Anda di halaman 1dari 19

c c

   

 c     

Metode Pembelajaran dapat didefinisikan sebagai cara yang


digunakan guru untuk mencapai tujuan pembelajaran yang bersifat
prosedural yaitu berisi tahapan tertentu.

Suatu yang yang terpenting bagi seorang guru bukan hanya


menyampaikan informasi dan bahan ajar kepada siswa, melainkan guru
harus berusaha menciptakan agar siswa dapat memahami secara
keseluruhan isi dari materi pelajaran yang disampaikan.

Agar proses belajar-mengajar menjadi berhasil, untuk itu seorang


guru harus mampu mempersiapkan bahan-bahan untuk kegiatan belajar-
mengajar di kelas serta merancang model-model pembelajaran yang sesuai
agar siswa tidak bosan dan akan lebih menyenanginya. Banyak kejadian
di lapangan siswa yang merasa bosan terhadap salah satu mata pelajaran
dikarenakan metode yang digunakan oleh guru tidak mampu membuat
siswa mengerti materi bahkan akan timbul persepsi yang negatif. Misalkan
pada pelajaran IPS, siswa merasa jenuh dengan cara guru menerangkan
materi karena siswa tidak diberi kesempatan bebas untuk mengeluarkan
pendapat,tetapi hanya mendengarkan saja penjelasan dari guru sehingga
siswa merasa jenuh.

Dengan bekal kemampuan dan keterampilan dalam merancang


model-model pembelajaran tentunya guru memahami dan menguasai
materi serta mampu menentukan jenis model-model pembelajaran yang
sesuai dengan materi yang akan digunakan dalam kegitan belajar-
mengajar di kelas.

Salah satu model pembelajaran yang dapat diterapkan dalam


kegitan belajar- mengajar IPS SD Kelas 3 adalah Model Pembelajaran
 Model pembelajaran ini melatih siswa untuk belajar sendiri dan
menemukan sendiri pengetahuan. Proses pembelajarannya lebih berpusat
kepada siswa.

Banks (1990) mengemukakan bahwamodel pembelajaran IPS


dengan menggunakan inkury sosial untuk menghasilkan fakta, konsep,
generalisasi, dan teori.namun tujuan utama inkury sosial adalah untuk
membangun teori. Para ilmuwan sosial percaya salah satu cara membantu
masyarakat adalah dengan membangun teori. Teori dapat digunakan untuk
memehami, menjelaskan, memprekdisi, dan mengontrol perilaku
masyarakat. Selain itu, tujuan inkuri sosial pun diharapkan dapat
membantu masyarakat dalam memecahkamn masalah ± masalah sosial
sehingga mereka dapat memperoleh kehidupan yang lebih baik. Untuk itu
inkuri harus difokuskan pada masalah-masalah praktis kemasyarakatan.

Dalam inkuiry siswa dihadapakan pada suatu yang bersifat


misterius, yang belum diketahui tetapi dapat menarik siswa, masalah
tersebut harus didasarkan pada suatu gagasan yang memang dapat
ditemukan kebenarannya dan bukan hanya mengada-ada.

c
 u      

1. Adakah kesulitan guru dalam menentukan model pembelajaran yang


sesuai dengan materi yang akan diajarkan?
2. Bagaimana penerapan model pembelajaran À dalam proses belajar-
mengajar pada mata pelajaran IPS SD Kelas 3?
3. Bagaimana keaktifan siswa setelah guru menerapkan model
pembelajaran À ?
4. Apakah kelemahan dan kelebihan dari model pembelajran À?

è
      

Dengan proses inquiry, diasumsikan bahwa sekolah menyediakan


pengajaran yang terbaik kepada siswa untuk mengarahkan diri, berpikir
kritis, dan dapat memecahkan masalah. Karena itu inquiry mengajaran
yang berpusat pada siswa, menghendaki siswa terlibat secara aktif dalam
pengajaran, yang berarti siswa berlatih dalam proses inquiry.

Dengan proses inquiry siswa dilatih untuk melakukan proses .


penemuan (MÀ  dan proses pemecahan masalah   À
.
Siswa menemukan arti suatu konsep kemudian membuat suatu kesimpulan
dan menyusun suatu generalisasi dari data yang mereka simpulkan.

Pembelajaran inquiry dipandang lebih efektif karena secara pribadi


terlibat ( baik fisik dan mental ) dalam kegitan belajar mengajar. Namun
model ini memakan waktu banyak (time consuming) dan, jika kurang
terpimpin atau terarah, dapat menjurus pada kekacauan dan kekaburan atas
materi yang dipelajarainya.


      


   c    

a. Untuk mempersiapkan bahan ± bahan untuk kegiatan belajar


mengajar di kelas.
b. Mengetahui pentingnya sebuah perencanaan yang matang agar
proses belajr mengajar berjalan dengan baik.
º
   c  

a. Guru diharapkan sedapat mungkin memperbanyak latihan dalam


merancang model-model pembelajaran.
b. Menciptakan proses belajar mengajar yang lebih efektif dengan
menerapan model pembelajaran Inkuiry.

¦
   c  

a. Melatih siswa untuk mampu memecahkan masalah damn menarik


kesimpulan sendiri.
b. Siswa lebih berperan aktif, belajar melakukan penelitian dalam
pembelajaran.
c c

    


     

Inquiri berasal dari kata ÷ À À yang berarti ikut serta, atau
terlibat, dalam mengajukan pertanyaan-pertanyaan, mencari informasi, dan
melakukan penyelidikan. Ia menambahkan bahwa pembelajaran inkuiri ini
bertujuan untuk memberikan cara bagi siswa untuk membangun
kecakapan-kecakapan intelektual (kecakapan berpikir) terkait dengan
proses-proses berpikir reflektif. Jika berpikir menjadi tujuan utama dari
pendidikan, maka harus ditemukan cara-cara untuk membantu individu
untuk membangun kemampuan itu.(----------------------

Sejak manusia lahir ke dunia, manusia memiliki dorongan untuk


menemukan sendiri pengetahuannya. Rasa ingin tahu tentang alam sekitar
di sekelilingnya merupakan kodrat manusia sejak ia lahir ke dunia. Sejak
kecil manusia memiliki keinginan untuk mengenal segala sesuatu melalui
indera penglihatan, pendengaran, pengecapan dan indera-indera lainnya.
Hingga dewasa keingintahuan manusia secara terus menerus berkembang
dengan menggunakan otak dan pikirannya. Pengetahuan yang dimiliki
manusia akan bermakna (À
) apabila didasari oleh keingintahuan
itu. Didasari hal inilah suatu model pembelajaran yang dikenal dengan
inkuiri dikembangkan.

Selanjutnya Sanjaya (2008;196) menyatakan bahwa ada beberapa


hal yang menjadi ciri utama strategi pembelajaran inkuiri. ÷,
strategi inkuiri menekankan kepada aktifitas siswa secara maksimal untuk
mencari dan menemukan, artinya pendekatan inkuiri menempatkan siswa
sebagai subjek belajar. Dalam proses pembelajaran, siswa tidak hanya
berperan sebagai penerima pelajaran melalui penjelasan guru secara
verbal, tetapi mereka berperan untuk menemukan sendiri inti dari materi
pelajaran itu sendiri.
M seluruh aktivitas yang dilakukan siswa
diarahkan untuk mencari dan menemukan sendiri dari sesuatu yang
dipertanyakan, sehingga diharapkan dapat menumbuhkan sikap percaya
diri (   À ). Artinya dalam pendekatan inkuiri menempatkan guru
bukan sebagai sumber belajar, akan tetapi sebagai fasilitator dan motivator
belajar siswa. Aktvitas pembelajaran biasanya dilakukan melalui proses
tanya jawab antara guru dan siswa, sehingga kemampuan guru dalam
menggunakan teknik bertanya merupakan syarat utama dalam melakukan
inkuiri.
÷À
 tujuan dari penggunaan strategi pembelajaran inkuiri
adalah mengembangkan kemampuan intelektual sebagai bagian dari
proses mental, akibatnya dalam pembelajaran inkuiri siswa tidak hanya
dituntut agar menguasai pelajaran, akan tetapi bagaimana mereka dapat
menggunakan potensi yang dimilikinya.
c c

c   

     !    

Inquiry merupakan komponen dari CTL. Inquiry adalah proses


perpindahan dari pengamatan menjadi pemahaman, Yang di awalai dari
pengamatan dari pertanyaan yang muncul. Jawaban pertanyaan ±
Pertanyaan tersebut didapat melalui siklus menyusun dugaan, menyusun
hipotesis, membuat pengamatan lebih jauh, dan menyusun teori serta
konsep yang berdasar pada data dan pengetahuan. Di dalam pembelajaran
berdasarkan inquiry, siswa belajar menggunakan ketrampilan berpikir
kritis saat mereka berdiskusi dan menganalisis bukti, mengevaluasi ide dan
proposisi, merefleksi validitas data, memproses, membuat kesimpulan.
Kemudian menentukan bagaimana mempresentasikan dan menjelaskan
penemuannya, dan menghubungkan ide ± ide atau teori untuk
mendapatkan konsep.

Melakukan inquiry berarti melibatkan diri dalam tanya jawab,


mencari informasi dan melakukan penyelidikan. Karena itu strategi inquiri
dalam proses belajar mengajar adalah strategi yang melibatkan siswa
dalam tanya jawab, mencari informasi, dan melakukan penyelidikan.
Dalam pelaksanaan siswa bertanggung jawab untuk memberikan ide atau
pemikiran dan pertanyaan untuk eksplorasi, mengajukan hipotesa untuk
diuji, menguji hipotesa, dan sampai pada pengambilan kesimpulan yang
masih tentatif. Inquiry ada banyak bentuk dan model, dan pemecahan
,masalah adalah salah satu dari kegiatan inquiry yang paling sering
digunakan. Proses ini terdiri dari 5 tahap. Siswa menghadapi atau
dihadapkan pada suatu permasalahan, kemudian siswa bekerja untuk
memecahkan masalah itu dengan meneliti untuk suatu pemecahan. Dalam
proses itu, suatu kemungkinan pemecahan atau suatu hipotesa diajukan,
kemudian penyelidikan dilakukan untuk membuktikan apakah
kemungkinan pemecahan atau hipotesa itu diterima atau ditolak. Dengan
dasar kata yang telah terkumpul, dan pengujian untuk pemecahan, siswa
akan sampai pada suatu kesimpulan yang masih tentatif, atau menolak
hipotesa itu dan melanjutkan penyelidikan sampai menemukan pemecahan
masalah yang memuaskan.
c
 "  

Inquiry terbagi menjadi tiga jenis berdasarkan besarnya intervensi


guru terhadap siswa atau besarnya bimbingan yang diberikan oleh guru
kepada siswanya.


   #O  

 0

Pendekatan inquiry terbimbing yaitu pendekatan inquiry dimana


guru membimbing siswa melakukan kegiatan dengan memberi pertanyaan
awal dan mengarahkan pada suatu diskusi. Guru mempunyai peran aktif
dalam menentukan permasalahan dan tahap-tahap pemecahannya.
Pendekatan inkuiri terbimbing ini digunakan bagi siswa yang kurang
berpengalaman belajar dengan pendekatan inkuiri. Dengan pendekatan ini
siswa belajar lebih beorientasi pada bimbingan dan petunjuk dari guru
hingga siswa dapat memahami konsep-konsep pelajaran. Pada pendekatan
ini siswa akan dihadapkan pada tugas-tugas yang relevan untuk
diselesaikan baik melalui diskusi kelompok maupun secara individual agar
mampu menyelesaikan masalah dan menarik suatu kesimpulan secara
mandiri.

Pada dasarnya siswa selama proses belajar berlangsung akan


memperoleh pedoman sesuai dengan yang diperlukan. Pada tahap awal,
guru banyak memberikan bimbingan, kemudian pada tahap-tahap
berikutnya, bimbingan tersebut dikurangi, sehingga siswa mampu
melakukan proses inkuiri secara mandiri. Bimbingan yang diberikan dapat
berupa pertanyaan-pertanyaan dan diskusi multi arah yang dapat
menggiring siswa agar dapat memahami konsep pelajaran matematika. Di
samping itu, bimbingan dapat pula diberikan melalui lembar kerja siswa
yang terstruktur. Selama berlangsungnya proses belajar guru harus
memantau kelompok diskusi siswa, sehingga guru dapat mengetahui dan
memberikan petunjuk-petunjuk dan  MÀ
yang diperlukan oleh
siswa.

º
  c #× 

 0

Pada umumnya pendekatan ini digunakan bagi siswa yang telah


berpengalaman belajar dengan pendekatan inkuiri. Karena dalam
pendekatan inkuiri bebas ini menempatkan siswa seolah-olah bekerja
seperti seorang ilmuwan. Siswa diberi kebebasan menentukan
permasalahan untuk diselidiki, menemukan dan menyelesaikan masalah
secara mandiri, merancang prosedur atau langkah-langkah yang
diperlukan.

Selama proses ini, bimbingan dari guru sangat sedikit diberikan


atau bahkan tidak diberikan sama sekali. Salah satu keuntungan belajar
dengan metode ini adalah adanya kemungkinan siswa dalam memecahkan
masalah   MM dan mempunyai alternatif pemecahan masalah lebih
dari satu cara, karena tergantung bagaimana cara mereka mengkonstruksi
jawabannya sendiri. Selain itu, ada kemungkinan siswa menemukan cara
dan solusi yang baru atau belum pernah ditemukan oleh orang lain dari
masalah yang diselidiki.

Sedangkan belajar dengan metode ini mempunyai beberapa


kelemahan, antara lain: 1) waktu yang diperlukan untuk menemukan
sesuatu relatif lama sehingga melebihi waktu yang sudah ditetapkan dalam
kurikulum, 2) karena diberi kebebasan untuk menentukan sendiri
permasalahan yang diselidiki, ada kemungkinan topik yang diplih oleh
siswa di luar konteks yang ada dalam kurikulum, 3) ada kemungkinan
setiap kelompok atau individual mempunyai topik berbeda, sehingga guru
akan membutuhkan waktu yang lama untuk memeriksa hasil yang
diperoleh siswa, 4) karena topik yang diselidiki antara kelompok atau
individual berbeda, ada kemungkinan kelompok atau individual lainnya
kurang memahami topik yang diselidiki oleh kelompok atau individual
tertentu, sehingga diskusi tidak berjalan sebagaimana yang diharapkan.

¦
    c   !   # d × ×  

 0

Pendekatan ini merupakan kolaborasi atau modifikasi dari dua


pendekatan inkuiri sebelumnya, yaitu: pendekatan inkuiri terbimbing dan
pendekatan inkuiri bebas. Meskipun begitu permasalahan yang akan
dijadikan topik untuk diselidiki tetap diberikan atau mempedomani acuan
kurikulum yang telah ada. Artinya, dalam pendekatan ini siswa tidak dapat
memilih atau menentukan masalah untuk diselidiki secara sendiri, namun
siswa yang belajar dengan pendekatan ini menerima masalah dari gurunya
untuk dipecahkan dan tetap memperoleh bimbingan. Namun bimbingan
yang diberikan lebih sedikit dari Inkuiri terbimbing dan tidak terstruktur.

Dalam pendekatan inkuiri jenis ini guru membatasi memberi


bimbingan, agar siswa berupaya terlebih dahulu secara mandiri, dengan
harapan agar siswa dapat menemukan sendiri penyelesaiannya. Namun,
apabila ada siswa yang tidak dapat menyelesaikan permasalahannya, maka
bimbingan dapat diberikan secara tidak langsung dengan memberikan
contoh-contoh yang relevan dengan permasalahan yang dihadapi, atau
melalui diskusi dengan siswa dalam kelompok lain.

Ñ
   

Model pembelajaran ini dikembangkan oleh seoranh tokoh yang


bernama Suchman. Suchman menyakinkani bahwa anak-anak merupakan
individu yang penuh rasa ingin tahu akan segala sesuatu. Oleh karena itu,
prosedur ilmiah dapat diajarkan secara langsung kepada mereka. Berikut
ini adalah postulat yang diajukan oleh Suchman untuk mendukung teori
yang mendasari model pembelajaran ini.
1. Secara alami manusia mempunyai kecenderungan untuk selalu mencari
tahu segala sesuatu yang menarik perhatiannya.
2. Mereka akan menyadari keingintahuan akan segala sesuatu tersebut dan
akan belajar untuk menganalisis strategi berpikirnya.
3. Strategi baru dapat diajarkan secara langsung dan
ditambahkan/digabungkan dengan strategi lama yang telah dimiliki
siswa.
4. Penelitian kooperatif (cooperative inquiry) dapat memperkaya
kemampuan berpikir dan membantu siswa belajar tentang suatu ilmu
yang senantiasa bersifat tentatif dan belajar menghargai penjelasan atau
solusi alternatif.

Secara singkat model ini bertujuan untuk melatih kemampuan siswa


dalam meniliti, menjelaskan, fenomena, dan memecahakan masalah
secara almiah.

è
  "   

1. Guru harus terampil memilih persoalan ± persoalan yang relevan untuk
diajukan kepada kelas (persoalan bersumber pada bahan pelajaran
yang menantang siswa atau yang problematis) dan sesuai dengan daya
nalar siswa.

2. Guru harus terampil menumbuhkan motivasi belajar siswa dan


menciptakan situasi belajar yang menyenangkan.

3. Adanya fasilitas dan sumber belajar yang cukup

4. Adanya kebebasan siswa untuk berpendapat, berkarya, berdiskusi.

5. Partisipasi setiap siswa dalam setiap kegiatan belajar.

6. Guru tidak banyak campur tangan dan intervensi terhadap kegiatan
siswa.


      $     $     $      
  %   


1. Tujuan Utama

Tujuan utama pengajaran inquiry adalah menyediakan peralatan atau cara


bagi siswa untuk mengembangkan ketrampilan intelektualnya yang
berkaitan dengan berfikir kritis dan memecahkan masalah. Apabila
berpikir merupakan tujuan pendidikan, maka cara yang harus dipikirkan
adalah untuk membantu mengembangkan kemampuan individual.
Perhatian utama pada inquiry adalah pengembangan proses mental seperti
mengidentifikasi dan menganalisis masalah, menyusun hipotesa,
mengumpulkan dan mengklasifikasi data yang relevan, menafsirkan dan
meferivikasi data, menguji hipotesa dan sampai pada suatu kesimpulan.
Inquiry meminta siswa untuk berfikir secara bebas. Siswa ditingkatkan
kemampuannya untuk dapat menemukan sesuatu untuk diri mereka sendiri
dengan mengaplikasikan prinsip metode ilmiah inquiry. Melalui inquiry,
mereka akan ³belajar bagaimana belajar´. Inquiry menekankan
menemukan sesuatu untuk diri mereka sendiri. Tujuan inquiry adalah
memberi latihan untuk mengembangkan ketrampilan intelektual yang
khusus, tidak mencakup menspesifikasi faktor ± faktor dari suatu ilmu.

2. Peranan Guru

Karena inquiry adalah pembelajaran yang terpusat pada siswa, maka


peranan guru adalah sebagai pembimbing dan sebagai stimulator; sebagai
fasilitator yang berhadapan dengan siswa membantu mereka
mengidentifikasi pertanyaan dan masalah, dan membimbing dalam
melakukan penyelidikan. Guru membuat suasana yang menjamin
kebebasan untuk melakukan eksplorasi, melakukan hubungan pribadi yang
baik, dan bersamaan dengan itu diperlukan bantuan psycologis. Sejauh
mungkin guru berusaha untuk meningkatkan cara kerja siswa secara bebas.
Guru membantu siswa dalam menemukan sumber informasi yang tepat
dan bertanggung jawab bahwa sejumlah sumber pengajaran itu cukup dan
digunakan. Guru menyusun kembali dan mengklarifikasi respon siswa,
dan menyarankan suatu alternatif penafsiran terhadap data. Situasinya
dibuat sedemikian rupa sehingga inquiry dapat berjalan dengan baik.
Karena itu siswa tidak secara keseluruhan bebas mengluyur sendiri
melakukan inquiry. Guru tidak menekankan kebenaran jawaban, tetapi
membantu siswa menemukan dan mengklarifikasi jawaban yang tepat.
Guru harus memilikiketrampilan khusus dalam bertanya yang dapat
meningkatkan berfikir kritis dan dapat memecahkan masalah.

3. Peranan Siswa

Peranan siswa dalam pengajaran inquiry adalah sebagai pengambil inisiatif


atau prakarsa dalam menemukan sesuatu untuk mereka sendiri. Mereka
aktif menggunakan cara belajar mereka sendiri. Sesungguhnya, tidak
diharapkan bahwa mereka tidak dibimbing dalam penyelidikan mereka,
tetapi diharapkan bahwa mereka ditingkatkan keberanian mengajukan
pertanyaan, untuk merespon masalah yang diberikan, dan berfikir untuk
alternatif pemecahan. Dengan keterbatasannya, siswa dengan bantuan guru
menyusun tujuan mereka sendiri. Siswa bebas melakukan eksplorasi, dan
diberi kesempatan untuk malakukan pemilihan alternatif pemecahan
masalah. Peranan siswa tidak hanya merespon pertanyaan yang diajukan
guru, tetapi juga mengajukan pertanyaan dan menemukan jawabannya
melalui penyelidikan.

4. Penggunaan Sumber Pengajaran

Berlawanan seperti apa yang sering dianggap, model inquiri tidak


memerlukan menggunakan materi pengajaran. Sumber ± sumber seperti
buku teks, buku pertanyaan atau anjuran, film, film strip, gambar, nara
sumber, perpustakaan dapat digunakan secara efektif untuk penyelidikan
inquiry. Dalam pengajaran inquiry seperti halnya dengan model yang lain,
masalahnya bukan sumber pengajaran apa, tetapi bagaimana mereka
menggunakan sumber pengajara itu. Inquiry memerlukan data untuk
penafsiran. Sumber pengajaran itu digunakan untuk membuka tabir
pertanyaan yang berupa hipotesa.

5. Evaluasi

Evaluasi hasil belajar siswa pada model inquiry dipusatkan pada sampai
sejauh mana siswa dapat menggunakan ketrampilan intelektual yang
berhubungan dengan pengajaran inquiry. Siswa tidak hanya dievaluasi
pada kemampuan mengingat (recall) dan mereproduksi informasi, Tetapi
inquiry mengutamakan bagaimana siswa itu menghasilkan dan
meferivikasi permasalahan. Seringkali, bila inquiry digunakan maka
evaluasinya didasarkan pada banyak pengetahuan yang dipindahkan. Tes
yang berstandart memusatkan pada pengukuran berfikir kritis dan
ketrampilan memecahkan masalah adalah lebih tepat dibandingkan
dengan evaluasi yang mendasarkan diri terutama pada penguasaan suatu
bidang ilmu.

SINTAKSIS MODEL INQUIRY

Tahap Satu : Menghadapkan pemasalahan.


Penjelasan prosedur inquiry.
Menyampaikan peristiwa peristiwa yang kontradiksi.

Tahap Dua : Pengumpulan data dan verivikasi.


Memverifikasi benda, keadaan, sifat dan peristiwa.

Tahap Tiga : Pengumpulan data eksperimentasi.


Mengisolasi variabel yang relevan.
Menyusun dan menguji hipotesa.
Hubungan sebab akibat.
Tahap Empat : Mengorganisir, Formulasi dan Penjelasan.
Menyusun aturan atau penjelasan.

Tahap Lima : Analisis Proses inquiry


Analisis strategi inquiry dan mengembangkan proses
inquiry lebih efektif.


     !  

1. Koneksi

 proses koneksi melalui : konsiliasai, pertanyaan, dan observasi


 proses koneksi melalui : konsiliasai, pertanyaan, dan observasi
 proses koneksi melalui : konsiliasai, pertanyaan, dan observasi
siswa mampu menghubungkan pengetahuan sains pribadi dengan
konsep komunitas sains.
Dilakukan dengan diskusi bersama, eksplorasi fenomena
Guru mendorong untuk mendiskusikan dan menjelaskan
pemahaman mereka bagaimana suatu fenomena bekerja,
menggunakan contoh dari pengalaman pribadi, menemukan
hubungan dengan literature.

2. Desain

 Proses desain melalui prosedur materi.


 Siswa membuat perencanaan mengumpulkan data yang bermakana
yang ditujukan pada pertanyaan. Disini terjadi integrasi konsep
sains dengan proses sains.
 guru memantauketepatanaktifitassiswa

3. Investigasi

 proses melalui koleksi dan mempresentasikan data


 siswa dapat membaca data secara akurat, mengorganisasi data
dengan cara yang logis dan bermakna, dan memperjelas hasil
penyelidikan.

4. MembangunPengetahuan

 proses melalui reflektif ± konstruksi ± prediksi.


 konsep yang dilakukan dengan eksperimen akan memberi arti yang
lebih bermakna dan mampu berfikir kritis. Ia harus
menghubungkan antara interpretasi ilmiah yang diterima.
siswadapatmengaplikasikanpemahamannyapadasituasibaru yang
mengembangkaninferensi, generalisasi, danprediksi.
 gurubertukarpendapatterhadappemahamansiswa.

o
 &   

Salah satu model inquiry yang berangkat dari fakta sampai pada teori,
adalah latihan inquiry yang dianjurkan oleh Bruce Joyce dan Marsha Weil
(1986). Kelima tahap pelaksanaan inquiry adalah sebagai berikut :

a. Tahap pertama, guru memberi permasalahan, dan menjelaskan


prosedur pelaksanaan inquiry kepada siswa. Di dalam penjelasan
diaturkan tentang tujuan, dan prosesnya dilakukan dengan ³yes and no
questions´ yaitu pertanyaan yang diajukan siswa, dan akan dijawab
oleh guru dengan ³jawaban ya atau tidak´. Dalam memberikan
permasalahan dapat berupa peristiwa yang kontradiksi, teka ± teki
yang sederhana yang tidak banyak memerlukan latar belakang
pengetahuan tentang teka ± teki tersebut. Namun permulaan
pelaksanaan inquiry dapat dimulai dengan masalah yanmg sederhana,
ide atau pikiran yang sederhana, dan dapat juga berbentuk tekai ± teki.
Yang diutamakan dalam hal ini ialah pengalaman proses berfikir
secara inquiry.

b. Tahap kedua, ialah verifikasi, dimana para siswa mengumpulkan data
atau informasi tentang peristiwa (masalah) yang telah mereka lihat
atau alami, dengan mengajukan pertanyaan kepada guru sedemikian
rupa sehingga guru terpaksa menjawab ³ya atau tidak´.

c. Tahap ketiga, ialah melakukan eksperimentasi. Siswa mengajukan


faktor atau unsur yang baru ke dalam permasalahan untuk dapat
melihat apakah peristiwa itu dapat terjadi secara berbeda. Walaupun
tahap kedua dan ketiga terpisah, namun cara berpikir siswa dan bentuk
pertanyaan yang diajukan umumnya berada di antara dua tahap ini.

Eksperimen memiliki dua fungsi; yaitu eksplorasi dan menguji langsung.


Eksplorasi adalah merubah sesuatu untuk melihat apa yang akan terjadi
dan tidak perlu bimbingan teori atau hipotesis, tetapi dapat memberi saran
untuk suatu teori. Menguji secara langsung terjadi bila siswa melakukan
uji coba teori atau hipotesa. Proses merubah hipotesa kedalam
eksperimentasi adalah tidak mudah dan memerlukan latihan atau praktek.
Banyak pertanyaan verifikasi dan eksperimen diperlukan hanya untuk
meneliti suatu teori.

Tugas berikutnya dari guru ialah memperdalam proses inquiry siswa


dengan memperluas jenis-jenis informasi yang mereka peroleh. Dalam
proses verifikasi mereka boleh mengajukan pertanyaan tentang :

1) Benda (obyects)

2) Sifat (properties)

3) Kondisi (conditions)

4) Peristiwa (events)

d. Tahap keempat, guru meminta siswa untuk mengorganisir data dan
menyusun suatu penjelasan. Biasanya siswa mendapatkan kesulitan
dalam membuat lompatan intelektual, dari informasi yang komprehen
yang mereka kumpulkan menjadi suatu penjelasan yang cukup jelas.
Mereka diperkenankan memberi penjelasan yang kurang dengan
menghilangkan beberapa bagian yang penting. Seringkali ada beberapa
teori atau penjelasan yang didasarkan pada data yang sama.

e. Tahap kelima, siswa diminta untuk menganalisis proses inquiry.


Mereka boleh menentukan bahwa pertanyaan itu efektif atau tidak
efektif, pertanyaan itu produktif atau tidak produktif, ada informasi
yang diperlukan tapi tidak diperoleh. Tahap ini penting jika kita ingin
membuat proses inquiry secara sadar dan secara sistematis mencoba
untuk memperbaikinya.


  !   

Di dalam sistem belajar ± mengajar ini, guru menyajikan bahan pelajaran


tidak dalam bentuknya yang final, tetapi peserta didik yang diberi peluang
untuk mencari dan menemukan sendiri dengan mempergunakan teknik
pendekatan pemecahan masalah. Secara garis besar prosedurnya sebagai
berikut :

1. Stimulation : Guru mulai dengan bertanya mengajukan mengajukan


persoalan, atau menyuruh peserta didik membaca atau mendengarkan
uraian yang memuat permasalahan.

2. Problem statement : Peserta didik diberi kesempatan untuk


mengidentifikasi berbagai permasalahan, sebanyak mungkin
memilihnya yang dipandang paling menarik dan fleksibel untuk
dipecahkan. Permasalahan yang dipilih ini selanjutnya harus
dirumuskan dalam bentuk pertanyaan atau hipotesis (pernyataan
sebagai jawaban sementara atas pertanyaan tersebut).

3. Data collection : Untuk menjawab pertanyaan atau membuktikan benar


tidaknya hipotesis itu, peserta didik diberi kesempatan untuk
mengumpulkan berbagai informasi yang relevan., dengan jelas
membaca literatur mengamati objeknya, mewawancarai orang sumber,
mencoba (uji coba) sendiri, dan sebagainya.

4. Data processing : Semua informasi (hasil bacaan wawancara,


observasi, dan sebagainya) itu diolah, diacak, diklasifikasikan,
ditabulasikan, bahkan kalu perlu dihitung dengan cara tertentu serta
ditafsirkan pada tingkat kepercayaan tertentu.

5. Verifikation : Berdasarkan hasil pengolahan dan tafsiran atau


informasi yang ada tersebut (available information), pertanyaan atau
hipotesis yang telah dirumuskan terdahulu itu kemudian dicek, apakah
terjawab atau, dengan kata lain, terbukti atau tidak.

6. Generalization : Tahap selanjutnya, berdasarkan hasil verifikasi tadi


siswa belajar menrik generalisasi atau kesimpulan tertentu.


 è  &   ! ¦

Pembelajaran IPS dengan menggunakan pendekatan inquiry dapat di


terapkan pada semua jenjang dan kelas. Untuk siswa sekolah dasar pada
kelas-kelas rendah dapat juga menggunakan pendekatan inquiry ini
melalui pembelajaran-pembelajaran yang sederhana, misalnya siswa
mengawali dengan belajar bagaimana belajar dan bekerja dengan
menggunakan peta dan globe. Dibawah ini adalah contoh pembelajaran
inquiry tentang ³Peta dan Globe´ pada kelas 3 SD.
Tujuan: Pada akhir proses belajar mengajar diharapkan para siswa dapat
(1) mengenal simbol-simbol yang ada di dalam peta dan (2)
mengemukakan alasan mengapa harus menggunakan simbol yang
berbeda-beda.

Prosedur: Bimbinglah siswa melalui langkah-langkah berikut ini:

Tahap 1

Guru: Siapa diantara kamu yang pernah melihat danau? Sungai? Adakah
diantara kamu yang pernah melihat laut? Seperti apakah sungai, danau,
dan laut itu? (Siswa menjawab setiap pertanyaan. Kembangkan pertanyaan
itu hingga para siswa menyebutkan bahwa semua tempat itu berisi air.)
Tahukah kamu bahwa lautan lebih luas daripada daratan? Orang yang
membuat peta dan globe mempunyai kesulitan karena harus dapat
meyakinkan orang lain wilayah mana yang berupa daratan dan wilayah
mana yang berbentuk lautan.

Tahap 2

Guru: Bagaimana pembuat globe untuk mengatasi kesulitan ini?


Bagaimana pendapatmu tentang cara menunjukkan lokasi perairan?

Kemungkinan jawaban siswa:

y Mungkin siswa menuliskan kata ³air´ pada tempat yang ada airnya.

y Mungkin juga mereka menggambar gelombang pada tempat yang


ada airnya.

y Mereka mungkin mewarnai bagian/tempat yang ada airnya.

Tahap 3

Guru: Anggaplah bahwa kita adalah ilmuwan yang akan menguji pendapat
siapa yang paling tepat. Mari kita lihat bola dunia ini. (Pegang bola dinia
ini) Coba berikan nama laut ini? (Apabila kamu tidak tahu coba bantu oleh
yang lainnya) Baiklah, mari kita lihat Laut Jawa. Ini ada di peta? Apa
warnanya? (Siswa menjawab: ³biru´) Mari lihat pula Samudra Indonesia.
Inilah ada di peta. Apa warnanya? (Siswa menjawab: ³warnanya sama ±
biru´)

Tahap 4

Beri lagi pertanyaan untuk membuktikan bahwa mereka telah


menguasainya. Beri pula dorongan agar mereka bercerita atau menjelaskan
apa yang telah mereka ketahui.
Guru: Berdasarkan informasi yang telah kita diketahui, bagaimana
pembuat bola dunia menggambar lautan agar berbeda dengan simbol
lainnya? (Siswa menjawab: ³warnanya biru´) Tahukah kamu, mengapa
pembuat bola dunia memilih cara membuat simbol laut dengan warna
biru? Maksud saya, mengapa mereka tidak menuliskan ³air´ pada tempat-
tempat yang menunjukan lautan atau menggambarkan gelombang? (Para
siswa menjawab: ³Apabila pembuat bola dunia itu menuliskan kata µair´
maka ia harus menuliskan kata air beberapa kali´. Karena ada wilayah
perairan laut yang sempit sehingga akan sulit menuliskan kata ³air´ pada
tempat itu´. ³Akan sulit juga menuliskan kata ³air´ untuk menunjukan
suatu ³sungai´. ³Menggambarkan gelombang untuk lautan mungkin saja,
namun kesulitan untuk sungai´.)

Tahap 5

Tahap ini adalah kesimpulan dari seluruh pelajaran. Selain itu, pada tahap
ini pun dirancang untuk membuat penjelasan umum yang dapat diterapkan
dalam situasi lainnya.

Guru: Dari apa yang telah kita pelajari, dapatkah kamu mengemukakan
simbol wilayah perairan pada peta dan bola dunia (globe)? (Siswa
menjawab: ³Wilayah perairan itu digambarkan dengan warna biru´).

Marilah kita perhatikan peta dan bola dunia lainnya. Samakah simbol yang
dibuat untuk wilayah perairan laut? (Guru dan siswa melihat-lihat peta dan
bola dunia lainnya.) Kesimpulannya: ³Umumnya pada peta dan bola
dunia, warna biru digunakan untuk menunjukan perairan´.

Pembelajaran dengan menggunakan pendekatan inquiry di sekolah dasar


untuk kelas yang lebih tinggi dapat dengan cara melakukan analisis
terhadap suatu data . Di bawah ini ditampilkan suatu contoh model inquiry
untuk siswa SD kelas 6 dengan topik kependudukan.


  !     


À 

Bahwa hasil belajar dengan cara ini lebih mudah dihafal dan diingat,
mudah ditransfer (untuk menghadapi pemecahan masalah). Pengetahuan
dan kecakapan (intelektual potency) peserta didik yang bersangkutan lebih
jauh lagi dapat menumbuhkan motif intrinsik (karena peserta didik merasa
puas atas penggunannya sendiri).


 
Kelemahan dari inquiry antara lain memakan waktu banyak (time
consuming) dan, kalau kurang terpimpin atau terarah, dapat menjurus pada
kekacauan dan kekaburan atas materi yang dipelajarainya.


 c   &   

 Guru memilih tingkah


laku/tujuan
1

2
Guru mengajukan pertanyaan yang dapat
menumbuhkan siswa menemukan pendapatnya

Siswa menetapkan hipotesis /praduga jawaban


3
untuk dikaji lebih lanjut (alternatif jawaban)

Secara spontan siswa Siswa tidak banyak


menjelajahi informasi/data berusaha mencari
4a untuk menguji praduga, baik 3a informasi untuk
secara individu ataupun membuktikan praduga
secara kelompok
Siswa menarik Guru membantu siswa,
kesimpulan mendorong melakukan kegiatan
4b
belajar untuk mencari informasi
yang diperoleh

Inquiry
Siswa mengidentifikasi
beberapa kemungkinan
5
jawaban/menarik
kesimpulan

Keterangan :

Jalur 1 ± 2 ± 3 ± 4a ± 5

1 ± 2 ± 3 ± 3a ± 4b ± 5

c c'





A. &  

Model pembelajaran inkuiry dapat dilakukan dengan cara- cara


sebagai beriktu :
y Didasarkan pada artefak (artifact) yaitu benda ± benda hasil
kepandaian manusia. Misalnya manusia diminta mempelajari
makna simbol yang terdapat pada mata uang bangsanya.

y Inquiry berdasarkan situasi masalah yang diminta pemecahan,


contoh untuk bentuk ini telah dikemukakan dalam perilaku
pemecahan masalah.

y Inquiry berdasarkan isu ± isu yang kontroversial atau kejadian


sekarang. Misalnya adanya protes dari penduduk suatu wilayah
tentang pencemaran limbah industri terhadap sumber air penduduk.
y Inquiry yang berdasarkan pada konsep ± konsep yang ditemukan
dalam pelajaran, misalnya mempelajari bagaimana kontak dengan
budaya lain mempengaruhi cara kehidupan. Misalnya kontak ±
kontak yang dilakukan oleh suku terasing dengan kelompok
masyarakat lain dan pengaruhnya terhadap suku terasing tersebut.

y Inquiry yang didasarkan pada potret dan ilustrasi. Gambar dan


ilustrasi adalah untuk meningkatkan ketelitian terhadap konsep
yang dikemukakan dalam buku teks IPS. Untuk itu misalnya guru
dapat mengajukan pertanyaan pada siswa misalnya:

1)Apa hubungan antara gambar atau ilustrasi tersebut dengan


materi/konsep yang kita bicarakan ? atau
2)Kapan gambar tersebut dibuat?

B. Saran