menko kesra. selama tiga hari. Karena terlalu banyak perhitungan. Sejak awal saya melihat SBY ini berkarakter lembek. yang erat kaitannya dengan Lapindo Brantas Inc. Tangerang Tidak Perlu Teramat Kecewa Di Indonesia. janji-janji kampanye politik sejatinya bukanlah komitmen yang bisa ditagih. bukan tipe get things done. Lebih banyak omong kosong untuk menarik simpati masyarakat.Bagian Lima Setelah Terhembus Angin ikut naik. sehingga 20. Bukankah kata-kata politisi itu sulit dipegang? Salah kalau rakyat terlalu mengingat janji-janji kampanye Susilo Bambang Yudhoyono (SBY). kalau setiap ada masalah presiden turun langsung. SBY ini tidak berani dengan Aburizal Bakrie. Saya melihat tak ada keberpihakan pihak penguasa kepada tenaga kerja. Mana janji-janji itu? Fatimah Resepsionis Ciledug. maka bencana lumpur panas tidak sedahsyat sekarang. Seharusnya menteri-menteri koordinator atau menteri senior bisa menuntaskan itu tanpa harus SBY berkantor di Lanudal Juanda. SBY juga lemah di manajemen. Sidoarjo. apa Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Tidak bisa tegas. Ingat kasus lumpur lapindo di Sidoarjo yang berlarutlarut. Lihat saja di lumpur lapindo. Tapi. selalu bimbang. keputusannya tidak bisa cepat dan tepat. Lha. Mereka lebih berpihak kepada pengusaha. sistem kontrak yang ada sekarang cenderung melemahkan posisi tenaga kerja dan menguntungkan pengusaha. Andai saja bulan September atau Oktober 2006 SBY dengan tegas menyatakan lumpur dibuang ke Kali Porong. Ingat bagaimana susahnya dia mengganti menteri. Ingat bagaimana alotnya SBY bikin kabinet. sekali lagi. Lihat saja.000 orang kehilangan rumah dan tempat tinggal.

yang nota bene. Rakyat harus lebih kritis. tidak terpukau oleh trik-trik kampanye ala pesolek politik. janji pendidikan gratis. memang sudah terwujud tapi belum merata ke seluruh Indonesia. Payah manajemen SBY! Tapi ini bisa dimaklumi karena secara politis SBY sangat lemah. rivalnya. Misalnya. SBY-JK sudah mewujudkan janji-janjinya tapi baru sebahagian kecil.Setelah Terhembus Angin Bagian Lima gunanya menteri-menteri yang banyak itu? Manajer kan mestinya hanya koordinasi saja. saya melihat banyak gedung sekolah yang harus dibangun kembali sesuai standar agar proses belajar mengajar berjalan dengan sempurna dan nyaman. Hurek Redaksi Berita di Radar Surabaya Baru Sebahagian Kecil Menurut saya. Begitupun dengan janji memberantas korupsi. Pemberantasan narkoba juga harus lebih diintensifkan karena tampaknya pengguna narkoba sudah semakin banyak.SBY tahu Partai Demokrat masih kecil sehingga dia perlu menjaga kelangsungan kekuasaannya dengan memelihara banyak menteri yang sebenarnya tidak kapabel. Di bidang pendidikan. Kita. Efiy Karyawan Bank BCA cabang Graha Inti Fauzi Jakarta Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Ia dikelilingi oleh menteri-menteri berlatar belakang politisi. tidak perlu terlibat dalam urusan remehtemeh. Baru yang kecil-kecil saja diberantas sementara yang kakap sengaja ditarik ulur. bangsa Indonesia. tidak perlu teramat kecewa karena politik di Indonesia masih dalam taraf segitu. siapa pun maklum mengapa SBY sulit sekali menunaikan janji-janji kampanye pada 2004. Lambertus L. Semoga di masa depan keadaan akan semakin membaik. Dari sini saja.

narkoba jadi mudah diperoleh di mana-mana sementara masyarakat semakin “masabodo”. Janji tersebut sudah terlaksana dengan baik namun belum sesuai dengan harapan masyarakat. Mungkin ada baiknya juga bila BNN (Badan Narkotika Nasional) menjadi semacam LPND (Lembaga Pemerintah NonDepartemen) yang independen dan langsung di bawah Presiden. Menurut saya. DFM Badan Narkotika Nasional Jakarta Jangan hanya Sekedar Retorika Sebagai rakyat biasa. Dari hari ke hari jumlah  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Ada perbedaan antara hasil dan pandangan masyarakat. Sindikat narkoba umumnya menjadi kuat setelah beroperasi di atas 5 tahun dengan tingkat solidaritas dan kepercayaan yang tinggi di antara sesama anggotanya.S. Penyuplainya meningkat. seperti KPK. Data menunjukkan adanya kenaikan yang tinggi angka pengguna narkoba. Semoga apa yang saya sarankan ini bisa bermanfaat. Sindikat semacam ini hanya bisa dilawan oleh organisasi yang juga solidaritas dan kepercayaan di antara sesama anggotanya sudah lebih dari 5 tahun. Jika sebentar-sebentar orang yang menanganinya diganti. saya hanya berharap terjadinya perubahan dalam hal jumlah kemiskinan. pemberantasan pun akan tidak maksimal.Bagian Lima Setelah Terhembus Angin Narkoba dan Kejahatan Jalanan Buku ini memuat janji SBY-JK mengenai prioritas pemberantasan narkoba dan kejahatan jalanan. Dr. SBY-JK akan sulit memenuhi janji-janjinya memberantas penggunaan narkoba jika sebentar-sebentar pejabat yang menanganinya diganti. tidak dalam bayangan Polri atau departemen manapun. Anwar Wardy W. Sp.

Tetapi membukukannya secara tertulis mungkin hanya sedikit dari tidak banyak dilakukan orang.. Untuk itu. Sama halnya dengan menagih janji dan komitmen itu sendiri. Terutama dalam hal hukuman yang dijatuhkan.Setelah Terhembus Angin Bagian Lima rakyat miskin di Indonesia semakin bertambah. Rakyat jadi menderita dikarenakan lapangan kerja untuk mencar nafkah tidak ada.Semoga. harga melonjak-lonjak tanpa jelas arahnya. Akhirnya. Pembangunan berada pada titik nol bahkan minus dengan munculnya berbagai musibah akibat kemarahan alam. upaya pemberantasan korupsi harus benar benar serius dilaksanakan. Salah satu Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Makin banyak janji makin sering rakyat dikecewakan. jangan hanya sekedar retorika saja.. Saya tak tahu mau dibawa kemana bangsa dan negara ini. Masyarakat miskin di desa pun akhirnya berurbanisasi besarbesaran ke kota. Makin banyak janji makin sulit kita merealisasikannya. Lihat saja.. Indra Darma Warga Jati Asih Bekasi Tidak Sistematis Lagi Makanya kita jangan suka berjanji. Edi Sofyan Wiraswasta percetakan Jakarta Mari Menakar Mencatat janji dan komitmen seorang pemimpin tentu saja banyak dilakukan orang. pembangunan di Indonesia menjadi tidak sistematis lagi.

walau ada kejadian luar biasa yang harus mereka beri perhatian. Jika menilik isi buku Jankomit ( Janji-janji dan Komitmen) SBY-JK. SBY-JK terkadang sering dibenturkan. Kita tidak menafikan bahwa selama memimpin bangsa ini. Dari Aceh ke Yogya. Dokumentasi tertulis seperti buku ini sangat penting untuk memudahkan kita menakar keberhasilan seorang pemimpin menunaikan janjinya. beberapa kelompok di luar organisasi pemerintahan sudah mulai melakukan manuver. dilakukan Rudy S Pontoh melalui bukunya Janji-janji dan Komitmen SBY-JK yang cetakan pertamanya dirilis Desember 2004. Baru setahun memangku jabatan. SBY-JK memang dihadapkan kepada musibah yang luar biasa. Jawa Timur. Belum lagi. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Musibah dan bencana demi bencana pun muncul seolah susul menyusul. yang tidak kalah pentingnya adalah menakar seberapa besar dan banyak janji sang pemimpin itu mampu dipenuhi. Seolaholah keduanya mulai pasang kuda-kuda sendiri. Dan. Tidak kompak. merupakan salah satu bentuk akses untuk menagih akuntabilitas seorang pemimpin ke depan. Meski keduanya harus mengganti beberapa kelasi yang dianggap bermasalah dan susah menyesuaikan irama pekerjaan sang nakoda. Ada-ada saja pihak yang menilai keduanya tidak akur.Bagian Lima Setelah Terhembus Angin di antaranya. Cara ini. yakni Gempa Bumi dan Tsunami di Provinsi Nanggroe Aceh Darussalam (NAD) yang menyita dan menumpahkan hampir seluruh perhatian republik. Saya mengibaratkan. Jalan sendiri. Para pengeritik SBY-JK tetap menuntut jankomit mereka. banyak sekali yang harus dibayar duet ini untuk mewujudkan janji-janjinya. kedua pemimpin ini melayarkan ‘’kapal republik’’ di tengah gempuran gelombang besar kiri kanan. hingga munculnya musibah lumpur lapindo di Sidoarjo. Menjaga jangan sampai kapal mogok hingga ke tujuan.

Bahkan banyak anak putus sekolah karena tidak mampu lagi membayar uang Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Presiden SBY juga mengganti pejabat Jaksa Agung. dan nepotisme (KKN). memasuki tahun keempat masa pemerintahannya. beberapa menteri. dan pembantunya. meski sulit menutup kesan adanya istilah ‘bongkar pasang’ kabinet yang berujung kepada kurangnya konsistensi dalam kesinambungan program menteri yang bersangkutan.Setelah Terhembus Angin Bagian Lima Tiga tahun sudah berlalu. koneksi. Saya kira. Bukti lain dalam penegakan hukum. jankomit SBYJK yang menguat menjadi wacana publik adalah pemberantasan korupsi. Tetapi ada geliat yang nyata untuk memberantas korupsi. Saatnya kita menagih dan menakar jankomit SBY-JK. Buktinya adalah pemerintah membentuk beberapa institusi yang memberantas KKN. Buku Bung Rudy dalam edisi kedua ini ada baiknya juga menakar sejumlah janji yang mampu dipenuhi SBY-JK. Secara kasat mata. Janji pendidikan murah ternyata yang terjadi biaya pendidikan makin mahal saja. Ini menunjukkan komitmen yang besar terhadap perbaikan roda pemerintahan.Dahlan Abubakar Staf Pengajar Fakultas Sastra Unhas Makassar Ajang Bisnis Saya tak tahu harus bilang apa. ada baiknya kita mulai menakar seberapa jauh jankomit kedua pemimpin bangsa mampu dipenuhi. Saya tidak punya data resmi berapa banyak di antara kasus korupsi yang ada sudah tuntas di pengadilan. Saking banyaknya lembaga yang menangani korupsi ini ada kesan tugas dan wewenang lembaga tersebut tumpang tindih. sehingga dapat menjadi acuan bagi publik untuk menagihnya. M.

Tetapi di zaman sekarang ini. Mulut mereka semasa kampanye benarbenar menjelma sebagai harimau mereka yang bisa membuatnya tampak gagah dan disegani bila memegang janji. Mungkin pada zaman dulu (sebelum masa reformasi) fenomena umbar mulut dan diakhiri berkelit lidah ini merupakan hal yang sangat galib dan tak beresiko apa-apa. Pertama. penguasa tak bisa lagi dengan gampang berkelit lidah. Soleh Sutisna Satpam. Penguasa tidak lagi memperhatikan rakyat kecil tapi sibuk mejadikan negara ini sebagai ajang bisnis. Apalagi bagi mereka yang sedang berkuasa. mulut juga bisa membuat mereka dibenci. diprotes dan dijatuhkan. fase berkelit lidah yang berupa upaya-upaya pengingkaran janji yang dilakukan pada masa setelah berkuasa. Pasalnya. fase umbar mulut atau umbar janji yang biasanya dilakukan pada masa kampanye. Namun di sisi lain. dicibir. atau akan tampak Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 . Penderita kekurangan gizi dan busung lapar tampaknya makin meningkat saja. Harga obat semakin mahal. Mulut adalah salah satu senjata sakti yang bisa membuat mereka terpilih. Ciledug Tangerang Antara Mulut dan Janji Mulutmu adalah harimaumu bukanlah isapan jempol belaka. dan disanjung. Secara garis besar. didemo. penguasa pada waktu itu begitu berkuasanya sehingga tak ada seorang pun yang bisa mempertanyakan pelaksanaan janji-janji mereka. dielu-elukan. rumah sakit pun sekarang makin tidak berpihak kepada rakyat kecil. Begitu juga halnya di bidang kesehatan. . Kedua.Bagian Lima Setelah Terhembus Angin sekolah. ada dua fase inti penggunaan mulut oleh penguasa atau calon penguasa ini.

Sepintas memang kehadiran buku ini seperti mengancam gerak langkah SBY-JK.Setelah Terhembus Angin Bagian Lima garang dan berpotensi memangsa dirinya sendiri bulat-bulat jika janji-janji masa kampanyenya tak ada yang ditepati. peneliti. apa yang telah dipenuhi dan apa yang belum. berhatihati dan menjaga langkah agar tidak terperosok oleh pengingkaran atas janji-janji yang pernah mereka ungkapkan sebelumnya. Benar-benar sebuah buku yang akhirnya dijadikan pegangan oleh para politikus. buku ini pun juga menjadi buku yang sebenarnya menguntungkan bagi sang presiden beserta pembantu-pembantunya. jurnalis. Cukup dengan membaca buku ini. Melalui buku ini masyarakat dengan gampang bisa mengevaluasi secara terinci apa yang telah dijanjikan presiden. Akibatnya. melihat apa yang pernah dijanjikan presiden dan akhirnya mempertanyakan apakah janji tersebut sudah dipenuhi? Buku ini benar-benar menjadi buku pedoman bagi seluruh warga Indonesia. Setiap merasakan adanya sebuah ketidakadilan. Dengan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . maka SBY-JK dengan gampang bisa melakukan introspeksi. banyak janji-janji kampanye penguasa yang terlupakan dan terlewat untuk ditagih oleh masyarakat. namun kalau dicermati. Kebanyakan janji mereka dilontarkan dalam bahasa lisan yang tidak terdokumentasi secara sistematis. dan semua kalangan yang hidup di negara ini tanpa terkecuali. Memang liputan-liputan media bisa menjadi sumber dokumentasi. Hadirnya buku “Janji-janji & Komitmen SBY-JK” ini benar-benar suatu berkah bagi masyarakat Indonesia. Tapi tak banyak kliping media yang tertata secara sistematis dan gampang diakses. Sayangnya menagih janji penguasa tidaklah mudah. Untungnya ada Rudy S Pontoh yang rela bersusah payah untuk mengumpulkan data-data janji penguasa khususnya Presiden Susilo Bambang Yudhoyono dan Wakil Presiden Jusuf Kalla (SBY-JK) pada satu buku yang gampang dibaca. dengan gampang masyarakat bisa membuka buku ini. para pengamat.

Cukup baca buku ini dan laksanakan janji-janji yang tertulis di dalamnya. Tak perlu mengumbar janji baru. WA Wicaksono Senior Copywriter Creative Network Communications  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .Bagian Lima Setelah Terhembus Angin begitu hadirnya buku ini justru membantu mereka untuk bisa menjadi pimpinan yang dielu-elukan rakyatnya dengan perwujudan janji-janji mereka yang tertulis di buku ini.

Istilah dan Singkatan Istilah dan Singkatan AIDS Angkot APBD APBN Apjati ASEAN Askes Bappenas BBM BIN BLBI BPK Bulog BUMN Calih Capres Cawapres : Acquired Immunodeficient Syndrome : Angkutan Kota : Anggaran Pendapatan dan Belanja Daerah : Anggaran Pendapatan dan Belanja Negara : Asosiasi Perusahaan Jasa Tenaga Kerja Indonesia : Association of Southeast Asian Nations : Asuransi Kesehatan : Badan Perencanaan Pembangunan Nasional : Bahan Bakar Minyak : Badan Intelijen Negara : Bantuan Likuiditas Bank Indonesia : Badan Pemeriksa Keuangan : Badan Urusan Logistik : Badan Usaha Milik Negara : Calon Terpilih : Calon Presiden : Calon Wakil Presiden Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

Istilah dan Singkatan DEN Depdagri Depdiknas Depkeh Deplu Depnaker DKN DOM DPP DPR DPRD DVD Ed. GAM GOR GPSP HAM HPH HTI : Dewan Ekonomi Nasional : Departemen Dalam Negeri : Departemen Pendidikan Nasional : Departemen Kehakiman : Departemen Luar Negeri : Departemen Tenaga Kerja : Dewan Keamanan Nasional : Daerah Operasi Militer : Dewan Pengurus Pusat : Dewan Perwakilan Rakyat : Dewan Perwakilan Rakyat Daerah : Digital Video Disc : Editor : Gerakan Aceh Merdeka : Gedung Olahraga : Gerakan Pemberdayaan Suara Perempuan : Hak Asasi Manusia : Hak Pengelolaan Hutan : Hutan Tanaman Industri  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .

Istilah dan Singkatan IDI IMF Irjen Jabotabek Jamsostek Jankomit JK Kadin Kapolri KB Keppres KKN Komnas Kosgoro KPK KPU KTI LSM : Ikatan Dokter Indonesia : International Monetary Fund : Inspektur Jenderal : Jakarta-Bogor-Tangerang-Bekasi : Jaminan Sosial Tenaga Kerja : Janji-janji dan Komitmen : Jusuf Kalla : Kamar Dagang dan Industri : Kepala Polisi Republik Indonesia : Keluarga Berencana : Keputusan Presiden : Korupsi Kolusi dan Nepotisme : Komisi Nasional : Kesatuan Organisasi Sosial Gotong Royong : Komisi Pemberantasan Korupsi : Komisi Pemilihan Umum : Kawasan Timur Indonesia : Lembaga Swadaya Masyarakat Menkopolkam : Menteri Koordinator Politik dan Keamanan Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

Istilah dan Singkatan MPR MUI NAD NKRI NTT NU Otoda Otsus PB IDI PDB PDI-P Pemilu PJTKI PNS Polri PT Puskesmas RI RUU : Majelis Permusyawaratan Rakyat : Majelis Ulama Indonesia : Nanggroe Aceh Darusalam : Negara Kesatuan Republik Indonesia : Nusa Tenggara Timur : Nahdlatul Ulama : Otonomi Daerah : Otonomi khusus : Pengurus Besar Ikatan Dokter Indonesia : Produk Domestik Bruto : Partai Demokrasi Indonesia Perjuangan : Pemilihan Umum : Penyalur Jasa Tenaga Kerja Indonesia : Pegawai Negeri Sipil : Polisi Republik Indonesia : Perguruan Tinggi : Pusat Kesehatan Masyarakat : Republik Indonesia : Rencana Undang-undang  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .

Istilah dan Singkatan SARA SBY SBY-JK SD SDA SDM Sembako SIUPP SJSN SLTA SLTP SMA SMP SMU Taspen TBC TKI TNI TV : Suku. Ras dan Antargolongan : Susilo Bambang Yudhoyono : Susilo Bambang Yudhoyono-Jusuf Kalla : Sekolah Dasar : Sumberdaya Alam : Sumber Daya Manusia : Sembilan Bahan Pokok : Surat Izin Usaha Penerbitan Pers : Sistem Jaminan Sosial Nasional : Sekolah Lanjutan Tingkat Atas : Sekolah Lanjutan Tingkat Pertama : Sekolah Menengah Atas : Sekolah Menengah Pertama : Sekolah Menengah Umum : Tabungan dan Asuransi Pegawai Negeri : Tuber Colosis : Tenaga Kerja Indonesia : Tentara Nasional Indonesia : Televisi Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  . Agama.

Istilah dan Singkatan UKM UMKM UU UUD UUD ‘45 VCD Wantanas WHO WNA WNI : Usaha Kecil Menengah : Usaha Mikro. dan Menengah : Undang-undang : Undang-undang Dasar : Undang-undang Dasar 1945 : Video Compact Disc : Dewan Ketahanan Nasional : World Health Organization : Warga Negara Asing : Warga Negara Indonesia  Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . Kecil.

bbc.com/bpost BBC Indonesia http://www.com Bisnis Indonesia http://www.bisnis.id Banjarmasin Post http://www.net Bali Post http://www.co.co.cn CNN http://www.chinabroadcast.com Blog Pemilu 2004 http://pemilu2004.goblogmedia.cnn.com China Radio International http://id.antaranews.uk/indonesian Berita Sore http://www.Daftar Rujukan Daftar Rujukan Antara http://www.com Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .balipost.indomedia.beritasore.

alumni-ipb.cbn.com Harian Berita Sore http://www.com/direktoriindonesia Equator Online http://www.com Gatra http://www.com Detikcom http://www.suaramerdeka.beritasore.or.gatra.com Himpunan Alumni Institut Pertanian Bogor http://www.detikportal.id Daftar Alamat http://www.com/daftaralamat Detik Portal http://www.equator-news.geocities.geocities.detik.com Direktori Indonesia http://www.com Harian Suara Merdeka http://www.net.id Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 00 .Daftar Rujukan CyberNews http://cybernews.

Daftar Rujukan Hukum Online http://www.dnet.go.jamanpro-sby.net.web.id Kaltim Post http://www.com Jaminan Pemeliharaan Kesehatan Masyarakat http://www.net Jatim.com Ikatan Cendekiawan Muslim se-Indonesia http://www.jatim.co.id Indonesia Interactive http://www.id http://www.or.go.com Info Menuju RI Satu http://www.id Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 .icmi.co.id Indosiar http://news.id Jawa Pos http://www.hukumonline.i2.indosiar.jawapos.id/infori Jamanpro-SBY http://www.jpkm-online.kaltimpost.

koalisi.lampungpost.org Komisi Hukum Nasional http://www.com 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .id Kompas http://www.id Komisi Pemilihan Umum http://www.id Lampung Online http://www.lampungonline.com http://www.koalisimedia.Daftar Rujukan Kapanlagi.go.org Koalisi Media http://www.kompas.org http://www.co.com Kebangkitanbangsa.com Lampung Post http://www.go.org Koalisi untuk Indonesia Sehat http://www.kapanlagi.kebangkitanbangsa.com Kompas Cyber Media http://www.komisihukum.kompas.kpu.

go.com Mega-Hasyim http://www.Daftar Rujukan Liputan 6 SCTV http://www.pagaralam.id Mediacorp Radio http://rsi.or.com Media Indonesia http://www.id Pikiran Rakyat http://www.pikiran-rakyat.mediacorpradio.id Perpustakaan Bappenas http://perpustakaan.pantaupemilu.mediaindo.bappenas.id Pemerintah Kota Pagar Alam http://www.liputan6.com Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 .co.com Lombok Network: http://www.go.or.id Partai Golkar: http://partai-golkar.lombok-network.megahasyim.com Pantau Pemilu http://www.

id Pusat Data & Analisa Tempo http://www.rri-online.republika.id Radio Republik Indonesia http://www.pontianakpost.rakyatmerdeka.com SBY Untuk President RI 2004-2009 http://prosby.co.id RCTI http://www.com SBY & JK Untuk Indonesia http://www.sby-oke.presidenri.riaupos.com Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 .co.tv Republika http://www.Daftar Rujukan Pontianak Post http://www.co.com PresidenRI http://www.or.pdat.com Rakyat Merdeka http://www.id Riau Pos http://www.rcti.

suarakarya-online Suara Pembaruan http://www.com Sriwijaya Post http://www.co.indomedia.com Sinar Harapan http://www.com Sekitar Kita http://www.com Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 .sbyudhoyono.sekitarkita.id TEMPO interaktif http://www.id Surya http://www.co.sumeks.co.com Sumatera Ekspres http://www.Daftar Rujukan Sbyudhoyono http://www.tempointeraktif.com/sripo Suara Karya http://www.sinarharapan.suarapembaruan.surya.id Sinar Indonesia Baru http://www.hariansib.

com 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .id Voice of America http://www.tv7.transtv.Daftar Rujukan Trans TV http://www.id TV7 http://www.co.wartaekonomi.voanews.co.com Warta Ekonomi http://www.

.. Sih? Kok. buku tersebut menduduki peringkat pertama penjualan di hampir semua toko buku terkemuka di Indonesia. Juga belum pernah diadakan acara promosi semacam peluncuran buku. resensi atau sejenisnya sebagaimana buku-buku lainnya. Padahal.Lampiran LAMPIRAN Kisah Biru: Ada Apa. keberadaan buku tersebut belum pernah diiklankan secara terbuka di media cetak. Semua Pada Nolak? Dari Balik Penerbitan Buku Janji-Janji & Komitmen SBY-JK Edisi Pertama Buku saya “Janji-janji dan Komitmen SBY-JK edisi pertama ternyata amat laris. Beberapa toko buku di Jakarta yang sempat saya kunjungi (tentu saja saya tak sempat mengunjungi semua toko buku) menempatkan buku tersebut di tempat yang paling diidam-idamkan oleh semua penulis buku: best seller. Dari laporan yang saya terima.!). buku tesebut dengan gagahnya menduduki singgasana itu. (ceillehh. Bahkan di sebuah toko buku besar di Matraman Jakarta. atau radio manapun. karena Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 . Saya bilang singgasana. saya pun turun langsung ke lapangan untuk melakukan survei kecil-kecilan. Karena penasaran. televisi.

ini artinya mereka setuju tapi dengan terpaksa dan tidak pasti kapan akan menerbitkannya. ada juga buku fiksi berjudul Supernova. Saya malah jadi kasihan pada mereka. predikat “best seller” amatlah luar biasa mengingat buku tersebut belum cukup dua minggu beredar. Sebenarnya. sebelum selesai ditulis. juga buku tentang tumbuhan merah yang bisa mengobati HIV. mereka jadi kehilangan nyali. Bagi saya. Saya sendiri tak tahu mengapa orang-orang jadi pada alergi menerbitkan buku itu. Lagipula selama ini kan belum pernah ada di Indonesia (bahkan di dunia) buku yang merekam dengan jelas janji-janji seorang politikus. Malah SBY-JK sendiri dalam berbagai 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? . buku ini tak punya pretensi politik apapun. sudah ada penerbit terkemuka yang bersedia menerbitkannya (buku saya lainnya diterbitkan oleh penerbit ini).Lampiran buku lokal yang bisa mendapat predikat itu di toko buku tersebut jumlahnya amatlah minim. apalagi seorang calon Presiden dan Wakil Presiden yang kemudian terpilih. dan satu buku lokal lainnya (tak ingat judulnya dan tak sempat baca dalamnya). Yang banyak adalah buku-buku terjemahan (sekitar 10 judul). Mereka mengatakan “Oke” tapi dengan suara rendah dan ludah tertahan di tenggorokan. Kok. Tapi begitu buku selesai ditulis dan melihat isinya. Selain buku saya. Mereka tak menyangka saya bisa merekam semua janji SBY-JK dan fakta nyata dengan begitu lengkapnya. Penerbit lain yang juga saya tawarkan (juga penerbit yang akan menerbitkan buku saya lainnya) tiba-tiba tampak seperti kehilangan nafsu. Saya jadi teringat saat-saat sebelum buku itu diterbitkan. Padahal berulang-ulang saya katakan. Apalagi sekarang kan kita hidup di alam demokrasi. Alergi? Buat saya.

Dari Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? 0 . supaya mereka tahu sudah sejauh mana mereka melangkah dan sudah sejauh mana mereka belum melangkah. Wah.mana. tapi punya tujuan yang sama.Lampiran forum berulang-ulang meminta agar mereka dikritik.. Bejibun SMS dan Telepon Maka mulailah saya berjuang dengan mengirimkan penawaran melalui faks dan email ke berbagai penerbit. Mengapa? Ya. jadi pada banci sih? Buku ini bukanlah buku kritikan. Kok. Tapi selanjutnya. boss-boss kita kalau bikin janji kan biasanya suka lupa) dan apa aja yang tidak mereka janjikan. Isinya adalah janji dilengkapi fakta dan data di Indonesia saat mereka mengucapkan janji. setelah itu saya berpikir untuk menerbitkannya sendiri. saya ternyata belum berpengalaman dalam menerbitkan buku untuk dikonsumsi masyarakat umum. Dengan kata lain. mau tidak mau saya harus mencari penerbit lain. dan 3 judul buku musik (ini hobi sampingan saya). jadi kemana . Dengan adanya buku ini mereka akan terbantu untuk mengingat apa-apa saja yang sudah mereka janjikan (soalnya. saya belum begitu menguasai jalur-jalur pemasaran di dalam negeri. Tapi setelah saya instropeksi diri (ceilehhh. kita semua jadi pada takut. rakyat malah menganggap mereka tidak memenuhi janji karena rakyat sendiri tidak tahu apa yang pernah dijanjikan kepada mereka. Kenapa tidak? Selama ini saya sudah menulis dan menerbitkan sendiri 41 (empat puluh satu) judul buku direktori bisnis. Dan semuanya laku dijual bahkan di pasar luar negeri.!). Ya. Jangan sampai mereka sudah bersusah memenuhi janji. SBY-JK jika sempat membacanya pun saya yakin pasti senang.

tentu saja setelah saya menerima kembali hak terbit dari penerbit sebelumnya.Lampiran 10 penerbit. Tabloid Kontan dan Harian Bisnis Indonesia. Sekarang. O. coba deh buktikan. Semuanya berisi dukungan dan kesediaan untuk menerbitkan. Bahkan ada yang langsung berniat membeli hak cipta buku tersebut dengan angka berapa saja. Kalau tak percaya. Huruf-huruf yang tampak semuanya jadi biru. Begitu surat pembaca dimuat.. hanya dua yang antusias dan bersedia langsung menerbitkannya dalam waktu dekat. Tapi saya belum langsung menjawab karena sebelumnya saya sudah terlanjur mengirim surat pembaca ke beberapa media cetak. Hanya butuh dua hari. dua media yang menjadi favorit saya selama ini. tapi bukan untuk diterbitkan melainkan untuk dimusnahkan (hehehe. Di sini juga saya tak habis pikir. dalam surat pembaca saya sertakan nomor hape saya). yang ini mungkin dari kelompok atau partai tertentu). Sungguh luar biasa. saya mencoba menerbitkan kembali buku ini secara self-publishing. saya akhirnya berhasil memilih satu penerbit yang saya anggap track record-nya selama ini sangat baik. kisah ini saya sebut kisah biru karena waktu menulisnya saya menggunakan kacamata dengan lensa biru penahan terik matahari.ya. Tak banyak yang berubah kecuali berbagai tambahan komentar dari mereka yang telah pernah membaca buku ini cetakan pertama. Yakni. saya menerima bejibun telepon dan SMS dari pembaca (maklum. tiga akan pikir-pikir dulu. hanya sekitar 2 minggu kemudian buku tersebut sudah beredar di pasaran.. deh. sementara sisanya bahkan untuk menjawab saja tak berani. Dan benar sesuai janji. Dari sembilan surat pembaca yang saya kirim untuk mencari mitra penerbit buku tersebut. hanya dua yang berani memuatnya. Bener. Kalau Anda membacanya 0 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? .

. Anda bisa merubah judulnya menjadi Kisah Ungu.Lampiran sambil menggunakan kacamata berlensa ungu.. Terserah.suka-suka Anda-lah ! Ini kan jamannya perubahan! CATATAN: Kisah biru ini saya tulis kembali berdasarkan tulisan saya dengan judul yang sama yang banyak beredar di internet. Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .

zamanku .Terima kasih khusus saya ucapkan kepada MODERATOR dan AKTIVIS milis (mailing list) di bawah ini yang telah banyak membantu upaya menerbitkan kembali buku ini: agromania. ppiindia. jaker. islamic_discussion_via_internet. katasibijak. ekonomiislami. resensibuku. komunitashistoria. relasimania. pantau-komunitas. bacayo. escaevabookclub. eramuslim. sulteng. sukasukamu. bukukita. indonesia-online. junior_trader. nasional-list. jelajahbudaya. tauziyah. wanita-muslimah. kolbu. jardiknas. buku-islam. pakguruonline. mediacare. milis-kammi. penulislepas. info_madani. indotalks. mobilemaniak. yok_ bacabuku. bmmi. kajian_lepaskerja. pasarbuku. cfbe (centre for the betterment of education). rezaervani. media-indonesia. dikmenjur. jurnalisme. diskusi-pembebasan. bhinneka_tunggal_ika. proletar. ebookmaniak. bandung_pusatbuku. pendidikan. dastanbooks. kebumian. referensi_ maya. lintaseni. wartawanindonesia. cikeas. tou-kawanua.

Kini. Pada masa itu. Lahir di Poso. sejak 2005 ia juga aktif sebagai Ketua Umum Forum Poso Bersatu. 18 Mei 1964. Juga masalah psikologi dan kesehatan (sesuai latar belakang pendidikanya) di berbagai media cetak Ibukota. PONTOH. dua bidang kepenulisan yang paling diminatinya. Di bidang hukum. ia juga tergolong penulis aktif angkatan kedua setelah angkatan Hamid Awaluddin (mantan Menteri Hukum dan HAM) di Identitas.Unhas (1983-1992) lalu terjun sebagai wiraswasta. lalu sejak 1994 pindah ke Jakarta dan bekerja sebagai direktur di sebuah perusahaan swasta terkenal. salah satu organisasi kepenulisan paling elite yang pernah ada di Makassar. koran kampus Universitas Hasanuddin Makassar. Alamat Email: rudypontoh@gmail. Sulawesi Tengah. Keaktifannya menulis di berbagai media membuat ia kemudian diangkat sebuah Ketua FPM (Forum Penulis Makassar). Pernah menjabat sebagai salah seorang direksi sebuah perusahaan properti di Yogyakarta. Antara tahun 1983 hingga 1986 ia aktif menulis masalah hukum dan internasional. sebuah organisasi kaum pemberani yang selama ini bertindak sebagai kontra provokator guna menghentikan dan meredam berulangnya konflik Poso. Kuliah di FK .com Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin?  .BIODATA PENULIS RUDY S. ia pernah berpolemik keras dan berkepanjangan dengan Achmad Ali (kini salah seorang tokoh hukum di Indonesia). di samping kesibukan bisnis.

.

......................................................................................................... 199 LAMPIRAN: Kisah Biru .................Menciptakan Kesempatan Kerja ................................................. 124 Meningkatkan Akses Rakyat Terhadap Layanan Kesehatan .................... 151 ...................................... 125 Memperbaiki Pengelolaaan Sumberdaya Alam ......... 123 ...... 126 BAGIAN TIGA : Data dan Angka Sebagai Indikator Janji Data dan Angka Media Massa ...................................... 177 ISTILAH DAN SINGKATAN ........................................................................................ BAGIAN LIMA: Setelah Terhembus Angin..................... 147 BAGIAN EMPAT : Dari Mereka yang Menunggu Realisasi Janji ........ Meningkatkan Kinerja dan Stabilitas Ekonomi Makro ..................... 131 Data dan Angka Warisan Megawati......... 122 .......................... 126 Merevitalisasi Pertanian dan Pedesaan ................. Menghapus Kemiskinan ............. 124 Meningkatkan Akses Rakyat Terhadap Pendidikan ......... 125 Menghapus Ketimpangan ... 207 BIODATA PENULIS .............................................. 213 Janji-janji dan Komitmen SBY-JK | (Edisi 2) Ternyata Hanya Angin? v ...................................................................................... 193 DAFTAR RUJUKAN ............

Sign up to vote on this title
UsefulNot useful