2/14/2011

A list of scanned Sanskrit books at III…

12780 laghupaaraasharii... gagaavishhnd-a shriikruushhnd-adaasa, General. Sanskrit, 2005. 44 pgs. 127801 vrxddhayavanajaatakama... davis pingree, General. Sanskrit, 2005. 452 pgs. 12782 kaavyaadashar... acharya ramachandra mishra, General. Sanskrit, 2005. 332 pgs. 12783 muhhuurtachintaamand-i... narayana acharya, General. Sanskrit, 2005. 492 pgs. 12787 taajikaniilakand-t'hii... pandit srimadhukantagana jyotishacharya, General. Sanskrit, 2005. 478 pgs. 12789 liilaavatii... pt.shri lakhanlal jha, General. Sanskrit, 2005. 386 pgs. 12790 rupachandrikaa... ramachandrajhaa vyaakarand-aachaayra, Religion. Theology. Sanskrit, 0. 318 pgs. 12790 rupachandrikaa... ramachandrajhaa vyaakarand-aachaayra, Religion. Theology. Sanskrit, 0. 672 pgs. 12793 sachitra jyotishha - shiqs-aa... b.c thakur, General. Sanskrit, 2005. 270 pgs. 12794 jyotishha vdaaraa roga upacchara... prem kumer sarma, General. Sanskrit, 2005. 214 pgs. 12795 shatayoogaman'jari... madhurakrishnamurthy sastry, General. Sanskrit, 2005. 92 pgs. 12796 muhuurtadarpand-amu... vavilla rama swamy sastrylu and sons, General. Sanskrit, 2005. 180 pgs. 12798 vitti evan' vuutti prabandha... aacharya mukund devagna, General. Sanskrit, 2005. 254 pgs. 12802 Jyotishha ratnaakara... devakiinandana sih, General. Sanskrit, 2005. 1118 pgs. 12803 dasharsurpakamuu... keshavaraava musalagaavakara:, General. Sanskrit, 2005. 574 pgs. 12804 saahityadaprand-ama... aachaariya sheshharaajashamaa regmii, General. Sanskrit, 2005. 1146 pgs. 12805 chamatkaara chintaamand-i... malaviyadaivajna dharmesvara, General. Sanskrit, 2005. 556 pgs. 12807 bharatiiya jyotishha... nemichandra sastri, General. Sanskrit, 2005. 450 pgs. 12808 sachitra jyotishha shiqs-a... b.c thakur, General. Sanskrit, 2005. 904 pgs. 12809 shhad'avagar phalamuu... krishan kumer, General. Sanskrit, 2005. 450 pgs. 12810 ladhupaaraasharii madhyaparaasharii... kedaaradatta joshii, Religion. Theology. Sanskrit, 0. 128 pgs. 12811 vrxddhayavanajaaakamuu... davis pingree, General. Sanskrit, 2005. 414 pgs. 12812 vasan'taraajashaakuna... -, General. Sanskrit, 2005. 610 pgs. 12815 saaraavaali... -, General. Sanskrit, 2005. 400 pgs. 12816 sarvaarda chin'taamand-i... sri kambampati ramgopalamurthy, General. Sanskrit, 2005. 328 pgs. 12817 maanasagarii... Dr . ramachandra pandey, General. Sanskrit, 2005. 540 pgs. 12818 brxhatparaasharaherashaastramu... madhurakrishnamurthy sastry, General. Sanskrit, 2005. 408 pgs. 12819 sachitra jyotishha shiqs-a... bii . ela . t'hakura, General. Sanskrit, 2005. 286 pgs. 12821 jyothisyashhabdakoshha:... Pandit Sreemathru Prasadha Pandeya, General. Sanskrit, 2005. 440 pgs. 12822 sachitra jyotishha shiqs-a... b.c thakoor, General. Sanskrit, 2005. 252 pgs. 12823 jyautishha- san'hhitaa... aacharya baskaranand lohini, General. Sanskrit, 2005. 272 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 1/167

2/14/2011

A list of scanned Sanskrit books at III… 12824 bhuvanadiipaka... pandit kashiram, General. Sanskrit, 2005. 88 pgs. 12826 svapnavaasavadantamuu... gang-ga'saagararaaya:, General. Sanskrit, 2005. 278 pgs.

12828 jyotirveidan... gobboru venkatananda raghavarao, General. Sanskrit, 2005. 230 pgs. 12831 prashnachand-d'oshvara... pandit vishnu dutt, General. Sanskrit, 2005. 88 pgs. A Catalogue Of Sanskrit And Prakrit Manuscripts In The Rajasthan Oriental Research Institute Part Iii A... Muni Jinavijaya, Unknown. Sanskrit, 1967. 626 pgs. A Cattalouge Of The Sanskrit Manuscripts... Dr.aryendra Sharma, Unknown. Sanskrit, 1964. 338 pgs. A Critique Of The Brahmasutra Part 1... P M Modi, Unknown. Sanskrit, 0. 530 pgs. A Critique Of The Brahmasutra Part 2... P M Modi, Unknown. Sanskrit, 1956. 422 pgs. A Descriptive Catalogue Of Sanskrit Manuscripts Volume I Part Ii... T P Upadhyaya, Religion. Sanskrit, 1953. 266 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts... P P S Sastri, Unknown. Sanskrit, 1929. 530 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts... Vidya Sagara, Unknown. Sanskrit, 1934. 452 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts Vo Iii... P P S Sastri, Unknown. Sanskrit, 1929. 632 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts Vol 14... Tanjore Maharaja Serfoji S, Unknown. Sanskrit, 1932. 523 pgs. A Dictionary English And Sanskrit... sir monier monier williams, Unknown. Sanskrit, 1957. 666 pgs. A Dictionary Of Sanskrith Grammar... Kashinath Vasudev Abhyankar, Unknown. Sanskrit, 1961. 436 pgs. A Grammatical Dictonary Of Sanskrit Vedic... Surya Kanta Sastri, Unknown. Sanskrit, 1953. 308 pgs. A Grammatical Word Index To Atharvaveda... vishva bhandu, Unknown. Sanskrit, 1963. 734 pgs. A Grammatical Word Index To Rigveda... Vishva Bhandhu, Unknown. Sanskrit, 1963. 648 pgs. A Grammatical Word Index To Taittiriya Samhita... vishva bhandu, Unknown. Sanskrit, 1963. 376 pgs. A Grammatical Word Index To The Four Vedas... Vishva Bandhu, Unknown. Sanskrit, 1963. 506 pgs. A Grammatical Word Index To The Principle Upanisads... vishva bandhu, Unknown. Sanskrit, 1966. 579 pgs. A Handful of Popular Maxims... Dr.m.d.balasuramanyam, Unknown. Sanskrit, 1983. 336 pgs. A Short History Of Sanskrit Literarure... T K Ramachandra Iyer, Literature. Sanskrit, 2002. 220 pgs. A Study Of Bharatas Natyasasatra And Avaloka On Dhananjayas Dasarupaka... Dr Manjula Gupta, Unknown. Sanskrit, 1987. 342 pgs. A Vedic Word Concordance Vol 5 Part 2... Visva Bhandu, Religion. Sanskrit, 1965. 174 pgs. A Vedic Word Concordance Vol Ii Part Ii... Visva Bandhu Sastry, Religion. Sanskrit, 1936. 746 pgs. Aachaara Bhuushhand-ama~ Grantha 57... Paahatryambaka Oko, Religion. Theology. Sanskrit, 1908. 449 pgs. Aachaara~yaa Abhyudayaa... D'indi'ma Raajanaatha~, Language. Linguistics. Literature. Sanskrit, 1945. 130 pgs. Aachaarendu Grantha 58... Aapat'e Hari Naaraayand-a, Religion. Theology. Sanskrit, 1909. 415 pgs. Aadhaanapadhdati... Aapat'e Mahaadeva Chimand-aajii, Religion. Theology. Sanskrit, 1947. 145 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 2/167

2/14/2011

A list of scanned Sanskrit books at III… Aagaashe Ispupaahai Gran'tha 5... Aapat'e Hari Naaraayand-a, Philosophy. Psychology. Sanskrit, 1912. 103 pgs.

Aanandakandachampuu... Mishraa Mitra, Social Sciences. Sanskrit, 1931. 260 pgs. Aapastambashulbasutrama~... Aapastan'ba, Philosophy. Psychology. Sanskrit, 1931. 352 pgs. Aapastambiiyan' Shraotasuutrama~... Chaara~ya Narasin'haa, Religion. Theology. Sanskrit, 1944. 816 pgs. Aapracharya Yasak Ki Vedvyakhya Paddhati... Dr Gyan Prakash Shastry, Unknown. Sanskrit, 1985. 164 pgs. Aapradarshprastavmala Vol I... Pandit Sri Vishwanath Shastry, Unknown. Sanskrit, 1951. 147 pgs. Aaprayyorday Kavyam Poorvadharm... Pandit Ganga Prasad Upadhyay, Unknown. Sanskrit, 0. 250 pgs. Aapstamba Shulba Suutrama~... Chaara Shriinivaasa, Religion. Theology. Sanskrit, 1931. 352 pgs. Aara~tha Shaastra Padasuuchii Trxtiiyo Bhaaga... Shaastri Shamaa, Social Sciences. Sanskrit, 1925. 358 pgs. Aara~thavara~nd-a Jyotishhama~... Dattaa Bhagavata, Religion. Theology. Sanskrit, 1924. 45 pgs. Aara~yaasaptashatii Faskikyulasa~1,2 Cha... Shriivishveshvaraapand-d'ita, Religion. Theology. Sanskrit, 1925. 376 pgs. Aashvalaayana Shraota Suutrama~ Prathamo Bhaaga... Shaastri Man'gala Deva, Religion. Theology. Sanskrit, 1938. 187 pgs. Aath Shri Madrunu Bhasyam... Shri Vallabha Charya, Unknown. Sanskrit, 0. 792 pgs. Aath Shrimadbhagwatha Darshini Ekhadarshaskarandra Prarbhaythe... -, Unknown. Sanskrit, 0. 478 pgs. Aath Smrithisaarodhwarprarambh... -, Unknown. Sanskrit, 0. 102 pgs. Aath Vamanpuranam Prarabhyathe... -, Unknown. Sanskrit, 0. 420 pgs. Aatmadarshanam... Vedhanth Anjaneyakumara Swamy, Unknown. Sanskrit, 1987. 178 pgs. Aatyoug pradipika... Shemraj Shri Krishnadass, Unknown. Sanskrit, 1874. 236 pgs. Aayura~vedasutrama~... Yogaanandanaatha, Philosophy. Psychology. Sanskrit, 1922. 356 pgs. Abhidavimarsh... Yogeshwar Dutt Sharma, Unknown. Sanskrit, 1980. 150 pgs. Abhidhaana Ratnamaalaa... Aupharet'a, Language. Linguistics. Literature. Sanskrit, 1928. 419 pgs. Abhidhana Manjari Of Bhishagarya... Shankar Sharmana, Unknown. Sanskrit, 0. 530 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrit Vol I... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 1056 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrit Vol I I I... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 1378 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrith Vol I V... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 1297 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrithvol I I... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 728 pgs. Abhidhanarajendrah Prakriti Magadhi Sanskrit Vol 6... Vijayarajendra Suri, Unknown. Sanskrit, 1985. 1482 pgs. Abhidhanarajendrah Prakriti Magadhi Sanskrit Vol 7... Vijayarajendra Suri, Unknown. Sanskrit, 1985.
sanskritdocuments.org/…/SanskritIIIT.…

1217

3/167

Religion. Sanskrit... Unknown... 1912.. 304 pgs. E.. Satavadhana Srinivascharya. Abhidhanarajendrah Vol. Rasiklal C. Aapat'e Hari Naaraayand-a.. Srimannarayana. Sanskrit. Sarasvatii Madhusudhana. Abhidhanarajendrah Vol.2/14/2011 A list of scanned Sanskrit books at III… 1217 pgs. 1945. Sanskrit. Abhinavaratnamaala Davitiiya Bhaaga.. Sanskrit.. 405 pgs.… 4/167 . Literature... Unknown. Pandit Ramachandra Sharman.. Advaithdeepika.. 364 pgs.. 518 pgs. 648 pgs. Sanskrit. Sanskrit. Sanskrit. Sanskrit.. Theology. 130 pgs.. Pandith Damodar Sharma Gaud. Th Aufrecht. Abhijnana Sakuntalam Of Kalidasa. Abhinavam Prasutitantram First Edition. 1618 pgs. 134 pgs. Shaastri Vaamana. Sarasvatii Madhusudhana. Unknown. Sri Chelamcheral Rangacharya. Technology. Religion. 1910. Unknown. Unknown. Vijayarajendra Suri. Unknown. 1953. Unknown. Sanskrit. 1968. Psychology. Narakand-t'hirava Shaastri Vat't'ipalli. 0. Theology.. Sanskrit. A N Krishna Aiyangar. Sanskrit. Sanskrit. 464 pgs. Acyutarayabhyudaya Of Rajanatha Dindima. 0. 1953. 1937. 161 pgs. 1900.org/…/SanskritIIIT. Theology. Unknown.obermiller. 0. Unknown. 210 pgs.. 1992.. 732 pgs. Sanskrit. 1922. Unknown. Unknown. 0. Theology. Mr. Sanskrit. 1921. Asan'gaa. Shanti Bhikshu Sastri. 1992.. Mahakavi Kalidasa. Adhyathyamramayana Vol Iii. Sanskrit. 0. Abhijnana Sakuntalam.. Psychology. Abhijnana Sakuntalam. Advaitasiddhi Trxtiiyasamput'ama~. Srimath Paramhans Parivrajakachary. Parikh. Sanskrit. Advaitasiddhi Prathamasamput'ama~. 40 pgs.. Abhidharmamrta Of Ghosaka..kale.. Sanskrit. 1940. Abhidhara~masamuchchaya. Religion. 993 pgs. Philosophy. Ghoshhaka. 260 pgs.. Sarasvatii Madhusudhanaa. Unknown. 1301 pgs. Abhijnana Sakuntala.... 882 pgs. Unknown. 284 pgs. 532 pgs. Adharva Vedha Samhitha. 208 pgs. Paand-d'uran'ga Oke Mahadevo.... Acharya Ddhruva Smaraka Grantha Vol 3. Sri Viswanatha Shastri Prabhakar. 1950. Agnihotra Chandrikaa Grantha 87. Language. Abhidhanaratnamala. Philosophy. Sanskrit.. 1910.. Abhidhara~maasamuchchayasya.. 1991. Vijayarajenda Suri. Vasubandhu.4... Acharya Jinabhadras Visesavasyakabhasya Part Iii. Sanskrit. 0. Addaitasiddhi Dditiiyan' San'skarand-an.. Abhisamayalankara Prajnaparamita Upadesa Sastra.. 120 pgs.. Sanskrit..5.. Sanskrit... 1950. Sanskrit. 326 pgs. Dalshuk Malvania. Adharsha Prasthav Rathnamala. 1861. Agnipuraand-ama~ Grantha 41. Unknown. 1933... 522 pgs.. Sanskrit. Unknown. Sanskrit. Sanskrit.. 100 pgs.. 1950. Unknown. 879 pgs. 690 pgs. 620 pgs. Sanskrit. Unknown. Bahadur Chand Chhabra.. Abhijnana Sakuntalam Naam Natakam. Unknown. Abhinava Vaasavadatta.. Religion. 1990.. Sanskrit.. Sanskrit. Social Sciences. Sanskrit. sanskritdocuments. Unknown. 172 pgs. Abhidharmakocarikah. Aasn'ga.. Sanskrit. Philosophy.. 194 pgs. 1982. Sanskrit. Sri Guru Prasad Shastry. Psychology. 152 pgs. Abhidhara~maamrxtama~.. 1964.. Unknown. 1946.. Abhilekha Sangraha Sixth Khandah.. Ganesh Kashinath Kale... Abhijnana Sakuntalam Of Kalidasa. Linguistics. 170 pgs.. Unknown. 1950..

339 pgs. Shastrii Esa~ena~. Alang-kaaramand-ihaara~ Chatura~tho Bhaaga. 1964.org/…/SanskritIIIT. 1917. 1986. Alang-kaaramuktaavalii. Alang-kaaramand-ihaara Da~tiiyo Bhaaga. Jaggu Venkatachari... Unknown. Sanskrit.… 310 pgs 5/167 .. 182 pgs. Parakaalasvaamii Shriikrxshhnd-abrahmatantra. 242 pgs. Language.. Sanskrit. Mm. 1982. 1981... Sanskrit.... Suranad Kunjan Pillai... 262 pgs.. Unknown... Sri Amaru Kavi. Literature. Literature. Language. Sanskrit. Parakaalasvaamii Shriikrxshhnd-abrahmatantra.. 662 pgs. Biography. Unknown. Literature. Linguistics. Literature. Sanskrit. 46 pgs.. Unknown. Sanskrit.. 0.. 1951. 1927. Sanskrit. Literature. 559 pgs.. Sanskrit.. 1923. 334 pgs.. 252 pgs.. Alang-kaaramand-haara Trxtiiyo Bhaaga.s. 282 pgs.. Alankaramand-ihaara Trxtiiyo Bhaaga. Alang-kaaramand-ihaara Prathamo Bhaaga. Language. Literature. 449 pgs.. 134 pgs. 1997. Literature.. Paand-d'eya Shriivishveshvara. Sanskrit. Akasmika Dana Laba Ke Yoga. k bhaskara rao. 1984.. Amara Bharathi Astami Kaksha. Sanskrit.... Language. History. Sanskrit.. Aanandagiri. Sanskrit.. Amara Shatakamu. H L Jain. Unknown.. Sanskrit. Unknown. Linguistics. Sanskrit. Sanskrit. 338 pgs. Theology. Unknown.. Sanskrit. 1929. C. Gaurinath Sharmana. Sanskrit. Theology.. 319 pgs.. Alphabetical index Of The Sanskrit Manuscripts Vol I. Religion. Misropahvedacharyapandithsrivamshidharshastriyna. 1943. Enter Subject Of The Book. Linguistics. Akaradhanukrmanika. 520 pgs. Anantakrisna Sastri. Religion. 1950. 1921. Unknown. All India Oriental Conference Thirteenth Session Nagapur University October 1946. 366 pgs.sivadatta... Sri Bharateeya Yogi. Sanskrit. Unknown. 1982. Parakaalasvamii Shriikrxshnd-abrahmatantra.. Amara Bharathi. Alankarathatvascha.. History. 1957. Sanskrit. Parakaalasvamii Shriikrxshnd-abrahmatantra. Ajnanadhavanta Candabhaskarah. Aldankar Sarvasvam. Sanskrit. 876 pgs.. brahmananda tripathi. 369 pgs. Alankara Sangraha Of Amrtananda Yogin. Dr Raj Kumari Trikha. Unknown.. Sanskrit. Parakaalasvamii Shriikrxshhnd-abrahmatantra. 139 pgs. Sanskrit. 1987. Art. Parakaalasvaamina~ Shriikrxshhnd-abrahmatantra.. Theology.. Amarakosa Namalinganusasanam Of Amarasimha. Aitareyopanishhata~ Panj-jamii Khand-d'a Grantha 11. 1931.. Surya Narayana Murty. Kondapudi Apparao. Lokanatha Chakravarthin. Alamkarasamgraha Of Amrtanamdayogin. 138 pgs. 94 pgs. Linguistics. 98 pgs. Religion. Alankarakaustubha Of Kavi Karnapura.. Language. Geography. Subrahmanya Sharma. Religion.2/14/2011 A list of scanned Sanskrit books at III… Aitareya Brahmana Of Sadgurusisya Vol I 1 To 15 Adhyayas.. Alang-kaaramand-ihaara Chatura~tho Bhaaga. 1942. Linguistics. 1949. Alang-kaaramand-ihaara Trxtiiyo Bhaaga. 1929.v. Sanskrit. Alankaraustubha Of Visvesvara Pandita.. Sanskrit. 1923.. 100 pgs. 0. 441 pgs. sanskritdocuments. 1996. 1983. Sanskrit... 69 pgs. Unknown. Alang-kaara Kaumudii. Language. Biography. 1923. 368 pgs. Geography.... v krishnamacharya. Sanskrit. Theology.. Alamkaras In The Works Of Banabhatta. Unknown. Linguistics. R. Sanskrit. Parakaalasvaamii Shrii Krxshhnd-abrahmatantra.

Unknown. Amhar Vani (sathvi Kaksha). Mahiipa... Unknown.s.. Language. 1983.snankarsastri marulkar... 1955. Unknown. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… 310 pgs. 571 pgs. Language. Amarkosh Pratham Kandam. An Indian In Western Europe. Sanskrit. Anekaathara~tilaka.. A N Upadhye.. Sanskrit. Sanskrit. Shriimuraarimishra Mahaakavii. 239 pgs. 1866. 258 pgs. Unknown. Sanskrit.. Annamacharya And Surdas.… 6/167 . Sanskrit. Ramaswarupa Bholanath Pandit. General. Sanskrit.. Sanskrit. Prof. Unknown.. Unknown. 1995. Mr. 70 pgs. 1969. An Introdution To The Grammar Of The Sanskrith Language.. Sanskrit. 328 pgs. 300 pgs... 1986. 524 pgs. Unknown. 336 pgs. Andhra Bhagvthanuvad. Anandashram Sanskrith Granthavali Trishtlisethu. S K De. Sanskrit... Anandanandini. Nithyananda Parvathiya... 305 pgs. Sanskrit. Sanskrit.. Annanda Sramasamskrutha Grandavali. 1932. 194 pgs. Anthya Karmadeepika. Anu Bhashya Vallabhacharya Art Sanskrit 1921 495 pgs sanskritdocuments. Kuttakarshiromani. Anara~gharaaghavama~ Trxtiiyo San'skarand-ama~. Unknown... Sanskrit.. 377 pgs.. Language. 358 pgs. Amarakosa of Amarasimha. Sanskrit. An Anthology Of The Epics And Puranas. 1864. Amarakoshah. Unknown. Unknown. Unknown. Geography. Anandasundari. Religion. 1952. An Anthology Of Poetry And Drama Part I. Sanskrit.. 468 pgs.. Anandh Samastha Granthavali. Shiromani Sannidhanam Suryanarayanshastry. 1993. Literature. Sanskrit. Sanskrit. Mamchala.. Viswanath Bhatt... Arjunavarmadeva. sri amar singh.. Sanskrit.. 1947.r.aruna Gupta.s... 1936. Literature. Linguistics. Linguistics. 1981.. H H Wilson. 233 pgs. 1947. Sanskrit. 0. Sri G A V Ms Uppalacharyulu. Unknown. 2000. Amarkosha Of Amarsingh.. Linguistics... 1939. 1990. Ttd. Sanskrit. Shriman Mahadev Chmanji Aftee. 1979. Unknown. Literature. History. 709 pgs. 375 pgs. 1985. 242 pgs. V. Sanskrit. Anekartha Tilaka Of Mahipa. Anekaara~thatilaka. Sanskrit.. 138 pgs. Sanskrit. Literature. 168 pgs. Sanskrit. 1984. Amarakosah Dwithiya Khandah. Sanskrit. Amarkosh Namalingaanusasana. 736 pgs. Sanskrit. Amerika Bhaaga Pahilaa. An Anthology Of Subhashitas Part Two. Biography. Dr Ram Naresh Tripathi. 0. Dr. 1940. 1971.. M.. Sanskrit. Unknown.. 1984. 1961. 0. Chandra Sekhara Sharma. Unknown. Anandasramsanskritgradhavali.. Unknown. 168 pgs.org/…/SanskritIIIT. Ancient Indian Economic Thoughts.. 1998. 1952. Unknown. Mahiipa..... Literature. 236 pgs. Jean Paul Lanly... Amarzakosha Vigraha Comm.. Ananda Ramayana.. 1999.. Unknown. Unknown. 66 pgs. Jaganadha Rao. Sanskrit.... Unknown.. Pandith Haragovinda Sastri. 1947. 388 pgs. . 745 pgs. Anandashramasanskruthagranthavalihi. Dr V Raghavan. 400 pgs. 136 pgs. 268 pgs. Sanskrit. Ogale Gurunaathaprabhakara.. 130 pgs. Madhukar Mangesh Patkar. Narayan Bhatt. pgs. 358 pgs. Unknown. Haragovinda Sastri. Amelioration Genetique Des Arbres Forestiers Forets 20. Sanskrit.. Literature.kale. Sanskrit. Sambu Prasad.. Theology... Amrau Shatakam. -. 314 pgs. Sanskrit. 1970... Unknown... V Raghavan.tirupati.

Philosophy... Apaharvarma Charita.. 1940. Dhamodar.. Sanskrit. Yajneswara Cimana Bhatta. Maharshi Panini.. Sanskrit.… 7/167 . 0.. 1951. Swamy Pramodgiri Vedanthkishore. Shaastrii Shriichaarudevashaastii. 1924.. Sanskrit. Unknown. Social Sciences. prasanna kumar acharya.. Unknown.. N Aiyaswami Sastri... 444 pgs.. 1998.. Unknown. 158 pgs. 262 pgs... Sanskrit. Ara~thashaastrapadasuuchii Prathamo Bhaaga. 330 pgs. 1924. 720 pgs... Ashtanga Samgraha.. Asalayina Gruhasutram. Sanskrit.. Unknown.. Ramchandra Sharmane. 1950... 896 pgs.. 1955. . 459 pgs. 1950. Sanskrit. Language.. Arthavedatdhasamhitha. Sanskrit. Apastambasrautasutra Dhurtasvamibhasya. . Social Sciences. Sanskrit. Unknown. 0.. History.. Popatbhai Ambashankar Mankad. Sanskrit.. Sanskrit. Religion. 762 pgs. 1927. Sanskrit. 1986. 1955. Anusuchi. Unknown. . Ganapati Sastri. Arthasatra Of Kautilya Vol Ii.. 0. Sanskrit. 469 pgs. 1924. Theology. J Jolly... Sanskrit..org/…/SanskritIIIT.. Unknown.. Ved Prakash Shastri...t. Sanskrit.. Vidwan Shivasri.. Dr Bali Ram Shukla. Arya Salistamba Sutra. sanskritdocuments... Shaastrii Shaamaa. Unknown. 986 pgs. Ashvinao Devtaki Bhoomika. 473 pgs. 1931. Sanskrit. Sanskrit. Unknown. Sanskrit. Anuvaada Kalaa Athavaa Vaga~vyavaharadara~sha. 0. Ardh srimadbagavathardha dharsan vol 1. Srinivasa Murti. 1925.. 346 pgs. Apabhran'shakaavyatrayii.. Sanskrit. 1928. Religion. 247 pgs. 289 pgs. 346 pgs... Arya Salistambe Sotra.2/14/2011 A list of scanned Sanskrit books at III… Anumana Pramana.... Anustana Prakasaha Mahanibandhaha. Sanskrit. 0. Ara~tha Shaastra Padasuuchii Prathamo Bhaaga. Anuvrath Vidhya Trishati. Aparajitaprccha Of Bhuvanadeva.. 0.. Ara~tha Shaastra Padasuuchii Dditiiyo Bhaaga. 0. Vethanamanom. 588 pgs.. Religion. Apasthamba Sulba Sutra. 552 pgs. Ardh Srimadbagavathardha Dharsan. 72 pgs. 1948. Sanskrit. Unknown. 280 pgs. Jindaattasuurii. Sanskrit. Ashtadyayi Sutrapaat. Unknown. 492 pgs. 277 pgs.. Aryavidya Sudhakara. Arthasastra Of Kautilya. D Srinivasacharya. Sripad Damodar Satvalekar. R Shama Sastry. 2000. 1989. Psychology. -. Sanskrit. Theology. -.. 472 pgs. Shaastri Shamaa. Aprakaashitaa Upanishhadah. Literature.. 367 pgs. 0... 157 pgs. History. Social Sciences. Sanskrit. 469 pgs. Theology. 1950. Pandith A Chinnaswami Sastri.. Unknown. Sanskrit. Ramachandra Sharma. Somraj Krishna Das. Kunj-chanaraaja Chi Dakt'ara~. Unknown. Unknown. 1923. pgs.. Unknown. Unknown... A Chinna Swami Shastrulu.. Sanskrit. 458 pgs. Shaastri Shamaa. 248 pgs. Architecture Of Manasara. Astadhyayisutrapatha. 1924. Sanskrit.. Unknown. 1924. Sanskrit. Sanskrit. Unknown. Astadasasmrtayah. 1064 pgs. 865 pgs. Apastambagrihya Sutra. Artha Sastra Of Koutilya.. Sanskrit. Sanskrit. Sanskrit.. 540 pgs. 1976. 1955. Arthvaved Sanhita.. 122 pgs. Linguistics. Unknown. Unknown.. Unknown. Sanskrit.

. Sanskrit.. Ath Sriskanandmahapuranam. Ath Srimnmatsyamahapuranam Prarbhyate. Sanskrit. Unknown. Nakula.. Saayand-aachara~yaa. Literature. Theology.. 257 pgs. 1987. Sanskrit.. 1996. 362 pgs.c. 867 pgs. Theology. -.. Religion..v. Asvasastram.. 1037 pgs. . Theology. 0... 436 pgs. 0.kumaraswamy.. Atharva Vedha Samhita Mulya Mantra Sayaye Bhashya Kshiks Kandah. Astanu Hrudayam. Theology.kunhan Raja. Tira~tha Svaami Ravi. Theology. . Sanskrit.vishnuteertha. 1956. Athara~vavediiyaa brxhatsara~vaanukramand-ika. 363 pgs. Ath Vishnudharmottar Mahapuranam. Sanskrit. 214 pgs. Gulab Chand.. Sanskrit. 1951. Atha Tatpurusha Prakaranam. 180 pgs. Athara~vedasan'hitaa Bhaaga 2. -... 0. Athara~vavedasan'hitaa Trxtiiyobhaagaa.. 1955. Bhagavadatta. 0. Unknown. Theology. Theology. 73 pgs.. 100 pgs. Ath Sriskand Mahapurane Brahmkhande Sethumahatmay Vol I I I..... Sanskrit.. Dr. 1895. Somraj Krishna Das. Sanskrit. 1916.. -... Dr. Baladevaprasaada. Athavarvediiya Panj-chapat'aalikaa. -.. 1923. Sanskrit.. 483 pgs. Asvalayanagrhyasutra Bhasyam Of Devasvamin. Sanskrit. Unknown. 594 pgs... Literature. Sanskrit. Atma Purana With Hindi Commentary.. Sanskrit. Sanskrit. Unknown. 1898. . Sanskrit. 1944. Atha Gaayatrii Tantra. pgs. Linguistics Literature. Literature. Religion. 1996. 0. Unknown. Unknown. Religion... 474 pgs.. 666 pgs.. Unknown. Sanskrit. Atharva Vedha Samhitha. Sanskrit. Jacob G A. Religion. Religion. Asya Vamasya Hymn. Ath Koormmahapuranam Prarabhyate.. . 0. Unknown. 562 pgs. Sanskrit. Sanskrit... 547 pgs.. Sanskrit. Shri Anand Van Aagadi. 1920.… 8/167 .. 0. Religion. 1952. 520 pgs..a. 0. Sanskrit. P. 404 pgs. Atharavaanaa Upanishhada Second Edition.. Unknown.. . 1922.. Asthadhyayisutrapaath. 106 pgs. . Atha Tatpurusha Prakaranam. Damodar Sathwalekar. Sanskrit. Shri Anand Van Aagadi.. Unknown. . Unknown. Sanskrit. Sanskrit. 0.. Sanskrit. 340 pgs.. -.. Atha Tatpurusha Prakaranam.. 288 pgs. 986 pgs. 0. Ath Sriskande Mahapuranm Vaisnavkhande Venkatachalammahatmay Vol I I. Sanskrit... Unknown.Vivaram-vranam. 0.... Unknown. 0. Unknown.. Sanskrit. Sanskrit. Athara~va Pratishaakhyama~ Prathamogyan' Bhaaga. Ath Srimaddwaramahapuranam.. Rama Chandra Sharma. Asvalayaand-a Graha Suutraa Vol I. Acharya Sri Sitaram Shastri. Atmadarsanam. 696 pgs. Sanskrit. Religion. 1955. sanskritdocuments. Sanskrit.. -.. Religion.. Atma Praboda. Athagreya Mahapuranam. Pandith K P Aithal. 555 pgs. Sanskrit. Shiva Sharma. 1824 pgs. 263 pgs.. saayand-aachara~ya. 310 pgs. . 1928. Sanskrit... 0. 650 pgs. Sri Venkatesho Vijaytetram.org/…/SanskritIIIT. Unknown. Sanskrit.. Religion. 1644. 1955. 0.. Theology. Sanskrit. Ath Shuklayajurvedakavya Samhitha... Unknown.. 130 pgs. Theology.Puspam.. 668 pgs. Shaastrii Raamagopaala. 234 pgs. Atma Purana. 0. 266 pgs. Religion. Ityupaadhidhaarind-aa Ema O Ela. Ath Sriskande Mahapurane Shanst Nagar Khand I I I.2/14/2011 A list of scanned Sanskrit books at III… Astam.

Sanskrit.. Mahaakavii. Literature. Kapaaliishaastrii Ti Vi. The Greatness Of Badari Kshetram Or Holy Place. 1989. Sanskrit. Baismi Parinaya Champu. 1945. 51 pgs. 602 pgs. Sanskrit. Shaaligraama Shan'karatukaaraama. Unknown. 432 pgs. Unknown.. Theology. 206 pgs. Sanskrit. 1933.. 674 pgs. Dr. Linguistics. 442 pgs. 382 pgs. Bakthamala Ramramsikavali. Theology.. 327 pgs. Bhaamatii Prathamo Bhaaga. Linguistics. Sanskrit. 772 pgs. Avachedakatvanirukti Of Sri Jagadisha Tarkalankara With Lakshmi Commentary. J. Baoudhagamarth Sangraha.a.. Unknown. K S Ramamurty. p sri ramachandrudu.. Bhaaminiivilaasa. Sanskrit. Balaramayana. 193 pgs. Bhaaratiistava Prathaman' Mudrand-ama~. Vaidhopahsriparushuramsharma. Unknown. Dr.. 1054 pgs. History.. 290 pgs..k. sri laxmiramaswami mahabhagavanamu. Religion. Beauties From Kalidas. Unknown.. 346 pgs.. Language. 1983. Unknown.bhatt. 182 pgs.. Linguistics. 1986.ganga Sagar Rai. 1922. Sanskrit. Shriimadatkhand-d'adeva. Literature.. Sanskrit.. Psychology. Bhaashhyaara~tha Ratnamaalaa Grantha 75. Chintaamand-ih Ti Raa... Speyer.. Sanskrit. S. Ayurved Vigyanasar. Geography. 1939. 1902. Jaikrishndas.... Sanskrit. Aund-aadikapadaand-ara~va Grantha 7. sanskritdocuments. 146 pgs.. Padhye. Balabharatham Of Agastya Pandita.. Sanskrit.. C. Language. 401 pgs. 190 pgs.. G.. kaas'inaatha paanduranga paraba. Literature. 324 pgs. 324 pgs. 126 pgs. Bala Bharatam. Sanskrit. 1927. History.. Unknown. Unknown. Subrahmand-ya.h. Sanskrit. Sanskrit.. Biography. Philosophy. -. 1939.. 1965.. 1983. Language. 1956. Sanskrit. 1962.. Baktha Mandram. Sanskrit. 412 pgs. Bhaat't'adiipikaa Niviitaanto Bhaaga 1. 1964. 125 pgs. Swami Sri Dharmananda... Ratna Ketamkavi. Unknown. Psychology. Veturi Prabhakara Shastry... 136 pgs. Pand-ashiikarasan'shodhitaa. Sanskrit. Sanskrit. Beejganitham Vol I I I. Unknown. 1948. Literature. Chantaamand-i Ti Raa.. 1984.. Ayurvedhakandah.… Bhagavadgaiitaa Bhaaratiiyadashara~naani Cha Shaastrii Ananta Krxshhnd-a Religion Theology 9/167 . Unknown.k. Bhagavadajjukam. 1924. Philosophy. Sanskrit.. Ayurvedabdhisara Part 1.. Ayodhyeche Nabaaba. 1899. 191 pgs. Unknown.org/…/SanskritIIIT. 280 pgs. Theology. 1982. Literature. Aya Srimadhnrumatrayam. Vaachaspathimishraa. 132 pgs... Sanskrit. Sanskrit. Unknown.. Sri Durga Prasad Divyvedaen. Geography. 1991. Religion. Sanskrit..s. 1889. 1935.. 1958... 1939. 294 pgs.kunhan Raja. Paarasaniisa Dattatrayabalavan'ta.. Avantisundariikathaa. 52 pgs. Sanskrit. Theology.. Baapuu Gokhale Yaan'chen' Charitra. 1941.. Religion. 1915. Sanskrit.. Bhaaminiivilaasa.. kalluri ahobila rao.2/14/2011 A list of scanned Sanskrit books at III… Atmarpanastutih.. Sanskrit.. Aunadikapadarnava. Avadanacataka A Century Of Edifying Tales Vol I.. Unknown. Sanskrit.. 0.. Sanskrit. Sri Sankaranarayana.. 480 pgs. Raramurthi.. 1933.. Literature. Aund-aadikapadaara~nd-avah. Sanskrit. Sanskrit. Biography. Religion.

Theology. 519 pgs..jd. 1991. 1945.. Bhaismiparinayacampu. Sanskrit. Vachaspti Gairola. Sanskrit. Unknown.. Sanskrit. Bhagavata Tippani Chalari.n. Sanskrit. 1944. 223 pgs. 340 pgs. Bhatta Dipika(uttrasatka Part I) With The Prabhavali Of Sambhu Bhatta. Bhasas Balcharitam. 1921. Sanskrit.. Bhagavantabhaskara Of Sri Nilakantha Bhatta Vol I I. 510 pgs. Sanskrit. Bharatarnava Of Nandikeswara. Venimadhav Sahastri Musalgonkar. Sanskrit. Art. 297 pgs. Bharata Natya Darsanam.r. 954 pgs.. Bhas Kee Bhasa Sambandhee Tat(natakeeya Visheshtaem. Bharatiyam Vrttam.. Panditraja A Subramanya Sastri. Unknown.. 1921. Sanskrit.. Sanskrit.. Sanskrit... Shaastrii Ananta Krxshhnd-a. Sanskrit.. Unknown. 512 pgs.. 291 pgs. . Unknown. Bharathi Nirukth Vedh Swarup Darshan. Unknown. Kumudranjan Ray. Matha.surya Narayana.. S Subramnya Sastri. 1983... 860 pgs. Sanskrit. Bharatarnava Of Nandikeshwar. Sanskrit. 0. Dikshit. 712 pgs.2/14/2011 A list of scanned Sanskrit books at III… Bhagavadgaiitaa Bhaaratiiyadashara~naani Cha. Sanskrit.. Sanskrit. Sanskrit. Bhattalankara Tikayuta. Bhasa's Pratima Part Ii Natakam.. Sanskrit. Sanskrit. 798 pgs. Dr Radha Kumud Mookherji. Janaswamy Subramanya Shasthri. Bhatruhari S Neetisataka. .. Swetaranyam Narayana Sastriar... 1933. 0. K Vasudeva Sastri. Sanskrit. 1952. 383 pgs. Saradaranjan Ray. 306 pgs. ... Unknown.. Sanskrit.. 1985. Bhasa's Pratima Part Ii Natakam. n gopalapanicker. General. Bhagavadgitha Anandatirtha. 1985. Religion. Sanskrit. 1952. Unknown.. pgs. Bhatta Dipika Uttarasatka Part I I. Literature... Literature.. 1936. Unknown. S. Religion. 1942..dasgupta... 1938. Unknown. 0. 1968. 1942. 0 pgs. Sanskrit. Sri Laxmana Sastry. 252 pgs. Literature. S. Unknown.. Unknown. 0.. Sanskrit. 1978. 1335 pgs..… Bhatti Kavyam Canto 11 12 Saradaranjan Ray Vidya Vinoda Unknown Sanskrit 0 280 pgs 10/167 . 1985. 1887.. Dikshit Jd.. Unknown. Sanskrit.r. Unknown. S R Sehgal. Kumudranjan Ray.. Bhatta Chintamani Tarkapada. Literature.. 442 pgs. Bharata Kaumudi Part I. 1951. Sanskrit. Sanskrit. 111 pgs. 240 pgs.. Unknown. 1973. Unknown. 1956. Bhamti Ekk Adhyayan. Sanskrit. Manju. V. Bhagavantabhaskara Of Sri Nilakantha Bhatta Vol I.... M. ... 552 pgs. 1959.. Sanskrit. . Theology. Ananta Deva. 316 pgs. 174 pgs. Sanskrit. Eeshwar Singh.org/…/SanskritIIIT. 1935. Bhaminivilasa..ramachandra Dikshitar. sanskritdocuments. Bhasa Ki Sambhandi Thatha Natakiya Visheshathaye. 165 pgs. Unknown.. 589 pgs.... Vacant. Unknown.. Bhagavatham With Curmikatika Vijayadwaja Tirtha Padaratnavali 1892... Dr. 1959. Sanskrit.. Unknown. Bhakti Chan'drikaa. Venimadhav Sahastri Musalgonkar. Bhatti Kavyam Canto 10. Bharathiy Darshan Me Parivarthan Ka Swarup Vishestha Boudd Darshan Ke Sandarb Me. Bhartiya Darshan Ka Itihas... 172 pgs. 1938. 1981. 304 pgs. Unknown.. 518 pgs. Har Dutt Sharma.. Sanskrit. 112 pgs. Bhattaldankartikaythu. 120 pgs. Bharadvajasiksa. V S Venkata Ragavacharya.. Naaraayand-atiira~tha.. Unknown.. 316 pgs.

1856.. 1998. E. 122 pgs. Vijnanabhikshu. Narayana. 1995. 540 pgs. 301 pgs. -. Unknown.. Linguistics. -.. 362 pgs.. Sanskrit. Unknown. 640 pgs... Philosophy. 576 pgs.… 11/167 . Bhramara Sandesa. Unknown. 1959. 1951. Bheddo Jevana Of Sri Vyasaraja. Sanskrit. Geography. Sanskrit. Sanskrit. M. 212 pgs.... 1980. Sanskrit. Bibliotheca Buddhica Vol Vii Nyayabindu. 0. 0. 1854. 504 pgs. Sanskrit... 830 pgs. M. Literature. Bhavaprakasa Of Bhavamisra. M.. Unknown. 60 pgs. Bodhaikyasiddhi Prathamo Bhaaga. Unknown. 434 pgs. Sanskrit. Sanskrit.. 388 pgs... 1987.. 1918. Bhattikavya Of Bhatti. Geography. Sanskrit.org/…/SanskritIIIT. Unknown. Sanskrit. Bhesajya Rathna Vathni. Sanskrit. Bhava Prakasika.. Sanskrit. 1945. Unknown..rose. Vacant. 557 pgs. Literature. Bhuhgoghatharangani. Bibliotheca Buddhica Vol Vvxx.. 0. 1933. Sanskrit. Achyutaraaya. Sanskrit.rajendralal. Balvanth Singh... Sanskrit. 185 pgs. Bibliotheca Indica A Collection Of Oriental Works. 580 pgs. 220 pgs.. 294 pgs. 1980. Bibliotheca Indica Volume 3. Geography. Bibliotheca Indica Volume 71 5. Literature. Geography. Gopinath Kaviraja. 636 pgs. Bhavya Bharatham. 1934. M. Bhoja Prabanda Of Ballala.. Geography. Bibliotheca Indica Volume 31 1. Sanskrit.. Language. Literature. Bibliotheca Indica Volume 71 1. 220 pgs. Sanskrit. Sanskrit.rajendralal.2/14/2011 A list of scanned Sanskrit books at III… Bhatti Kavyam Canto 11 12.. pandit sri bhramha shankara misra.. Sanskrit. Sri Girijadayalu Shukla.. 422 pgs.. Bhavprakashnidhantu.... Bhoja s Samaarangana Suutradhaara Vol I... E. Bhedojjeevanam.. Geography. Dwaita Philosophy. Unknown. 0. 0. Sanskrit. Vacant. Sanskrit.. Sanskrit. 1903.. Sanskrit. 320 pgs. sanskritdocuments. 1983. Bhelsanhita. Bibliotheca Buddhica V... -. sri ranga ramanujamuni. Bibliotheca Indica Volume 71 2. Sri Govind Das. 1987. Geography. Bheda Ratnam.. 1981.. Bhoja. 90 pgs. Sanskrit. Sanskrit.... Philosophy. Y Mahalinga Sastri.. M. 2003.rajendralala. 968 pgs. 1959. Bibliotheca Indica Volume 4.. Psychology.. 280 pgs. 1987. Bibliotheca Buddhica Vol Vi.. Unknown. V. Sanskrit. Bhushanasara Samiksha Part Ii. Unknown. 1987. Bhupala Mandanam Of Devasri Narada. Unknown. Bheda Vidya Vilasa. Sanskrit. R Nagaraja Sarma. Bibliotheca Indica Volume 71 4. 1962. Literature. Sanskrit. 580 pgs. 134 pgs. Ramakrishnamacharya K. Tirumala Charya. Prahladacharya..rajendralala.. Biblotheca Indica. Vijnana Bhikshu.. 1992..... Sanskrit. Late Vinayak Narayan Shastri Vasudev Laxman Shastri. 50 pgs. Geography..rose. Sanskrit. 135 pgs. Maheshchandra. -. 984 pgs. 134 pgs.. Unknown. Unknown. Bhedojjivana Of Sri Vyasaraja. Sanskrit. 722 pgs... 1954. Sanskrit... V.. 120 pgs. C Lakshmi Kantaiah.... Unknown. 1980. Unknown. 0. Sanskrit. Unknown. Sanskrit. Kavikarnapura. 0...rajendralal. Venkataramana Reddy. Bibliotheca Indica Volume 45 1. 1991. 1949.. Geography.. 66 pgs. 1991.. Vasudeva Sharman. Bibliotheca Indica Volume 27. Sanskrit.. Saradaranjan Ray Vidya Vinoda. Sri Vyasaraja Tirtha. 646 pgs. 108 pgs.

General. 584 pgs.… 12/167 . 1980.s. 779 pgs..nene. 462 pgs. Brahmanjali Nam Parameswararpitha Slokamalika.. Literature. Unknown. 326 pgs. Ram Swarup Sharma. Brahmasutras. 536 pgs.. Unknown.. Sanskrit. Brahmasutras And Dasasloki. Brahdaranyakopanishath Vol-liv.. Natural Sciences... R.. ... Sanskrit... Laxman Shastri Pansikar. 95 pgs. 222 pgs. Bodhicaryavatara. Religion. 1966. 1950.s...org/…/SanskritIIIT. Sanskrit.tatvaprakashka1..tekct.srinivasacharya.s. Brahmasutravrtti Mitaksara Of Annambhatta.. Sanskrit. Bhaapat'ashastrii Vishhnd-uvaamana. 1915.. Brahmasutrashaariirabhashhyaara~tha Bhaaga tiisara.. Archaryavara Rama Swarup Sharma. 644 pgs.ananthacharya.. K V Rangaswami Aiyangar. Sanskrit. G. 890 pgs. Brahaspatismrti. Sri Madra Dwapayamuni. Philosophy. Physical Fitness. Unknown. 740 pgs. Unknown. 586 pgs. L.. Brahmanda Purana Of Sage Krsna Dvaipayana Vyasa. Unknown. 372 pgs. Sanskrit. 0. Sanskrit. . Sanskrit. Sanskrit.. Unknown. Acharya Mandanmisra. 1982. I. 1960. Unknown. Theology.. Unknown.. sanskritdocuments. Acharyavara Ram Swarup Sharma. J L Shastri.. 1966.. 402 pgs. 1953.. Brahma Vaivartha Puranamu Vol 1. 1937. 0.. Brahmasutra Bhasyamsahithayatham Thathvaprakasika. Unknown. Sanskrit... Bodhayana Grihya Sutram. 1944. Brahma Sphuta Siddhanta Vol Ii. Ram Swapup Sharma. 750 pgs. Brahma Vaivarth Eak Pradyayan. Brahma Sphuta Siddhanta Vol 4. Not Available. 758 pgs. 486 pgs.. Brahmasutra Bhashya Of Sri Madhvachrya. 329 pgs.panchamukhi. 448 pgs. 168 pgs. Sanskrit. 661 pgs. 600 pgs.. 18 pgs.. Brahma Sphuta Siddhanta Vol 3.. 1979. Book Of Exercises Part I.2.. 1973. Khemraj Sri Krishnadass.sampurnananad. Unknown. Unknown. Brahmasutra Bhashya. Brahatkatha Manjari.. Brahma Sutra Nyaya Sangraha. 505 pgs. P L Vaidya. 1965. Sanskrit. 1832. 336 pgs.rama Sastri. Sanskrit. Brahatstotraratnavali Vol I. Brahmanda Puranam.. Brahma Suutraand-i Grantha 67. shri bramha gupta. R. Unknown. Brahmasutrabhashya. Brahmasutrabhasya Vol 1.s. Sanskrit. Unknown. Sanskrit. Unknown. 1925.. Religion.. P. Unknown.. 0. 88 pgs. 0. Brahma Sphuta Siddhanta Vol. Sanskrit. 584 pgs. Sanskrit..... Sanskrit.. Sri Vijayeendra Tirtha. 1904. Bodhicharya Vatara Of Santideva. 1980. Unknown. 762 pgs. Somraj Krishna Das.. Sanskrit. Sri Narahari with a Commentary by the Author's Pupil Pandit Divakar. 0.. 586 pgs. 1906. 708 pgs.. 200 pgs. Unknown. Pandurangatmaj Kashinath Sharma. Sanskrit. 0. Brahma Sutra Dwithiya Bagamu. Sanskrit.. Sanskrit. 0.... Unknown. Dr. 334 pgs.. Sanskrit. Sanskrit. .. 1992.. Sanskrit. Pandit V... 1911.. Sanskrit. Arka Somayaji. Geography. Unknown.panchamukhi.. Sanskrit.. Sanskrit.. 1937.. R Antoine. Brahama Sphuta Siddhanta Vol Iii. Sanskrit.. Brahmasiddhi. Unknown.. Religion. Language... Theology. Unknown. 1966.2. 1927.2/14/2011 A list of scanned Sanskrit books at III… Bodhasara a treaties on Vedanta. 0. Sanskrit. 452 pgs. Sanskrit.. Shankar Shastry Venegavakar. 286 pgs. Brahma Sphuta Siddantha Vol I. Brahmasutra Bhasyamsahithayatham Thathvaprakasika. Sanskrit. Linguistics. Unknown. 1966. 1941. sathyanarayan tripati. Sanskrit. Brahmachary Vishnu.

... Pandit Ramgopal Shastri. Prabhaakaramishra. Religion. Linguistics. Psychology. 1992. Brhajjatakam Bahotpala Tika.. Theology.. Sanskrit. pg Brahmavaivara~tapuraand-ama~ Prathamo Bhaaga Grantha 102. .. 0. 282 pgs. Brihadaranyakopanishad Bhasya Part 1. 1936.. Brahmavaivarta Puranam. . Theology. 1935. 753 pgs. A list of scanned Sanskrit. Bhat't'achaara~yaa Vidhu Shekharaa. Kenjiu Kasawara.. Brahmavaivatar Puraand-ama~. 1886. Gand-esha Vinaayaka. Stcherbatsky.. 457 pgs. Unknown. Sanskrit. . Sanskrit.. Religion. Theology.. Theology. Theology. Unknown. Upanishads.. Aapat'e Vinayaka Gand-esha. 614 pgs. Max Walleser. 1954.. Unknown. Bruhanigantu Rathnakara Panchama Bagh. 0. Sanskrit.sharmistha Sharma. 0. 880 pgs. Unknown. Sri muralidhar. Bruhajjyothi Sarnava (mirra Skandha) Hari Krishna.org/…/SanskritIIIT. 1994.. 0. Unknown. 214 pgs. Sanskrit. Sanskrit. . 1885. . 190 pgs.. . Sanskrit.. Brhadavanyaka Bhava Botha. Sanskrit. Sanskrit. 926 pgs. 1953. Brahnnighantu Ratnakar Vol I. 1992.. Religion. General. Buddhist Avadanas. sanskritdocuments. 0. 216 pgs. 268 pgs. 463 pgs. Theology.books at III… Brahnni Ghantu Ratnakar Vol V I. 385 pgs. Brxhadaarand-ya Kopanishhadabhaashhya Vaara~tikama~ Prathamo Bhaaga Grantha 16. 1922. Braj Bakthi Vilas. 1935. Brahmavaivatara~purand-ama~ Ddvitiiyo Bhaaga Grantha 102. 56 pgs.. 86 pgs. 225 pgs. 1934.. Sanskrit. Sanskrit. Sanskrit.... Religion. Sri Krishnadas Aatmajain Ganga Vishnuna. jyotirvdaya datta. Sanskrit. Sanskrit. Sanskrit. Buddhist'a T'eksat'a Ashokaa. 1980. Bruhadh Hodachakra vivaranamulu. Religion.. 457 pgs. 1986.. 914 pgs. 334 pgs.. Brhadaranyakopanishad Bhasyam.. 1935. 600 pgs. Srilnarayana Bhatta Goswami..… 13/167 .. Sanskrit.2/14/2011 .. Vira Raghavachaya. Sanskrit. Unknown. Unknown. Unknown. Brihadaranyakopanishad .. Religion. Theology.Bhashya. Chaara~ya Matsureshvaraa. Sanskrit. 503 pgs. Sanskrit. Religion. T Veeraraghavacharya.... 1937. Brxhatii Prabhaakaramishraprand-iitaa Prathamo Bhaaga.. Religion. 1954. 503 pgs.. Religion.. 1935.. 0... Shaastrii Kashiinaatha.. Buddhist Technical Terms. 580 pgs. Franklin Edgerton. Theology. Unknown. Buddhapalita Mulamadhyamakavrtti. Somraj Krishna Das. Brxhadaarand-yakopanishata~.... Brahmavaivara~tapurand-ama~ Dditiiyo Bhaaga Grantha 102. . . Sanskrit. 396 pgs. 260 pgs. 0. Brxhatii Prabhaakaramishraprand-iitama Da~tiiyo Bhaaga... 0.. Buddhist Hybrid Sanskrit Reader. Sanskrit. Philosophy. 1867. Literature.. Bruhat Samudrika Sastramu. Sanskrit. 351 pgs. Buddhist Logic Vol 1. Theology.. Sri Krishna Das Satmaj Gangavishnu. Sri Krishnalal Thanaya Datt. 206 pgs... Unknown. 1953. Prabhaakaramishra. 616 pgs.. Sanskrit. Sanskrit. Sanskrit. Unknown. Sanskrit. Language.. Philosophy. 437 pgs.. Theology. Sanskrit. Brihat Sarvanukramnika Of The Atharva Veda. Sanskrit. Bruhaddevagnanaranganam. 110 pgs. Brahmavaivarta Maha Puranam.. -. Aapat'e Vinaayaka Gand-esha. Maraat'he Vaasudeva Shaastrii.. Sanskrit..t... .. Dr.. Religion. Sanskrit. 0.

2/14/2011

A list of scanned Sanskrit books ,at III… y g

gy

,

1948. 73 pgs. Budhabhushhand-ama~... Shambhu Shriimada~, Philosophy. Psychology. Sanskrit, 1926. 132 pgs. Budhabhushhnd-ama~... Shriimachchhan'bhunrxpa, Philosophy. Psychology. Sanskrit, 1926. 132 pgs. Bugusamhita Mahashastra Palitha Kanda... , . Sanskrit, 0. 613 pgs. Bugusamhitargata Yogavali... Somraj Krishna Das, . Sanskrit, 0. 343 pgs. Calcutta Sanskrit Series... Pandit Amareswar Thakur, Unknown. Sanskrit, 1934. 830 pgs. Camatkarachandrika Of Visvesvarakavichandra... Dr P Sri Rama Murhy, Unknown. Sanskrit, 1969. 270 pgs. Canakya-caritam... Dr.thakur Prasad Mishra, Unknown. Sanskrit, 1981. 180 pgs. Candravyakarana Of Candragomi... K C Chatterji, Language. Linguistics. Literature. Sanskrit, 1953. 360 pgs. Carudattam Edition I I... C R Devadhar, Unknown. Sanskrit, 1943. 136 pgs. Catalogue Of Sanskrit Pali And Prakrit Books Vol-i... -, Unknown. Sanskrit, 1951. 354 pgs. Catalouge Of Sanskrit Parakrit Manuscripts Vol 3... Muniraja Sri Punyavijayajit, Unknown. Sanskrit, 1968. 368 pgs. Chaitanyachandroday Naam Natakam... Sri Rajendra Lal Mitrena, Unknown. Sanskrit, 0. 294 pgs. Chamatkaar... Dr Krishna Lal, Unknown. Sanskrit, 1985. 112 pgs. Chamatkara Chintamani... bhatta narayana, Unknown. Sanskrit, 1964. 550 pgs. Chanakyasuthram Part 1... Pandit Vijendermisra, Unknown. Sanskrit, 0. 48 pgs. Chandas Sastram... Sri Pingalacahrya, Unknown. Sanskrit, 2002. 321 pgs. Chandha Shastramu... Sri Pingali Nagh, Unknown. Sanskrit, 0. 326 pgs. Chandogya Panisad Bashyam Pradhama Bagamu... Sri Ranga Ramanuja Muni, Unknown. Sanskrit, 1952. 546 pgs. Chandogyopanishad... Sri Ranga Ramanuja Muni, Unknown. Sanskrit, 1952. 596 pgs. Chandologyopanishad... Venkata Subramanyam Sastri.m, Ayurveda. Sanskrit, 1924. 939 pgs. Chandrapeeda Katha... Pandit V Ananthacharya, Unknown. Sanskrit, 1946. 90 pgs. Chandraprabha Charithramu... P.amruthlal Jain, Unknown. Sanskrit, 1954. 34 pgs. Chandrika Sahitha Kuvalayananda... , Religion. Theology. Sanskrit, 0. 328 pgs. Charak Saheta Vol 3... Sri Narendrasen Gupt, Unknown. Sanskrit, 0. 664 pgs. Charaka 1... -, Unknown. Sanskrit, 0. 502 pgs. Charaka 5... -, Unknown. Sanskrit, 0. 626 pgs. Charaka Samhita 3... -, Unknown. Sanskrit, 0. 326 pgs. Charaka Samhita 6... -, Unknown. Sanskrit, 0. 534 pgs. Chaturdashalakshani With Didhiti,didhitiprakashka,vivarana... N.veejhinatha, Indian Logic. Sanskrit, 1997. 867 pgs. Chhaandogyopanishhata~... Upanishhata~, Religion. Theology. Sanskrit, 1952. 549 pgs. Chhaandogyopanishhata~ Grantha 14... Aapat'e Vinaayaka Gand-esha, Religion. Theology. Sanskrit, 1934. 539 pgs. Chhaandogyopanishhata~ Grantha 79... Nityaananda, Religion. Theology. Sanskrit, 1915. 223 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Chhanda Shaastrama~

Chaara~ya Pin'galaa Language Linguistics Literature Sanskrit 1950 272

14/167

2/14/2011

A list of scanned Sanskrit books at III… Chhanda Shaastrama ... Chaara ya Pin galaa, Language. Linguistics. Literature. Sanskrit, 1950. 272 pgs.

Chhatrapatisan'bhaajii Mahaaraaja... Rangand-ekara Keshavaman'gesha, Geography. Biography. History. Sanskrit, 1950. 86 pgs. Chidgagana Chandrika... Kalidas, Unknown. Sanskrit, 0. 208 pgs. Chitra Champu... sriram charan, Unknown. Sanskrit, 0. 146 pgs. Chitra Prabha... Bhagavata Hari Sastri, Unknown. Sanskrit, 1932. 480 pgs. Chitrasenapadmavati Charita... Mulraj Jain, Unknown. Sanskrit, 1942. 98 pgs. Chittavishuddiprakarand-a... Aara~yadeva~, Religion. Theology. Sanskrit, 1949. 147 pgs. Chrak Samhitha Part 2... -, Unknown. Sanskrit, 1950. 568 pgs. Chytanya Nandanam... Nistala Subramanyam, Unknown. Sanskrit, 1987. 170 pgs. Cikitsa Of Srinivasa... sri s venkatasubramanya sastri, Unknown. Sanskrit, 1953. 414 pgs. Cikshasamuccaya... Canti Deva, Unknown. Sanskrit, 1992. 494 pgs. Cola Campu Of Virupaksa... T Chandra Shekaran, Unknown. Sanskrit, 0. 90 pgs. Collected Papers Of Manavalli Ramakrishna Kavi... P S R Appa Rao, Unknown. Sanskrit, 1986. 340 pgs. Critical Study Of Vedarthasangraha... t v raghavacharyulu, Unknown. Sanskrit, 1989. 250 pgs. D'a Had'agevaara Charitra... Paalakara Naaraayand-ahari, Geography. Biography. History. Sanskrit, 1882. 538 pgs. Da Aara~ya Shatakama~... Shriimadappayyadiiqs-ita, Philosophy. Psychology. Sanskrit, 1944. 72 pgs. Da Ethimalojiisa~ Apha~ Yaska... Vara~maa Siddheshvara~vara~maa, Language. Linguistics. Literature. Sanskrit, 1953. 272 pgs. Da Jaataka Maalaa Prathama~ Bhaaga... Aara~ya Kuuraa, Philosophy. Psychology. Sanskrit, 1943. 279 pgs. Da Katuhsataka Dvitiya Bhaaga... Ara~yadeva~, Religion. Theology. Sanskrit, 1931. 344 pgs. Da Mahaabhaarata Sabhaapara~va... Vishhnd-u Esa~ Suktaankara~, Language. Linguistics. Literature. Sanskrit, 1943. 217 pgs. Da Saundarananda... Ashvaghosha, Philosophy. Psychology. Sanskrit, 1928. 200 pgs. Daa. Ketakara Vyaktti Aand-i Vichaara... Ketakara Shriidharavyan'kat'esh, Geography. Biography. History. Sanskrit, 1955. 216 pgs. Daivat Sanhita Vol-3... Sripad Damodar Saatvalekar, Unknown. Sanskrit, 1948. 284 pgs. Daivata San'hita Prathama Bhaaga... Shriipaada Daamodara Saatavad'ekara bhat't'aachara~ya, Religion. Theology. Sanskrit, 1941. 987 pgs. Daivata San'hitaa Bhaaga 2... Saatavalekara Sriipaada Vasan'ta, Religion. Theology. Sanskrit, 1943. 923 pgs. Dandanitiprakaranam... V S Bendrey, Unknown. Sanskrit, 1943. 144 pgs. Daqs-ind-achyaa Mdhyayugiina Itihaasachi sadhane Khan'd'a 2... khera~ Gand-eshaharii, Geography. Biography. History. Sanskrit, 1934. 119 pgs. Dara~sha Puura~nd-a Maasa Prakaasha Prathamo Bhaaga Grantha 93... Daad'ekaro Sarasvatii Bhushhand-a, Religion. Theology. Sanskrit, 1924. 652 pgs. Darsan Ka Prayojan... Bhagvan Das, The History Of Philosophy. Sanskrit, 1987. 312 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Das Gopatha Brahmana

Dieke Gaastra Unknown Sanskrit 1919 360 pgs

15/167

2/14/2011

A list of scanned Sanskrit books at III… Das Gopatha Brahmana... Dieke Gaastra, Unknown. Sanskrit, 1919. 360 pgs.

Das Purana Pancalaksana... Wllibald Kirfel, Unknown. Sanskrit, 1927. 664 pgs. Dasa Charitam... Sri Sailusuri, Unknown. Sanskrit, 1989. 232 pgs. Dasapadyunadivrtti No 81... Dr Mangal Deva Shastri, Unknown. Sanskrit, 1943. 578 pgs. Dashaa Kumaaraa Kathaa Saaraa... Appaayaamatya, General. Sanskrit, 1949. 39 pgs. Dashopanishhada Grantha 106... Maarulakara Shan'kara Shaastrii, Religion. Theology. Sanskrit, 1937. 227 pgs. Dasopanishadas Vol 1... C.kunhan Raja, Unknown. Sanskrit, 1935. 520 pgs. Dasopanishads Vol Ii... The Pandits Of The Adyar Library, Unknown. Sanskrit, 1936. 644 pgs. Dasopanishads Vol-1... C.kunhan Raja, Upanishads. Sanskrit, 1935. 519 pgs. Dasopanishads With The Commentary Of Sri Upanishad-brahma-yogin... C.kunham Raja, Upanishads. Sanskrit, 1936. 518 pgs. Dasopanishads With The Commentary Of Sri Upanishad-brahma-yogin... G. Achari, Art. Sanskrit, 1936. 518 pgs. Dathu Rathnakara... Sri Madwi Jayalavanya Soori, Unknown. Sanskrit, 0. 348 pgs. Dattakamiimaan'saa Grantha 116... Nanda Pand-d'ita, Religion. Theology. Sanskrit, 1954. 379 pgs. Dattapuranam... Swami Vasudevananda Saraswathi, Unknown. Sanskrit, 2004. 736 pgs. Descriptive Catalogue... K.s.ramamurthi, Upanishads. Sanskrit, 1993. 111 pgs. Descriptive Catalogue Of The Government Collections Of Manuscripts Jaina Literature And Philosophy Vol Xvii... Harilal Rasikdas Kapadia, Unknown. Sanskrit, 1954. 330 pgs. Descriptive Catalogue Vol I... Dr.k.s.ramamurthi, Religion. Sanskrit, 1993. 222 pgs. Deshabhakta Krxshhnd-aajii Prabhaakara Uura~pha Kaakaasaheba Khaad'ilakara Charitra... Khaad'ilakara Kaashinaathahari, Geography. Biography. History. Sanskrit, 1949. 428 pgs. Deshabhaktta Saahityasamraat'a Narasin'ha Chin'taamand-a Kelakara Yaan'chyaa Aat'havand-ii... Baapat'a Sa Vi, Geography. Biography. History. Sanskrit, 1945. 680 pgs. Deshii Naama Maalaa Dditiiya Khand-d'a... Hema Chandraa, Religion. Theology. Sanskrit, 1938. 523 pgs. Deshiinaamamaalaa... Hemaachandraa, Language. Linguistics. Literature. Sanskrit, 1938. 525 pgs. Devalaya Grama Mahatmyam... Balachandra Kavishvar, . Sanskrit, 1827. 277 pgs. Devanandamahakavya of Sri Meghavijayopadhyaya... Pandit Bechardas.j. Doshi, Unknown. Sanskrit, 1937. 102 pgs. Devatadhyaya Samhitipanisad Vamsa Brahmanas With Commentaries... Ballikoth Ramachandra Sharma, Unknown. Sanskrit, 1965. 270 pgs. Devatadhyaya Samhitopanisad Vamsa Brahmanas... B Ramachandra Sharma, Unknown. Sanskrit, 1965. 264 pgs. Devendra Mahakavyam... P.bhochardas Jeevraj Desi, Unknown. Sanskrit, 0. 114 pgs. Dhaara~mikavimara~shasamuchchaya... Bhaaratii Svaami Vidyashan'kara, Religion. Theology. Sanskrit, 1944. 237 pgs. Dhaatukoshaa... Shaastrii Baahuballabha, Language. Linguistics. Literature. Sanskrit, 1912. 288 pgs. Dhanyaalokaa... Chaara~ya Aanan'davaradhana, Language. Linguistics. Literature. Sanskrit, 1937. 149 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 16/167

463 pgs.. 320 pgs. Dhaturoop Sangraha. 552 pgs. Unknown. Gokhale. laxmanshastri joshi. Sanskrit. Religion.... Sanskrit. Sanskrit. 764 pgs. Unknown. Dhavnalokha. Sanskrit. Dhatvarthavijnanam. 216 pgs.. Dravya Gun Vignan Purvardhamu. 1914. 1950. Unknown.. Dharmasindhu. Unknown. 117 pgs.. Dr Nagendhra. 415 pgs. Sanskrit. 424 pgs. 56 pgs.. 1935... Religion... 167 pgs.bhagiratha Prasada Triputhi Vagisa Sastri. 1954. 1942. 156 pgs. Pandith Sri Shobhit Mishra. Sanskrit. Sanskrit... 1949. Dhathuratnakarah Shasthi Vibhagah.. Sanskrit.. laxman shastri joshi. Unknown. 1950.. 674 pgs. 352 pgs. 212 pgs. Dhara~matattvanind-ara~ya Prathamaa Bhaaga 1. Dhwanyalok Rahasyam Prashnouttari. Sanskrit. Thakur Udaya Narayana Singh. Draahmaayand-a Grxhma Suutravrxtti Grantha 74. M L Jacks. Unknown. Unknown.. Dhara~matattvanind-ra~ya Parishishht'ama~ Bhaaga 2. History... Sanskrit.. Theology. Biography... Unknown. 214 pgs.v. Sanskrit.. Lelegan'gadhara~ Vinaayaka~. Sanskrit. History. Sanskrit. Dharma Kosah Vyavaharakanda Vyavaharamatrka Vol 1 Part 1. Laxmana Shastri Joshi. Dhavnyaloksar.. Geography. 0. Drahyana Grihya Sutra. 544 pgs.. 109 pgs. K. Sanskrit.. Unknown. 1980.2/14/2011 A list of scanned Sanskrit books at III… Dhara~ma Bin'duu. Dr.... Unknown. Unknown.. 1977. Khem Raj Krishna Das. Sanskrit.. Unknown. Unknown. 1941. sanskritdocuments. Theology.. Religion... Religion. Dvadashan' Pushhpama~.. 1872. 1929.. Sanskrit. Dhaturupa Manjari.l. 86 pgs.. -. Dvadasaranaya Chakra Of Sri Mallavadisuri Vol 1.. Vaidy Jadwaji Trikamaji Acharya. 1950. Aapat'e Gand-osha Vinaayaka. Ddivedii Dura~ga Prasaada.. 0.sastri. N G Kalelkar. Sanskrit. Sanskrit. Sri Purshoutam Sharma Chaturvedi. Dharmakosa Upanisatkanda Volume 2 Part 4.… 17/167 . Sanskrit. 120 pgs. Sanskrit.. Educationas A School Social Factor... Theology. Sanskrit. 294 pgs. Religion. Hari Bhadraa. 0. Theology. 1953. Sanskrit. 1946.. Unknown. Unknown. Sanskrit. Laxmansastri Joshi. 1937. Sanskrit. Sanskrit. 146 pgs. Dharmikvimarsamuchya Vol I I. 1955. 1954. Dr C Kunhan Raja Presentation Volume. 1935. pandit feroz phamaji. 1937. Shriivasudevaanan'da~. Sr Madananthram Shastry Vetalen. 1952. Unknown. 232 pgs. Docrichikitsarnava. Dilkush Untasdi Gayaki Prathama Bhag. Unknown. Aapat'e Gand-osha Vinaayaka. 528 pgs. 388 pgs. Biography.. 182 pgs. 0.. Late Munichaturvijayaji.. Sanskrit. 1940. 0. Unknown. vadilal bapulal shah. Religion. 2001...org/…/SanskritIIIT.. Charandas Shastry.. Dura~gaa Pushhpaanj-jali Grantha 22. Dina Visheshha... 211 pgs. Theology.. Dura~daivii Mohare. Geography. Dhvani Vicara.. 76 pgs. 166 pgs. Sanskrit. Unknown.. Sanskrit. Sanskrit. Dharmakosa Upanisatkanda Vol 2 Part 2. Pandith Marulkaropahvanar Hari Shastry. 860 pgs. Dutadangand. 145 pgs.. Unknown. Theology. Joshii Prahlaadanarahara. Dharmakosa Vyavaharakhanda. Unknown.. Unknown. Sanskrit. 0... 1952. Khemraj Shri Krishnadas.

82 pgs. 534 pgs.. Unknown. Ekavali Of Vidhydahra.. Biography.. Bhasara~vajnaa Aacharaya~. Sanskrit. Linguistics.. Sanskrit. 0.r. Unknown. Sanskrit.sreekrishna sarma. Sanskrit. 0. Sanskrit. Gajasiksha. Linguistics. Language. First Lesson In Sanskrit. 1968. 670 pgs. 1801. Sanskrit. Gandhi Gita... Gand-adara~pand-a Shhashht'ha San'skarand-ama~.org/…/SanskritIIIT.. Gadhy Padhy Mala Chaturth Kusumam Vol I. T. Unknown. Language. Gajasiksa. Eethi Sriskande Mahapuranam Prabhaskhand. 78 pgs. Theology. Bhattacharya. Unknown. Srimath Paramhans Parivrajakar Chary Brahmanisht Loksangrahi. Sanskrit. Dr. Gand-ikaa Vrxtta San'grah Khand-d'a 1 Grantha Maalaa 4.. Esevyopanishad Bhashyam. Unknown.padmanabhachrya Chitaguppa. Kelakara Chin' Na. Religion. Gajasiksa. 1953. 1987. Gandavyuhasutra.. Sanskrit.. Sanskrit...V I I I. Tantras. 360 pgs. -.. Sanskrit. Sampurnanand. -. Unknown.. 94 pgs. 1084 pgs. History.... 1867. Sanskrit.tadpatrikar. Sanskrit... Krishana Gi Parisharam Bide. E. 1975. Unknown. 1992. 140 pgs. Sanskrit.. Sanskrit. Gangavaratana. 0. Social Sciences.. Gananeshwari. Unknown. Sanskrit... Sanskrit. Unknown. Unknown. 1954. 214 pgs. Somraj Krishna Das.. Eeshopanishanthu. Unknown. 0.. Sanskrit. Dr. 418 pgs. 1950. . Sanskrit. Psychology. 1939.. . 702 pgs.k ramachandra aiyar.. Sanskrit. Sanskrit. 116 pgs. Unknown. 1981. Philosophy.. 106 pgs. 490 pgs.… 18/167 . Unknown. P L Vaidya.. Sanskrit. Literature. Unknown. 1958. Sanskrit. 177 pgs. Ganesh. S. 96 pgs. 542 pgs. 226 pgs.. Garuda Maha Puranam Of Sri Vedavyasa Mahamuni.r.j. 100 pgs.. 2000. 253 pgs.. Exercises in sanskrit translation. 130 pgs.. Unknown.... 2004. 90 pgs. Unknown. 1937. Sanskrit. 1949.. Language. 1920. Sanskrit. mahadeva deshiah. Unknown. 206 pgs. Gaud'apaadoyama~ Aagamashaastrama~. Gand-akaarikaa. Sanskrit. Religion...ballantyne.. Sternbach Ludwik.. Narayana Dikshita. -. Unknown. Sanskrit. Literature. P. Gaadadhari Vol Ii. Gajagrahana Prakasa.n. 152 pgs. Raamataarand-a. 1933. Theology. Dr. Geography. 1960. Sanskrit. 470 pgs. Sanskrit.ramaji Malaviya. naradamuni. 1975. 0.. subrahmanya sastri k s.r. Unknown.. Gaja saastram of paalakapya muni. 96 pgs. Garuda Puranam. 561 pgs.. Sripati..2/14/2011 A list of scanned Sanskrit books at III… Eeshavasya Upanishad I. Sanskrit.. 1975.. Gautamiyamahatantram.. Sanskrit. 383 pgs.. Veeraragava Achariya.. Dr P Sriram Chandrudu.. 707 pgs. Unknown. 348 pgs. Ganitatilaka. Gatagoshha~t'i Arathata~ maajhii Jiivana Yaatraa. 490 pgs...brej Mohan.. Ganesa Purana. Gaud'ayaada. Sanskrit. Linguistics.... 1920. 0. Gaekwad's Oriental Series. 1916.. 2001. Unknown.. 1968. Sree Krishna Sarma E... Pandit Kedaranatha Sastri. Literature. sanskritdocuments.. Ganatiya Kosh.

Sanskrit. 1983. 338 pgs. 338 pgs. Sanskrit.. Unknown. Gitagovinda Kavyam. Unknown. Unknown. 0. Sanskrit. 320 pgs..2/14/2011 A list of scanned Sanskrit books at III… Geeta Vignana . Geethopadesa.. 1924. 507 pgs.. 1935. Goldavyaprashnavimarsh. 1948... Rajendra lal Mithra.. Giitaayogapradipaara~yyabhaashhya. Bhaaskaraachara~yaa Shrii. 1952. Gilgit Manuscripts Vol Iii Part 3. 186 pgs. Unknown..l. Pandit S'ri Lakshminatha Tha. Sanskrit. 174 pgs. 322 pgs..tatacharya. 532 pgs. 184 pgs. 219 pgs.r. Glimpses Of Buddhist Culture In India. 890 pgs.. Sanskrit.. Anil Varan Roy. -. 246 pgs. Sanskrit. 256 pgs. Unknown... 253 pgs. Unknown.sampath Kumara Charya. Sanskrit. Sanskrit. 200 pgs.. Nalinaksha Dutt.. Dattatrey Venkateshwar Kettar.. Gommatasara Karma Kandah. Sanskrit. 0. 284 pgs. Unknown..... Gudharthatattvaloka A Commemtary On Samanyanirukti Gadadiiari. Religion... Gomileeygruhakarmaprakashika. Sanskrit. 1908. 383 pgs.. Gilgit Manuscripts Vol I I I Part I I I. 512 pgs. A. Sri Math Paramhans Parivrajakarchary Brahmanisht Lok Sangrahi.. Geetharthsangraharsha Geetabhashytathparyachandrikach. 322 pgs. Unknown. 1927. Gangadar Bapurao Kale. Unknown. Unknown. Gilgit Manuscripts Vol Ii. Goladyay Dwithiya Bagam. Narayan. V Subramaniam. Gitagovinda Mahakavyam.. Geetha Dharm Chandogyaupanishad Vol Ii... Sanskrit. Unknown. Unknown. 360 pgs... S B Valankar.nalinaksha Dutt. Sanskrit. Religion. Unknown. 1934..Bhashya. Theology.. Gudhartha Dipika. Krishna Yajurved. 1952. 1941.. Gilgit Manuscripts Vol Iii. 1934.. Dhanapati Suri. 1943. 116 pgs. 66 pgs. 244 pgs. Sanskrit. 100 pgs. Narayana Ram Acharya. Gopath Brahmana Of Atharva Veda.... Unknown.. Sanskrit.… Religion Theology Sanskrit 0 1049 pgs 19/167 . Sanskrit. Theology. 1932.. 316 pgs. 1972. Subhramanyamvidhusha. Sanskrit. .. Sanskrit. Sanskrit.org/…/SanskritIIIT. 1939. 0. Gitagovinda Of Jayadeva With Commentary Of Laksmidara. Unknown.. Nalinaksha Dutt.s. Unknown... Religion.. 1941.n. Religion. 132 pgs.. Gilgit Manuscripts Vol I. 186 pgs. Unknown.. 1971. Religion. 178 pgs. k s ramamurty. Sanskrit. Unknown. Gochar Aur Asthakavarga. Sanskrit. Golaadhyaaya Uttarara~dharupo Da~tiiyo Bhaaga. Ramamurthi.aryendra Sharma.. Sanskrit. Unknown.. Gramegeya Ganamatk. Gitagovinda Of Jayadeva.. Aara~muni Pand-d'ita~. Sanskrit. Unknown. 0. 1942. Dr. Unknown. Nalinaksha Dutt. Gopala Sahasranama Stotram. 247 pgs.. Sanskrit. Gita Samiksa.. 1942. 1941. Sanskrit. Gilgit Manuscripts Vol Iii Part Ii. Unknown. 1943. 1990.. 1990... Theology.. Guruparampara Charita With Comm sanskritdocuments. Graganithadyaya. Dr Nalinaksha Dutt. Sanskrit. Sanskrit. Sanskrit. Grihya Sutras Of Varah. Religion.s. E R Sreekrishna Sarma. 1939.. Sanskrit.. Sanskrit. 1969. Sanskrit. Religion. 126 pgs. 1946.. Dr Nalinaksha Dutt.. Dr. 1972.. 1985. Religion. K. Gruha Vidhan. 452 pgs. Sanskrit. Geetageervanam.m.. Mohan Lal. Dr. Aacharya baskaranand lohini... 100 pgs.. veerendrarai chandra shankar mehatha. Sharma. Sanskrit. Unknown..

Philosophy. Sanskrit. History. Halayudh Kosha.. Harshacharita Sara. Unknown... 1939. Bodhendrasarasvati. 1964. Gyaariibaald'ii. Paramesvara Bhatta.. Vopadeva. Religion... 763 pgs.. Haribhadra Suri Grantha Sangrahah. Unknown.m. Kelakara Narasin'hachin'taamand-a. Hariharaaddaitabhuushhand-ama~. 261 pgs. Sanskrit... Religion.. 0... Sanskrit. Guruvamsha Mahakavyam. 1957. Theology. Sanskrit.. Jaya Bharati. Theology.. Religion.. 96 pgs. pgs. Unknown. Sri vadiraja Tirtha. Durgaprasada amp Kasinath Pandurang Parab.. Unknown. Unknown. 1954... Sanskrit. Haricharita. Harshacharita The Fifth Ucchhvasa. Aappaapaadydhye Keshava~. 1948. O... R. 1879. Pandit V Ananthachary. 166 pgs.… 20/167 . 1945. Piit'ara~sana~ Piit'ara~. Sanskrit.. 67 pgs. Shri Dhanya Kumari. Sanskrit..p. Sanskrit. 115 pgs. 1931. Hanumannnatak. Harshacharitha Sangraha.. Harshacharitha Sangraha. Hari Charitra. Theology.. 1989. Parameswara Bhatta.. 139 pgs. Jai Shankar Joshi. Religion. Unknown.sri.. Halayudhkosh Abhidhanratnamala..k. Haridiiqs-ita. Sanskrit... 1917. . Hara Naaraayand-a Aapat'e Yaan'chen' San'qsipta Charitra. 167 pgs. Theology.... 1920.. 1948. 146 pgs.. 120 pgs. The Arts. 1958.. Ram Swaroop Sharma. Unknown. Hari Naaraayand-a Aapat'e Charitra Va Vaang-a~mayavivechana. Religion. Harshacharita Ek Samskrutika Adhyayana. Aan'bekara baapujiimaara~tan'd'a. Shriijagadiishhvarabhat't'aachaara~ya. Sanskrit. Geography. Theology. 305 pgs. Sanskrit.. 153 pgs.. Paanase Venubaaii. 1948. 1948. Sanskrit. Hashacharitha Sangraha. Harsha Charitam. Sanskrit.. Sanskrit.org/…/SanskritIIIT. 1049 pgs. 590 pgs.... 93 pgs. Vasudevasaran Agarwal. 1982. Haravijayam Of Rajanaka Ratnakara. Sanskrit. Haimsa phrama~ Da Rxgvedaa... 249 pgs. Psychology. 1896. Literature. The Arts. Sanskrit.. Subrahmanya Shastri. 1960.. Haricarita By Paramesvara Batta. Haasyaara~nd-avaprahasanama~. 0. Hemaadra Uura~pha Hemaad'apan'ta Yaachen' Charitra. Theology. Tryambaka Makhin. 419 pgs.. Hatopadesha. Geography. Unknown. Mahadevaiah K. History. Biography. Haricharita. Hariliilaa Nan' 3. Sanskrit. Harivan'shaachii Bakhara.. 764 pgs. Haridiiqs-itakrxtaa Brahmasutravrxtti. 0. 383 pgs. 1948. Sanskrit.. Sanskrit. Literature. Dr Suram Srinivasulu. Sanskrit. Religion. Harmakutam Sundarakanda. Vaamanashaastriikhare Vasudeva.. 104 pgs. Jaya Shankar Joshi.. 254 pgs. Sanskrit. Unknown. 0 pgs. 113 pgs. 1922.. 1951. Psychology. Religion. Religion. Bi h Hi t S k it 1939 500 sanskritdocuments. Sanskrit. 199 pgs. Theology.. Philosophy.. 0.. Biography.y. 0.. C Sankara Rama Sastri. 1999.. 1952. Unknown. Sanskrit. 1909. Sanskrit. ..2/14/2011 A list of scanned Sanskrit books at III… Guruparampara Charita With Comm.v Krishnamachariar. Sanskrit. Sanskrit. Sanskrit. Durgaprasada amp Kasinath Pandurang Parab. 308 pgs. Geography. Religion. Hasya And Prahasana A Critical Study. Haricharita.. 98 pgs. 144 pgs..... Unknown.dhorasamaiah. 1917.. Religion. Sanskrit. Sanskrit. 1994. 1850. Bal Govind Jha.. 556 pgs. Sanskrit. Sanskrit. Gurvarthadipika.. 238 pgs. 743 pgs. Sanskrit. Krishnamacharya. Gulab Chand. Literature. 0 pgs. Unknown..

Unknown. P V Kale. 466 pgs. Unknown. sanskritdocuments. 274 pgs. Pt.. C Dwarakanatha. 454 pgs. Unknown. 120 pgs. Deva Utpala. R Shama Shastri. 423 pgs. Sanskrit.. Sanskrit. Theology. 132 pgs. Unknown.. Hitopdesh. G V Devasthali.org/…/SanskritIIIT. Peterson Peter. Intermediate Sanskrith Selections. Iishaavaasyopanishhada~. G V Devasthali. Sanskrit. 1941.. 1921. Religion.. History Of Sanskrit Poetics. 2002. Unknown. Dr R Shama Shastry. 1949... 360 pgs... Iishaavaasyopanishhata~ Grantha 5. Sanskrit. 1953.. Theology. Religion. History Of The Duta Kavyas Of Bengal. 192 pgs.. 530 pgs. Sanskrit. Iishvara Pratyabhinj-aa Prathamo Bhaaga Grantha 22. Pandit Sukhlaji Sanghavi. Sanskrit... Gupta Mada Abhinava. Govinda Das. Sanskrit. 1986.. 258 pgs. Intermediat Patchabagh..2/14/2011 A list of scanned Sanskrit books at III… Biography. Gupta Abhinava.. Deva Utpala. 105 pgs. Unknown.. 1925. Unknown... Gupta Abhinava... 1938.. 176 pgs. 168 pgs.. Indian Scientific Nomenclature Of Birds Of India Burma And Ceylon Vol X X... Unknown. H M Lambert.. Sanskrit. History. Philosophy. Hinduism. 1953. Sri Krishnavallabha Charya.. Unknown. 1930.. 1951. Arthasasthra Visarada. Indo Aryan And Hindi. Sanskrit. Theology. Theology. Unknown. Sanskrit. Index Verborum Part Iii. Religion. Unknown. Introduction To The Devanagari Script. 1943.. Iishvara Pratyabhi Nj-aavivrxti Vimara~shinii Prathamo Bhaaga Grantha 60.. Ishvara Pratyabhijna Vimarshini Of Utpaladeva. 100 pgs. Sanskrit. Psychology. Unknown.. Religion. Theology. Shan'karaananda. Iishrvarapratyabhijnaavivrxtivimara~shini. 134 pgs... Sanskrit.. Hetubindutika Of Butta Arcata. Unknown... Unknown. 302 pgs.. Sanskrit.. Sanskrit.. Religion.. Sanskrit. Theology. Sanskrit. Theology. 90 pgs.. Religion. Unknown... Indravijay. N Padmavathy. 1990. Intermediate Sanskrit First Year. Sanskrit.… 21/167 . 161 pgs. 290 pgs.. Introduction To Kayachikitsa. Sanskrit. Sanskrit. 1949. Influence Of Kalidasa On Harshavardhana.. 78 pgs. Kiranvalli.. 515 pgs. 436 pgs.. Unknown. 520 pgs. 1930.. 1921. 1938. Sanskrit. 457 pgs. Religion. 1949. Mukunda Rama Shastri.. Sanskrit. 0. Introduction To The Study Of Mudra Raksasa. 1918. 354 pgs. Unknown. Introduction To The Study Of Mrcchakatika. Sanskrit. 1948.. Unknown... Suniti Kumar Chatterji. 1969. Sanskrit. 1925. Sanskrit... G V Devasthali. -. Unknown. Sanskrit. 500 pgs.. Sanskrit. 470 pgs. Sanskrit. Iishvarapratyabhinj-aa Dditiiyo Bhaaga Grantha 33. Dr Jatindra Bimal Chaudhuri. Hetubhindut'hiikaa. Bhat't'a Aara~ya. Sanskrit. Index Verborum Part Ii. 1939. 1973.. Iishrvarapratyabhijnaavivrxtivimara~shinii Trxtiya Bhaaga.. Hitopdesh Mitrlabh. 1924. Theology. 1942. 632 pgs. Sanskrit. i srinivasa rao.hargovind Shastry. 323 pgs. Sri Madhusudan Sharma. Religion. Index Verborum Part 1... 197 pgs. Unknown. Raghu Vira. 1953. Theology. 354 pgs.. 0. Bhin'd'a Sadaashivashaastrii. Religion. Sanskrit. Unknown. 0. 457 pgs. Sanskrit. 1934... Sanskrit. Hymns From The Rgveda. Hitopdesh Suharbudedh. 1986.

... 1951. Jatakatthakatha Vol I. 1984. Sanskrit. 248 pgs. Sanskrit. Unknown.r. Sanskrit. Unknown. Unknown. Jainendravyaakarand-ama~. 1982. Unknown. 536 pgs.org/…/SanskritIIIT.. Dr B Ramaraju. shambhunath tripathi. Muura~tii Vijaya. Sanskrit. Sanskrit. Jatakattha Katha.m. Sanskrit. Unknown.. Sanskrit. Jaiminiya Brahmana of the Samaveda. Theology. Jataka Parijata Adhyayas 11-15. Daivajana Vaidyanatha. Theology.2/14/2011 A list of scanned Sanskrit books at III… Isvasyopanished Asyam. 350 pgs.. Gandesha~gore Naaraayand-a. Sanskrit. 0.. Jaathakadesha Margaha Chandrika. 296 pgs.. Unknown. . Unknown... Bhikshu Dharm Rakshit.. Jaiminiya Brahmana Of The Samaveda... Jambhavati Parinayam. 1922.. Theology. Jambu Chariyam Number Xxxxiv. Jathakat'a~t'hakathaa Prathama Bhaaga. 0. Jaiminiya Arseya Jaiminiya Upanishad Brahmanas.. Acahrya Jinvijay Muni. Sanskrit.r. 1952. 1950. 524 pgs.. Jainendra Mahavritti Of Shri Abhayanandi. Language...... Tripitakacharya Bhikshu Dharma Rakshit. Linguistics. 1947. Sanskrit. Sanskrit. Sharma. 146 pgs. Sanskrit.. Jainashiilaa Lekha San'grah Dditiiyo Bhaaga.. 538 pgs. 333 pgs. Raghuvira.. 1969. 455 pgs. Mahopadesaka S Rajavallabha Sastrigal. Jaiminigrxhmasuutrama~. 305 pgs.. Dr Prabhakar Shastry. V. Sanskrit. Sanskrit. Jathaka Bharanam. Biography. Language. Janasrayi. 1950. 1980. 1951.. 0. 1950. 568 pgs. Sanskrit... Sanskrit. 105 pgs. 1937.. Sanskrit.. Sanskrit. B.… 22/167 . 1956. Mallinathana Si Esa... gopesh kumar ahoja... Theology. 0. Language. 414 pgs. 247 pgs. Sanskrit.. 344 pgs. Jathaka Baranamu. Literature.. Jagadish Anumitha Grandhah. Unknown. Gupte Ke Esa~. 0. Religion. 1984. 1934..... 1920. Religion... brahmachari sarveswaranand. Literature. Itihasah Shaastra Va Tattvajnj-aana. Religion. 582 pgs.. Jaatakapaarijaata. Literature. 170 pgs. 1904. Bhiqs-u Dhara~maraqs-ita. Theology. Unknown. Jagadruru Sri Sacchidananda Sivabhinava Nrisimhabarathi Vijayakavya.. 940 pgs. Biography. Sanskrit. Achyatananda. Raghu Veera. Javaahara~lala~ Neharu Aatmacharitra. Jaimani Sutra Vritti Subhodini Namika.. 1951. Unknown. Unknown. Ramakrisha Kavi.. Jaminiya Arseya jaiminiya Upanishad Brahmanas. 178 pgs. V. Sanskrit.. Subramanya Sastri... 408 pgs.. Jaisinhakalpadrumah Dharmashstragranth 1. 342 pgs. Jainadara~shanasaara. Religion. Theology. Unknown. 1954.. Geography. Unknown. Jathaka Baranamu. sanskritdocuments. Sri Vallabhacharya. 0. Sanskrit. Devanandimunii. Pullagummi Venkatacharyulu. Bellikoth Ramchandra Sharma. Linguistics. Sanskrit. 0. 0. Kalaan'da Vi. Jaiminiiya Braahmand-an' Dditiiye Kaand-d'e. 446 pgs... Lokeshachandrend-a. Jalabheda. Jaipur Ki Saskrith Sahitya Ko Daen. 175 pgs. 145 pgs. Sanskrit. Unknown. 442 pgs. Unknown.... 76 pgs. 171 pgs. Unknown. 406 pgs. Vacant.. Sanskrit. . Sanskrit. Acharya. Linguistics. History. Religion. Sanskrit.. Astrology. 81 pgs.. Religion. Linguistics Literature. Panditharinarayansharmami.. 1933. Sanskrit. Linguistics Literature. Sanskrit. Sanskrit.. 1944.. 714 pgs. Geography.

Shriibaand-abhaat't'aa Mahaakavii. 0.. Jinaratnakosa Vol I.. Jyothishshamasangraha Jaathakbhag. 1867. 216 pgs. Linguistics. 56 pgs. Sanskrit. 714 pgs. Language.. 545 pgs. Journal Of Sri Venkateswara Orintal Institute Tiruoathi Vol 2.b. Pandit Narayan Datta Vaidy. Unknown. Sanskrit.. Jeevanandanamu. Language. Language.. 623 pgs. Linguistics. 694 pgs. Literature.. Sanskrit. Sanskrit.. Kaalamaadhava.. 264 pgs. 1925. 349 pgs. 408 pgs. Jeevandhara Champuh. Literature. 88 pgs. Literature.. Unknown.. Sanskrit. 1954. 1076 pgs. Kaalidaasa. 1934. Kaashi Kaa Vivarand-a Panj-jikaa Khand-d'a 3. 643 pgs. Miraashii Vaasudevavishhnd-u. Vilomakaaland-d'a Shriidakt'ara~.. 134 pgs. Unknown. Pandit Pannalal Jain Sahitya Charya. 563 pgs. 217 pgs. Literature.... Pandit dayashanleareupadhyaya. Unknown. 264 pgs. 1936. Unknown. Theology. Sanskrit. Language. Iishvara~ Proktama~. Linguistics.. Philosophy. Sanskrit. Philosophy.. 0.. 304 pgs. Linguistics. Jotisha prasna phala ganana. 1995. Kaat'hakagrxhyasutrama~ Bhaashhyatrayasarasutama~. 1919. Ramchandra Kesava Bhagwat. Theology. Theology. 1131 pgs. -. Jyaneswarinche Shabda Bhandar.. Religion. 1947. Religion. Sanskrit. 247 pgs. Sanskrit.org/…/SanskritIIIT. Sanskrit.. 772 pgs. Sanskrit.. 416 pgs. Literature. Ram Chandra Narayan Velingkar. shyam lal. Jayadevacharitram. 1975. Theology.. Kaasyapagnaanakandaha. M. Sanskrit. 1959. 0. Aashaadhara Pand-d'ita. 1952. 488 pgs. 0. Literature. Rajanadh Sarma. Unknown. 188 pgs. 1951. Biography. -.. Psychology. Sarasvatihrdayalankara. Jayasri Grandhavali. Kaashi Kaa Vivarand-a Panj-jikaa Vol Ii Part I. Language.. Linguistics. Jitante Stotram. Kaat'hakopanishhata~. R. 142 pgs. Unknown. Chaara~ya Maadhava. Sanskrit. Jayapoorva Bhavamu. Unknown. Language... Sanskrit. Shriidhashaastrii Pan'd'ita.. 0..… 23/167 .. 1909.. Hari Damodar Velankar... Sanskrit. 1921.... Buddhi Jinendra. Bhat't'aachaara~ya..2/14/2011 A list of scanned Sanskrit books at III… History. Religion. 1944. Kaalidaasa.. Jivanandanam. Sanskrit. 314 pgs.. Sanskrit. Kavii Narasin'ha. Kaadambariikalyaand-an' Naat'akama~. Kaarikaavalii Mukttaavaliida~vitiiyan' San'skarand-ama~. Kaadambarii Shhashht'a Vrxtti. Theology. Religion.. Linguistics. 1944. 576 pgs. Jinasahasranaama. Sanskrit. 1913... Sanskrit. 1976. Balasharma... History. Religion.. Chakravara~tii Chan'draa. Sanskrit. 1948. Sanskrit.. 736 pgs. 0. Sanskrit. 1929. Jnaneshwari. Literature.. Sanskrit. Jnaanaara~nd-avatantrama~. Unknown. 1925...duraiswami Aiyangar. Linguistics.. Religion. 64 pgs. G Laxmi Kantaiah. Sanskrit. Sanskrit.. Kaalidaasiiyama~ Rxtusan'haarand-ama~ Da~vitiiyo Granthaa. K t'h k i hh t Ch t thi k tti V d Phil h P h l sanskritdocuments. Parthasarathy Battacharya. Unknown.. 141 pgs. 1954. Geography. Unknown. Language... Sanskrit. Jigyansadhikarnpoorvapaksh. Sanskrit..... 1947. Literature. Sanskrit. Buddhi Jinendra. Sanskrit. Kaashikaavivarand-apanj-jikaa Prathama Bhaaga.

Siddhichandragand-i. 1932.. Kaat'hakopanishhata~ Grantha 7. Kaavyamaalaa Shashht'ho Guchchhaka. Kaavyamaalaa Saptamo Guchchhaka. 1930... Sanskrit.. Linguistics. Sanskrit. Durgaprasada~ Pandita~. Kaavyamaalaa Da~tiiyao Guchchhaka. Sin'h Satyavrata..2/14/2011 A list of scanned Sanskrit books at III… Kaat'hakopanishhata~ Chatura~thiyamang-kanaavrxtti. Literature. Sanskrit. Language. Kaavyaprakaashakhand-d'ana. Linguistics... Harihara Kripala Dwivedi. 143 pgs. Biography. 0.. 282 pgs. Unknown. 1986. 1934. 254 pgs. Biography. 147 pgs. Kalidasa Sahitya Evam Vadana Kala. Language. Unknown. 363 pgs. 1938. 1914. Dand-d'i Aachaara~yaa.. Kadambari . Shriimaanatung-gaachaaraya.. Unknown. Dr Sushma Kulshreshtha. Linguistics. Kaavyamaalaa Dvadasho Guchchhaka. Sanskrit. 126 pgs. Sanskrit. Sanskrit. Kadhambari Purvabaga Part 2. 0. Technology.. 207 pgs...... Kaavyamiimaan'saa.org/…/SanskritIIIT. 1993. Geography.. K S Rama Swami Sastri. 156 pgs. Unknown.. Aapat'e Mahaadeva Chimand-a. Dura~gaaprasada~ Pand-d'ita. Kalpadrukosa Of Kesava Vol I Ramavatara Sarma Unknown Sanskrit 1928 564 pgs sanskritdocuments. Philosophy. 1954. Madhava Charya.. Unknown. 240 pgs. Raajashekhara Kaviraajaa.Purva Bagha.. Sanskrit. Unknown.. 114 pgs. Theology. Vyasadevena. History. Kala Madhav. Psychology. Technology... 1937.sehgal. 0. Sanskrit. Sanskrit. Sanskrit. Raajashekhara Kaviraaja.. Unknown. 1936.. Kabeer Manshur. Kainkaryaratnavali. Literature.. Philosophy. Raajashekhara Kaviraajaa. Sanskrit. 1935.. Sanskrit. 1993. -. Kaavyaadara~sha. Unknown. Sanskrit. -.. Religion....... 1935. 1926.. Biography.. Sanskrit. Sanskrit. 1394 pgs.. 300 pgs. Sanskrit. 1972. Kalapoornoday. Kalidasa Vol Ii. Kalidasa's Kumarasambhavam (cantos I-vii).. 176 pgs.. 1953. Kaavyaratnan.. 1931. 1952.… 24/167 . Kalpa Kalkika. Kaavya Prakaasha 15.. 172 pgs.. Kakolutikeeyamu. Dr M Srimannarayana Murti.. Shaastrii Shriivasudeva. Literature. Sanskrit. 212 pgs. 0. Sanskrit. 280 pgs. 412 pgs... Sanskrit.. Literature. Language. Linguistics. 606 pgs. Unknown. kapila vatsyayan. Literature. History. Language. Kalatattvakosa. 290 pgs. Sri Paramanandaji. Unknown. Sanskrit.r.. Kaavyamiimaan'saa Prathama San'skarand-ama~. 715 pgs. Sanskrit. 1954. 352 pgs. Social Sciences. Sanskrit.. Literature. History.. Sanskrit. 389 pgs. 108 pgs. 376 pgs. 1955. 175 pgs.. 1958. 140 pgs. Kai Govin'dasuta Ura~fa Parushuraama Govin'da Chin'chaalakara. Psychology. 1992. Language. Sanskrit. 160 pgs. Kaavyamiimaan'saa Aalochanaa Nibandha. 1939.. Kalaamruthamu. Kainkaryaratnavali Of Paravastu Krsnamacaharya.. Geography. Linguistics. S. 377 pgs. Linguistics Literature. Kaayaparishuddhi. Parushuraamachin'chaalakara Dattatraya. Sreemannarayanamurthy. Language. Literature. 1959. Literature. Sanskrit. Sri Vishnu Sharma.. Sanskrit.. Durgaprasada~ Pandita~. Linguistics.. Sanskrit. Ara~hadhaasii.. Linguistics Literature. 510 pgs. S Suryanarayan Shastry.. 1955. Sanskrit.. Kasinatha Panduranga Parab. Geography. Sanskrit.

Sanskrit. Kalpadrukosa Of Kesava Vol I I.. Kamalavilasabhana. 231 pgs. Kashyapgyaankanda.. Bapuharshet Devalekar.. Indian Astrology. Sanskrit.patrusarthi Bhatta Charya. Somasnambhu. Kanakaamara Munii. 268 pgs. 558 pgs. Geography. Kalyan Ank. Unknown. Sanskrit. Pardha Saradhi Battacharya.. 1934. Unknown. Unknown. Kalyan Sankhya-i.. 1967. Bhattacharyen Sripad Sharmana Damodar Bhattsununa. Sanskrit. Kanva Sanhita.. 212 pgs. Sanskrit. Ghorapad'e Ekanatha Keshavarava. 0. Technology. 176 pgs. Unknown. Karmakanda Karmavali. sanskritdocuments. Karaka Mimamsa. Kalpalataviveka By An Anonymous Author. Sri Kalanath Jha. 1937.. 1915.. Sanskrit. Kalyaanamaalla Mahaakavi... -. Unknown. Karmakanda Kramavali No Lxxiii. Kashyagnanakandah. Sri Somashambhu. Sanskrit. Ramavatara Sarma. Linguistics. Sanskrit. Kashyapa Mahaara~shhi.. 2001. Sanskrit. Madhava Shastri.… 25/167 . Sanskrit. Sanskrit. Sanskrit. Unknown. 0. Unknown. Unknown. Karupuramanjari Edition Ii. 1960. Kalyaanamaalla Anan'garan'gama~. Literature. Kalyan Sanshikpt Skand Puranam.. 240 pgs. Sanskrit. Kashyapashilpama~. 462 pgs. Sanskrit.. Sanskrit.. 564 pgs. 0. Kara~maviira Bhaauuraava Paat'iila Charitra Va Kara~ya. Religion. 1942. Unknown. 1899. Sanskrit. 0.. Sanskrit. Unknown. Kalyan. Kesava. Kapphinabhyudaya.. 100 pgs.... Unknown. 906 pgs. 0. 207 pgs.. 1947. -. Kanva Sanhitha. Sanskrit.. 0. Unknown. Parthasaradhi Bhattarcharya. Sanskrit.. 216 pgs. 313 pgs. 192 pgs. 395 pgs. Sanskrit.. 1969. Unknown. Sanskrit. 234 pgs. 1175 pgs.. Sanskrit.... 90 pgs. 140 pgs....... Karana Kutuhalam Of Sri Bhaskaracharya. Sanskrit. Linguistics Literature.. Unknown. Murari Lal Nagar. Gunabhadracharya. 0. Hanuman Prasad. Dr. 1960. Kalpadrukosha Da~vitiiya Bhaaga... Sanskrit. Kanya Sanhitha Of The Shukla Yajurveda. 1915. History. 674 pgs. Karanaprakasa. Karakan'd'achariu. Hanumanprasad Pohar.. 234 pgs. Unknown. Unknown. Unknown. 1860. Narayana Kavi. Kalyan Markandeya Puranam. Kaniviya Anthyashti Padhathi. Manomohan Ghosh. Language. Linguistics. 0.. Sanskrit. 1947. Sanskrit.. Unknown.. 30 pgs. 240 pgs. Sanskrit. Karak Darshanamu. Language. Unknown. Hanuman Prasad Pothar. 1927.. Kashika Part 3. . Kamakunjalata..2/14/2011 A list of scanned Sanskrit books at III… Kalpadrukosa Of Kesava Vol I... 1991. Biography. 112 pgs. Krishna Das Gupta. R. Unknown.. 0. 1932. 294 pgs.. 760 pgs. Motilal Joshi.. -. Indian Astrology. Unknown...... 1926. Kasaya Pahudam Iii Thidi Vihatti.. Unknown... Kalpasutra(subhodhika Vyakya). Srikanth Sharma. 1928. Linguistics Literature. 370 pgs.. Unknown.. Vamana. Sanskrit. Kalyana Sancheka. Panditraj Dhunddhiraja Sastri. 1971. Sanskrit. 900 pgs. Unknown. 0.... 528 pgs..satyendra Mishra. 412 pgs. Literature.. 1976. 1948. Sanskrit. 306 pgs. Unknown. Gauri Shankar..org/…/SanskritIIIT. Kartika Masa Mahatmyam. Sanskrit. Sanskrit. 148 pgs.. 307 pgs. 0.. Sanskrit.. Theology.. 782 pgs.. Kashyapajnana Khandah. 302 pgs... Sanskrit. The Arts.b. Badlikar Sriyeag Raghavrisurisununa. Brahmadeva. Sanskrit. 1958. 1932.

Rajachudamani Dikshita. Kavya Parisha.. 1939. Dr. Unknown. Social Sciences. 1924. Social Sciences. Shaastrii Ra Shamaa. Sanskrit. William Caland. 342 pgs.. Theology. Sanskrit... Sanskrit. Katha Sarithsagara. 266 pgs. Kavyadeepika. 114 pgs. 1960. Kautilya Vol I. 240 pgs. Sanskrit.. Sanskrit.manduka Vyasatirtheeya. 222 pgs. Linguistics. Kavindracharya List.. Sanskrit.. Kaut'iliiyama~ Ara~tha Shaastrama~ Dditiiya Khand-d'a. 172 pgs. Sakuntal Rao Sastri.. 0.m. 142 pgs. Kasyapa Maharshi.b. 1965.. Religion. 220 pgs. F Keilhorn. 58 pgs.nitya Nanda Parvatiya. Sanskrit.. Kavikalapadruma Of Vopadeva. Unknown. 1925... Jolli Je. 1944. Katha Kagruha Suthra. Literature. 1925. Sanskrit.. sanskritdocuments. Unknown. Linguistics. Sanskrit. 0. Bhin'de Sadaashivashaastrii. 1919. Dr Ram Gopal Mishra.org/…/SanskritIIIT. 1930..p.. 1952.... Vamana And Jayaditya. Sanskrit. Unknown... 1904... 1923.krishnacharya. Katyayana And Patanjali Edition Ii. 344 pgs. Unknown. 1969. Kavya Prakash.. Kathamruthamu.. Kathakagrhyasutram. Jollii Je. Jolli Je. 0.Jnan kanda... Sanskrit. 338 pgs. Sanskrit. Sanskrit. Sanskrit... S V Shastri... Linguistics Literature. Kasyapa Samhita. 330 pgs. Unknown. 84 pgs. 1924. 230 pgs. 1923. Katakarajavamsavali Vol I. 1948... 1921. Unknown.. Kaut'iliiyan' Ara~tha Shaastrama~. Unknown. Unknown. Kaushhiitakagrxhyasutraand-i. Sanskrit.... Parthasarathy Battacharya. 1954. Kavikalpadruma Prathama San'skarand-ama~.. Theology. Sri Parushuram Sharmana.. 1979.. 339 pgs. Pandith Rangacharya Raddi Shastry.r. Dr Gaya Charan Tripathi. Sanskrit. Kavyakotukadarsh. Rambalak Shastri. Kasyapa Jnanakanda. Social Sciences. Unknown.. M. 1938. Unknown.. Rarthasarathi Bhattachar. 486 pgs.. Unknown. 260 pgs. Kathasaritsagara Part 2. Sanskrit. 1951. 338 pgs. 378 pgs. Sanskrit. Literature.. Shriivopadevagosvaamii. R Ananta Krishna Sastry. Sanskrit. 1998. Kaut'iliiyama~ Ara~tha Shaastrama~ Khand-d'a 1.. 62 pgs. Unknown. Kavyadarsh. Pandith Sri Ram Govind Shukla.2/14/2011 y pgy p A list of scanned y Sanskrit books at III… pg Kasika Part 1. Literature.... 210 pgs. Gajanan Balkrishna Pa sule. Sanskrit. Sanskrit. 502 pgs.willem Caland. Unknown. 202 pgs.. 92 pgs. 466 pgs. 164 pgs. 1963. Sanskrit. Sanskrit... Social Sciences. Katiyeshti Dipaka. Rarthasarathi Bhattachar R. Kathaka Vyasatirtheeya Teeka. Unknown.. Kasyapa .. T...… 26/167 . Sanskrit. 236 pgs. 624 pgs. Language. Chintaamand-i Ti Ra. 1959. Unknown.r. Har Dutt Sharma.... Language.. 1984.girdhar Sharma. Sanskrit. Sanskrit. 142 pgs. Sanskrit.vedeshiya Teeka. R. Unknown. K C Varadachari. Somadeva. -. 1924. Pt... Unknown. 211 pgs.. 1934. Sanskrit. Religion. Kavindracandrodaya. Kasyapa Gnanakandaha. Kavyadarpana Volume 1. 1987. 348 pgs. Kat'hopaanishhada~ Aavrxtti Pahilii. Kaut'iliiyama~ Ara~tha Shaastrama~ Dditiiyo Bhaaga.. Sanskrit. 1904. Kaumudi Mahotsava. Religion. 122 pgs. Sanskrit. Kathopanisad Bhasya. Unknown. Sanskrit. 1948. Unknown... Unknown. Sanskrit. Unknown. Sanskrit...srinivasa Tirtheeya Etc. 423 pgs.

1916. 124 pgs. 1997. 1916. Sanskrit. Narayana Daso Banahatti. 1934. Unknown... Indian Logic. 1992.. 166 pgs. 1952. 1938. Koushetika Brahmanam Achara Vichara.. Sanskrit. Sanskrit.. Narayan Nathaji Kaulkarni.. Kavyalankara. Unknown. Sanskrit. 123 pgs. 1951. Bhat't'a Keshava. Acharya Hemachandra. 1919.. Sanskrit... Religion. Unknown. Krishna Charitramu Peri Venkateswara Shastri Unknown Sanskrit 0 74 pgs sanskritdocuments. 327 pgs.. Banhatti. 334 pgs. Unknown. Sudhakar malaviya.. Kavyalamkarasutravritti Of Vamana. The Arts. Sanskrit.. Unknown... Sanskrit. Unknown. Unknown.. Khilandhikara... Kenopanishhata~. Narayan Ram Acharya. 1951. Kevalanavyiprakarnaam. Sanskrit. 576 pgs. 1961. 1917. Pandit. Kavyalankarasutrani Vol I V... Unknown.. Philosophy.. Linguistics. Sanskrit. Unknown. Language. Dr. Sanskrit. 1956. 356 pgs. Khanda Kadya Sahastrika. 70 pgs.2/14/2011 y p A list. 1959.b. Unknown. Srigowrinatha Shastri.. Pandit Durga Prasad.. Hari Narayan Aapte. 0. 1937. Theology. 646 pgs. Kemopanished.. Rajvaidya Jivaram Kalidas Shastri. Sanskrit. 1938. 224 pgs. 117 pgs. Sanskrit. 1938. Kavyamala. -.. Dr. Kramadiipikaa. 174 pgs... Sanskrit. 1919. Pandit R. 538 pgs. Ganeshopadhyay.. Poems... Kiranavalirahasyam Of Mathuranatha Tarkavagisha. 2003. Sanskrit.. Sri Venkataramanarya. 449 pgs... 57 pgs. 232 pgs.. Sanskrit. Sanskrit. 112 pgs. Nitiivara~ma Mahaakavi. Psychology. 2002..… 27/167 . Sanskrit. Kishkindhakandah Of Srimad Ramayanam..org/…/SanskritIIIT... Kavyasangraha 3. Kasinath Panduranga Parab. 180 pgs. Religion. Theology.madladevi Shastri.pathrusarthi Bhatta Charya. Kavyalankara... Mahamahopadhyaya Pandith Shivadatta. Unknown.. Keinchuifantsan.. 359 pgs. Sanskrit. of scanned Sanskrit books at III… . Kavyalankara Sara Sangraha.. 1992. 510 pgs. Sanskrit. Machchhakad'araachaara~ya. Kavyalankara. Unknown. Sridhar Shastri. Kavyamala Part 1. Kavyamrtam. Pardha Saradhi Battacharya. 332 pgs... 626 pgs.. Sanskrit.ezhuthachan. ananthalal thakur. Kavyanusasana. 108 pgs.. 587 pgs.. 1925. Kavyaprakash.. 203 pgs. Sanskrit. 114 pgs. Religion. Jivananda vidyasagar Bhattacharya.. Kavyanusasana Vol I. Literature.. Sanskrit. Unknown. Sanskrit. Sanskrit. 1929. Unknown. Sanskrit. Sanskrit.. Laqs-mikaantasyaa jii. Kavyamala Part 13.. K.n. 0. N. Unknown.. Keralodaya (a Historical Poem). Pandit Durgaprasad. Kiirasandeshah. Kavyamala Part 5. Kiratarjuniya 1889. 582 pgs. Kavyaprakasa of Acharya Mammata. 1927. Unknown. 176 pgs... Kiichakavadhama~. Sanskrit. 1957. -. . Pandit Sivadatta. Krishna Charitam. Sanskrit. Unknown. Poems. 1962. pg Kavyalaksana Of Dandin. 140 pgs.. Sanskrit. Sreeramamurthy. 275 pgs.. Arka Somayaji. Unknown. 1889. Kenopanishhata~ Shhashht'hiiya Khand-d'a Grantha 6. Khiladikara. Unknown. Kiratharjuniyam. 1944. 0...d. Unknown. Sri Harishankara Sarama. 191 pgs. Sanskrit. Sanskrit.. 1934. 1981. Sanskrit... 43 pgs. 1929.. Unknown. Sanskrit. Kavyamala Part I X.. Naaraayand-a. 1166 pgs. Sanskrit. Kavyasamudaya. Theology.... 190 pgs. Durgaprasad.

.. Sanskrit.ayendra Sharma. Religion. Kundamaalaa. Theology. Dr. 1983.moksakanda. Sanskrit. 1997.. Rangaswami Aiyangar. Sanskrit. Krxshhnd-ayajura~vediiya Taittiriiyasan'hitaa Prathamo Bhaaga. Peri Venkateswara Shastri. 1976.. 234 pgs. Krtyakalpataru Of Bhatta Lakshmidhara Vol Iv. 1929. Dr.org/…/SanskritIIIT. Unknown.. Krtyaratnakara. k v rangaswami aiyangar.. Sanskrit. Shriimatsaayand-aachaara~yaa. C. Unknown. 1950.. 1929. Krtyakalapataru Of Bhatta Laksmidhara Vol 1.. 1983.ramamurti. Sanskrit. Vaamanashastrii Pand-d'ita. Kumarasambhavam Mahakavyam.. 1950... Shriimatsaayand-aachaarayaa... Krxshhnd-a Yajura~vediiya Taittiriiya San'hitaa.. Sanskrit. 424 pgs. 1890. 0. 658 pgs. Theology.. 592 pgs. 1940. Theology. Dr. Unknown. 1954. Rama Murti. Dr Surya Kanta. 777 pgs. 178 pgs. Shriimatsaayand-aachaara~yaa. Religion. Unknown.… 28/167 . Sanskrit. Unknown.. 373 pgs.. Sanskrit. Sri Neelamanimukhopadhya.. 1946. Rangaswami Aiyangar. Rangaswami Aiyangar. 230 pgs. Krishnajuvirdeeya Taitireeysanhitha... Unknown.. Krxshhnd-ayajura~vediiyataittiriiyasan'hitaa Da~viitiiyo Bhaaga.. Religion. 401 pgs.ramshankara Bhattacharya. Sanskrit. Literature. Unknown. Religion. Religion. 414 pgs. Shivaa Chara~yaa Niilakan't'ha. Shriiding-a~naaga Mahaakavii. 681 pgs. Thakkura.. Kriyaasaara Vol I.. Kumparnapuranam. Sanskrit. Kurmapuranam.. Krxshhnd-ayajura~vediiya Taittiriiyaarand-yakama~ Prathamo Bhaaga... Krxshhnd-ayajura~vediiya Taittiriiyopanishhata~ Pnj-chamiiyamang-kanaavrxtti. sanskritdocuments.. Sanskrit... Unknown. Sanskrit. 1954.. 1950.v. Krithya Kalpataru. Unknown. Rangaswami Aiyangar. Theology. 462 pgs... Krtyakalpataru Of Bhatta Laksmidhara Vol 3 Niyatakala Kanda. 1945. Sanskrit. Sanskrit. Sanskrit.. 446 pgs. k. 1967.2/14/2011 A list of scanned Sanskrit books at III… Krishna Charitramu. Religion.. Kriya Svara Laksanam Or Yohi Bhasyam.. 290 pgs. Unknown.v.sudhakar Malaviya.. 1941. Krsnavilasa Of Punyakoti. 644 pgs. Language. K V Rangaswami Aiyangar. 74 pgs. Sanskrit. Religion.s. 478 pgs. Theology. 490 pgs. Religion.v. 322 pgs.. Sanskrit. Unknown. 1945.. 413 pgs. Krxshhnd-a Yajura~vediiya Taittiriiya San'hitaa Panj-chamo Bhaaga. k. 446 pgs. Unknown. 1950. 436 pgs. Sanskrit. 1940.v. 1948.. 372 pgs. Religion. Sanskrit. Sanskrit.. Pandith Sripad Damodar Sathvalekar.. Shriimatsaayand-achaara~yaa.xiv.. Unknown. Dr. K. Krtyakalapataru Of Bhatta Laksmidhara.. Sanskrit. Sanskrit.. 1961. Ksemendra Studies. Suru Bhatta. 580 pgs. 349 pgs. Theology. K V Ranga Swami Aiyangar. Theology. Unknown... 1942. Linguistics.. Sanskrit. Sanskrit.. Ksemendra Ladrukhayasangra. Krxshhnd-a Yajura~vedii... Religion. Sanskrit. 1925. K. Unknown.k. 180 pgs. 1848. Krishna Vilasa Of Punyakoti With Commentary. Krtyakalpataru Of Bhatta Lakshmidhara Vol X. Sanskrit. Unknown. Krtya Kalpataru Of Bhatta Laksmidhara Danakanda Vol 5. Sanskrit. Krtyakalapataru Of Bhatta Laksmidhara Vol. 1976.. Rangaswami Aiyangar.. 258 pgs.s.. k.

. 162 pgs.2/14/2011 A list of scanned Sanskrit books at III… Kut't'aakaarishiromand-i. shri achyuthananda jha. Unknown.. Acharya Krishan Mohan Shastry. Prakash. 684 pgs.. Unknown. 1651. 1917. Munj-jalaachaara~ya.. Literature. Lakshmisahasra Vol Iv. Laghu Sabdendu Sekhara Vol I. Laghumaanasama~. Kutuuhalavrxtti Prathamodhyaaya... Sanskrit.. 328 pgs. 1974. 220 pgs.. Natural Sciences. Diiqs-ita Vaasudeva. Sanskrit. Sanskrit. Sanskrit. 1993. Theology. Sanskrit. Lakshmisahara. 34 pgs. Shriinaageshabhat't'a Mahamahopaadhyaaya. Laghu Siddanta Kaumudi. 298 pgs. Sanskrit. 1941. Sanskrit.. Peri Venkateswara Sastri. Sudarshanacharya Tripathi. Shara~mand-aa Vaasudeva.. Sanskrit.. Unknown. Kuttanirmatam Kavyam. Lectures On Patanjali S Mahabhasya Vol 2 Ahnikas 4 6.. Sri Girishkumar Tagore. 372 pgs.. Pandith Sri Narayana Dutt Shastrina. Sanskrit. Sanskrit. Sanskrit. Theology.. Laghurkatantrasamgraha And Samasaptalaksana.. Varadaraajaachaara~yaa. 130 pgs. -. Lagusidhantkomudhi.. 1904. Laghu Sabdendu Sekhara. Krishnamacharya.. Unknown. 1978. Unknown. Laghu Kashika 1... 1998.. Sanskrit. 1988. Lagusidhanthkoumudhi. 314 pgs. Sanskrit. Unknown. 277 pgs. 394 pgs.. 134 pgs. 608 pgs. 70 pgs. Laghu Parasari And Madhya Parasari. 1936.. 342 pgs. 1867. 174 pgs.. Dasharadhi. Madhusudan Kaul. 1954.... 1962. Theology. Ladhu Ramayanam. Shriibhaaskaraachaara~ya... 290 pgs. 514 pgs. Religion. Religion. Sanskrit.. Le Role Des Forets Dans Le Developpement Des Collectivites Locales Forets7.. Sri Varadharajacharya.… 29/167 . Laalaa Lajapatharaaya Yan'chen' Aatmacharitra Va Charitra. 46 pgs. Unknown. Geography. Suryakanta.. Natural Sciences. Unknown.. Unknown. Laghuparashari Madhyaparashari. Sanskrit. 456 pgs.. Lalleshwari Vyakyani. Language.. Laghubhaaskariiyama~. 1977. 310 pgs.. 1938. Unknown. Shriidevaraaja. Sanskrit. 1946. 34 pgs... Sanskrit. 858 pgs.. Natural Sciences. Sanskrit. Varadharajacharyapranith.org/…/SanskritIIIT. Sanskrit.. Prakash. 1940. Lakshmi Sahasram Part 1. 1951 314 sanskritdocuments. 0. Biography. 496 pgs. Theology. 257 pgs.. Unknown. 1944.. Unknown.. Unknown.. Pandit Sri Achyutananda Jha. Language. N C S Venkatacharya. 65 pgs. Unknown. Sanskrit. 1999. Sri Govindnath Guha. alfred lord tennyson.. Linguistics.. Sanskrit... Saktisrm. Unknown. Unknown.. Laghusiddhantkaumudi.... Religion.... 1941. Pandith Nandkishore Shastri Ayurvedacharya. 124 pgs. 133 pgs. Unknown. Sanskrit. Sanskrit. 2000. Kuvalayaananda. Literature. Sanskrit. Unknown. 1931. Tata Subbaraya Sastri. 1952. 296 pgs.. Laghu Siddhanta Kaumudii Pura~vaara~dharuupa Prathamo Bhaaga. Venkatadhvari. Sanskrit. Sanskrit. Laghushabdendushekhara Napadaantasuutraanto Bhaaga. 0. 1959. Lavangee. Lalitha Madhavam Gareth And Lynette.. Sanskrit. Kulakara~nii. Linguistics Literature. Lakshmi Tantra A Pancaratra Agama.. Religion. 1983.... Sanskrit. Unknown. J P George. History. 466 pgs. 1950. 1993... Sanskrit. Pandith V. Laghusidhantakoumudhi. Raghunathaharya N c. Ladhunibandha. Sanskrit. 0. 1280 pgs. 1944. Laghu Shabdendu Shekar. Sanskrit.. Unknown. 0.. P S Subramanya Sastri. Sanskrit. 152 pgs. Latkamelakamu. Linguistics... Sanskrit. Unknown.

Sanskrit. Linguistics.. Chaara~yaa Vyaakarand-a. Madanamaharnava. Sanskrit.. 1947. Sanskrit.. 0. 86 pgs. 268 pgs. 1931. Geography.… Madhavanidan Vijayarakshita And Shri kanthadatta Unknown Sanskrit 1932 792 pgs 30/167 . 1955. Natural Sciences. Bhavabhuuti. Linganusasana Of Durgasimha.. 1944... Sanskrit. Lectures On Patanjalis Mahabhasya Vol I I I. 187 pgs.2/14/2011 A list of scanned Sanskrit books at III… 1951. Liilaavatii Uttarara~dharupo Da~vitiiyo Bhaaga... Ma. Geography. Language. Religion. Maajhaa Sn'giita Vyaasan'ga.. Linganusasana.. Unknown. Devadhara. Theology. 491 pgs. 677 pgs. Psychology.. Literature. Sanskrit. History. Shriimadbhaskaraachaara~yaa... History. Sanskrit. 1937. Maanavii San'skrxtiicha Itiihaasa. 178 pgs. 1946. Maanameyaarahasyashlokavara~tikama~ Sakalashaastrasaarasan'graharupama~. Literature. Sanskrit. Kara~ve Chintaamand-agand-esha. 1948. 1953. Leelavathi. Unknown.. 1934. 1935. Sanskrit. Unknown. Shriinivasaachaara~ya Laqs-miipurama~. Religion. Sanskrit. Sanskrit. Literature. Maanameyarahasyashlokavara~tikama~. Philosophy. Maanavaa Grxhayasuutraa. Biography.org/…/SanskritIIIT. Shaastrii Raamaakrxshhnd-a Hara~shaajii. Biography... 1951. Madanpalnidhantu. Literary Circle Of Mahamatya Vastupala And Its Contribution To Sanskrit Literatute... Psychology. Sanskrit. sri visvesvara bhatta. History... Linguistics. vinayak ganesh apte. 374 pgs. 104 pgs. 1937. 266 pgs. Unknown. Geography. Language.. Pandith Ravi Dutt. 1952. Maajhii vilaayatachii Saphara~.. Language. Lokaprakasha Of Kshemendra. Harsavardhana. sanskritdocuments.. Sanskrit. 327 pgs. Language. 491 pgs. 1931. Geography. 194 pgs. Kulakara~nd--ii Ran'ganaatha. 0. Unknown.. 146 pgs. 115 pgs.. Liilaavatii Pura~vara~dharupam Prathamo Bhaaga. 448 pgs. History. 1924. Sanskrit. Sanskrit. Sanskrit. Aapat'e. 501 pgs. 1953. Biography.. Sanskrit. 1812. Literature. 182 pgs. Tekumalla Achyuta Rao. 150 pgs. 1930. Shriimadbhaskaraachaaryaa. Bid'e Sadhaashivashaastrii. Unknown. 1925. 1926.. 314 pgs. Gaan'dhii dara~shana~. Life of Pingali Suuranaarya.. 1928. 277 pgs. History. Korat'akara Vit't'alakeshavaraava. Pandit Jagaddhar Zadoo Shastri. Geography. Sanskrit. Dattatrey Gangadhar Koparkar... Shriibhavabhuutii Mahaakavii.. Sanskrit. Biography. Philosophy.. Theology. 685 pgs. Maara~ka T'a~vena. 314 pgs. 120 pgs. Sanskrit.. Maan'nd-d'ukyopanishhada~ Taittiriiyapanishhada~ Aavrxtti Pahilii. Linguistics. Sanskrit..... Language. Linguistics... Vinayak Ganesh Aapte. bhogilal. Leelavathi Uttarshorupo Dwithiyo Bhagah. Unknown. Maalatiimaadhavama~. Literature. Sanskrit. Maalati Maadhava Sekand'a~ Ed'iishana~.. P S Subrahmanya Sastri.. T'en'be Govin'da. Unknown. 270 pgs.... Maalatiimaadhavan' Naamaprakarand-ama~. Maadhaviyaadhatuvarittii.. Sanskrit.. 326 pgs... 474 pgs.. Natural Sciences. Unknown. Shriinivaasaachara~yaa Laqs-miipurama~. Sanskrit.. 1913. Linguistics. 0. Biography. Sanskrit. Sanskrit.

.. Sanskrit. Madhyama Kavatara Par Candrakirti. 1953. Literature.... 0.. Linguistics. 198 pgs. Madhavnindanam. Unknown.. Geography. 162 pgs.. Sanskrit. Vijayarakshita And Shri kanthadatta. Sanskrit. Theology. Sanskrit. Language. 1940.. 176 pgs. 104 pgs. 1924. Madhura Vijaya Or Virakamparaya Charita.. Madhyakalin Hindi Sant Vichar Aur Sadhana. 520 pgs. 710 pgs. Madhvatantramukhamara~danama~. Sanskrit. Language. Social Sciences. Phool Chand Siddhanth Shastry. Sanskrit. Sanskrit. Maghas Sisupalavadham Canto I I Edition V I. Saradaranjan Ray Vidyavinodha. 601 pgs. khemraj Shri krishnadas. Sanskrit.. Dr Hari Narayan Dixit. Madvanidhan.. Valle poussin. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Madhavanidan. Linguistics.chaudika prasad sharma. Sri Vrajwallabh Sharmana. 741 pgs. Saatalekara Daamodara. Mahaaraaja Shivaajii. 1932. 1888. 456 pgs... Unknown. 406 pgs. Unknown.. Unknown. Bhuda~bali Bhagavan'ta~.. Shriimadappayyadiiqs-ita. Unknown. 1936. -. Language. 1930.. 92 pgs. Linguistics. 0. 1992.. Literature. 1086 pgs. Biography. Language. Religion. 1965.. Literature. Sanskrit. Philosophy. Sanskrit. Pushhpadantaa Mahaakavii. Mahaabhaashhyama~ Prathama Grantha. P. The Arts. Madhyanta Vibhanga. Sanskrit. Sanskrit. 503 pgs. Mahaaban'dho Bhaaga 2.. Keshani Prasad Chaurashiya. Psychology.org/…/SanskritIIIT.. Unknown. 180 pgs. Bhagavan'ta Bhad'aaraya Bhuudabali. 1986.. 1984. Gaddangadevi. Sanskrit. Sanskrit. 1835. 0. Unknown. Sanskrit. Mahaapurand-ama~ Da~tiiya Khand-d'a. Ganga Devi. 385 pgs. Madhavanidhan... Literature.. Literature. 589 pgs.. 408 pgs... Mahaabhaaratama~ Prathama Bhaaga Viraat'apara~vama~. Sanskrit. Theology. 1983... Sanskrit. Pand'e Siitaaraama Vasudeva. Mahaaban'dho Pustaka~ 3. 84 pgs..... Kaand-e Pii Vii. 1969. 1931. 832 pgs. 1931. 792 pgs. Maha Bhashyam... 70 pgs. 1956... 1941. Maha Bandho Vol Iii Book Iv. sanskritdocuments. Manmukundamuni. Mahaabhaaratapraveshikaa... Sanskrit. 596 pgs. Unknown... 448 pgs. 1912. History.. Mahaapuraand-ama~ Uttarapurand-aada~vitiiyaara~dhabhuutah Trxtiiya Khand-d'a.. 454 pgs. Raghuviiraa. Sanskrit. 1954. Sanskrit. Mahaanaarayand-a. 1953. Literature. Sanskrit. Unknown. 172 pgs. Biography. Pandith Sri Ramchandra Bhatt. Sanskrit. Sanskrit.. Madhura Vijayam. Mahaabhaaratama~ Sat'iikama~ Chatura~to Bhaaga Drond-apara~va. Linguistics. Language. Madvanidhanamu. Philosophy.. Geography. Vasubhandu And Sthiramati... Sanskrit. Psychology. Unknown. Sanskrit.. sri madhuvakar. Sanskrit. Unknown. Unknown. 444 pgs. 590 pgs. Shriimanniilakand-t'ha. 1992. Unknown. Maenkavishwamithram.. Madhyakaumudini Rahasyam Prashnottari. Mahaanaarayand-a Upanishhada.. madhakara. Sanskrit. 0. Mahaabhaarata 13 Anushaakanapara~va.… 31/167 . 170 pgs. Madhavanidana. Religion.. History... Unknown. 1919. Linguistics.. Vipushhpadantaa Mahaakavi. 1951..

. 0. 670 pgs. Aajagaan'vakara Jagannatha Raghunaatha. Shri Yogendra.... The Arts. Unknown..… M h t Of Th M it i S kh R ki h H h ji S ti U k S k it 32/167 . Mahaviirachacharitaa. Unknown.. Sanskrit. Maharaja Bhojarajas Sringar Prakasha. P. Mahaban'dho Prathama Bhaaga. 1941. -.. Shastri. Maitrayani Samhita. Sanskrit... Sanskrit. Sanskrit. Sanskrit. Unknown. Unknown. 1918. Sanskrit.. History. Sri Charudevshastryna. Sanskrit. Sanskrit. 290 pgs. Sanskrit. Religion.. Biography.r... -. Mahabhasyam. Sanskrit. Unknown. 1951. Theology. Sri Sheshraja Sharma Shastri. Sanskrit. 0.. 77 pgs. Mahanirvana Tantra Vol Xiii with The Commentary Of Hariharananda Bharati. -. 597 pgs. Anundoram Borooah. Mahabharathamu.. 1911. 1845. 790 pgs. Mahabharatha Kosha. Mahaarashhatra Itihaasaman'jarii. Mahakavi Bhasas Swapna Vasavdatta Natak. 1982. Unknown. Biography.org/…/SanskritIIIT. Geography. 1929.. History. Mahaveera Charithramu.. Madhukanth. 1954. 1955. Mahabharata Tatparya Nirnaya With Comm Anandha Thirtha. Sanskrit... Majjhi Manikaya Vol 1. 0. Sri Anjani Nandan Sharan. Swami Dwarikadas Shastri. M... Mahartha Majari. 1969. 0. Majjhi Manikaya Vol 2.. Bhuutabalibattaraka Bhagavan'ta~. Sanskrit. 166 pgs. Mahabhasya Praskash...... Unknown. Spiritual Experience And Mysticism. Mahavyutpatti.. Mahavira Charita Of Mahakavi Sri Bhavabhuti. History. Bhaavabhuuti. Unknown. 1986.. Maharajas Sanskrit College Magzine. 334 pgs. Sanskrit. Sanskrit. 422 pgs. Mahaviracharita Of Bhavabhuti. 378 pgs.. Sanskrit. 750 pgs. -. 709 pgs..2/14/2011 A list of scanned Sanskrit books at III… Mahaaraashht'a San'ta Kavayitri. G R Josyer. 486 pgs. 1968.. 1947.. Sanskrit. Manasa Piyush Sundara Khanda. Acharya Sri Ramachandra Mishra. 1989. Mahapurana Vol Ii Uttar Purana. Pannalal Jain. Biography. 0. Theology. 1931. -. 1993. Sanskrit. 0. Sanskrit.. 1926.. 556 pgs. Unknown. Gaan'dhiijii Mohana~daasa~karama~chanda~. Unknown. Unknown.... Sanskrit.. 502 pgs. Mahaatmaajiin'che Satyaache Prayoga Athavaa Aatmakathaa. Swami Dwarikadas Shastri. Mahabhashyam.. 285 pgs. Sri Ramachandra Mishra. Sanskrit. 284 pgs. Unknown. Unknown.. Malavikagnimitram A Play In Five Acts. 0. Unknown. 1990. Sanskrit. 1998. 537 pgs. 280 pgs.. 0.. 315 pgs. Sanskrit. sanskritdocuments... 1951. Unknown. Sanskrit.. 360 pgs. 269 pgs. Sanskrit. Mahabharathmarmagya Varnasi Subhramya Shastry. Sanskrit. 420 pgs. Unknown. 232 pgs.. 370 pgs. Geography.... 1949. 1951.. Sanskrit. Sanskrit. Sanskrit. Unknown. Satavalekar. Vayu Purana... Unknown. Religion. Pandith Sri Ramchandra Mishra. 164 pgs. Pandit Guru Prasad Shastri. 744 pgs. Unknown. Unknown.. 354 pgs. 153 pgs. Mahabharathvachanamruthm. Malavikagnimitram. Unknown. Geography. . Malatimadhava. Aapat'e Dattaatrayavishhnd-u. Unknown. 274 pgs..... 1918. Malavikagnimitram. ramkumar rai.. 503 pgs. . Sanskrit.. Mahabharathtatvadeep. H Mhpohobs. Sanskrit.. 765 pgs. ..

v. Sanskrit. Kashmorey Dwij Sri Prannath Pandith. 195 pgs.... 1924. Sanskrit. Sanskrit. Theology... God'abole Krxshhndaajiiballaala. 302 pgs..… 33/167 . Literature.raghavacharya. Maunt'ast'uara~t'a Elfinst'ana Saaheba Yaan'chen' chariitra Pura~vaara~dha.. 1969. Sanskrit. 184 pgs. Mandukya Upanished. Sanskrit. 0.. Sanskrit. Mimamsabalaprakasha Of Sri Bhatta Shankara. 318 pgs.. Sri Mukunda Shastri.org/…/SanskritIIIT. Unknown.. 335 pgs. Unknown. Sanskrit.. 230 pgs. Mishra bandhu vinod. Geography. Manusmruthi. 220 pgs.r.2/14/2011 A list of scanned Sanskrit books at III… Manavagrhyasutra Of The Maitrayaniya Sakha. 1918.. Unknown. Saradaranjanray Vidyavinode. 203 pgs. 690 pgs.. Hira Lal Jain. Sanskrit. 94 pgs. 1961... Sanskrit. Shalaram Dwivedi. Unknown. Sanskrit.. Psychology. Unknown. Ramakrishna Harshaji Sastri.. Medhdutam. G. 1937.. Marcandeya Purana.... Linguistics. Mrxgaang-kalekhaa Naatikaa. 114 pgs. 1970. 333 pgs. 1915. Sanskrit. Sanskrit. 306 pgs. Literature. 1879. Mandaaramarandachampuh.. 760 pgs.. Sri Harish Shankar Sharmana.. Language.. sanskritdocuments. Dr Ramashankar Tripathi. Philosophy. 1923. Linguistics. 372 pgs. Sanskrit.v. 2002. Language. V. 632 pgs. 0. 2001. Jaimini. Sanskrit. Miimaan'saadara~shanama~.. Unknown. History. Language... Unknown. 374 pgs.. 49 pgs. Sri vidyanth Jha. Sanskrit. Language.. 174 pgs. Sanskrit. 0. 1926... Psychology.nandargikar. Sanskrit. Unknown.. Unknown. Mudrarakshasa Or The Signet Ring A Sanskrit Drama In Seven Acts. 583 pgs. Raajaa Kun'haana. Upanishads. 128 pgs. 200 pgs. Shyam bihari Mishra.. Apte. Mimamsa Shastram. Unknown. Sri Haridas Siddhanta Vagosha Bhatta Charya. Jaya Shankar Lal Tripathi. Religion. Vishaakhadatta. Sanskrit.. Mrcchakatika of Sudraka. Unknown. -. Sanskrit. 235 pgs. Sri Shathragna Mishra. Kavi Shriikrxshhnd-aa. Literature.. Mayurasandesa. Sanskrit.. Sanskrit. 540 pgs... Unknown... Linguistics. Manthrardha Deepika. -. Unknown. 0. Sanskrit.. Biography. 330 pgs. Meghaduta of Kalidasa Text With English Translation amp Notes. 0. Mudraraksasa First Edition. gagaavishhnd-a shriikruushhnd-adaasa. 1982. Unknown. 1902. Dr C Kunhan Raja. 0. 0. 274 pgs.. 1984. 0.. Unknown. Mudra Rakshasam. 702 pgs. -. Mayadprajaichariu. 1911. Sanskrit. Manormaratnavivek Vol Iv. 178 pgs. Mruschakatika. Philosophy. Sanskrit. Deva~ Shriivishvanaatha.. Visakhadatta. Sanskrit.. Muhoorta Depika. Unknown.. Linguistics.. Unknown. Unknown. Mudraraaqs-asa Prathama San'skarand-ama~. 1944. Shukadev Bihari Mishra. Sanskrit.. 1929. -.. Meghadutam.. 1921. 308 pgs. Mudrarakshasam. Sanskrit.. Literature. Minorworks Of Ksemendra. 2002. khemraj Shri krishnadas. Literature. -. 1948. Megh Dootam. Sanskrit.. Ganesh Bihari Mishra. Meghavijayopadhyayas Digvijaya Mahakavya. 62 pgs.. Mayuura Sandesha. Sanskrit... 185 pgs... Sanskrit. Sanskrit. Unknown.....g. 1944. 1962. Markandeya Samhita. Muhatri Chintamani. Literature. E.

Naat'a~yadara~pand-ama~ Prathamo Bhaaga... Dhanj-jaya Mahaakavi.. 67 pgs..b. Sanskrit. Literature. Nagari Pracharini Granthamala Series No..3. 1469 pgs. Religion...2/14/2011 p g g A list of scanned Sanskrit books at III…gy g pg Muhurtha Chintamaani. 178 pgs. Literature. Namalinganusasana Alias Amarakosa Of Amarasimha. 0.. Literature. 135 pgs. Language.. Sanskrit. Linguistics. Sanskrit.. Chand baradai. Nagari Pracharini Granthamala Series No. Chand baradai. Dr Jagdamba Prasad Sinha.. 1933.. Unknown. Chintaamand-i. Literature. Nalopakhyanam. Sanskrit.org/…/SanskritIIIT. C. m m pandit sivadatta dadhimatha. 78 pgs. Sanskrit. Myths And Races Of The World. jyeshtarama mukandaji.. 1937. Linguistics... Unknown. Pushhpadanta Mahaakavii. 0. 1950. Valle Poussin.. Naagapura praan'taacha Itihaasa.. History. 1934. Nalopakyanam Dwithiya Khandah.. Baalakrxshhnd-akulakara~nd-ii Purushhottama~... Aapat'e Hari Naarayand-a. Maadhavakaale Yaadava. 210 pgs. Natural Sciences. Unknown.chakraberti. Unknown. Naaraayand-aguro San'skrxtakrxtayaa. 0. 0. 1937. 290 pgs. 4-6. Sanskrit. Kaviatan Pandit Shiv Dutta. Dr. Psychology. S k it 1984 554 sanskritdocuments.. Sanskrit.devarshi Sandhya Shastry. Sanskrit.. Unknown. Unknown.… 34/167 . 1927. Naathamaadhava Trot'aka Charitra va Aat'havand-ii.. Language. Geography. 0.. Geography. Chand baradai. Language.. Linguistics. Naagarasara~vasva Kaamashaastrakaa Apuura~va Gran'thaa. Naaraayand-aguro.. P V Ramanuja Swami. Jagdamba Prasad Sinha. Pandith Sri Guru Prasad Shastry.. 358 pgs. Linguistics. Unknown.. Sanskrit.. Philosophy. Naanaathara~ San'grah... Sanskrit. Unknown. Sanskrit...d. -. 4-8. 1906.. Chand baradai. 1933.. 1953. 1906. 1907. Sanskrit. 132 pgs. Literature. 1985. 4-9. 1941. 1926. Sanskrit.. Dr Devarshi Sanadhya Shastri. Unknown.. Bhat't'a Qs-irasvaami.. Naamamaalaa.. Sanskrit. 1929. Naishaddhiya Charita. 674 pgs. 567 pgs. 0.. Unknown. Literature. 1927.. Nagari Pracharini Granthamala Series No. 384 pgs. Sanskrit... 1906. 131 pgs. Literature. Language. 173 pgs. Sanskrit. 4-8. Literature.. Biography. 452 pgs. Linguistics.. Literature.. Naisadhiyacharitham Canto12 22 Uttarardha. Naagakumaaracharita. My Prayers Vol. 168 pgs. Sanskrit. Nagananda Edition I I. Biography..dhawan. Naamalid'agaanushaasanama~. Sanskrit. Sanskrit. Mysticism And Symbolism In Aitareya And Taittiriya Aranyakas.. Unknown. Sanskrit.. 4-10. Naanaara~tha San'grah Grantha 10. Mund-d'akopanishhata~ Grantha 9.. 92 pgs.. Unknown.. 492 pgs. Sanskrit. Gunasaan'dra and Raamachandra. 1992. 1988. Sanskrit.. 194 pgs. Nagari Pracharini Granthamala Series No.. 236 pgs. Chand baradai. Literature. Chintaamand-i Ti Raa. 206 pgs. 1962. Nagananda Natakam... Sanskrit. 1331 pgs. Nagari Pracharini Granthamala Series No. 790 pgs. Language. Mulamadhya Makakarikas.. 111 pgs. Naisadhiyacaritam Of Mahakkavi Sriharsa.. Sanskrit. Sanskrit. Sanskrit. Unknown. 162 pgs. Pada~mashrii. Sanskrit. Technology. 680 pgs. Sanskrit. Theology. Dr. 276 pgs. 1987. History. 170 pgs. 1934.

Pandith Shivduttsharma. 1955.r.. Sanskrit.ravishankar Nagar.s. Abhinava Gupta Charya.. 1934... 1984. C. 64 pgs. Unknown. 222 pgs. Natyasastra With The Commentary Of Abhinavagupta Vol 3. Sanskrit.. Narasinha Puranam. 146 pgs. Sanskrit.. Unknown. Narayankruthvruthisametamashrav Layan Shauthsutram. Sanskrit. 392 pgs.. 162 pgs. 1930. 506 pgs. Linguistics.. Sundara Pandya. Sanskrit. 344 pgs. Unknown. 1924. Nanjarajayasobhusana Of Abhinava Kalidasa. Sanskrit. Nanartha Samgraha. 422 pgs... Language. Unknown.. 219 pgs. 144 pgs..nagar. Sanskrit. Dr. Language. 471 pgs.. 1969. 1953. 1994.abhinavabharati 1. 420 pgs. Sanskrit. Niruktan' Dditiiyo Bhaaga. 446 pgs. Abhinava Gupta Charya. Rama~lala~ Kanjilala~ Yama~ Hecha~. Language. 204 pgs. 0. Sanskrit. Sanskrit. Unknown. acharya hemachandrasuri s.. Sri Daivagyadunichandratmajapandit. Natyashasrta Of Bharathamuni Vol I I.. Unknown. Unknown. 748 pgs. Unknown. Unknown. Sanskrit. Linguistics. Unknown... Nirnaysindhu Vol Ii. Unknown. Niruktam. Literature. Makara Bhad'aka. Natya Sastra Sangraha Vol Ii. Sanskrit.. Sanskrit. Natyasastra Of Bharatamuni Vol Iv. Naradh Puraye.sankara Ramashastri.saini. Natyasastra Of Baratamuni.r. 1926. Sanskrit. Unknown. 0.org/…/SanskritIIIT.. Unknown. Sri K Vasudeva Sastri. Nispannayogavali. Unknown. Unknown.… Nitiprakashika Vaisampayana Unknown Sanskrit 1953 135 pgs 35/167 . Social Sciences.. Nitidvishashtika... 1928. Natya Sastra Of Bharatamuni 3. Unknown. Dr. T R Chintamani. 1937. Sanskrit. Niilamatapurand-ama~. Sanskrit. Navaratnavidhapadhathi. Unknown. Sanskrit.s.... Unknown. Sanskrit. 1941. 367 pgs. Unknown. Language.. Sanskrit. Sri Kamalakar Bhatt. Unknown. Linguistics. 1917... 474 pgs. 1949... 560 pgs. Literature. 1986. 0. Unknown. 554 pgs. Nanarthasangraha Of Ajayapala... Sri Madanthram Shastry. Sanskrit. Bhattacharya. 230 pgs. Kulakara~nd-ii Ekanaatha Dattaatreya. 1954. 1968.. 340 pgs. -. Sanskrit.. Unknown. sanskritdocuments. 1984... Anundoram Borooah.. 218 pgs. Unknown.. Literature. Nishkarma Siddhi... Nirakttama Da~vitiiyo Bhaaga. 1926... Sri Prem Vallbh Tripatisha Thran. Nira~nd-aya Sindhu. Nilakanthavijaya.. 1942.. 300 pgs. 1994. Abhinavaguptacarya.. 1986. Literature. Hari Narayan Aapte. Religion.... Natya Sastra Sangraha Vol I. 1949. 972 pgs. Sanskrit. 562 pgs. Natyashasrta Of Bharathamuni Vol Iii. Sanskrit. 420 pgs.. embar krishnamacharya. Nareshvarapariksha. Sanskrit. 556 pgs. Sanskrit.. K Sambhasiva Sastri.. Bhat't'a Kamalaakara. 0. Namamalikaa Bhojaa. Ramakantha. Sanskrit. Sanskrit. 772 pgs. Sanskrit... 129 pgs. Literature. 1984. 1961.. Niteshatakam. Dr. Nighantusesa. m ramakrishna kavi. Sanskrit.. K Vasudeva Sastri. Theology.. 764 pgs. Linguistics... 366 pgs.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit. 0. Shriimadhyaaskaachaaraya.. 1983. Narayaniya Of Narayana Bhatta.. Sanskrit.

vallabhacharya... Unknown. 108 pgs. Mahadeva Sastri.. Philosophy. Nyay Lalavati. 0. vallabhacharya. Shriidhara~mottaraa Chaara~ya. 872 pgs.. Philosophy. Linguistics. Unknown. Goswamy Damodar Shastry.... Unknown. 243 pgs. Nyaayabhaaskarakhand-d'anama~. 1992.. Nyaayakusumaan'nj-jali. 58 pgs.. vallabhacharya. Psychology. Nyaya Makarandaha. Philosophy.... Nyayamrithaha Sudha chandrika. Remella Suryaprakasa Sastri... vallabhacharya. Sanskrit. Nyaya Lilavati Vii 7. Unknown. 1985. 1940. Unknown.. 1909. 1954. Sanskrit. Gopinath Kaviraj. Philosophy. 110 pgs.. Psychology. 971 pgs. Sanskrit. Vishwanathvritti. 1990.. Nyaayasudhaa. . Sanskrit. Nyaayabindu. Nrxsin'hapuuvauttarataa Paniiyopanishhata~. Sanskrit. Theology. Language.. 1992.. 666 pgs. Nyayabhindu Of Dharmakirti And The Nyayabindutika Of Dharmottara.. Sanskrit. Unknown. Sanskrit. Gustav Oppert. 153 pgs... Language. 155 pgs. 1938. Sanskrit. Sri Ananda Bodha Battaraka Charya. Nyayabhindu Of Dharmakirti.. 2000. Unknown. Someshvara Bhat't'a. Unknown.. 1990. 115 pgs.obermiller. Literature. Nyaya Kumud Chandra Vol-i. Nyayabhindu. Nityotsava Vol Iii. vallabhacharya.. 1932.... Linguistics.. Aapat'e Gand-osha Vinaayaka. Shriimadudayaanaachaara~yaa. Psychology. 1941. Unknown. Unknown. 332 pgs. Sanskrit. 110 pgs. Psychology. Nyasakalpalata. 106 pgs. 328 pgs. Theology. Sanskrit. 388 pgs.. Vyallabhacharyya. Sanskrit. Sanskrit. Tukaram Javaji. vallabhacharya....2/14/2011 A list of scanned Sanskrit books at III… Nitiprakashika. 1909. Nyaya Lilavati Viii . Sanskrit. Padamunnur Sri Narayanacharya. sanskritdocuments. 849 pgs. 1938.. Literature. 1929. Nyayamritakulya. Vaisampayana. Unknown. Nyaya Lilavati Vi 6. 112 pgs. Sanskrit.. 184 pgs.. Sanskrit. 1933. Unknown. -. Kumaara Nyaayaachaara~ya Mahendra. Nrsimhtyasya Prayoga Parijatasya Sodasa Samskara Kandam Pakasamstha kanda Samksepasla. Sanskrit. Nyayadarsana.. 119 pgs..... Sanskrit. 134 pgs.. 102 pgs. 1932. Sanskrit. 1907. Sanskrit. 1927. Sanskrit. Nyayabhindutikatippani. Psychology. Sanskrit. 36/167 . 216 pgs. -. 41 pgs. 1992.org/…/SanskritIIIT... Unknown. Unknown. Mahendra Kumar Nyaya Shastry. 608 pgs. Sanskrit. Indian Logic... Literature. Unknown. E. Shukla Sri Raja Narayan Sastry. 355 pgs. 1916. Sanskrit.. Sanskrit. 186 pgs. 1919.. Religion. 102 pgs. Nyaya Lilavati Ii 2. Sanskrit. Nitya Kamya Karma Mimamsaa.. Unknown. . 1904. Sanskrit. Unknown. 0.. 1955... Remella Suryaprakasa Shastri.. Sanskrit. Nyaya Lilavati I 1. Sanskrit. Nyayadarshanamu. Nitya Kamya Karma Mimamsa.... Sanskrit. Nyaaya Kumuda Chandra Dditiiyo Bhaaga. 1932. . Unknown.8. Shastrii Raamasubramand-yama~. 96 pgs.. 1948. Literature. 1927.. Nyaya Lilavati V 5. Religion. Sanskrit.obermiller. Philosophy. 1953..… Nyayamrtatarangini 686 16383.. E. Unknown.. Nrisinha Prasada Tritha Sara. Bhat't'asomeshvara... 1929. Sanskrit. 135 pgs.. 236 pgs. 1936. Sanskrit. Sanskrit.. 216 pgs. Nitiprakasika. 118 pgs. 249 pgs.. Nyaayasudhaa Faskikyulasa~9. 1902. Dwaita Philosophy.

Viiraraaghavaachaara~ya Mund-aluura~. Theology... 554 pgs. 249 pgs. Biography. Sanskrit.. 134 pgs... 757 pgs.s.. 68 pgs. Sanskrit. scanned Sanskrit booksSanskrit. 386 pgs. Sanskrit.. 1951. Pahile Mahaayudhda Bhaaga Tisaraa. Sri Haridatta Misra. Unknown.. 1984. Sanskrit. Sanskrit. 210 pgs.. 258 pgs. Panchampushpam V. Unknown. Sri P P Vasudevanand Saraswathi Tembeswami. Sanskrit. P i ht k Utt dh P dith S i Y t d tt t ibhi U k S k it 0 380 sanskritdocuments. . 1954. Language. Om Brihat Sarvanukramnika Of The Atharva Veda.… 37/167 .org/…/SanskritIIIT. Linguistics. 422 pgs. Literature. Dr. 534 pgs.. Sanskrit. P. Philosophy. Dr. Nyaysutravaidikvruthi. Sanskrit. Panditaraaja Jagannatha.. Nyayasiddantamuktavali Of Viswanathapancanana Bhattacarya. 1971.. Linguistics Literature. Linguistics. 230 pgs. Pan'chamapushhpama~ Kaavyadvayama~. Sarasvatii Vaasudevaananda. Language. Unknown.. Sanskrit. 274 pgs. Sanskrit.2/14/2011 A list ofLinguistics. Pancaratram. Sanskrit. 283 pgs.ramaswami Sastri Siromani. Sanskrit.r. Unknown. Sanskrit.. Unknown. Sanskrit. History. Nyayasudha Sesavakyartha Chandrika Chapter 1 Subunit 4.. Religion. 1957. Unknown. Shaunakamahaamuninaa Bhagavataa.krishna Murthy. Religion. Maniantha Misra.. 132 pgs. Gajanana Shastri Musalagaonkar. C R Devadhar. 157 pgs. Nyayasastra With The Commentary Of Abhinavagupta.. Unknown. Unknown.. Sanskrit. K Surya Narayanashastri.. 252 pgs.. Nyayamrtatarangini 686 16383. Sanskrit. .. Theology. Sri Jaya Tirtha. Sanskrit. 1939. at III… 0. 392 pgs. Unknown.. Khaad'ilakara Shrii Krxshhnd-aajii Prabhaakara. Padit Raj Jagannath Mahakavi. 1958. 1952. 380 pgs.. Pandit Bhanu Dattshastri. Psychology. Padhamanjari Pradhama Bhagamu. Palkuriki Somanatha. Padukapattabhisekam Of Narayanakavi. Literature.gajanana Shastri Musalagaonkar. Unknown. 1990. Pandit S.... Haribhaskara.. Sanskrit.. 1981.. Sanskrit. 1940. Paand-inisutravyaakhyaa. 392 pgs. 1953. 1981... Sanskrit... 1937.. 89 pgs.. Unknown. 311 pgs.. Unknown. 660 pgs. Language. 254 pgs. Shriimadamitagatyaachaara~ya. Padakavya Ratnakara. Literature... Paashhara~dasuutrama~. Aara~yend-a Subrahmand-ya.... 83 pgs. 1953. 152 pgs. Dr K S Rama Murthy.. 0. Padya Mala. K... Sanskrit. Sanskrit. Theology. gandanatha jha. 1941.. Religion. 667 pgs. Unknown. Unknown.. Geography. 0. Sri Haridatta Misra. Unknown.. Nyayasutra Of Goutama. Unknown. 1983.. Panchatantram Vol Ii. Dr Smt Mudigonda Uma Devi. 1904. 1953. Sanskrit. Sanskrit. . Padhyapushhpaanj-jali.. Anantha Charyar. 1984. Sanskrit. Nyayarakshsmani Of Srimad Appayya Deekshithendra.. Nyayaratna. 1922. Sanskrit. 1927. Pandit Ramgopala Shastri. Unknown. 702 pgs.b. m ramakrishna kavi. 1973. Sanskrit. 434 pgs. Panditaraaja Kaavyasangraha Complete Works of Panditaraja Jagannatha... 1953. Padyamrta Tarangini. Unknown.. 1941.... 777 pgs. Pandith Devdutt Sharmana. Pan'chasan'graha. 1934.. Unknown. Padhamanjari Dwithiya Bagamu. Nyayasiddhanta Muktavali. Nyayaratnamala Of Parthasarathimisra. Sanskrit..

70 pgs. Religion.. -. Tadnujen Sri Manmadhusudansharma.. 323 pgs.. 1980. Sanskrit. Unknown. Language. 1940. Bhat't'a Naagojii.. 164 sanskritdocuments. Sanskrit. 531 pgs. Pingala Acharya.. 1934. Paramaanandakaavyama~. Sanskrit. Sanskrit. Pandith Sri Yutagnadutt Sastry. Unknown. 380 pgs. D.. Parijaat. 1959. pandit bapudeva sastri. Sanskrit. Plane Trigonometry. Literature.. T.. Paramartha Prakasika. 0. 334 pgs.arkasomayaji.. Praayashrvittendushekharah. Linguistics. Linguistics..... 1952. 454 pgs. Literature. Viraraghavacharya siromani. Paribhashedendushekar. Pandith Sri Yutagnaduttasastribhi. Pilibhit ka Sahitiyik Itihaas. Poona Akhbars Vol Ii.. Paqs-chimottarashaakhiiyan' Vaalmikiiya Raamaayand-ama~ Kishhkindha Kaand-d'ama~.. Literature.. 1938. Pindagalachand Suthram. Paqs-chimottarashaakhiiyan' Vaalmikiiya Raamaayand-ama~ Yuddha Kaand-d'ama~. 497 pgs. 173 pgs.. Paribashendu Sekhara... Panj-chavin'shatisaahastrikaa Pranj-aapaaramitaa. 0. Unknown. Sanskrit. Unknown. 0. 1916. 112 pgs. Sanskrit.... Sanskrit. 1936. Sanskrit. 1874.. Sanskrit. Unknown. 0. Sanskrit. Sanskrit. 334 pgs.. Sanskrit. srinatha pandita.. Sanskrit. Theology.. Datta Nalinaaqs-a. Parama Samhitha. Religion. 175 pgs.. 1947. Sanskrit. 1923. Literature. 181 pgs. 172 pgs. Vaalmiikii. Harinarayna Apte.. 1947. 1938. Sanskrit.. 172 pgs.. Paramaananda~. Unknown.. Language. 1946. Praakrxtashabdapradiipikaa. 1913. Natural Sciences. 132 pgs. Grammer. Sanskrit. Literature. Panini As A Variationist. Persian Sanskrit Grammer.. 97 pgs.org/…/SanskritIIIT. Sanskrit. Sanskrit. Ghosha Manamohana. Pandith Nityananda Panta Parvatiya. Sanskrit. 252 pgs. Sanskrit.... Unknown... 245 pgs. 0. Panineeyasthakam Poorvadharm. 247 pgs.. Unknown. Paribhashendushekar. 1933. Pandita Viswanatha Shastri. Valmiiki. 1944. Sanskrit. Unknown. Natural Sciences. Viraraghavacharya. k r joshi s m ayachit. Language. Linguistics... 624 pgs. Unknown. 1954.. 1972. 694 pgs. Sanskrit. 506 pgs. Sri Pindagala Charya. 1990.. Theology. S Krishnaswami Aiyangar. 442 pgs.… 38/167 . Pashvaalambhamiimaan'saa.. Sanskrit. Language. Religion. Unknown.. 1931. Sanskrit. Sri Nagesh Bhatt. Sanskrit. Sanskrit. 1954.. Sanskrit... Ganesh Shankar Shukla. Parameshwarpitha Slokamalika. Philosophy. Language.. S D Joshi.. Pandith Sri Kapileswar Shastrina. Literature. Jinavijaya Muni. Paninisutra Vyakhya Vol 1 Purvardhamu. Paniniya Shiqs-aa. 0. 1935. Unknown. Linguistics... 0. Unknown. Philosophy Of Poetry. 188 pgs. Prabandaha Cintamani Of Merutungacharya Part I. Unknown. 252 pgs... Sanskrit. Valmiiki. Sanskrit.. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Panineeyashtakam Uttaradharm... C Kunhan Raja. Paqs-chimottarashaakhiiyama~ Vaalmiikiiya Raamaayand-ama~ Uttara kaand-d'ama~. Aan'bekara Vishhnd-ubaapujii. Unknown.. 1957.... Unknown. Linguistics. Sanskrit. Paraamara~sha Khan'd'a 1. 436 pgs. Theology. Sanskrit. 134 pgs. Parama Laghu Manjuaha Of Nagesh Bhatt. 200 pgs. 582 pgs. Nrxsin'hashaastrii... Shaastri Vaamana. Unknown.. Parahita Samhita. Unknown. 374 pgs. Post Independence Sanskrit Literature. 322 pgs. 1940. Narendra Nath Choudari..

Prakrutananda.varadhachari. Pradhama Padyamala. 922 pgs. Unknown. Sanskrit... gomi kara~nd-aka. 1953. Language... Haribhadraa. Psychology. Prakriyaasavara~svama~. 142 pgs. Prasnamarga. Prasnopanisad Bhasya I I.. Sri Harishanker Mishra. Shriiprabhaachandraachara~yaa. Psychology. Sutradhaaramand-d'ana. 652 pgs. Sanskrit. Sanskrit. 1936. 134 pgs.. Theology.. 261 pgs. Prakriyasarvasva Taddhita. 152 pgs... Ramaji Upadyaiah. Aanandagiri. Prasaada Mand-d'anama~.. Literature. Raghunatha Kavi. 0. K. Prameyaratnaalang-kaara.... Sanskrit. Linguistics. Sanskrit. 676 pgs. 272 pgs. 160 pgs.. 1941. -. Religion. 1932.. 394 pgs. Prashanamka choodamani. Unknown. Atalananda Sarasvati. Prapancha Sara Tantra Of Sankaracharya.. 262 pgs. E.. Dr P L Vaidhya. 1981. Tallapally Muralidhara Gowd. Linguistics. Language. 1994. Prakrta Prakasa. Prabhu Lingaleela.. Unknown. 1931. Prasnopanishad Bhasya.. Sutra Dharamandana. Language.. Sanskrit. Sri Ramachandra Mishra. Sanskrit.. Punnasseri Nambi Neelakndha Sarma. Theology. Prabhaavakacharita Prathama Bhaaga Muula grantha.. Unknown. Pandit sri seetaramanga Jotishaclarya. 0.. 1948. 1947.. Religion. 252 pgs.. 1932.. Sanskrit. Unknown. Unknown. Prajna Paramitha Ratnaguna Samcaya Gatha. Linguistics. Literature. Mishra Krxshhnd-a. Sanskrit..org/…/SanskritIIIT. 441 pgs. Appayya Diiqs-ita.shantiraja Sastri... Sanskrit. 70 pgs.… 39/167 .. 722 pgs. Panditaratnam A. Religion.. 0. Prachina Sanskrit Natak.. Language. 1975.2/14/2011 A list of scanned Sanskrit books at III… pgs.. Sanskrit. Prashnopanishhata~ Grantha 8. Unknown. Theology. Sanskrit.obermiller. Sanskrit.. Sanskrit. P. Sanskrit. Sanskrit. Mallikarjuna Shastri. 164 pgs. Sanskrit. Narayana Bhatta.. Sanskrit. 1941. 1955. 1978. Sanskrit.. Unknown. Prameyakamal Martand.. Prameykamlamartand Vol Ii. Unknown..c.. 484 pgs.. Pandit. Mahendrakumar Shastriyna.Edition. Sanskrit. 265 pgs. 107 pgs. Shriigovindaamrxbhagavaana~. Religion. Unknown. 186 pgs. Pratima Natakam. Philosophy... Philosophy. 1926. sanskritdocuments. Sanskrit. Jinavijaya Muni. Sanskrit.... 176 pgs. Prasadamandanam. Pramaand-avaara~ttikama~ Svaara~thaanumaanaparichchheda. Literature. 1954.. Tantras. 128 pgs. 1951... 1943. Shriinaaraayand-a Bhat't'aprand-iitan. 1941.. Unknown. Theology. Unknown.. Technology. 1933.. 1947. Sanskrit. Prameyaratnalankara... Shri Prabha Chandra. Sanskrit... 1940. Prabandhakosha Prathama Bhaaga.. 1992. 924 pgs. 1948.. 239 pgs. Linguistics. Sanskrit. Sanskrit. 1935. Prabodhachandrodayama~. Shriimadabhinavachaarukiira~tipand-itaachaara~ya. Prataha Smranmala.. 186 pgs. Sanskrit. The Arts. 20 pgs.. Unknown. Unknown. Unknown. 0. Prajnaparamitasa~ Prathama Bhaaga Abhisamayaalad'a~kaaralokah. Prabhanda Chinthamani Of Merutungacharya Part 1. Vijaya Jina. Sanskrit. Sanskrit. 346 pgs. Prakrxtamand-idiipa Prathamao Bhaaga. 94 pgs. Unknown. 252 pgs. Sanskrit.. Prabhodhanaachandrodayama~. 77 pgs. Theology. 1935. Religion. Literature.

scanned Sanskrit books . 611 pgs.. Unknown.. A. Prayodhya Kavyam... Raashht'a~ra Giitaanj-jali. Sanskrit. Dr. Unknown.. 310 pgs.gangaprasad.. 1945... Sanskrit.. 1908. 286 pgs. Religion. Ranjit Sitaram Pandit. Raghuvamsam Canto V. Mahadeva Sastry. Unknown. Purva Mimansa Darsana. Sanskrit.. Sanskrit. Sanskrit. 176 pgs. Suryakanth Shastri. Unknown. 369 pgs. 480 pgs.. 1945. Sri Krishnaiah Panth Sastriye.... Proceedings And Transactions Of The All India Oriental Conference..2/14/2011 A list of ... 1926. Sanskrit. 1935.. Sri P. 0. 1950. Language. Proceedings And Transactions Of The First Oriental Conference Poona Vol 1.. Purushparthchintamani. Sanskrit. Sanskrit. 1875. Purvakhandatmika Bhaktiyogaparisha. 308 pgs. 242 pgs.. History. A. 1930.. Ragavibodha. 163 pgs. at III… pg Pratimaa Mana Laqs-and-ama~. 0.. -.. Sanskrit. Proceedings And Transactions Of The First Oriental Confirence Poona. Linguistics.. Raasabihaarii Basuun'che Kraan'tijiivana. Pratyakruttatvachintamani Vol I. Proceeding And Transactions Of The Fifth Indian Oriental Conforence Vol I. Unknown. Sanskrit. Unknown. a s altekar. 246 pgs. 626 pgs.. Sanskrit... Unknown. G. Theology.a. Unknown. 0. Sanskrit.. Sanskrit.. 0. Lakshminarasimha. 1952. 302 pgs. Ragatarangini. Unknown. 370 pgs. 1985. Sanskrit. Visvanatha Pandita. History. Literature.. Unknown.. Unknown. Raamaayana Of Vaalmiki Bala Kanda. Premarasayana. Vasudev Sharma.. 0..subrahmanya Sastri. Yagna Ramulu.. Purascaryarnava.shrikrishnamani Tripathi. Sanskrit.. Literature. Yashpal Tandon's. 936 pgs. Sanskrit.. Bhagavad Datta. 1922.org/…/SanskritIIIT. Sanskrit. Saradaranjay Ray. Language.. Raghava Naishadhiya. 118 pgs... Prem Pathanam. Unknown. 82 pgs. 1999.. Sanskrit. Sanskrit. Unknown. Social Sciences. 112 pgs. 0.. 1952.. Theology. Vaalmiiki.. Unknown. 1928. 0. Sri Madramkrishnabhattsunuvishnubhatt. 1931. Unknown. 1989.. 1929. Saradaranjanray Vidyavinode.. Raamaayand-ama~ prathama khand-d'a.. 1979. Sanskrit. Religion.. Unknown. 451 pgs. Sanskrit. Geography. Purana Panchalaksana. 330 pgs. 826 pgs. 154 pgs. Haradaasa Baalashaastrii Saahityaachaara~ya. 1947. Dr.. Pandit Sivadatta.. Bosa Phanin'draa Naatha. Unknown. sanskritdocuments. Sanskrit. Muralidhar jha. 1993. 1935. 1323 pgs. G D Thukral. Qs-iira Ratagd'ind-ii.. 82 pgs. Unknown. Sanskrit... Sanskrit. 1985.. Pt. Sanskrit.shastry. Purva Kalaamrutamu. 730 pgs.. Sri Sadanand Vidvadwirichith. Purana Vishya Samnukramayaka.. 40/167 . 1920. 536 pgs. Sanskrit. 1927.. Sanskrit. Unknown. Linguistics. Biography. Unknown.. Kara~mara~kara~ Epi. Da~vivedii Kapiladeva. Miimaan'saka Yudhishht'hira. 98 pgs.. Sanskrit. Sanskrit. Bharatwaj. 348 pgs.. Sanskrit. Unknown.… Raghuvamsham. Religion. Raghuvamsam (canto vi). S. Theology. Purva Mimamsa. 490 pgs. Raghuvamsam. Sanskrit. 226 pgs. Sanskrit Religion. Unknown. -. 828 pgs. Purusharth Chintamani. Late. 492 pgs.... Puranika~ En'thalojy Puraand-a Kaavya Stotra Sudha.

1983. Jagannath Prasad Kayath. Unknown. Rajagopalachari. 681 pgs. -. Sanskrit. Durgesh Singhal. Bhagavad Datta.. 1983. Sanskrit. .. 1992. 1934. Sanskrit.. Sanskrit. Satkari Mukhopadhyaya. Ram Swayamvaram. . Ramayana Of Valmiki Vol Iv Kishkindhakanda.. 1983.. Religion.. 2002.. Unknown. 427 pgs. Unknown.. 638 pgs.c. 0. Unknown.... Unknown. Unknown. Unknown. Ras Gangadhara... . Unknown. 1902. Sanskrit... 1985.... 845 pgs.. Sanskrit.. T. Ramayana. 612 pgs. Ramayana Of Valmiki India S National Epic. Sanskrit. Sanskrit. Temples. 1983... 234 pgs. Raghuviracharata. Unknown. Sanskrit.… Rasagadagdar Rahasyam Sri madanmohan Jha Unknown Sanskrit 0 60 pgs 41/167 . Ramayana Of Valmiki Vol Viii Index Of Verses.Vaarasree. 1935... Sanskrit. Sanskrit. Sanskrit... Ramayan Valmikiye Aadikand.. Bagaiah . at 730 pgs.. Shripad Krishna Belvalkar. 1983. Sanskrit. Unknown. Philosophy. Temples. Di Valmici.. -. Sri P Ramachandraghna Vyakaranacharyah. Unknown. Sanskrit. Sanskrit. Sanskrit. Ramayana Of Valmiki Yudda Kanda. Unknown. 426 pgs. Unknown. 168 pgs. 164 pgs. Unknown. Unknown. 0. 112 pgs.. Ramalashiktha Jyothish. Sanskrit. Ramayana Of Valmiki Vol Vii Yuddhakanda. Unknown. 164 pgs. Ramayana With Three Commentry Tika.. 350 pgs. 523 pgs.shrikrishnamani Tripathi. Ramayana Ramabirama.2/14/2011 A list of scanned Sanskrit books III… Raghuvamsham. 0. Unknown. . 1950. 605 pgs.. Sanskrit. 588 pgs. Kalhana.. Ramayana Of Valmiki The Aranya Kanda. .. . Satkari Mukhopadhyaya.. 330 pgs. Ramayana Of Valmiki Vol V Sundarakanda. 481 pgs. 2001. Satkari Mukhopadhyaya. 2001. Mishra Brahmashan'kara. Satkari Mukhopadhyaya. Ramayana Of Valmiki Vol Iii Aranyakanda. Peeyush Darya. 1944. 369 pgs. Ramayana Of Valmiki Vol Ii Ayodyakanda. Sanskrit. Literature. 700 pgs. Unknown. 795 pgs.. Raghuvamshamahakavyam. Pandit Sri Bhadarinath Jha. Rangaayana. Raja Tarangini.. Satkari Mukhopadhyaya. Sanskrit. sanskritdocuments. 0. Sanskrit... 1955. Sanskrit. Unknown. 317 pgs. Sanskrit. Sanskrit..... Sanskrit. 1983. Sanskrit. 1917. 1983.. 1260 pgs. Sanskrit. 1915. Rasa-jala-nidhi. Raghuvan'shamahaakaavyama~.ganapati Sastri.. 1965. Bhudeb Mookerjee. Rangayan Vol 34. Rangayan Vol 34 Jan-june 2001. Ramayana Vol 3. 1895. 193 pgs.m. 0. 192 pgs. 460 pgs. Dr. Ram Rasayan Ayodhyakand.. 0. pgs. Sanskrit. 1983. Ramayana Of Valmiki Vol I Balakanda.. Psychology... Sanskrit... Vishva Bhndhu Shastri. Kavignar .. Satkari Mukhopadhyaya. Unknown. Ramayana Of Valmiki Vol Vii Uttarakanda.. 354 pgs. Religion.... Satkari Mukhopadhyaya. 454 pgs.org/…/SanskritIIIT.... Ramas Later History Vol X X I. Unknown. Raghu Vira.. Unknown... Satkari Mukhopadhyaya. 164 pgs. Sanskrit. Rangayan Vol 34 Jan-june 2001. 2002. Sanskrit. 1938. 706 pgs.

1949. Linguistics. Sanskrit. Ravi-vichaar. Sanskrit. sanskritdocuments. Ratna Dipika And Ratna Satram. Sri Rama Sharma. 1955... 94 pgs. 1951.c. Technology. Sanskrit. Sayanacharya. Theology. Sanskrit. Rgveda Samhita Vol 4. Sanskrit.. Gonda. Language... Rediscovering India Manav Dharma Shastra Vol 30 I. P.n. Unknown. Dinakara Bhatta.sastri. Aryendra Sharma.... Sanskrit.. 1904. Reader Iii. Sudarsanacharya. 206 pgs. Rigveda Samhita. Sanskrit. 332 pgs. Philosarhy.l.v.. Rigveda Samhita Vol Iii 6 8 Mandalas. Ramgovind Trivedi Vedanthshastry. 403 pgs. 100 pgs. 1314 pgs.. Unknown. Sayanacharya. J Gonda. 0. Unknown. T. Sanskrit. Literature.sastri. 1951. Language.v. 2001. K. Sanskrit.v. 1927.. V S Venkata Raghavacharya. Sanskrit. 266 pgs. Ram Suresh Tripathi. Unknown. 1986. 1981.. 594 pgs. Unknown.. Sri Mathsainacharyavirchitbhasyasameta.k...l. Art. Unknown.. Rasagangadhara. Rgvedi Purva Proyoga..org/…/SanskritIIIT. 1945.… 42/167 . Haughton G. 1074 pgs. Vidhydhar Johrapoorkar. Sanskrit. 134 pgs. Sanskrit. Sanskrit.. 1992.v.. 964 pgs. 1204 pgs. Shriigovindabhagavatpaada. Srit. 1997. 60 pgs. Srinarayan Misra. K. Rigveda Samhita Vol Iv Ix X Mandalas. Sanskrit. Unknown. Rg Bhasya Sangraha.lakshman Sarup. Sanskrit. 1946. 354 pgs. Sanskrit.. 152 pgs. Theology. K. 1987. 0. 231 pgs. Budhdabhat't'a Chand-deshvara~ cha. Unknown. 84 pgs.I.. Rgarthasara Of Dinakara Bhatta Vol 1. Unknown.. Rigved. Dr.. Rasahrxdayatantrama... 1956.... 1965... Late Dr. Sanskrit. Unknown. 1951. 1959..... Religion.kapali Sastry.2/14/2011 A list of scanned Sanskrit books at III… Rasagadagdar Rahasyam. L Finot. Religion.. 1152 pgs. Unknown. Rastrapala Pariprccha Sutra Du Mahayana. Ravanarjuniyamu. 552 pgs. Rashtriya Panchang. Dev Raj Chanana. Sanskrit. Sanskrit... Unknown. Rgarthasara Vol I. Unknown.. Linguistics. Linguistics. Sanskrit. Sanskrit. Sanskrit. Allaraaja. 1974. 1868. -. 0. Rasaviveka of Kavya Darsa. Vedas. 1988. 2001. Sri madanmohan Jha. History.l. Unknown. 133 pgs. Bhaanubhat't'aa Shrii... Language. 241 pgs. Unknown. Rasendra sarsangra.. Sanskrit. 82 pgs.. 1961. Sanskrit. Sanskrit. Narayana Sharma. 82 pgs. 0.. Ratnadiipikaa Ratnashaastrama~cha. 1941.. Literature. Rasamanjari Of Bhanudatta. Unknown.. Regved Sanhita Vol.. 1961.. Sanskrit. Sanskrit. Ramasastri. 500 pgs. Sanskrit.. 129 pgs. 188 pgs.. 1996.. Sanskrit.. Reader I.. Unknown. Unknown. 1959. Rgveda Samhita Vol-i. Unknown. Rasamanj-jari faskikyuulasa~ 3. Geography... 1951. 75 pgs. Literature. 0. 220 pgs.sastri. Sanskrit... Unknown... 100 pgs... 148 pgs. sri bhattabeem. -. N R Bhatt. Sanskrit. Reader Ii.. 116 pgs. 0. Unknown. Sanskrit..p. Sayanas Comentary.s. Unknown. Rigveda Samhita. Rgvedasamhita.. Rasaratnapradiipikaa Gran'thang-ka 8. Sanskrit..v.. 128 pgs. 146 pgs. Literature. Unknown. Sanskrit. Remarks On The Sanskrit Passive. Remarks Of Similes In Sanskrit Literature... 1108 pgs. Biography. Rauravagama Volume I.

Rudrasthadhyayi. Linguistics. Vilsana~ Hecha~ Hecha~. Theology. 170 pgs. 158 pgs. 1932. 502 pgs. Shriimaadhavena Shriiven'kat'aara~yaatanudbhavena. Unknown. Linguistics. Rxgvedaanukramand-ii Prathamo Bhaaga Grantha 2. Theology. 429 pgs. 641 pgs. 1929.. Roopdeepika. Sanskrit. Religion.. Sanskrit. 1955... Sri Balayajnavedesvara. Sanskrit. Literature. Linguistics. Rigveda Samhita Vol-v Indices.. Sanskrit.. Rudraadhyaaya Grantha 2. 1986. 283 pgs. Rxgvedaa Vyakhyaa Maadhavakara~ta.. Language. 1945. Sanskrit...t.. 1928. . Shriimatsaayand-aachara~ya. Sri Pandith Jwalaprasad. Sanskrit. Rudradasas Chandralekha. Bijapurakara Vishnd-u Govinda. Theology.. Ritriratna Prakash. Sanskrit.. Rukminishavijayahaha. 32 pgs.. 0.. Sanskrit.. Religion. 770 pgs.2/14/2011 A list of scanned Sanskrit books at III… Rigveda Samhita Vol-ii 2-5 Mandalas. 1951. Sanskrit...org/…/SanskritIIIT. Bhat't'ena Maadhava... Theology. 102 pgs. Dharmasthala.. 176 pgs.. Unknown.… 43/167 . A Narayanadas. . 249 pgs. Rksamhita... . Religion.. 1929..t.. Sanskrit. Journals. Rxgveda Sn'hitaa. Raajaa Kunahaana.. Sanskrit. Shriimadhavaa. Religion. Rkbhasyam Chalari. Rxgveda San'hiita Shashht'o Bhaagaa. 352 pgs. Theology.. Theology. 2000.. Theology. 450 pgs.. Rxgaratna Bhaand-d'aara. Rxgveda San'hitaa Trxtiiyo Bhaaga.. Literature. Sri Rama Sharma. Unknown. Sanskrit. 374 pgs. Sayanacharya. Sayanacharya.. 1940.. Rksamhita. 1966. 1986. 1950. 1936. Theology. Religion. 454 pgs. Sanskrit...r. Krishnacharya. Riksan'graah Trxtiiya Khand-d'a. Sanskrit. Rkbhasyam Tika. 1940.. 0. Rukminikalyana Mahakavya.. Rxgara~thadiipika Chatura~tho Bhaaga. Aapat'e Hari Naarayand-a. Religion. 914 pgs. Rigvedasya Prathamamanadalasya Sayana Venkatamadhava Bhasyayos. Religion. Sanskrit. 1951. Santavalekara~ Shriipaada Daamodara~. Sanskrit. Theology. Theology. Sanskrit. 1823. 736 pgs. 1219 pgs. 362 pgs. . 242 pgs. Theology. Sanskrit. 0... Sanskrit. 1242 pgs. Sanskrit. Ramanand Divvedina. 1955. Kamakshi. Kolan'gad'e Raamachan'dragovin'da.. Language. Sanskrit. . Unknown.. Religion. Religion. Krishnacharya. 298 pgs... Language. 1058 pgs.. P. 1939. Rxgara~thadiipikaa chatura~tho bhaaga. Rukminikalyana Mahakavya Of Rajacudamani Diksita. Sanskrit.. Unknown.. 1950. Rxgara~thadipika Bhaaga 2... Rigveda. Pramodhini Panda. Religion.. 1823. Rxgveda San'hitaa Bhaaga 2. sanskritdocuments. 1062 pgs. Religion.. 1208 pgs. Dr A N Upadhye. Religion.. Literature.. 200 pgs. Sanskrit. Literature. . Sanskrit. 0. Shaastri T'i Vi Kapaali. Sanskrit. Sanskrit... 1931. Shriimaadhavena Shriiven'kat'aara~yaatanudbhavena. 1929.. Shriipaadashara!~mand-aa Bhat't'aachayaind-a. Sanskrit.r. Rubaiyat Of Omar Khaiyam. Rxgveda San'hitaa Prathamo Bhaaga.. Unknown. 1935. 1058 pgs. Sanskrit. Theology. 1140 pgs.

1939. 1938. Rxgvedasan'hitaa Prathamaashht'akama~. Religion. Theology. Sanskrit. 1961. Rxgvedavyaakhyaaya Bhaaga 2 Ast'aka 1 Adhyaayaasa~ 5 Se 8. Bhaagavata Hari Radhunaatha.2.. Religion. Theology. Sanskrit.. Religion. Pandit Dhundhiraj Sastri. Sanskrit.u. 353 pgs. 77 pgs.. Religion. 1142 pgs. Sanskrit.. 543 pgs. Religion. Religion. 1951. Theology. Theology. Shriikapaalishaastrii. 1947. Theology. Raamaanuja Jaiyasaragomat'han. Theology. Rxgvedasan'hitaa Trxtiiyo Bhaaga. sanskritdocuments. Sanskrit. Sayanaachaara~yaa Shrii. Theology. 1917. Theology. Sanskrit.. Svaruupaachaara~ya Anuubhuuti. Rxgvedasan'hitaa Trxtiiyobhaaga. 1941. Religion.v. 1936. Shriikapaalishaastrii... S.oriental Journal Vol-4 Part 1 .. Saamaanya Bhaashhaavijnj-aana. Sanskrit. Religion.… Sabdakalpadruma Kanda Ii Radhakanthadev Religion Theology Sanskrit 1976 944 pgs 44/167 . 126 pgs. Language.a. Religion. 238 pgs. Rxgvedasan'hitaa Prathamashht'akama~ Prathamo Bhaaga. Religion. Sterling Publishers Private Limited New Delhi. Chaara~ya Saayand-a... Sanskrit.... Rxgvedasan'hitaapadapaat'hah.. Sanskrit. 702 pgs.. Saara~tha Upanishhatsan'graha Bhaaga Sahaava. Literature. pg A list of scanned Sanskrit books at III… Rxgvedasan'hitaa Pdaadisuuchyaatmakah Panj-chamo Bhaaga... 370 pgs. Sanskrit. Saamaveda San'hitaa. Sabda Manjari. Literature.. 2002.sastry. K.. 1072 pgs.v.. 1990. Sanskrit. Religion.. Sanskrit.. Unknown.. Saamavediiya Taand-d'yamahaabraahmand-ama~ Da~vitiiya Bhaaga. 1151 pgs. Rxgvedavyaakyaa. Bhaagavata Hariraghunaatha. 160 pgs. 1913. Sabda Manjari.. Theology. Sanskrit. 359 pgs. 1943. Theology. Theology.. Linguistics. 1957. Sont'ake Esa~ena~.. 1934.. Linguistics. Language..2/14/2011 . Saamavediiya Chandogyopanishhata~.. Virachita Nanj-jund-d'aaraadhya. Linguistics. 1950.. Tippayya Parishkrit.. 1940. Purushottam. L Laxminarayan. 1935.. 1947. Matsaayand-aachaara~ya. Saadaashivabhaashhyama~. 197 pgs. Sanskrit. 1936. Sanskrit. Saarasvata Vyaakarand-ama~ Uttaraaddhara~ma~. Shara~maa Raamasvaruupa. 1934.. Saamavediiyataand-jyamahaabrahmand-ama~ prathama bhaaga. Sanskrit. Sanskrit. shriimatsaayand-achaara~yaa.. 189 pgs. Religion. Raghuviira~ Achaara~ya. Saathar Upanishhatsn'grah 4 Bhaaga... 353 pgs.org/…/SanskritIIIT. Theology. Sanskrit. 387 pgs... Rxgvedasan'hitaa Prathamaashht akama~ Prathamo Bhaagaa. Unknown. 1922. Religion.. 602 pgs. Sanskrit.. 949 pgs. Natural Sciences. Literature.. Language. Unknown.. Saamavediiya Jaiminiiya San'hitaa Bhaaga 3. 1951. 547 pgs. Saaraswatham (vyakaranam).. 208 pgs.t. Madhavaka~ra~ta. Sanskrit. Sanskrit. Religion. Theology. Shriikapaalishaastri. Maadhavakara~ta. Saayand-aachaara~yaa.. 168 pgs. Indology.. Sabda Sakti Prakasika.. Theology. Sanskrit.. 1984. Theology. Saksenaa Baaburaama.. Sanskrit. 492 pgs. 1922. Sanskrit. 285 pgs.l. 500 pgs. Religion.

.. Sanskrit. 1981. Sahithya Darpan Of Vishvanatha Paricchedas I Ii X. Literature.. -. 1956. 0.. Sahitya Darpanam.r. . 394 pgs. 151 pgs. Sanskrit. Kaloori Hanumanthrao. Sanskrit... Sahityaratnakara Of Dharmasuri Part I I. Bhuskut'e Vi Bha. 558 pgs. Dr B R Shastry. Sahityaratnakara Of Dharmasuri Part I I I. Unknown. Religion. The Arts. 1939. Unknown. ekanath dattatraya kulkarni. 1967. Srotaranay Tarakavachaspati abhattacharya. Unknown..narasimha Charya. 485 pgs.. Unknown.. 1979. 1913. 1973.. Sahitya Vimarsa. Literature.. Sri Durga Prasad Divyedaen. 498 pgs.. Sabhashyatatvarthadhigamsuthrah. 292 pgs.. Saddarsanasamuchchaya. 1976. Sahiti Jagathi. 1924. Sanskrit. 88 pgs. Sanskrit. Sanskrit. Sama Veda Rahasya Ganam. Sahstra Deepika Of Partha Sarathi Misra. Sanskrit. 1957... Unknown.... Unknown. Sadguru sri Tyaga Brahma Pushpanjali. Sabhashya Rathna Manjusha. Sanskrit. 1974. Rama Krishana Misra.ramanatha Deekshithar.. 188 pgs. 266 pgs. 1802. 84 pgs..bhatt. Shriibhojadeva Mahaaraajaadhiraaja. Stotras. Sagaud'a Paadiiya Kaarikaathara~va Vediiya Shhashht'hiya Khand-d'a Grantha 10. sanskritdocuments. Literature. Language. Unknown.a. 408 pgs. Unknown. History. 1886 pgs. Sanskrit. Sanskrit.. 348 pgs. Sakuntala. Sanskrit.. Linguistics. 1945. 1911. 101 pgs. Sachurnika Srimad Bhagavatam... Dr P Sri Ramachandrudu... Unknown. Sabdartha Ratnamu. Sanskrit. Samaarang-gand-asuutradhaara Prathama Bhaaga. 412 pgs. Sanskrit. 110 pgs. 1961. Khubchandraji Siddhanthashasthri. Unknown. Sanskrit. Sanskrit. 450 pgs. P V Kane. . 1994. 272 pgs. 420 pgs. 1917. T.... Language. 944 pgs..radloff.. Bhagavata Shan'karaanan'da. Literature. Linguistics. 142 pgs. Sanskrit. Unknown. 0. Not Available. Unknown.. Sahithya Rathna Kosah Thruthiya Khandamu. Unknown. Religion.. 0. 1982.. Sanskrit.. 1962. Sabhasha Arthavedika Vishaysoochi. Sahitya Darpan. Sanskrit. Unknown. M. Pandith Bechardas J Doshi... Sanskrit. Sanskrit.. Chaturveda Shastry... Sanskrit. Sanskrit. 1982.. 1936. 174 pgs. 388 pgs. Sabdapasabdavivekahaccn0 946.. Sanskrit. Sanskrit. Sanskrit Grammer. Sanskrit. 188 pgs. 634 pgs.org/…/SanskritIIIT. 1981. Geography. Sanskrit.. Salihotra Of Bhoja... 1932. shivnath khanna. Theology. Unknown. W. Mayuram Sri M. Sabdha Koustubha. 764 pgs. 639 pgs. 94 pgs. 494 pgs. Theology. Nalinaksha Dutt. Sanskrit.. Hari Damoder Velankar. Sahityasara. Aomesvara Sharma... Sri Haribhadrasiri. Biography. Sanskrit.... Sacitra Prasuti Tantra. Sahitya Sudhalehari. Unknown.. Sahasra Yogaha. Unknown. 1949. Sanskrit. 1987. Sanskrit. Sahitya Darpan (vimla). 814 pgs... Unknown. 498 pgs. -. Sabdartna With Bhairavi.2/14/2011 A list of scanned Sanskrit books at III… Sabdakalpadruma Kanda Ii. 623 pgs... Saddharmapundarika. Sadaashivaraavabhaauu.. 0. Radhakanthadev.. 1906. Religion... 1951.. Unknown. 0. Sanskrit. Pushpa Srivatsan. Sanskrit. Unknown... 249 pgs. . Sabdanusasana. 1953. Sri Madachutaraya. Sanskrit... Theology. Unknown. Pandit Bhatta Yogi Dikshit.. Monier Williams.… Samanya Vedanta Upanishad Mahadevshatrin Religion Theology Sanskrit 1921 556 pgs 45/167 .

1965. 136 pgs. Mahadevshatrin. Trutiya Kanda.. Sanskrit. pandit s subramanya sastri. Art. Unknown. 98 pgs.. 384 pgs. Satyavarata Samasarami Bhattacharyyaa... -.. Linguistics. 557 pgs.. 0. Unknown. 490 pgs. . 0. 0. Sanskrit. Pandit V. 1948.. .. Language. Sri Gowrishankar Sastri. Language.. 144 pgs. Unknown. 266 pgs.. Sanskrit. 1921. Sanskrit. Samskrita Akshara Siksha. . 2000... 407 pgs. -. Sanskrit. .. Samkhyayogadarsanam. Sanskrit. 587 pgs. Pandit M Suryanarayana Shastry. Unknown. 1948. 0. 0. Samskrta Kavi Jivitam Part Ii. Sanskrit. . 102 pgs.1. Ramji Upadhyaya. Theology.balasubramanyam. Sanskrit. 0000. 424 pgs. Samskrutha Bhakthamala.. Pandith S Subrahmanya Sastri.... Sanskrit.. Literature. Language.. Dr. Yudishtar Mimasak. Gosvami Damodara Sastri. Samskruth Chittah Trutiya Bagh. 103 pgs. 0.. Samskrita Swayam Sikshak Praba. Sanskrit.... Samskaranrusimhaha. Literature. Unknown. Samskruta Vanmaye Chandrah.. Unknown. 1925. .krishnamacharya. Sanskrit... Linguistics Literature. R. 0. Samaskrit Basha Vibushanam. Samskruth Sukthi Sagar. Samkalpa Suryodaya Of Venkatanatha Part 1. Unknown. 323 pgs.. Sanskrit. Sanskrit. Samskruta Sahitya Silanam.. 0. Sanskrit. Linguistics Literature. Sanskrit.. Religion. Mulchandr Patak. Sanskrit. V. Shriibhojadeva. 226 pgs. 95 pgs. Religion. Literature.. 0. 0... sanskritdocuments.. Sanskrit. Literature.. 634 pgs. Sanskrit. Literature. Samskrit Baladarsa. Sanskrit.. Sanskrit. Samsara Chakram. 736 pgs. Subbrayudu. 288 pgs.. Sanskrit. Samskara Prakasika.. -.… Samskrutha Sikshamajyarayaha Bhattacharya Sanskrit 1934 143 pgs 46/167 . Samgita Rathnakara Vol 1. Samgitaratnakara Vol I V Ashyaya 7. Linguistics Literature. Sambapuranam (upapuranam). Samarad'gand-asutradhaara Bhaaga 2. 0. Unknown. C. 440 pgs. Jithendranath Shukla. Sanskrit. 1961. Sanskrit. 1983. Samskrtu Vadumaya Kosa.. Unknown. Linguistics..org/…/SanskritIIIT. 1935. Samkalpasuryadaya.. 0.. 233 pgs... Bhavavibhuti Bhattachary. 1948.. 226 pgs... Unknown. Sanskrit. Sanskrit. Unknown. 454 pgs. Narayana Swamy. . 1963. V. Shrikrishanamani. Samskritha Prathibha Vol I. Sanskrit.. Sanskrit. Krishnamacharya. Linguistics. 1937.. Theology. Vidyasagar k L V Sastri.. . Religion.. Samsara Chakram. 615 pgs. Samskruta Vyakarana Sastra Ka Ithihas Part . Samaveda Samhita Volume Iv. 84 pgs. 0. Sanskrit. 0. Sanskrit. Samarrngara Sutradara Vasthu Sastram Mulamatram.. Samaveda Samhita. V. Literature. Samarangara Sutradara Vasthu Sastram Mulamatram. Sanskrit.. Theology. 422 pgs. Unknown.. Sridhar Bhaskar. Literature.. 166 pgs.. 0. 568 pgs.. Sanskrit. Literature. Linguistics. 104 pgs. Satya Srinivasa Ayyangar. Samkalpasuryodaya Of Sri Venkatanatha..2/14/2011 A list of scanned Sanskrit books at III… Samanya Vedanta Upanishad. 263 pgs. Sanskrit.. 436 pgs. Samavedasamhita. 452 pgs. 1983. 1990... Sanskrit.v... 1992. . Sriramdeen Cheturrvedi.. 1943. 556 pgs. Unknown... 1965. 364 pgs. Language.krishnamacharya. Samskruta Sukthi Sagar.. Linguistics Literature. Samskruth Natakome Athi Prakruth Thatv. 1982.

subrahmanya Sastri. 230 pgs.. San'qs-epashaariirakama~ Da~vitiiyo Bhaaga. Sanskrit. Others . Samyasara Of The Nature Of The Self. Language. Sangitaratnakara Of Sarngadeva Vol I. 143 pgs. Theology. Sanathakumara Samhita. Biography. 1941.. Chimnaajii Gand-esha. 1982. Literature. Unknown.. 86 pgs. Vaamana Kaane Paan'd'uran'ga. Sanskrit.. Philosophy. Geography. 0... Poonam Niraula. 1918. Samvedika Sri Subhodini Paddhati. Linguistics. Unknown. Religion. Atri Samhita.. Mathura Prasad. Sanskrit. 72 pgs.. Unknown. Sara~vajnj-aatmamuni. . 406 pgs. Others . Art. Hajari Prasad Divyedi. Sri Kunda Kunda.. Sandesh Rasak. Geography. Unknown. 1950. Gummaluura~yupanaamaka Sang-game Shrvarashaastrind-a.. Sangita Chandra.. San'skrxtavaachanapaat'hamaalaa Dvitiiya Khand-d'a. San'skaara Paddhati Grantha 94. 1992. 1917. Sandhi Samasa Manjusha. Samtanantarasiddhi Vol Xix. Natural Sciences.. Bhaand-d'aarakara~ Raamakrxshhnd-agopala. 1934. Biography. 638 pgs. Theology... San'qs-ipta Vaalmikii Raamaayand-a Trxtiiyo Khand-d'a. Psychology. Samtanantarasiddhitika.. Sanskrit. 154 pgs.. Sanskrit. 822 pgs. 1950. Theology. Sanskrit. San'skaararatnamaalaa Uttaraara~dama~ Bhaaga 2. Unknown. Sanskrit. Natural Sciences. San'skrxtamandiraantah Praveshikaa. 1955. Sanskrit. 1933. Sanskrit... pandit s subramanya shastri.. 1899. Sanskrit. Social Sciences.. Sanskrit. 386 pgs. 462 pgs. Sanskrit. Sanskrit. 603 pgs. Sanskrit.. 212 pgs. Gand-eshaa Shaastrii Laqs-mand-a. Samveda Vachaspathi. 1960. 176 pgs.... Philosophy.. Religion. San'qs-epashaariirakama~ prathamaadhyaayarupa Prathamo Bhaga. Sanskrit.. Unknown. San'skrxtapadyavali. Art. Sanskrit. Sang-game Shrvarakrod'ama~. 1928. Sanatsu Jatiya. 405 pgs. Sanghameswara Krodam. 82 pgs. Sanskrit. Sanskrit. Unknown.... Aalatekara Maadhava daamodara.. 244 pgs. 0. Sanskrit. History. Sanskrit. Sri Kunda Kunda.. 312 pgs. Sri Ramachandra Jha Vyakarnacharya..… Sangitopanisat Saroddhara vacanacharya sudhakalasa Unknown Sanskrit 1961 198 pgs 47/167 .. 439 pgs. 1899.. Vaidaya Si Vi.33. Rigveda Samhita.. 331 pgs. Gopinathadiiqs-ita Bhat't'a. San'skaararatnamalaa Prathamo Bhaaga. 237 pgs. Sangeetanjali. 1953. Sanskrit. Literature. Pandit Omkarnath Thakur. 80 pgs. Bhat'a~t'agopiinaathadiiqs-ita.. 270 pgs. 1913.. Sangitaratnakara Of Sarngadeva Vol 4 Adhyaya 7. 1931..33.. Bhattacharya.. Sanskrit. Religion. Sangita Chandra (a Trearise On Indian Dance). 1987. 455 pgs.. Atri Maharshi. Sanadaapatraan'tiila Maahitii. Samurtar Chanadhikarana: Atri Samhita. Sanskrit. Sanskrit. Sara~jnj-aatmamuni. 1943. V.. Suklapandita. Suklapandita.. 1921. Samyasara Of The Nature Of The Self. History... Language. Sanskrit. 173 pgs.2/14/2011 A list of scanned Sanskrit books at III… Samskrutha Sikshamajyarayaha. 298 pgs. San'pura~nd-a Aagarakara Bhaaga 2. Unknown. 1947. Sandhi Chandrika. 560 pgs.. Linguistics. 0000. Sanskrit.... Atri Samhita. Psychology. Sanskrit. Sanskrit. Pandit S.... Unknown. Shaastri Bhaaskara. 1918. 1677. 1924. 267 pgs. sanskritdocuments... Sanskrit.krishnamacharya. 180 pgs.org/…/SanskritIIIT.. 1953. 406 pgs. 1934. 1982....

Hari Narayan Dikshit. P K Gode. Sanskrit. Unknown. Pt. Unknown.. Unknown. Linguistics. Sanskrit. 0. Sankara Bhashyalochanam. -. Unknown. Unknown. 62 pgs. 1947. 0.upadhaya. 0. I Shekhar. -.. Sankhya Darshan Pravachan Bhashya... Sanskrit Sahithyothihas Vol. Pro. 0. Sanskrit. 1961.. Theology. 523 pgs. Sankalp Suryoday Vol I. 684 pgs. Sanskrit.. 70 pgs. Sanskrit Text Book For Detailed Study 1960. Pandit Krishnama Charya. Sanskrit. G. 0.ix. Sankshepa Sarirakasya Adhyaya I.. 284 pgs. G. Unknown.. 650 pgs. 2002..org/…/SanskritIIIT. -. Sanskrit Text Book For Detailed Study 1962. 467 pgs. 456 pgs. Sri T K Tiruvenkatacharya. Sanskrit. Sanskrit.. Sanskrit Saiva Kavyas Vol I. Unknown. 1976. 435 pgs. 1945.. Sanskrit Ratnakarmay Shigyandank. Sanskrit. Linguistics. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Sangitopanisat Saroddhara. Language. Unknown. Pandit Vruddhi Chandra Sharma Shastri.. 1940. Sanskrit..p. Unknown.. Unknown. Biography. Leidecker. 1930. Unknown. 352 pgs. 1987. 1963.. -. Ramashankara Bhattacharya. Unknown. 102 pgs. Sanskrit Nibandhavali. Unknown.. Unknown. Sanskrit. Sankskrutha Gantha Suchi.sriram Sharma Acharya. Unknown. 198 pgs. Acharya Udhayveer Shastri. 1954. Language.. Linguistics Literature. 1948.. Unknown. Sanskrit.. Unknown. 0.. Sankhya Darshan Ka Ethihas... Unknown. 50 pgs. P.krishnamachariar. Sanskrit. Gopala Bhatta. 118 pgs.. Language. 1985. Sanskrit Drama Its Origin And Decline.. 758 pgs. Sanskrit Bhashamahe. 0. Sanskrit. 1976. Sanskrit.s. Sanskrit Gadhy Padhy Sangraha Vol I. Sri Vijnana Bhikshu. 2002. Literature. 1994. K.hansraj Aggarwal. 1976. Sastri.. Geography. 1994. 150 pgs.. 1953.. Sankaravijaya. 254 pgs. Shri Brihaspati Shastri. 110 pgs.. 146 pgs.. Sankya Darshan. 1959.. 0. Sanhit.. 644 pgs. Sanskrit Manuscripts 2. 266 pgs. Sanskrit... Sanskrit.. Sanskrit Journal Sahrudaya Part 8. Unknown. S. sanskritdocuments. Sanskrit.. Krishnamachari.. Sanskrit.. Sanskrit.. Sanskrit... Pandith Rajesh Dixit. 435 pgs. Unknown. Linguistics. Sanskrit.. Sanskrit Essentials of Grammar and Language. 164 pgs. Sankhyayana Grihya Sangraha. Thibaut. Religion.. Narayanacharya. 1980.. 207 pgs.. History.. 107 pgs. 131 pgs. Sri Brahaspati Shastry.. .p. Sanskrit Gadya Padya Samgraha. vacanacharya sudhakalasa.… 48/167 . 0.. Unknown. Sanskrit. 1956. Sanskrit. 260 pgs. Sanskrit Syntax And The Grammar Of Case. ... 68 pgs... Unknown. 667 pgs. 1958. Sree Purushottam Lal Srivastav.. Sanskrit Bhasha Bhodhini Vol I I. 243 pgs. Sanskrit. Sanskrit. Sanskrit. 588 pgs. .. 302 pgs. Surendra Kumar Gambhir.. Unknown. Sansar Sagar Manthanam Vol Ii.. Brahmachari Surendra Kumar. Sangrahartha sangraha. Unknown. 1947. Kanta Gupta. 377 pgs.. Not available. 1886. Unknown. Sankhyadarsana. 146 pgs.. Literature. Sanskrit. Vyasacala.1. Sanskrit. Sanskrit English Dictionary Vol 2. Literature.. Sanskrit. Sanskrit.. Sanskrit.. Sanskrit Journal on Sahrudaya. Sanskrit Sopanam Vol Iv.. Sanskrit.. Sanskrit Manuscripts Vol. Sanskrit Text Book For Detailed Study.. Sanskrit. 1960.. Kurt F.venkataramanan. Sanskrit.....

58 pgs. Dr. 174 pgs.org/…/SanskritIIIT. Unknown. Sanskrit. Unknown. Sanskritkavicharcha. Unknown. Sanskrit. Sanskrit. 1868. Sanskrit. 0.... Sanskrith Siksha Vol Ii. Sanskrit.. Pandith Sripad Damodar Sathvalekar. Sanskrith Paath Mala Vol I V. 0. Sanskrit. Religion... Sanskrit... 1973. Sanskrith Sopanam Vol Ii. Sanskrit. 40 pgs. Sanskrit Text Book For Detailed Study 1964. Lele Laqs-mand-agand-eshaastii. Surendra Kumar Gambhir. Sanskrit.. Sanskrit Text Book For Detailed Study 1967. 1955. 62 pgs. 1927. 42 pgs. Sanskrit. Sanskrit. 336 pgs. 0.. Sanskrith Paath Mala Vol X I I.. 404 pgs.. 1930. 84 pgs. 1990. . Unknown.. 1976. Pandit Ram chandra Jha. Sarasvata Home Of Kalidasa.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit Text Book For Detailed Study 1963..kapildev Devedi Acharya. Linguistics. Benfey T H. Philosophy.. Unknown.. Sanskrit. 1981. Sanskrit.. 44 pgs.. 475 pgs.. 133 pgs. V. Sanskrit. Sarasvanth Vyakaranam Poorvadharma. Sri Naraharishastry. Sapindya Kalpalatika. Unknown. Sanskrit. 116 pgs.. History.m. Literature. Saralaayurved Shiksha.. 72 pgs. 132 pgs. Unknown. Literature. 1942... Sanskrit. 0...... Santi Prakasa. Sanskrit. Unknown.. Sanskrith Paath Mala Vol Ix. Unknown.... Unknown... Unknown.. Sanskrit. 410 pgs. 70 pgs. Pandith Sripad Damodar Sathvalekar. Santati Shastra. Sanskrit. Unknown. 1956. 1982. 366 pgs. 324 pgs. Unknown. 315 pgs. Gopinatha Kaviraja. 214 pgs. -. Mangesh Patkar.. 420 pgs. Dr. Pandith Jeevaram Upadhyay.. Pandith Sripad Damodar Saatvalekar. Sanskrit. 1928. 57 pgs. 418 pgs. 133 pgs. 0. Sanskrit. 302 pgs.. Sanskrit Vyakaranam. Unknown. 1950. 146 pgs. 48 pgs. 2002. Surendra Narayana Tripathi. Sarasabharathi Vilasa. 100 pgs. 122 pgs. Sanskrith Grammar. Language. Unknown. Sarasvata Vyakaranam. Sarasangrahah. 0..kapildev Devedi Acharya. 0.... Sri Guru Prasad Shastry.. Sanskrit. Religion.. -. Biography. Sanskrit. 0. Geography... 1950. Sanskrit. -.. Jagdish Kumar. 0. Unknown. Krishnagopal Goswami Sastri... Sarasvatibhavana Granthamala Volume X. 70 pgs.. Dr. Sarasabharati Vilasa. Linguistics Literature. Unknown. Sanskrith Kathasagar. Sanskrit. 166 pgs... Sanskrit. Sanskrita Shiksha 1. 0. Garikapati Laxmikanthaiah. 0.. 1927. Unknown. Unknown.. Sanskrita Sahitya Itihasa Khunjka. 1949.… 49/167 ... Sri Vadirajathirtha. Janardana Pandeya. Babu Ayodhya Prasad. Sanskrit.. Acharya Paramanand Shastry.. Sanskrit. Unknown. 1843... 300 pgs. Unknown. Sanskrit. Sanskrith Siksha Vatika Vol Iv.. 60 pgs.. Unknown. 1951. Unknown. Sanskrxtavaachanapaat'hamaalaa Da~tiiya Khand-d'a. -. 1996. Sanskrit Vyakaran Praveshika A Sanskrit Grammar For Students. 1982.kapildev Devedi Acharya. Sanskrita Shiksha 3. Sanskrit. Sanskrit. Unknown. 110 pgs. Sanskrit. -.prabhanjanacharya. Sanskrit. Sanskrita Shiksha 2. Pandith Rahul Sanskruthanen. Sanskrita Kavya Kanthah... Chaturya Lal. sanskritdocuments... Sanskrit. -.. Saradiyakhya-namamala of Harsakirti. Unknown. Sanskrith Paath Mala Vol Ii. 1985. 1990. Unknown. Sri Rurthar M Mikanal.. Sanskrite Panchadevastotrani. Ramchandra Sharma..

Sarva Darsana Sangraha Of Madhavacarya.. 1957.. Sanskrit. 241 pgs. 1915. 431 pgs. Unknown. 1937. Sanskrit. History. Sarvedic Prasnothari. History. Raobahadur Gangadhar Bapuraj Kate.. Sanskrit. 1927. Sardh Jnaneshwari. 164 pgs. 0. Sanskrit.. Dr. Sanskrit. Pandit Sri Vishveswara Jha.. Sathyaashhaad'ha. 1912. 1950.. Sarvavednta Siddhantasarasangraha.. 1940. 185 pgs.. Sanskrit. 1913. Unknown.. 226 pgs.... Sanskrit. Unknown. Sanskrit. 401 pgs. Sanskrit.. 166 pgs.. S R Krishna Murthy Shastry.... Language.2/14/2011 A list of scanned Sanskrit books at III… Sarasvatii Kand-t'haabharand-ama~ Bhojaadevaa. Sanskrit.. History. 1935. Mangesh Patkar.. Sanskrit. Sanskrit. 1973.r. Satha Dushini.. Sasthramuktavali... 214 pgs. 1952. Vaidya Shivacharan Dhyani. 1927. Geography. Literature. Sastra Dipika. Linguistics. 539 pgs. 402 pgs. Philosophy. Saraswati Sushma Vol 37 1 4.. Vedas. 880 pgs. 1969. 1986. 340 pgs. 0.. . 1995.. Mangesh Patkar. 0.m. Religion. Sathyaashhaad'havirachitamn' Shraotasutrama~ Shhashht'o Bhaaga. Theology. Sarvasiddanthasara Vivechanam.. Philosophy. Geography. Linguistics.. Unknown. 162 pgs. Sri Sankaracharya. 212 pgs.r. 1927.m. 206 pgs. Sanskrit.r. sanskritdocuments. 1927. Biography. History. Sanskrit. Saraswati Vilasa (vyavahara). pgs.shama Sastry.. 1964. 1986. Sanskrit. 456 pgs. Sanskrit. 1967. Satapada Brahmanam. .p. Sanskrit. Theology. 1901. Satha Dushini. bhatta vasudeva. 562 pgs. 431 pgs. 1983. Sanskrit. Religion. Philosophy..shama Sastry. Geography.sastri. 1935. Chin'taamand-i Ti raa. Sathya Shasan Pariksha. Sanskrit.. Sanskrit.… Satikathraya Sri Valmiki Ramayanam Utthara Kandam Sanskrit 0 2090 pgs 50/167 . Unknown. Saraswati Bhavana Texts Part Ii.. Sanskrit. 0. Biography.. Saraswathi Suhama Vol 53 Mar Dec 1998-99.. Sri Pradhacharya Vidwanandi.. 1951. Dr. 120 pgs.s.. 1951. 382 pgs. 405 pgs. Sanskrit. Sanskrit. Sanskrit. Philosophy... Dr. 80 pgs. 0..shama Sastry. Sarvadarshana Sangraha. Sarira Kriya Vijnaniyam.. Sathavarthmala Sampoorna.. Sastri Dipika. Sanskrit. Unknown. ... 233 pgs. Sarth Jnaneswari.. 0. P.. Unknown. Sarkara Srinivasavirachita Tatvaprakasika. Ramchandr Savath. Sanskrit. . Sanskrit.. Sanskrit. Philosophy. 1916. Shri Nanamaharaja Joshi Sakhre. pgs. Sri Nanamaharaja Sakhare.. Vedanta Desika. Anubhavananda Swamy.. Gopi Natha Kaviraja.cowell. Unknown.. Unknown. Sastra Siddhantalesasangraha Volume I. Satha Dushini. Sanskrit. Unknown. 241 pgs.. Sanskrit. E. . Sastra Darpana. 400 pgs. Unknown. Saraswathi Sushama Vol 37 (1-4). Saraswathi Suhama Vol 53 Mar Dec 1998-99. 182 pgs. Literature. 357 pgs. Saraswathi Sushama Vol 37 (1-4). Geography. Biography.. Chinnaswamy Sastri. Sanskrit. Srimadvijayeendrateertha. Unknown.org/…/SanskritIIIT. pgs.. 694 pgs. Anundoram Barooah. Sanskrit.. Pandit Rama Krishna Misra... Vageesha Sastry. Language. Biography. 544 pgs.. Literature. Sarva Siddhanta Sourabham.. Unknown. 1935. Unknown. Sastra Siddhantha Lesa Sangraha..... 158 pgs. Saraswari Kanthabharana.. Unknown... Saraswatha Vyakaranamu Purvardhamu. Sri Amalananda. Religion.. Unknown. Pandit Rama Krishna Kishra.b.. Sanskrit..

Satyaashhaad'a. Theology. Sanskrit.. Sanskrit. Religion. Seethaharanam. Satyaashhad'ha.. Swamy Ghanapathi. Sanskrit. Saudaryalahari.. Philosophy. 165 pgs. 1953. 367 pgs.n.. Religion. 1907. Religion. 138 pgs. 0. sanskritdocuments. Theology. 1925. Gaadi. Satyaashhaad'havirachitan' Shraotasuutrama~. Literature. Satyaashhad'ha. Religion... Religion. Language. 359 pgs.. Religion. 331 pgs. V.. 1941. Sanskrit... Sattotravalivibhag. Satyaashhad'ha.. Haraprasad Shastri. Unknown. Satyaashhad'ha Shraotasutrama~ Da~tiiya Bhaaga. Satyaashhad'ha Shraotasutrama~ Chatuura~to Bhaaga. Linguistics. 455 pgs... 2090 pgs. Sanskrit. Aapat'e Vinaayaka Gand-esha.. Unknown. 158 pgs... Religion. 350 pgs. 1975. Philosophy. Satyaashhad'havirachitan' Shraotasuutrama~ Navamo Bhaaga. W. Satyaashhad'havirachitan' Shraotasuutrama~ Saptamo Bhaaga... Select Sanskrit Inscriptions. Saurapuraand-an' Vyaasakrxtama~ Grantha 18. Sanskrit. Seleqs-ansa~ Phrama~ San'skrxta~ Insa~kripshhansa~ Para~t'a~ 1 Tekst'a~. Sekoddesatika Of Nadapada Naropa. 1908.. Sanskrit. Kalluri Hanumanth Rao. 1921.. 1932. Satyaashhad'havirachitaman' Shraotasuutrama~ Ashht'amo Bhaaga. 328 pgs.. Religion. 212 pgs. Religion. Sanskrit. 51/167 . Satyashhad'ha. Theology. Sanskrit. Sanskrit... .. Theology.shri Krishnamacharyswamy. Shaan'karapaadabhushand-ama~ Da~vitiiyo Bhaaga. N. Prof.. Satyaashhad'ha. 71 pgs. 1929. 169 pgs. Sanskrit.. 221 pgs. Religion. Aapat'e Vinaayaka Gand-esha..... Theology. Theology. Literature. Satprati Pancha Grandhaha.. 1927. Diskaalkara~ Di Bii. Theology. 310 pgs...org/…/SanskritIIIT. Satyaashhad'havirachitaman' Shraotasuutrama~ Dashamo Bhaaga. Shaad'a~khaayanaarand-yakama~ Grantha 90. Satyaashhad'ha. Mario E Carelli. Satyaashhad'ha Shraotasuutrama Trxtiiyaa Bhaaga.… Shaan'karapaadabhushhand-ama~ Prathamo Bhaaga. Sanskrit. Saundara~yalaharii Third Edition. Aapat'e Vinaayaka Gand-esha. 144 pgs. 1969.. 125 pgs. 1908... Theology. 455 pgs.. Theology. 1908. Sanskrit.. Theology. Shriiraghunaathasuri. Theology. Theology. Language. Unknown.. Sanskrit. Sanskrit. Vedas. 1939.. Religion.. Satyagrahodaya. Sanskrit. 368 pgs. Saundarananda Kavya Of Arya Bhadanta Asvaghosa. Sanskrit. 1932.. Jwalaprasad Goud. Psychology.. Unknown. Linguistics. Dr. 73 pgs. Satyaashhad'ha.. Theology. Theology. 140 pgs. Sanskrit. 1922. Karambelkar. Satyaashhad'ha. Satyaashhad'ha Shraotasutrama~ Da~tiiyo Bhaaga. Satyashhad'ha Virachitaman' Shraotasuutrama~ Navamo Bhaaga.. 1930. Sanskrit. Religion. Vedas. Sanskrit. 166 pgs.. Sanskrit. Religion. 0. 406 pgs... 1930... 370 pgs. . Satyaashhaad'a Shraotasutrama~ Trxtiiyo Bhaaga. Raghunaathasuuri. Shan'karaa Chaara~yaa. Sanskrit. Religion..2/14/2011 A list of scanned Sanskrit books at III… Satikathraya Sri Valmiki Ramayanam Utthara Kandam. 1987. 400 pgs. Unknown. Sanskrit. Dr B R Sastry. Satyaashhad'ha.. 1907. 1940. 1975. Sanskrit. 1933. Psychology. Sanskrit.

569 pgs. Unknown. Pandit Ramprasad Rajvaidy Patiyal. Shaiva Paribhaashha. 558 pgs.. 485 pgs.. Linguistics. Shabda Kalpadrum Part I I I. 1927. 1961. 945 pgs. 0. 0. 1946. 1961. Sanskrit. 1979. Unknown.. 344 pgs. . Pandith Madhusudhansharamamaithila. Sanskrit.. Unknown.. 818 pgs. 0. -. Shabd Kalpa Druma Chaturthi Kandam. Linguistics. Shabdakaustubhah Da~vitiiyo Bhaaga. Diiqs-ita Bhat't'o. 170 pgs.. Ramakanta Angiras. Philosophy. 524 pgs. Language. Unknown. 8798. Literature. Unknown.. Sanskrit. 438 pgs. Literature. Sanskrit.. Dr B R Shastry. 340 pgs. 1997. 1988. Bhat't'aachaara~ya Gadhaadara.. Religion. Sanskrit... Sanskrit. 1961. Vedas. Sharirkvigyanam Vol I. Linguistics.r. Shabda Kalpadrum Part I V.. 245 pgs. Unknown. .. Unknown. Philosophy. Shabdh Deepika... Tara~kalan'kaaraa Shriijagadiisha... Linguistics.. 265 pgs. Shabda Kalpadrum Part 5. 345 pgs. Sanskrit. Sanskrit.org/…/SanskritIIIT. Sanskrit. Unknown.. Language. 0. Sanskrit. Unknown. 592 pgs. Shabdakalpadruma Volume I. 1822. Shaan karapaadabhushhand ama Prathamo Shriiraghunaathasuri. Sanskrit. 116 pgs.. Sanskrit. -. Sanskrit.... Literature. Shanker Vedanta Ek Annusheelan. Shamakosh sabhayanuvadh. 0. Sanskrit. 340 pgs. Anandagiri. 1961. raja radha kanta deva.. 194 pgs.. Sir Raja Radha Kanth Dev Bahadur. Theology. 1934. 1822. Shabd Kalpa Druma Padama Kanda. Shatakatratama~ Bhaaga 9. Raja Radha Kanta Deva. Religion. 494 pgs. 244 pgs. Theology. Religion... Unknown. Linguistics. Shriibhara~trxhara Mahaakavii. 247 pgs. 1949. Psychology. 0... 278 pgs... Shabdhakapadrumaha Thruthiyakandaha. Sanskrit. 652 pgs. 519 pgs. Shabda Kaustubha Prathamo Bhaaga. Language. 147 pgs.. 557 pgs. Language. Sanskrit. Shabda Nirnaya Dipikahsampadanamu. 802 pgs. Literature. 2003. Sri Madhusudhan. 1950. Shabdhakapadrumaha Panchamakandaha. 1949. Sanskrit.. Sanskrit.. 1984. Sharushan-sar-patrika. 289 pgs.. 324 pgs.. Kantha Dev. Vyaasaachala. Sanskrit. Shang-karavijaya. Shankara Bhashya Sametha.. Raja Radha Kanta Deva. 573 pgs. Shadgadhara Samhitha. Sanskrit. 430 pgs... Sanskrit.. Shabdashattkiprakaashika. Literature. Unknown. Shambhohara Prakasha. 0. Theology.… 52/167 . Shang Dhara Samhata... Sanskrit. Shakttivaada. Sanskrit. Language.. Chara~yaa Shiva. Language. Psychology. Sanskrit. Shabdakalpadruma Volume V. . Babu Zalim Shing.. 1954. sanskritdocuments. Unknown. Sir Raja Radha Kanth Dev Bahadur. .. Prabhakara Prasad. Ramswaroop Sharma.. Shareerak Vignanamu Dwithiya Bagamu. 1951. Sanskrit. Raja Radhakanta Deva.. Sanskrit. 0..... Language. 1932.2/14/2011 A list ofBhaaga... Shadkar Vijay. mahidhara sharma. 1933. Linguistics. Kaatare Sadaashiva Laqs-midhaaraa.. Sanskrit. 294 pgs. Sanskrit.. scanned Sanskrit books at III… Philosophy.. 1909. -. Shabda Kalpadrum Dwithiya Bagam. Sanskrit. Sanskrit. Literature. Shastavakru Geeta. Theology.. Shaastratattvavinira~nd-aya.. Sanskrit. 0. . Religion. 790 pgs. Bhat't'ojiidiiqs-ita.. Literature. Linguistics. Sanskrit. Psychology.... Shabdhakapadrumaha Chaturthakanda. .. Unknown. Unknown.. 1929. Sanskrit... Unknown. Literature.

. Shraotasutrama Bhaaga 2. 1927. 608 pgs. Theology. 221 pgs. Vishwanath Shastri... Shiqs-aatrayama~. Unknown.. 404 pgs.. Sanskrit. Religion. 315 pgs.. 404 pgs.. Religion. Religion. Biography. History. Unknown.. Shatgidhara Samhitha. Unknown. 1927. Sanskrit. Sanskrit. 1893... Sanskrit. 52 pgs. Pandit Sreemathru Prasadha Pandeya. 1868. Aagesh Ithyupavedattatreyashastry. Religion.Brahmanam Part Ii. Sanskrit. Shiksha Patri. Shraota Suutran' Dditiiyo Bhaaga Grantha 53. Shraotasuutrama~ Panj-chamo Bhaaga. 1908. 0. Sri Vasudeva Brahma Bhagwat.. Theology. Sanskrit. Religion.madannatkrishnshastrikrut. 1940. Shraota Suutrama~ Shhashht'ho Bhaaga Grantha 53. Sanskrit. 893 pgs. 1909. Shri Ramacharanpurikruth. 909 pgs. Shishupalvandh.. Shivajataka.... 160 pgs. 1997. 1957. 1919. Religion. Sanskrit. Sanskrit. Krishna Kaura Mishra. 360 pgs. Religion.. Sanskrit. Vaasudevananda Pa Pa. Sanskrit. Sri. Bosa~ Phaniin'dranaatha~.. Unknown. Sanskrit... Shivaraj Vijay. 1939. Satyaashhaad'ha. Shri Hari Swami. Religion. 400 pgs.... 1928.. Religion. 360 pgs.. 0. Sanskrit. Shatashlokii Aavrxtti tiisarii. Joshii Shankara~naaraayand-a.. 200 pgs. Religion.. 225 pgs. 1940. Religion.… Shri Madbhagvadgeeta Vijay Chandra Varmanujya Unknown Sanskrit 0 340 pgs 53/167 . Theology. Shatpath Brahmanamu Part Iii. Theology. Sanskrit. Unknown. Sanskrit. 62 pgs.2/14/2011 A list of scanned Sanskrit books at III… 212 pgs.. 1935. 152 pgs. 936 pgs. Shraadhdamanj-jarii. Theology. Shriimachchhan'kaarachaara~ya. Sanskrit. Satyaashhaada... 209 pgs. Sanskrit. 1951. Aapat'e Hari Naaraayand-a. Shri Anka Kavya. Sanskrit.. Shraotasuutrama~ Panj-chamo Bhaaga. Unknown.. Satyaashhaad'ha.... Sri Guruprasad Shasrti. Satyaashhaad'ha. Srimathi Urmila Devi Sharma. Sanskrit. 816 pgs. Sanskrit. sanskritdocuments. Vedas. 310 pgs. Theology. Theology.... Shraotasutrama~ Prathama Bhaagah. Sri Narendraprasadji Maharaja Sri Ni. Unknown. 135 pgs. Religion. 317 pgs.. Vedas. Shivacharitra Pradiipika. Sanskrit. Sanskrit. Narayana Ram Acharya. 1982.. 1929.. Srimat Travibhashyakar Sayanacharya. 288 pgs. Shiva Samhita. History. Shraotasuutrama~ Ashht'ama Bhaaga. Social Sciences. Viiraa Raghu. Unknown.jetendriya Charya. 1928. Religion. Theology. 127 pgs... 1907.. Theology.. 1907. 254 pgs. 84 pgs. Religion. Sanskrit. 1847. Unknown. Satyaashhad'ha. Shivacharitra Saahitya Khan'da 3 Ra. Sanskrit.. 1854..... Unknown. P. Sanskrit. 337 pgs. 1908.. Shatpath Brahmanam Part V. 302 pgs. Shrautapadarthanirvachanam... Shatpath .. Shatpath Brahman.. 1940. Geography. Shatbhushni Vol-1.org/…/SanskritIIIT. Shatapatha Braahmand-ama~ Dditiiyo Bhaaga. Theology. Sanskrit. Satyaashhad'ha. Theology. Satyaashhaada. 105 pgs. 1972. Geography. Sanskrit.. Theology. Satyaashhaad'ha. Satyaashhaad'ha. Shrimat Trayibhashyakar Sayanacharya. Shraotasutrama~ Chatura~tho Bhaaga. 0.. Aapaat'e Da Vii.. 0... Shradhamanjari. Theology. 438 pgs.. Biography. Shatpath Brahmanam. Shraotasuutrama~ Saptamabhaaga. Sanskrit. Theology... 1930. Shilpa Shaastrama~. Sanskrit. 1927. Unknown. 168 pgs. Sanskrit. Unknown. Sanskrit.

Sanskrit. 612 pgs.. Literature. Aapat'e Vinayaka Gand-esha. Sanskrit. Sanskrit. Literature. 326 pgs. Sanskrit. Chaara~yand-a Shrii Krxshhnd-a Priyaa. Sanskrit... Shrii Madaara~yabhat'iiyama~. 50 pgs. Philosophy. Sanskrit. 1644. Shriishang-khadhara. 458 pgs.. Theology. Linguistics. Sanskrit. Unknown. Shrii Panj-charaatran. Goswami Tulasidas. Shrii Alang-kaarakaustubha Da~vitiiyo Bhaaga.. 1927. 0.. Maarulakara Shan'kara Shaastri.2/14/2011 A list of scanned Sanskrit books at III… Shri Madbhagvadgeeta.. 808 pgs. Sanskrit... Shrii Lat'akamelakama Trxtiiyo Bhaaga. Sanskrit. Shriibhaasa Mahaakavi. Shrii Paribhaashhendushekhara. Social Sciences. Linguistics.. 112 pgs. Religion. Psychology. Shri Pacchadashi Pitambhari Bhashya. 1923.. Social Sciences. Sri Narayana Charya. 1947. Unknown. 1934. 357 pgs. Shrii Dayaananda Mahaavidhaalaya Vol 25. 373 pgs. Linguistics. Aapat'e Hari Naaraayand-a.. Shriimanniilakand-t'haa... Shrii Sang-gameshvarakrod'ama~. Sang-gameshvarashaastrii Gummaluurii. Theology. Shrii Dara~shanodaya. 161 pgs. Shrii Giitaamrxtataran'gind-ii.… 54/167 . 1903.. Shri Vidrananya Muni. 1922. Sanskrit. Sanskrit. Shrii Aashchara~yachud'aamand-i. Sanskrit. Sanskrit. Paramadiishvaraa.. Philosophy. 517 pgs. Sanskrit.. Unknown.. 0.. Mahaakavii Shriishaktiibhadraa... Social Sciences. Shrii Manmahaabhaartama~ Shhashht'hobhaaga Anushhsanapara~va. 1933. Theology. Shrii Gautamamuniiprand-iitanyayasutrani. 82 pgs.. Shrii Bhaashyama~ Da~vitiiyo Bhaago Vivrxtyaatmaka.. Sanskrit. Linguistics. 167 pgs. 1918.. Shriddisarah. Bhat't'a Shriinaagesha. Shaastri Mukundaraama. 384 pgs. Philosophy. Theology. 378 pgs. Shriimadramaanujaachara~yaa.. Philosophy. Shri Manmahabharathamu Vol 3. Sanskrit. Language. -. 340 pgs. Literature. 1933.. Kara~nd-apura Kavii. 473 pgs. Vishvabandhu Shaastrind-a. Shriinivaasaachaara~ya Laqs-miipuran. 1932... Religion. Sanskrit. Language.. Language. Psychology. 611 pgs. Literature.. Sanskrit. 131 pgs... Psychology.. Literature. Linguistics.. Shriihariishaastrii Pand-d'itavara. Language. 642 pgs.. 239 pgs. 2001. Mumbayyaan. Linguistics. Sanskrit. Sanskrit. 1237 pgs. Religion. Theology. Shri Ram Charit Manas. Religion.org/…/SanskritIIIT. Natural Sciences. 1978. 1951.. 1916. Psychology. Unknown. Sanskrit. 1958.. 294 pgs. Shrii Chitraprabhaa. Gautamamunii. Literature. Language.. 1933. Shrii Ashht'adashasmrxtayaa. 1851. Sanskrit.. Shrii Paraatrin'shikaa Grantha 18. Unknown. Language.. Shrii Mada~ddaipaayanaprand-iita Brahmasuutraand-i Grantha 21. 1933. Sanskrit 1933 89 pgs sanskritdocuments. 1917. Religion... Shrii Madabhgavadagiitaa Grantha 44. Vijay Chandra Varmanujya. Theology. Sanskrit. Raghunaathaprasaada~ Pand-d'ita~. 1846.. Shri Raghavendra Vijayah. Sanskrit.. Sanskrit. Jayakrishna Misra.... 219 pgs. Shrii Puraand-a San'hitaa Grantha 89. 278 pgs. Shrii Madabhagavadagiitaayaa Prathama Dditiiyaadhyaayau.. 680 pgs. 1874. 1938... Religion... Literature.

. Sanskrit. Sanskrit. 330 pgs... Shriimanmadhvaachaara~yaa. Theology. 288 pgs. Shriimadabhagavadagiitaa Grantha 64.. Theology. 1943. Sanskrit. Shrii Madabhinavaguptachaara~ya. 1954. Abhinavaguptaa.. 219 pgs. Theology. 1933. 1933. Shriigand-eshaathara~vashiira~ra~shha Sabhaashhyama~. Sanskrit. Religion. 344 pgs. 291 pgs.. 1939.. Shriimadabhagavadagiitaa Dditiiya Khand-d'a Grantha 34. Sanskrit. Religion. Sanskrit. Theology. 348 pgs. Theology. Theology.. Religion. Psychology.. Shriishriivallabhaachaara~yaa. 619 pgs.. Religion. Shriimatsaayand-aachaara~yaa.. Religion. Qs-emaraaja. 326 pgs.. Shrii Sara~vadara~shanasan'graha. Religion.. Sanskrit. Philosophy. Shriimadabhagavadagiitaa Grantha 112. Theology. sanskritdocuments. 1948. Chaara~ya Madraamaanujaa.. 1927. Religion. Geography.. Shriimadagand-eshagiitaa Grantha 52. 168 pgs.. Sanskrit. 215 pgs. Taad'apatriikara Shriinivaasa Naaraayand-a. Theology. 1945. Natural Sciences. Sanskrit.. Philosophy. Shaastri Kaashiinaatha.. Religion. Shriimadand-ubhaashhyama~ Faskiikyulasa~ 9.org/…/SanskritIIIT. Raamaanujaachaara~yaa Shrii. Religion. Theology. Shriimatsaayand-aachaara~ya.. Psychology. Religion. Shriigurucharitama~ Da~visaahastrii. Sanskrit. Shriimadaachaara~yadand-d'i. Shriikrxshhnd-ayajura~vediiyataittiriyasan'hitaa Ashht'am Bhaagah. Religion. Shriivaasudevaanandasarasvatii Pa Pa. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… Sanskrit. Sanskrit. Theology.… Shriimadand-ubhaashhyama~ Faskiikyuulasa~ 8 Shriishriivallabhaachara~yaa Philosophy 55/167 . Theology.. Shriimadand-ubhaashhyama Faskiikyulasa~ 8. Theology. Shrii Vedaara~thasan'graha.. 761 pgs. 1924. 94 pgs. Sanskrit. 1930. Theology. Psychology. Shriikhachchhandatantrama~ Panj-chamo Bhaaga Grantha 53. Shriishriivallabhaachaara~yaa. Religion. Philosophy. Sanskrit. Kaula Madhusuudana. Sanskrit. Religion.. Shrii Tantraaloka Bhaaga 7. Vallabhaachaara~yaa Shriishrii. Shrii Shaakttivaadah. 215 pgs. Qs-emaraaja. Sanskrit. Sanskrit. Theology.. Biography. 1906. Religion. Theology. Sanskrit. 110 pgs. 1929.. Shrii Svachchhandatantrama~ Grantha 31. Qs-emaraaja. Psychology. 1951.. 393 pgs. 1924.. Sanskrit. 42 pgs.. Shriikrxshhnd-ayajura~vediiyataittiriyasan'hitaa Trxtiiyo Bhaagah. 1927.. Shriimadabhagavadagiitaa Grantha 92. 1906. Sanskrit. 1921. Kand-t'ha Raajaanakaraama. Sanskrit. 1921... Shrii Tantraaloka Shhashht'ho Bhaaga... Shriikrxshhnd-ayajuravediiyataittiriiyasan'hitaa Panj-chamakaand-d'arupa Saptamo Bhaaga. Shriimadand-ubhaashhyama~ Faskiikyulasa~ 13.. History. 1924... 1906.. Shrii Svachchhaandatantrama~ Grantha 52.... 1947. 264 pgs. 1919. Religion.. Religion. Bhat't'aachaara~ya Gadaaghara. 112 pgs. 299 pgs. 89 pgs. Shriimadaachaara~yadand-d'ivirachita Kaavyaadara~sha. Philosophy. Religion. 111 pgs... 1952. Shriimatsaayand-aachaara~yaa. 297 pgs. Theology. Vaamanashaastrii Pand-d'ita.. 443 pgs. Shrii Svachchhandatantrama~ Chatura~tha Bhaaga Grantha 47. 374 pgs. Niilakand-t'ha. Sanskrit.. Theology. 1923. Sanskrit..

Biography.. Religion.. 1936. Aapat'e Hari Naaraayand-a. Sanskrit. Shriishriivallabhaachaara~yaa. Psychology. 395 pgs. Philosophy. Sanskrit. 700 pgs.. Shriishriivallabhaachaara~yaa. Theology... Sanskrit. Religion. Philosophy.. Shriimada~vallabhaachaara~yaa.. 1905. Sanskrit. 110 pgs. Sanskrit. 297 pgs. Literature.. 1935.. Shriishriivallabhaachara yaa.. Shriishriivallabhaachaara~yaa. 1906. 1906. Philosophy. Psychology... Philosophy. 350 pgs. 1953. Theology. 1875... Shriimanmahaabhaaratama~ Prathamo Bhaaga. Religion. 212 pgs. Shriimadand-ubhaashhyama~ Faskikyulasa~ 6. Theology. Sanskrit.. Sanskrit.. Language..org/…/SanskritIIIT.. Shriiraamaayand-ama~ Prathama Khand-d'a Baalakaand-d'ama~. 102 pgs. Shriiqs-emaraaja. Psychology.. sanskritdocuments. Shriisvachchhandatantrama~. Shaastrii Pi Pi Subrahmand-ya.. 1905.. 165 pgs.. Sanskrit. Social Sciences. Sanskrit. Linguistics. Religion. Paand-d'eyena Raamateja. 110 pgs.. Shriisvachchhandatantrama~ Dditiiyo Bhaaga Grantha 38. 639 pgs. Philosophy. 1930. Shriimatsaayand-aachaara~yaa. Shriimadand-ubhaashhyama~ Faskikyulasa~ 12.. 110 pgs. 112 pgs. Theology. Philosophy. History.. Theology. Aapat'e Vinaayaka Gand-esha. Shriimadand-ubhashhyama~ Da~tiiyo Bhaaga Baalabodhinii.2/14/2011 A list of scanned Sanskrit books at III… Shriimadand ubhaashhyama Faskiikyuulasa 8. Vaad'hdivasa. Shriishan'karabhagavatpaadaachaara~yaa. 1926. Shriishivabhaarata. Shriishivabhaarayama~. 1849. Upaadhyaaya Shrii Baladeva. 483 pgs. Geography. Sanskrit. Religion. Theology. 1933. 1953. Shriimadbhagavadgiitaabhaashhyaara~tha. Shriimadand-ubhaashhyama~ faskikyulasa~ 4. Baapat'ashaastrii Vishhnd-uvaamana. 324 pgs. Sanskrit. Shriimadand-ubhaashhyama~ Faskikyulasa~ 10. Religion. 110 pgs. Psychology. Literature.. Shriivaalmiikimahaamuni Aadikavi. 1906.. 1906. Theology. Philosophy.. Qs-emaraaja. 626 pgs. 1952. Vallabhaachaara~yaa Shriishrii.. 1906.. Theology. Shriishang-karaachara~yaa. Sanskrit.. Psychology. Psychology. Theology. Shriimadgand-oshagiita. Sanskrit. Religion. Sanskrit. 1939. Vallabhaachaara~yaa Shriishrii. Sanskrit.… Sh ii h hh d t t G th 31 A h M h h h R li i Th l 56/167 . 1923. Shriimadbhagavadagiitaa Trxtiiye Khand-d'a Grantha 34. Shriimadbhagavadadgiitaa. 112 pgs. Language. 1963. Psychology.. 110 pgs. Sanskrit.. Sanskrit. Paramaananda Kaviindra. 1906. Govindaachaara~ya. 1921. 138 pgs.. Linguistics. Religion.. Sanskrit. Religion.. 851 pgs. Shriishriivallabhaachaara~ya. Philosophy. 874 pgs. Kalanda~ Viillemena~... Theology. Shriisayaajiigauravagran'tha. Psychology. Philosophy. Theology. Shriisvachchhandatantrama~ Bhaaga 5. Sanskrit.. Shriipurshhasukttama~.. Theology. Psychology. Shriishuklayajura~vede Shatapathabraahmand-ama~ Bhaaga 2. 377 pgs. Shriimadand-ubhaashhyama~ faskikyulasa~ 5.. Shriipaarameshrvarasan'hitaa. Sanskrit. Religion. Shriimadand-ubhaashhyama~ Faskikyulasa~ 14.. Religion... Sanskrit. Paramaananda. Sanskrit... Religion. 1931.. Shriimaddevii Bhaagavatama~ Mahaapuraand-ama~. Qs-emaraaja~. 1933. 29 pgs.. 1926. Sanskrit.. Sanskrit. 1368 pgs.. Sanskrit. 517 pgs.

. Religion. Theology. Sanskrit. Philosophy..… Shukla Yajura~vediiya Kaand-va San'hitaa Saantabalekara Vasantashriipaada Religion Theology 57/167 . Shriramanageetha. Philosophy... Sanskrit. Unknown. Theology. 232 pgs.. 1946. 111 pgs. 1938. 1927. 1975. Ant'ona~fuha~rera~.. Sanskrit. 1940. Theology. Sanskrit. Jeevanrama Lallurama. Biography. Sanskrit. Shriman Mahabharatam Part 4 7 Dronaparvan. Shriitantralokah Panj-chamo Bhaaga. Shubh Santhathi Yogaprakasha.. Geography. Philosophy... Unknown. Gupta Abhinava. Shrxn'gaaraa Prakaasha Prathamo Bhaaga Grantha 1. 304 pgs.. 1912.... Sanskrit. 1930. Religion. 1922. sanskritdocuments.. Sanskrit. Shrutikalpalata. 1922... Religion. Niranjananda Swamy. Theology. 287 pgs. 1956. Shriitantraalokah Shhashht'ho Bhaaga. 262 pgs.. 78 pgs. Shriitantraalokah Chatura~tho Bhaaga. Theology. Raaghavana Vi. 301 pgs. Sanskrit. Religion. 93 pgs. Shrii Mumbayyaam.. Religion.. Theology. Sanskrit. 370 pgs. Religion... 1926. Shastri.. Unknown. Shriitantraaloka Navamo Bhaaga. Sanskrit. Theology. 1926. Shriisvachchhandatantrama~ Grantha 48. Theology. Shriisvachchhandatantrama~ Shhashht'ho Bhaaga. Aachara~ya Maaheshvaraa. Shriitantraloka Dvadasho Bhaaga... Chaara~ya Madaabhinava. 1921. Shriitantralokah Navamo Bhaaga..... Gupta Abhinava. Religion. 1921. Gupta Abhinava. Sanskrit. Sanskrit.. 93 pgs. Unknown. Shrimad Bhagvad Geeta. Aloiisa~ Ant'ona~ fuha~rera~. Literature. Shriivaasishht'hadhara~mashaastrama~. Sanskrit... Sanskrit. Sanskrit. 287 pgs... Religion. 262 pgs.. 282 pgs. Shriiraamabhadradiiqs-itaa. 1922. Sanskrit. Religion. Unknown. 1938. Sanskrit. 844 pgs.. Shriitantraloka Saptamo Bhaaga.. 185 pgs.. Religion. Dr Abhaya Nath Mishra.. Gupta Abhinava. Shriivaasishht'adhara~mashaastrama~. Abhinavaaguptaa. Srimadvaman Pandith Virchita. Shriitantraaloka Ashht'amo Bhaaga Grantha 47. Religion. 1921. Sanskrit.. Shriitantraalokah Ashht'amo Bhaaga. Aachara~ya Mahaamaaheshvara. Chara~yaa Tot'akaa.. 1926. Shrotriyas Of Mithila.. 548 pgs. 1935. Gupta Abhinava.. 1910. 237 pgs. 300 pgs. 594 pgs. 177 pgs. Sanskrit. Gupta Abhinava. Sanskrit.. 1924.. K. Sanskrit. Shriitantraalokah Bhaaga 2. Sanskrit. 342 pgs. Shriisvachchhandatantrama~ Trxtiiyo Bhaaga Grantha 44.. Religion.. Pandit Ramachandra Shastri Kinjawadekar. 1936.. Religion. Sanskrit. Sanskrit.... 161 pgs. 1931. 1930. 321 pgs. Shukasaptati. Sanskrit. Theology. Mulkaraj Sharma.. 2001. 340 pgs. 1922. Theology. Theology.. Religion.. 280 pgs.. 351 pgs. Gupta Abhinava. Sanskrit. Unknown. Sanskrit. Theology. Shrutisaarasamuddharand-ama~. Qs-emaaraaja Shrii. Sanskrit. Theology. Religion.org/…/SanskritIIIT. 1930. Gupta Abhinava. 1936. Psychology. Shriitantraaloka Chatura~tha Bhaaga. Sanskrit. Shrimad Bhagawatam. 290 pgs. Shriitantraaloka. Guptaa Abhinava.. 1984. Aachara~ya Maaheshvara. 279 pgs. Language. Theology.2/14/2011 A list of scanned Sanskrit books at III… Shriisvachchhandatantrama~ Grantha 31.. Shrxng-gaaratilakama~ Da~vitiiya Vrxtti. Theology. 105 pgs. Linguistics. Religion. Ram Prasad. History. Theology. Religion.. Religion.. Theology. Theology.

434 pgs. . Unknown. 235 pgs. 1937.. Anantha Charya. 0. 249 pgs.. Sri Anantaviryacharya. Sanskrit. Philosophy. Diqs-ita Appayya. 474 pgs. 416 pgs. Sanskrit. Siddanta Muktavali Dinakari Ramarudra.. Theology. 1916. 932 pgs.. Philosophy. 1937. 1938. 1991. Unknown. 690 pgs.. Language. Siddantakaumadyam.2/14/2011 A list of scanned Sanskrit books at III… Shukla Yajura vediiya Kaand va San hitaa..… 58/167 . . M. 96 pgs. Unknown... 404 pgs. 1949. Philosophy. 112 pgs. Shulkayaju Praatishaakhyama~ Dditiiya San'skarand-a. sanskritdocuments. Bhat't'aachaara~yaa Jiivaananda Vidhaasaagara. Pan'chaananabhat't'aachaara~ya Shriivishvanaatha. Siddanta Siromani Of Bhaskaracharya. Unknown. Sanskrit.kesavarao Musalgaonkara.bhatt. 1962... 1960. 2002. 40 pgs. Sanskrit. 1219 pgs. Religion... Diiqs-ita Shriibhat't'oji. 1916.5.. Sanskrit. Siddantha Sidda Gnanam.. Sanskrit. Sanskrit. Religion.. Language. Siddhanta Rahasyam. 360 pgs.. Sidhdaantamuktaavalii. 0. Dr D Arkasomayaji. Yudishtara Mimamsak. 1929. 0..h.. Unknown. Linguistics. Siddhaantalesha San'graha Bhaaga 2. 1990. Sanskrit. 317 pgs. 1929. Philosophy. Sanskrit. Sanskrit. Literature. 942 pgs.. 1921. M. 1877. Siksha Sutrani.. Siddhanta Kaumudi. 215 pgs... Philosophy. Unknown.venkata Rao. Shukla Ysjuhu Shskeysksrams kanda Pradeepa. Vedanta. Sanskrit. 1862. Linguistics.. History.. Sanskrit. 155 pgs.. Sanskrit.. Sindhi Jaina Granthamala.. 1005 pgs....... Geography. Indian Astrology. Theology. Shukraachaara~yaa Shriimada~... -... Sibrasutra Nrubhatrayam. 1997. Philosophy. 1499 pgs. Shvetashvataropanishad. kumudranjan ray.. Bhat't'oji Diksita. T. Sanskrit. Siddhivinishchayatika.. Sanskrit. Sri Chandiprasadshuklashastrina. Sanskrit.. 142 pgs. Sri Ramasram..sri Sudhakara Dvivedi.s. 235 pgs. Jagannatha Shastri. Diiqs-ita Bhat't'o. 234 pgs.. Siddhanta Kaumudi Vol 3 Part 1. Siddhaanta Kaumudii Trxtiiyo Bhaaga Grantha Maalaa 136. Shukraniiti. Sri Vallabhacharya. Language.g. Pt. 134 pgs. Chandra Sekhara. 142 pgs. Biography. 325 pgs. Jagannatha Shastri. 1925. wasudev laxman sastri pansikar.. Sanskrit. 1906. Sanskrit. Sanskrit. Language. Linguistics. Saantabalekara Vasantashriipaada. Linguistics. Literature . 1942... Literature... 534 pgs. 580 pgs.. 130 pgs. Sanskrit. 565 pgs. 1998.. 1910. Siddhanth Kaumudhi. Sinjiniyam... G. Siddhanta Siddhanjana. Linguistics.. Unknown.. Sanskrit. Sanskrit. Literature.. Unknown. 2002. Siddanta Chandrika. Sanskrit. 0. Unknown. Sidhanthkalpavalli.. Sanskrit. Sanskrit. Sanskrit. Language. Sanskrit Grammer.. Bahadur Simhaji Sindi. A C Subbukrishna Srowthy. 1959. Sidghnithryam.. Sanskrit. Sanskrit. Sanskrit. Msk Shasthri.. Siddhanta Kaumudi Or Bhattoji Dikshit S Vritti On Paninis Vyakarana Sutras. Sisupalavadham. 1980... . Siddhanta Kaumudii Bhaaga 2. 166 pgs.shastri. Siddhitrayi And Prthyabhijna Karika Vritti. Technology. 0. Siddhanta Tatva Viveka Of Sri Kamalakara Bhatta.org/…/SanskritIIIT.. Literature. . Literature. Psychology. 1893. Dr. Unknown.. Siddhaantakaumudii. Sanskrit. Sanskrit. 679 pgs.

Smruthi Chandrika. Bhat't'aa Devaanaa. 232 pgs.. Sanskrit. 1962. Religion...k.g. Sanskrit. 301 pgs. devana bhatta. 0. 334 pgs. Sanskrit. Theology.. Bhat't'aa Devand-a.padhya. Smrxti Sandara~bha Trxtiiyo Bhaaga. D. Sanskrit.. 410 pgs. Sanskrit... Sanskrit.. Smrxti Chandrikaa Prathama Bhaaga.org/…/SanskritIIIT. Social Sciences. 1921. Religion. Srimadananda Theertha. 170 pgs. 1918. 1918... Unknown. Sanskrit... Literature. Smritichandrika. L. Skanda Purana Part Ii. Sivadvaita Nirnaya. 478 pgs. Sanskrit. Sanskrit.. 1875.. Language. 179 pgs.. Gand-apatin' Naathaadigurutrayan... Sanskrit... Art.. Religion. 661 pgs. Sanskrit.. 1965.. Hari Narayana. 437 pgs.. Skanda Puranam Brahma Khanda. Philosophy. . Sanskrit. A Ramachandra Ratnaparakhi.. Philosophy. 1966. 375 pgs. Skanda Purana Volume 1 Index.. krishna Das. Language. 1914.. Unknown. 1912. Language. Unknown.. Theology. Skanda Mahapuranam Vaishnava Khanda. 1929. Sitaramaviharakavyam Of Orient Laksmanadhvari. Sanskrit. Unknown.. 1952.2/14/2011 A list of scanned Sanskrit books at III… Sita Ravana Samvada Jhare... Sanskrit. 1959. 328 pgs. Linguistics.. Theology. Theology. 1916. 480 pgs. Literature. Skanda Mahapuranam Nagara Kanda. Philosophy. L. Sanskrit. Sanskrit. Smrxtyara~thasaara Grantha 70. 944 pgs. Pandith Sri Ramchandra Jha. Nag Sharan Singh. Unknown. Somraj Krishna Das. Religion.. Theology. 1978. Sreenivasacharya. Narasimhachar. Sreenivasacharya. 102 pgs. Linguistics.. 0. 262 pgs.. 787 pgs. Bhat't'a Devand-a. 1965. devana bhatta.k. 474 pgs.. 412 pgs. 1905. Smrutyartha Sagara..… 59/167 ... Bhat't'aa Devaanaa. Language. Sanskrit.. Literature. Smrxti Chandrikaa Shraaddha Kaand-d'a. Smritichandrika. Sanskrit. Smrityartha Sarah.. Religion. Skanda Purana Avantya Kanda Vol7.. 1914.. L. Smritichandrika Iii Vyavahara Kanda Part I. Smrxti Chandrikaa Khand-d'a 3 Dditiiyaa Bhaaga. 144 pgs. Dharaachaara~ya. 1914. . sanskritdocuments. . Theology.. Sanskrit. 1916. . 502 pgs. Sanskrit. 1914. 0. 1982. 336 pgs. Sanskrit. Skanda Purana Kasi Kanda. Smritichandrika Ahnika Kanda. Theology. Smrxtichandrikaa Samskaarakaand-d'ah Prathamah.... 673 pgs.. 379 pgs. Philosophy. Sanskrit.. Linguistics. Skanda Mahapuranam Vol Iii. Religion.. 1916. 156 pgs. Sanskrit. 1966.. Sanskrit. Smrxtiinaan' Samychchaya Grantha 48.. Devana Bhatta. 486 pgs. Bhat't'opaadyayaa Shriiyaajnikadevand-a~. Somraj Krishna Das. 198 pgs. 1914.. . Literature..srinivasacharya. 1949.. Linguistics. Skanda Purana. Smritichandrika Part Ii. 1899. Smriti Chandrika Sraddhakanda. Unknown. A B L Awasthi. 252 pgs. Sanskrit. Religion... 0. 423 pgs. Sanskrit. .. 122 pgs. . Sanskrit. krishna Das. R. 1912. 119 pgs. Religion. Unknown.. Sanskrit. Sotara Siddhanth Kaumudi Prayogsoochi Vol Iii. Sanskrit.. . Appayya Diksita. 470 pgs. Unknown. Smavadamala. Sanskrit. Sanskrit... Smrxti Chandrikaa. Aapat'e Hari Naaraayand-a. ..

. Unknown. 374 pgs. 166 pgs. Spota Darsana. . sanskritdocuments... A Ramulu. Sri Bajothsav Chandrika. 126 pgs. Sanskrit. Sri Ath Madhvanidaanvishayanukramnika. Sphotavada Of Nagesa Bhatta. Sanskrit.. Madhusudanacharya. Raghunatha Patak. Sanskrit.. 110 pgs. g somayaji. -. Sphutartha Abhidarmakovyakhya. Sanskrit. 270 pgs. Language. 258 pgs. Srauta Prayascitta Vidhi. 1887. 0. Sanskrit. 341 pgs.. 1065 pgs. Sri Ramachandra Jha. Sanskrit. 701 pgs.. Sanskrit.. Sril Narayan Bhattagoswami.. Ramdin. 1992. Unknown. 46 pgs. Sri Bashya Vimarsana Pariksha. 1919. Sanskrit Mimansa. 1989.. 163 pgs.. Sri Ascharyachudamani. 0. Madhusudan Kaul. . Sri Bashya Vartikam. Unknown. Sree Lakshminarayan Samhitha.. Sanskrit. Linguistics Literature.. 0. 416 pgs. Southara Prasnavali.. Sri Krishna Das. 0. 1917. Sraddha Marthandam. Sanskrit. .. Mahamahopadhyaya Pandit Mukunda Rama Shastri. Language. V Krishnamacharya. Sanskrit. ... 1927. Naageshabhat't'a. Sanskrit. pgs. 392 pgs. Sri Bashya Vimarsana Pariksha. Linguistics Literature. Sree Subhodhini. Sanskrit. Vallabhacharya. Sanskrit.. Psychology.. Unknown. 490 pgs... Sree Mrgendra Tantram... 136 pgs. S Levi. Sanskrit.. Language. 40 pgs.. Literature. Swamy Sri Krishnavallabha Charya. 1927. Sanskrit. Unknown..org/…/SanskritIIIT.. 598 pgs. Sanskrit. Sanskrit. Sanskrit. 1997. 580 pgs. 1933. 188 pgs. 1956. Mishra Aachara~ya Mand-d'ana.. Literature. 220 pgs. 1956. Sanskrit. Unknown.. Unknown.. 1956... Unknown. Sanskrit.. 0.. Sanskrit. -. 110 pgs. 439 pgs. 682 pgs. 0. Unknown. Unknown. Sri Sundaracharya. Sanskrit. 0. Sr Madradbagavathgeetha.. 0. Soundarnand Mahakavy. Sphot'avaada. Unknown. Sri Acaranga Sutram Part3. 1907.. Linguistics. Sanskrit.... 46 pgs. 0. Sanskrit. Linguistics. Unknown.. Sanskrit. Unknown. Sanskrit. 225 pgs. Unknown. Ramayanam. 0.. Soundarya Lahari. Sanskrit.. 1946. Unknown.. Govindacharya. Sotthara Prashnavali Vol I.. 0.... 0... Sri Ramachandr Jha. 1949. Sradha Martanda.. Linguistics Literature. Unknown. 0. 130 pgs. Krishna Datta Shastrin. Southara Pradhama Prasnavali. Sphotavada. Vedanta. Sanskrit. 244 pgs.. Sree Skande Mahapurane Panchama Avanthyakhandye. 1948. Pandith Sri Ramchandra Jha. 108 pgs. Krishnananda Natha. Sanskrit.. Sri Bashyam. Sramana Bhagavan Mahavira Vol 1 Part 1. 1931. Sanskrit. Sri Anubhashyam.. Unknown. 1952. Sri Bashya Vimarsana Pariksha.. 142 pgs.. 158 pgs. 1946. Literature...... Krishnamacharya. Sanskrit. 1927. 194 pgs. Muni Ratna Prabha Vijaya.… 60/167 . S Kuppuswami Sastri. 1946... Sphot'asiddhi Grantha 6. Unknown. Unknown. Literature. Sanskrit. Spanda Sandoha Of Kshemaraja..2/14/2011 A list of scanned Sanskrit books at III… Sothara Prashnavali Dwithiya Kandamu. Sradda Viveka. Unknown... 234 pgs. 372 pgs. Unknown. Sakthism. Sri Bagavathgeetha. . 214 pgs. Sanskrit. Sanskrit. Unknown. Unknown. Sree Madbhagavathgeetha. Swamy Vishnu Thirdha. Sanskrit. 0... V.. Linguistics.. Philosophy.. . 1930.

536 pgs. 1955.. Sri Harithsanhita. Unknown. Sanskrit.. Sri Datta Puranamu. 268 pgs.. Sanskrit. Unknown.. Unknown.. Sanskrit.. 1935. 624 pgs. 616 pgs. Sri Gurucharitam Vol 2.ananthacharya. Unknown. 2000. 1935. 0.. Sri Dommraj Narsinghraj. Unknown. Sri Brahnidhanturatnakar Vol Iv. Swami Jagadisvarananda. 312 pgs... Vasudeva Vidyabhushan. Sri Chaitanayalilamratsar.. Sanskrit. 0. Unknown. 1966... Unknown. 473 pgs. 1240 pgs.. 1938. Khem Raj Krishna das.. Sanskrit. 70 pgs.. 2000.. Sri Gurusanhita. Badhiri Das. Sri Ramanuja.. Acharya V R. Sanskrit.. 243 pgs. Sri Durga Saptasati. Biography. Sri Ranga Ramanuja Charya. 1917. Sanskrit.. 1958.. Sanskrit. History. Unknown. Sanskrit. 1962. M. Sanskrit. Bhavamisra.. Unknown..ananthchary. Sri Vasudeva Nandasaraswathi Tembeswami.. 1953.. 252 pgs... Pandith Sri Sudama Mishra. Sri Mahadev. Unknown. Philosophy. Sanskrit.. Sri Bhasya Sariraka Mimamsa Bhasya Vol I.. 694 pgs. Sri Brahma Sutriya Vedanta Vrtti.. 1954... Sri Bhava Prakasa. 0. Literature. 1950. 1954. Unknown. Theology. Sri Bhasya Vol I.. Sri Vasudevanandsarawathiswamikrutha. Sanskrit. Sri Brahtstotraratnakar.. 1938. Unknown. Shes Raj Sharma. Sri Bhrthurisubhashitam Vairagya Shatak. Grammer. sribhavamisra. 1939. 588 pgs. Unknown. Unknown. 1941. Sanskrit.... 1960. 506 pgs. 1910.. -. 154 pgs.. Sanskrit.… 61/167 .. Unknown. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Sri Bashyam. Pandith Jwala Prasadji Mishra.. 128 pgs. Sanskrit. Sanskrit. Sanskrit. Sanskrit. . Sri Jathi Bhaskar. Sri Brajotsava Chandrika.ityanen. Pandith Duttram. Sanskrit.. 1867. Sanskrit.. 1954. Religion. 242 pgs. Pandith Sri Kankalalasharma Thakur.. 202 pgs. 1993. Chakravarthy Acharya Swamy U V P M. Unknown. Sanskrit. 1970. Sanskrit. 569 pgs. Khem Raj Krishnadas .. 362 pgs. Sri Bhavaprakasa Of Bhavamisra. Unknown.. Sri Gurugovind Singh Bhagvat Padh Jeevnetivratham. Sanskrit. Sri Hikmath Prakasha. Sanskrit... 1237 pgs. 886 pgs.org/…/SanskritIIIT. 334 pgs.. sanskritdocuments.. Sri Devi Poojakalp. Linguistics Literature. Srivasudevanandsaraswathikruthm. Sanskrit.. 22 pgs.. 1947. 532 pgs. Sanskrit. . Sri Jayapura Raja Vamsyavali. Sri Bhattikavyam.. 1943.. V.. Sanskrit. 228 pgs.. Srikanth Sharma. Sri Geethardha Prabodh. 538 pgs. 408 pgs.. Sri Bhasya Or Bhramasutrabhasya Vol 3. Unknown. Sanskrit. Sri Devipuja Kalpa. Sri Geetha Jnanmarg. Sanskrit. Language. Venkat Rao Raysam. Sanskrit. 0. 0.. Geography.ranganadhacharya. . 580 pgs.. 128 pgs. Unknown. Sri Yashodanandanayen. Linguistics Literature.. Sanskrit. 569 pgs.. 1942. Sri Fakkikartanmanjusha Vol I. Sri Bhagavata Dashamaskandha part... Ramanatha Nanda Sarma.. Sri Daandeepika. 504 pgs. Narayana Bhatta Goswamy. Sri Bhavishya Mahapurana. Sri Bhasya Or Brahmasutrabhasya Vol Ii. Sri Bhasya Mahapuranam. Philosophy. 1930. Swami Sri Raghuvaracharya. Unknown.. 1953.. 290 pgs. Unknown.. Somraj Krishna Das. Sri Brahmasutrani. Unknown. Sanskrit. Linguistics. 294 pgs. Pandit V. Unknown.

784 pgs.. Unknown.I V. Sanskrit. Sri Ramanujbhasyen. Unknown.... Unknown. 854 pgs.. Sri Madhevibhagavatam Mahapuranam. Unknown.. . Swami Vireshwarananda. Sanskrit. 422 pgs. Linguistics. Unknown. . -... Chintamani Gangadhar Bhanu. Jona Raja.. 0. Sanskrit... 1985.. 246 pgs. Unknown. 1957. 466 pgs.. 0. 0. Language. Sanskrit. 393 pgs.. Literature.. Language. 1957. 1985.. . Sri Krishna Janmaskanda. 1971. 0. Literature. Unknown... 1976.... 0. 283 pgs.. Sri Madbhagavadgita Gitarthasangraha Of Abhinava Gupta.. Sri Madbagavath Sridaritika. Linguistics. Sanskrit. 1956. Sanskrit. Sri Madhandra Maha Bhagawatakathah.raghunathacharya. Sanskrit... Theology. Sanskrit. Sri Laghu Bhasyam. Sanskrit. Dr. 1956.. Sri Mad Bhagavad Gita. 362 pgs. Sri Laghu Bhasyamu.. 0.s. 1921. Sanskrit.. Sri Madbhagavatam Pradama To Dvadasakandaha Full With Sanskrit. Sanskrit. Swami Srikrsnavalla Bhacarya Shastri. 0. 0. 262 pgs. 0. Sanskrit. Sri Mad Bhagavatam Trutiya Kandam.. 1956. Sanskrit. . Sanskrit. Sanskrit. Sri Laghu Siddhanth Kaumudi.. Unknown. 1953. Sanskrit. Sri Lalthasahasranama.... 151 pgs. .. 145 pgs. Sanskrit. 1164 pgs. Unknown.. . Sanskrit. Sanskrit. Sanskrit. Pandith Sri Shobhakanth Jha. Sri Madbhagavathy Panchama Scanda. sanskritdocuments. Dr. Unknown. Unknown... Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Sri Kanta Charitam Of Munkhaka... 1976. Sri Ramanuj Bhasyen. Literature. 353 pgs. 1963. Unknown. Sri Mad Bhagavatam Ashtamaskanda. 792 pgs.. Sri Madbhagavatham Vol 5. 578 pgs. Sanskrit. S Vshwanathan... . Mahakavi Sridhara Acharya Virchit.. 415 pgs. 0.. 192 pgs. 0.. Abhinava Gupta. 0. Srimannarayanramanujjeeyswamini.. 383 pgs. 1957.. Sri Karbhashyam Vol. Sanskrit.. . . 468 pgs. Unknown. Pandit Ramtejpandeyan. Sanskrit. Unknown.. Sri Kavyardash.sankaranarayanan.. Sri Laksminarayanasamhita Vol. Sri Raghunath. 546 pgs. Sri Madbhagvathgeethaya Vigyanbhashyam. . Unknown. Sanskrit. Sri Laxminarayana Samhitha Of Sri Svetayana Vyasa Vol 1 Part 2.. 1976. 855 pgs.. Sanskrit. Sri Kavyadarsa Of Dandin Edition Iii. Sanskrit. Literature. Literature. 384 pgs. . 278 pgs. Sri Madbhagavathy Thiruthiya Skandhaha.... 1567 pgs.. Sri Madbhagavathe Prathamaskandhaha. Somraj Krishna Das.… 62/167 . Swami Srikrisna Vallabhacharya Shastri. Sri Mad Bhagavatam.org/…/SanskritIIIT. . 1971. Religion. Sri Madbhagavatham Vol 7.. Sri Madbhagvadgeeta. Shivnarayan Shastrina. 1972. Unknown. 515 pgs. 412 pgs. Unknown.. Sri Laghushabdendulkala. Unknown. Sanskrit.1. Linguistics. Sri Chidirematiyeveerchandrasharma. 0. . 0. Linguistics. Sri Madhusudhan Sharma Maithli. 845 pgs.. Language.. Sanskrit. Unknown. 802 pgs. 746 pgs. . Sanskrit. . 252 pgs. Khemraj Krishnadas. Ganga Vishnu Sri Krishna das.b.. Sri Madbhagavathe Akadhasaskandhaha. Sri Mad Bhagvadgeeta. G Laxmikanthaiah... Language. 352 pgs. 122 pgs.. Sanskrit. Unknown. .. Sanskrit. Sri Maaliniivijaya Varttikam. 0. 1976. 306 pgs.. Sri Madbhagavad Gita Sri Mahabharathantargath. Sanskrit. Sri Mad Bagavadgeeta Sri Mahabharath Antargath.

Sri Nyayamrutha Kaladharaha. 43 pgs. Unknown. P P S Sastri. 665 pgs.. Religion. Nalachakravarthy K. Unknown.. Sri Madvalmiki Ramayan Vol I. Sri Mahabharatham Ashravmedhikparv Vol X V I I I... Sanskrit. . Sanskrit. 1968.. Sanskrit... 98 pgs. 0. 288 pgs. Sanskrit. 0.. Yoganarasimha. 572 pgs. Religion. Sri Madhvas Tattva Vada. Sri Madramayanmimamsa. Vedavyasachar. . 1992.. Sanskrit. . 259 pgs.. Unknown. Sanskrit. Sanskrit. Sri Mannyayasudha Prarambha.. Sanskrit. ... 226 pgs. 1922.I. Unknown.. Linguistics. 1992. Unknown. 1987. 1994. Sanskrit. Sri Markandeyapuranam.. Sri Malinivijaya Varttikam.. 540 pgs. Sanskrit.. Sri Madvalmiki Ramayanam Vol.. Sanskrit. 0. Unknown. Sri Man Mahabharatam. 1935. Literature... 148 pgs. Pandut Madhusudan Kaul Shastri. Hariprasad Bhagirathi Ityesham. 0.. 1921. 498 pgs. 939 pgs. Sri Madwasiddantasarasangraha. Anandtheertha Bhagavatpadacharya. Religion. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Sri Madhragra Sanhitha. sanskritdocuments. Unknown... 1985. Sri Mani Charithamruth. Language. Sri Mahabharatham Shanthi Parvan. Dattavathari Sri Manik Prabhu Yanche. Sanskrit. 0. Sri Maha Bhagavatam. 1948.. 1944. Linguistics. Ganagavishnu Sri Krishnadas. Sanskrit. Literature. Sri Nilakanta Bashyam. Unknown. Sri Rajnarayan Shastry. 130 pgs. Unknown.krishnacharya. 0. Sanskrit. Religion.. 370 pgs. Sri Thulasi Das.. Sanskrit. 334 pgs. Sanskrit.. Sri Madhvacharya Brahmasutra Bhasya Vol Iii. Unknown. Ganga Vishnu Sri Krishna Das. 1366 pgs.. 1922. Religion Theology. T R Krishnacharaya. Sri Manmanas Namavandana... 1955. Sanskrit.I I I. Sri Manoramashabdaratn Prashnouttarwali Vol I.r. K Ramachandra Shastri. Unknown. Sanskrit. 900 pgs.. T. 534 pgs. Sri Mahabharatha Tathparyyanirnaya Satikas. 1995. Sri Nimbarkvrathnirnay. 1867. Sri Malinivijayottara Tantram Vol Xxxvii.... Jai Krishna Das Haridas Gupt. . Literature.. Pandit V Ananta Charya. 0.… 63/167 . Ganaga Vishnu Sri Krishnadas. Unknown. T Srinivasacharya. 82 pgs. Sanskrit. 215 pgs.... Religion. 0. Sri Madvalmikiramayaname Sundharakandam. Literature. . Sanskrit.. Dr Malladi Gopal Krishna Sharma. Language. Linguistics. Pandith Shivdutten. 459 pgs. Sanskrit. Unknown. 328 pgs. 1948. 240 pgs.. Unknown. ... Sri Madvalmiki Ramayanam Vol. Unknown. Unknown. Sanskrit. 0. Sanskrit.. 1322 pgs. 1950.. Sanskrit. Sanskrit.. Language. 1940. Sri Nilakanta Bagavathpada. Language.. Unknown.. . Linguistics. 0. 402 pgs. 1043 pgs. Unknown. Sanskrit. 956 pgs. 0. 780 pgs. Sri Manmaharaj Sanskrit Mahapatashala Patrika. Sanskrit. 368 pgs... Sri Natakatha Sangraha Abridge Stories Of Sanskrit Dramas.... 1907.. 94 pgs. Sri Madhwa Mantrartha Manjari Of Vaishwanathi Narayanacharya... Theology. 816 pgs. Sanskrit. Sri Nirnaysindhu... Pandit Madhusudan Kaul Shastri. Sri Manoramashshabdartan Prashnouttarvali Part I I. Sanskrit.. Sri Malavikagnimitra Of Kalidasa.org/…/SanskritIIIT... C Sankara Rama Sastri.

128 pgs.org/…/SanskritIIIT. Language. Linguistics. Sri Parasara Bhatta's Sri Ranagarajasta .. Sri Madnubhutiswarupacharyapranitham. 724 pgs. Sanskrit. Unknown.. Krishnamacharya V. 1942. Sri Sathpurush Charitra Prakash.. 600 pgs. Sanskrit.. 592 pgs... 1952. 1976. Prabhakara Rao M. Sri Sankara Grandhavali Upanishadvani. Vijayeendrateertha.. 0. Sanskrit. Sanskrit. 0. 635 pgs. Philosophy. Literature.. Dvaita Philosophy. Literature. 605 pgs. Sri Rama Sahasra Namastotram Sri Tyagaraja Nama Stotram And Namavali.. 0. Subramania Sastri. 160 pgs.. Literature. 47 pgs.. Religion. . 818 pgs. sanskritdocuments. Sanskrit. Theology. -. Sri Paribhashendu Shekar. 86 pgs. Sri Sarvamoola Granthah Of Sri Anandatirtha Bhagavatpadacharya I... Sri Sareeraka Meemansa Bashya. V. Unknown. Literature. 378 pgs. 230 pgs. Sanskrit. 0.... History.… 64/167 . Unknown. Sanskrit. . Unknown. Sri Sankara Grandhavali . Sanskrit. Sanskrit.... 1933. 88 pgs. Sanskrit.... 1954. 70 pgs. P Sri Rama Chandrudu. 1998. Unknown. Sri Sarvasiddhantasarasara Vivechanam. Literature. 394 pgs. 1999.. Unknown.. Sanskrit.. Not Available. 558 pgs. Unknown. 232 pgs. 1980. Sri Sukhanandnathen. Unknown. 1949. 1978. Sri Ramanuja Campu. 100 pgs. Language. Sri Shabdharthchintamani Kosh I Vol I I I.. Pandith Sri Ramchandra Jha. Sanskrit. Linguistics. Sanskrit. .. 2000. Dhinanathasharma. Sanskrit.. Sri Sankara Vijaya Makaranda. Sri Raghuvamsam Pakyanam. Vedanta. Rambalashastri. Sri Satika Threemuthrrasagara Nam.. Sharma V A. Geography. 1054 pgs. Unknown... Theology. Unknown. Sri Rasayoga Satakam Part Ii... Sri. K. Sanskrit. Sanskrit.. Religion.. 1661. Sri Sahityanushasanam. Sanskrit. Tirumazisai Alwar. Madhvacharya Gangur. 533 pgs. 1988. Unknown. Sanskrit. Sri Paninivyakarne Vadartanam Vol I. Unknown. Literature. Sanskrit.Vol 2. Sri Sanatana Dharma Lokaha Part Iv. M. K Srikrishna Das.. Acharya Pandit Sri Sotharam Chaturvedhi. 1958. 242 pgs. 2001. 81 pgs. . Sri Pithrakarm Nirnay. 0. Sanskrit. Ram Balak Shastri. Unknown.. Sri Sanskrithalok Vol I I. Unknown.. 0. Sanskrit. Unknown. Biography..2/14/2011 A list of scanned Sanskrit books at III… Sri Nyayasudhatipani. 1987.. 1956.. 416 pgs. P Srirama Chandrudu. 1920.. Sri Ramanujas Theory Of Knowledge. Linguistics. Sri Valmiki Mahamuni... Sri Sandhichandrika. Sanskrit.. 52 pgs. Sanskrit... Pandith Sri Ramchandrabhakt.varadachari. 1661. Unknown.. 210 pgs.. -.... Sanskrit..c... Teekadutt Dhikal. Sri Ramayanamu Pradhama Khandamu Balakhandamu. 0.. Sri Paribhasendushekhara. Sanskrit. 1954..Upanishadvani. Literature. Unknown. Sanskrit. Sri Nyayasudhatipani Srinivasathirthavirachita Prarambyathe.. 382 pgs. Sanskrit.. Sri Sanskruthalok Vol I I I. Unknown. Pandith Surya Narayan Shukla. 1965. Sanskrit. Sanskrit. Sanskrit. 0. Language. 570 pgs.. Sri Raga Ratnakar Tatha.. Sri Paramahamsah. 656 pgs. 0. 235 pgs. Pandit Sri Mayaram Sangrahit. Sri Saaraswatham. Sri Ramayan Valmikiye Ayodhyakand.. Narasimha Charya A. 500 pgs. pgs. 0. Sanskrit.

K Krishna Das... 0. 108 pgs. Sanskrit. 1064 pgs. Unknown. 0. 1993. Sanskrit. Sri Srigandgiri Sri Jagadgur Charitra Sangraha. Sri Srinivas Makhi Vedanth Deshike. Sri Sri Vishnu Purana. 82 pgs. Sri Veerkrishnavijay Mahakavyam.. Unknown. 1830 pgs. 1867... G H Bhatt. Unknown. Sri Subodhini. Sanskrit. Pandith Ramchandra Sharma. Unknown. .. Goswamy Sri Krishnaiah Chautan. Sanskrit. Sanskrit. Sri Vaikhanasa Paitrumedhika Prayogaha. Unknown. Nrusimha Bharathi. Sanskrit. 660 pgs. Sanskrit. Vedas. Shri Madhava Charya.. Sri Tantraloka Vi. Dr Parama Hamsa Mishra. Sanskrit. 218 pgs. 728 pgs. Sanskrit.. 418 pgs. Dr Palle Poorna Pragnya Charya. Lanka Sita Ramanshastrin. 1889. Sri Sita Ramayanam. Sri Sudarshana Shathakam. sanskritdocuments.... Sanskrit. Sri Valmiki Ramayanam Sundara Kandam. Sri Srinivas Vilas Samskruth Kavyam.. Dvaita Philosophy.. Unknown. Unknown. 1963. Sri Shivamahapuranam Vol Ii. A S Mahaskar. 1966....... Sri Vaikhansagruhasutram Vol Ii. Sri Srinivasamkhivedanth Deshike.. Kulkarni G V. 374 pgs. 355 pgs. Sri Shaligramoshdhshabdh Sagar. 1996.. Sri Siddhhemchandrashabdanushasanam. Acharya D V N. 1116 pgs... Theology. Linguistics. Sri Tukaram Charitra. Haridas Shastri.. 184 pgs. 1973. Sanskrit. .. 673 pgs. 1952. 262 pgs.. Chilukuri Ramabhadra Shastri. Unknown. Sanskrit. Unknown.. Sanskrit. 1953. 1939. Sri Vayustuti.. 108 pgs. 672 pgs. 1960.. 210 pgs. Sri Srimad Alankara Koasthubha Accn0 589. Sri Siva Samhita.. 1980.. Sanskrit.. Late Prof. Chandraji Goswami Mahodayan.. Sanskrit. Unknown. Sri Sri Gandhi Katha. 0. Sanskrit. Sri Shankatrashdarbhashyvimarsh... Sanskrit. 423 pgs. 610 pgs. Sanskrit. 1959. 804 pgs. Religion. 0. Religion. -... 1947. Unknown. Laxman Ranchandra Pangarkar. 1940.2/14/2011 A list of scanned Sanskrit books at III… Sri Shagdhara Pragadvitha. .. Sri Sri Chantayan Chandramurthy. Literature.. Literature. Unknown.. 545 pgs. Unknown. Sri Sivagitabhashyam. Sreemuralidhar.. Linguistics.. 0. Sanskrit. Sri Munilal Gupta. Sanskrit.. Sanskrit. Sanskrit.. G Sri Yadunathaji Maharaj. 192 pgs. Sanskrit. Sri Skandamahapuranam Saptmaprabasakandam Prarambyathe.. Tiruvenkatacharyana. 406 pgs. 0. Sanskrit. 1889. Sanskrit. Unknown.. Sri Vaikhansagruhasutram. Bellankondopnamkaramaraykavindren.... Unknown. 72 pgs. 112 pgs.. Sanskrit. 0. Sri Svathsvrutham Vol I. Sri Vallabhadigvijaya. Sanskrit. 0.. 402 pgs. 216 pgs.… 65/167 . Language. Sanskrit. Khem Raj Krishna Dasane..org/…/SanskritIIIT. Pandit Taradatta Panth... 255 pgs. Philosophy.... 1985. 0. Sanskrit... Unknown. Unknown. Sri Valmiki Ramayanam Ramabiramatikayitham. Language. Maheshwar Shastry. Unknown. Sri Valmiki Ramayanam Mahabyas.. Unknown. Sanskrit.. Literature.. Unknown. 0.. Garikpati Laxmikanth. 0. 0. . Sanskrit. Sanskrit. 1985. Tantras. 696 pgs. 1979.. Literature. 1998. . 148 pgs. Sri Suryacharit Mahakavyam. Sri Srishukadooth Mahakavyam. 236 pgs. Sri Vallabhacharya And His Doctrines. 78 pgs. Ganga Vishnu Sri Krishna das.

Somraj Krishna Das. 360 pgs. 123 pgs. Srimath Srinivasay Parasmay Brahmane. 416 pgs. Sri Vyasa Panini Bhavanirnaya. Unknown. Sri Vrindaranya Kshetramahatyam. Sanskrit. Sri Venkatachala Mahathyam Pradhama Bagam. 1959. 1973. Unknown. 1972... Dinker Vishnu Gokhale..jayaseeta Rama Sastry.. Srimad Bagavad Geetha... Srimath Srinivasay Parasmay Brahmaney.org/…/SanskritIIIT. Sriharshas Naishadha Darshanaparamsha. 1943. 1954.. Unknown.. Sanskrit... 1941. 0. Srima Brahmasutra Bashyam Part 3 2 Pada. Unknown. 1982.. 1959. Unknown. Srimad Almiki Ramayanamu Thruthiya Bagamu... Sri Vidvadwibhooti.. Srimad Bagavathgeetha. Sri Venkatachalam Mahatyam Vol. Sanskrit. Gandham Sri Rama Murthy. Srimadvallabhacharya. Sanskrit. Sri Ram Chandra Jha. Sanskrit. Unknown. Sri Yogvashista Bhasha Vol I I. 208 pgs... 1961. Sri Venkatesa Kavya Kalpaha. 498 pgs. Unknown. 559 pgs.. 441 pgs. 202 pgs. sanskritdocuments. Srikrsnavallabhacarya Sastri.. 460 pgs. 0. Philosophy.. Unknown. 1993. 1960.. Literature. Sri Venkatachalam Mahatmayam Vol I. 510 pgs.. Ramlagna Pandey. Sanskrit. Sri Venkatachalam Mahatmay Vol I... 0.. Sanskrit. Sanskrit. Sanskrit.. 584 pgs. 105 pgs. 1960.. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Sri Vemageeta Prathama Sahasram Part Ii. Sri Venkatachala Mahathyamu. 1959.. Unknown. Unknown. 1960. Sanskrit... Sanskrit. Sanskrit.. 1867. 1944. 582 pgs. Srikhaudar Khanda Granth. Sri Krishna Das Sathmaj Gangavishnu.... Sri Venkatachalammahatmayam Vol-i. Sanskrit. 578 pgs. Srimath Srinivasay Parasmay Brahman. 1000 pgs.. Sanskrit. Sri Prayoga Dasji. 1974. Sri Venkatachalamahatyam. Unknown. 0. 584 pgs. Unknown. 1959. S Sethumadhavacharya. Unknown.. Sanskrit. . 500 pgs. -. Sanskrit. Sri Vishnu Puranamu. 340 pgs... Religion. 1244 pgs.. 0.. Sri Venkatachalam Mahatyam Vol I.. Tatacharya D T. Tippal Samalad.. Madhusudhanacharya. 1926.. 552 pgs. Sanskrit. Sri Venkatachala Mahathyam Dwithiya Bagam. 130 pgs. Belvalkar S K. Sanskrit. Sri Venakatachala Mahatyam. 448 pgs.. Unknown.. Sri Vichara Dipika. P. Someswara Sharma Y. Unknown..… 66/167 . 1915.vargranth Bhattacharya. -. Sanskrit. -. 1987.. Religion. Religion. Sri Viswanatha Shamran. 1930.. Sri Venkatachalam Mahatmay Vol Ii. Sanskrit. Sri Vimanacharya Kalpaha. 714 pgs..I I.. 294 pgs. 584 pgs.. Unknown. -. Unknown.. 1959.. Unknown. Shri Math Srinivasa Parasmay Brahman. 1953. Sanskrit.. Sri Vishnu Dharmottara Mahapuranam. 1963. Srimath Srinivasay Parasmay. 349 pgs.. Unknown...m. Sri Parashar Rammaharshi.. Sanskrit.. -. Bhagavadgita.. Swami Bramahananda. 1959. 846 pgs.. Unknown. 606 pgs. 280 pgs. Sanskrit. Unknown. Srimad Bhagavad Gita. Sanskrit. Sanskrit. Sanskrit. Unknown. 276 pgs. Sanskrit. Unknown. Sri Vrath Raja. 250 pgs. Srilakshminaryanasamhita Of Sri Svetayana Vyasa Vol Iii. Sanskrit. Dr.. Sanskrit.. M Ranganadhacharya. Sanskrit. Sanskrit. Sri Yogtarangini.

Bhagavadgeeta. Srimad Valmiki Ramayanam Saralagadyatmakam. 0.. Srimadbhagavatam Astamaskanda. Art.. Sanskrit.. 341 pgs.. Sanskrit. Srimadbhagavatam Pradamaskanda. Sanskrit.. 1969. Sanskrit. Srimad Brahmasutrani Part Ii. Religion. Srimad Brahmasutra Bhashyam Vol I Part Iii.. 308 pgs.. Theology. Sanskrit. Srimadbhagavatam Navamaskanda... Sanskrit. Maganlal Ganpatiram Shastri. 1985.. . 1982.. -. . Srimad Valmiki Ramayana Part 2. 1982. Sanskrit. Anandtheertha Bhagavatpadacharya. Religion.… Srimadbhivishgarvgadadhartanyavadgnasen Vidhusha Virchitaha Khemraj Sri Krishna Das Srehthina 67/167 .. Unknown. Srimad Vijayindratirtha. Srimad Vallabhacharya. 720 pgs. 1992. Srimad Bhagavata Mahapuranam Vol I. 1961. 291 pgs. 0.. 286 pgs. A V N Acharya. Theology..... Srimad Bhagvad Geetha. Sanskrit... Sanskrit. 1961. Brahucharya. 1983.2/14/2011 g A list of Sanskrit books at III… g scanned g pg Srimad Bhagavadgeeta.. 1989. Sanskrit. Sanskrit. Srimadbhagavatam Shashtamaskanda. 1997. Srimad Brahmasutra Bashyam Part 3 1 Pada. Srimad Bhagavata Mahapuranam Of Maharsi Vedavyasa Vol 1 Skanda 1. 358 pgs. 1913... 126 pgs. 1980. Srimad Brahmasutranu Bhasya Of Srimad Vallabhacharya.. Sanskrit. Sanskrit. 291 pgs.... Maganlal Ganapatiram Shastri.. 75 pgs. 1954. Dr N C V Narasimhacharya. Wasudev Laxman Shastri Pansikar. Sanskrit. sanskritdocuments.. Ramayanam. Bhagavadgeeta. . 1987. Brahucharya.. Religion. Prof.. Srimad Valmiki Ramayanam Part 2. . Sanskrit. Srimadvallabhacharya. 292 pgs. Srimad Brahmasutranubhasya Of Srimad Vallabhacharya. Unknown. . 370 pgs. K Hanumantha Rao... Srimadvallabhacharya. Srimad Brahmasutra Bashyam Part 1 1 Pada.... Srimad Jayatirthas Tattvasankhyanatika.. Sanskrit. Unknown. 276 pgs. 1936.. Srimad Valmiki Ramayanam: Aranyakandamu Kishkinda Kandamu... P Radha Krishna Sarma. Srimadbhagavatam Ekadasaskanda. Srimad Valmiki Ramayanam.. 1984.. 212 pgs. Brahucharya.. Unknown. 956 pgs. 327 pgs. Srimadvallabhacharya. 1270 pgs. Srimad Brahmasutra Bashyam Part 3 4 Pada. 1997. Bhagavad Gita. Religion. Mahadeva Gangadhar Bakre. Hanumantha Rao K... Sanskrit. Bhagavadgita. 428 pgs. .. Unknown. 1997. 650 pgs. 1980. -. 355 pgs. Sanskrit. Unknown. 242 pgs.. Unknown. 1997. Sanskrit. Religion. 120 pgs. 1911. Sanskrit.. Sanskrit. 148 pgs. Religion. 0. 92 pgs. Sanskrit.... 1961. Sanskrit. Religion. Srimadvallabhacharya. . Sanskrit. Religion. Srimad Brahmasutra Bashyam Part 2 2 Pada. 426 pgs.org/…/SanskritIIIT. D Harishankar Mishra. Srimad Bhagavadgita. Hanumantha Rao K. 1006 pgs. Srimad Valmiki Ramayanam Balakandam Ayodhya kandam. Srimadbhagvata Aur Tulsi Sahitya Tulnatmaka Anushilana. Religion.. Sanskrit.. 605 pgs. Sanskrit. 1998. 1875.. Sanskrit. Srimad Bhagavath Dashamaskanda Subhodini. Jwalaprasad Misra.. 744 pgs. K Hanumanth Rao.

Sanskrit. Sriman Nyadudha Vol Ii. Sriman Nyaya Sudha Vol Ix.. Sriman Nyadudha Vol . .. Philosophy. 1983. Sanskrit. Sriman Nyaya Sudha Vol I. 171 pgs.. 1982. 186 pgs.. 1933..9... Sanskrit. 1998.. 1983. Philosophy. Sanskrit.. G Laxmikanthaiah. Srimadhya Mahapuranam. 1981. 723 pgs. Venkata Reddy K. 198 pgs.. Sriman Nyaya Sudha Vol ... Sriman Nyayasudha part 1. Unknown. 1982. Srimahedantdesika Grantha Malaya. pgs. Sanskrit. 1982..10. pgs.guru Venkatacharya. Sriman Nyaya Sudha Vol . 1997. pgs. 164 pgs. 160 pgs. Sanskrit. .. 1941. Sriman Nyaya Sudha Vol .. .. 1982. Philosophy. .. Linguistics Literature.. Sanskrit. Sriman Nyadudha Vol Iii.9.8.. Philosophy. 1982. 1982.d. Sanskrit. . ..2. Sanskrit.1. Philosophy. 1156 pgs. 842 pgs. . 1918. 1868. Sriman Nyaya Sudha Vol .. P P S Shastri. 1982.. Sanskrit. Philosophy. 1983. 164 pgs.2/14/2011 A list of scanned Sanskrit books at III… Srimadbhivishgarvgadadhartanyavadgnasen Vidhusha Virchitaha. 163 pgs. 163 pgs. Sanskrit. 1982. Sanskrit.5. Venkata Reddy K. 1981. . Sanskrit. G.9. Sanskrit. Sriman Nyaya Sudha Vol . Philosophy. Philosophy. 183 pgs. 160 pgs.. Sanskrit. Sriman Nyaya Sudha Vol . Unknown. 266 pgs.... Sriman Nyaya Sudha Vol . Sanskrit. 1983. Philosophy. 1983. Philosophy. 1981. . Language. Sriman Nyadudha Vol . pgs. Philosophy.1. Sanskrit. . Sanskrit. Srimadhandra Mahabharatha Kathah.2. 166 pgs. Sriman Nyadudha Vol V.. Sanskrit. Philosophy. Sriman Nyaya Sudha Vol .… 68/167 . . 0. Philosophy. Sriman Nyaya Sudha Vol . Unknown. Sanskrit. 1983. 160 pgs. . Sriman Nyaya Sudha Vol . 1983..arka Somayaji. Linguistics. 1983.org/…/SanskritIIIT. Sriman Mahabharathamu Aranyaparvan. Sanskrit. 130 pgs.. 1983. Philosophy. Philosophy. 336 pgs.. Unknown. Philosophy.. pgs. Sanskrit.. Unknown.. Khemraj Sri Krishna Das Srehthina. . 1981. 1983.. 1984. Sanskrit..3.. Venkata Reddy K. Sriman Nyadudha Vol I.. Sriman Nyaya Sudha Vol Ii. Dr. Sriman Nyaya Sudha Vol .. Sriman Nyaya Sudha Vol X. Sanskrit. Jayatheertha. 1980. 1981. Sanskrit... Sriman Nyadudha Vol .. . 1110 pgs. Srimath Vedantadesika Granthamala.. Jayatheertha.. 1983. Sanskrit. 167 pgs. Philosophy. pgs.. Philosophy. 171 pgs...8. Literature. .. . Philosophy. 166 pgs. 186 pgs. Sanskrit. 1983. Sanskrit. Sanskrit.. Philosophy.. Vayu Purana. Sanskrit. Philosophy... Sanskrit. Sriman Nyayasudha part Ii. . ..2... 171 pgs. . Sanskrit. 316 pgs... Jayatheertha.. Sriman Nyadudha Vol . 184 pgs. Srimat Sitaramajaneyam. Sriman Nyaya Sudha Vol . Sri Kanchi P B Annangaradharyar. Sanskrit. 167 pgs. Linguistics Literature. Ramayanam.. sanskritdocuments.8. B N K Sharma. .. Sriman Nyaya Sudha Vol Viii. Gadi Srikrishnmacharyaswami. .10. Philosophy...1. Srimat Tatparya Chandrika Volume Iii.. Philosophy.. 384 pgs. 1983. Philosophy. Philosophy.. 1061 pgs. Sanskrit...... Sanskrit..

2/14/2011

A list of scanned Sanskrit books at III…

Sriramakirti Mahakavyam... satya vrat shastri, Unknown. Sanskrit, 1990. 582 pgs. Sriramyansar Kanya Tilakam... B.ramraj, Unknown. Sanskrit, 1972. 243 pgs. Sritattvacintamani... Chintamani Bhattacharya, Tantras. Sanskrit, 1937. 123 pgs. Srngara Sekhra Bhana... Dr B Rama Raju, Unknown. Sanskrit, 1969. 76 pgs. Srngaraprakasa... P P Subrahmanya Sastri, Language. Linguistics. Literature. Sanskrit, 1939. 100 pgs. Srngaraprakasa Part I... Maharajadhiraja Sri Bhoja Deva, Art. Sanskrit, 1939. 101 pgs. Stava Chintamani... Bhatt Narayana, Art. Sanskrit, 1918. 165 pgs. Sthotramala... K Prathivaadi Bhayankar, Art. Sanskrit, 1942. 112 pgs. Stotraadisan'grah... T'embe Shriivaasudevaa Nanda Sarasvatii, Religion. Theology. Sanskrit, 1952. 474 pgs. Stotrasamuccaya... Dr.v.raghavan, Unknown. Sanskrit, 1969. 332 pgs. Studies In Buddhism And Sikhism... Harcharan Singh Sobti, Unknown. Sanskrit, 1986. 116 pgs. Studies In Skanda Purana Part 3 Vol 1... A B L Awasthi, Unknown. Sanskrit, 1983. 182 pgs. Subhaashhitaratnabhand-d'aagaarama~ Parivara~dhitamashhtaman' San'skarand-ama~... Raama Naaraayand-a, Language. Linguistics. Literature. Sanskrit, 1952. 528 pgs. Subhashitasudha Ratna Bhandagaram Or Treasures Of Sanskrit Poetry... pandit shivadatta kavirathna, Unknown. Sanskrit, 0. 876 pgs. Subhasita Ratna Bhandagara... Narayan Ram Acharya, Kavyas. Sanskrit, 1952. 525 pgs. Suddhadvaitamartanda... Ratna Gopala Bhatta, Kavyas. Sanskrit, 1954. 116 pgs. Suddhadwita Pushtimaargiya Samskut Vagnmaya Part I... Prof Kantamani Sastry, Religion. Theology. Sanskrit, 0. 268 pgs. Sudhasharachhandhramu... Chilakamurthy Laxmi Narasimham, . Sanskrit, 1927. 180 pgs. Suklyajurveda Samhitha... Wasudev Laxman Sastri Pansikar, Unknown. Sanskrit, 1929. 658 pgs. Sulabasutram... P Venkataramaiah, Kavyas. Sanskrit, 1984. 74 pgs. Sulabasutram... Niccolao Manucci, Kavyas. Sanskrit, 1984. pgs. Sulabasutram Katyana... P Venkataramaiah, Kavyas. Sanskrit, 1984. 70 pgs. Sulabasutram Katyana... Niccolao Manucci, Kavyas. Sanskrit, 1984. pgs. Sulbhavykaranamu Part I... kambamupathi gopalakrishnamurthy, Unknown. Sanskrit, 1959. 46 pgs. Sundari Meghasamdesa Or Dakshinatya Meghasandesa... Veluri Subbarao, Unknown. Sanskrit, 1999. 122 pgs. Sundarkandam... Dr.chandra Prabha, Unknown. Sanskrit, 1981. 284 pgs. Supplement To Purana Vol Ii No 2... Dr Ganga Sagar Rai, Religion. Theology. Sanskrit, 1963. 40 pgs. Surjan Charita Mahakavyam... Sri Chandrashekhar, Unknown. Sanskrit, 1952. 264 pgs. Surya Dandaka... Mayura Kavi, Unknown. Sanskrit, 1989. 46 pgs. Surya Siddhanth... -, Religion. Theology. Sanskrit, 0. 358 pgs. Sushruta San'hitaa Muulamaatraa... Sushruta, The Arts. Sanskrit, 1945. 1261 pgs. Sushrutasamhita Of Sushruta... Jadavi Trikumji Acharya, Unknown. Sanskrit, 1915. 778 pgs. Sutrarthamrta Lahari... Dr. R. Nagaraja Sarma, Unknown. Sanskrit, 1951. 112 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Sutrutham

Sri Jovanand Vidhyasagar Bhattacharya Unknown Sanskrit 1983 908 pgs

69/167

2/14/2011

A list of scanned Sanskrit books at III… Sutrutham... Sri Jovanand Vidhyasagar Bhattacharya, Unknown. Sanskrit, 1983. 908 pgs.

Suuktimuktaavalii... Harihara~, Technology. Sanskrit, 1949. 186 pgs. Suuta San'hitaa Dditiiya Khand-d'a Grantha 25... Chaara~ya Maadhava, Religion. Theology. Sanskrit, 1950. 441 pgs. Suutasan'hitaa Grantha 25... Aapat'e Vinayaka Gand-esha, Religion. Theology. Sanskrit, 1924. 374 pgs. Suutasan'hitaa Trxtiiya Khand-d'a... Aapat'e Hari Naaraayand-a, Religion. Theology. Sanskrit, 1929. 380 pgs. Suutasn'hitaa Bhaaga 3... Aapat'e Gand-osha Vinaayaka, Religion. Theology. Sanskrit, 1929. 390 pgs. Suvarnaprabhasa... C.e.marobz, Unknown. Sanskrit, 1992. 758 pgs. Suvarnaprabhasa Das Goldglanz Sutra... W Redloff, Unknown. Sanskrit, 1992. 270 pgs. Svabhaava Chitren' Prathamaavrxtti... Divekara Dinakaravaasudeva, Philosophy. Psychology. Sanskrit, 1934. 180 pgs. Svacchanda Tantram... Kshema Raja, Literature. Sanskrit, 1923. 345 pgs. Svachchhan'da Tan'trama~ Vol V... Shaastrii Madhusudhana Kaula, Religion. Theology. Sanskrit, 1930. 297 pgs. Svachchhandatantrama Bhaaga 2... Qs-emaraaja, Religion. Theology. Sanskrit, 1923. 348 pgs. Svapnavasavadattam... C R Devadhar, Language. Linguistics. Literature. Sanskrit, 1946. 169 pgs. Svara~nd-a Kirana~... Shrii Sumitraanan'dana Pan'ta, Philosophy. Psychology. Sanskrit, 1947. 197 pgs. Svetasvaradyupanishad Purushasuktha Bashya Part 1... Veera Raghavacharya T, Upanishad. Sanskrit, 1955. 445 pgs. Svetasvataradyu Panishad Purushasukta Bhasya Part 1... T Veeraraghavacharya, Unknown. Sanskrit, 1955. 448 pgs. Svetasvataradyupanishad Purushasukta Bhasya... T Veera Raghavacharya, Unknown. Sanskrit, 1955. 446 pgs. Swapravasavadatta... Haradayalu Singh, Art. Sanskrit, 2003. 47 pgs. Swetha Swatharaghupanishatpurushasukthabhashyam Prathama Bhagah... Sri ranga rananuja murthy, Unknown. Sanskrit, 1944. 448 pgs. Taan'trika T'eksat'a Khand-d'a 11... Raavaa Bhaaskara, Religion. Theology. Sanskrit, 1922. 117 pgs. Taittiriiya Praatishaakhyama~ Grantha 10... Maahishheya, Religion. Theology. Sanskrit, 1930. 262 pgs. Taittiriiyaarand-yakama~ Bhaaga 2... Krxshhnd-ayajura~vediiyan, Religion. Theology. Sanskrit, 1927. 471 pgs. Taittiriiyaarand-yakama~ Dditiiyo Bhaaga Grantha 36... Aapat'e Vinaayaka Gand-esha, Religion. Theology. Sanskrit, 1927. 479 pgs. Taittiriiyabraahmand-ama~ Dditiiye Khand-d'a Grantha 37... Krxshhnd-ayajara~vediiye, Religion. Theology. Sanskrit, 1937. 570 pgs. Tajika Neelakanti... , Language. Linguistics. Literature. Sanskrit, 0. 280 pgs. Tamara Parinayam... , . Sanskrit, 0. 448 pgs. Tandyamahabrahmana... Pandit A Chinnaswami sstri, Unknown. Sanskrit, 1935. 510 pgs. Tantra Sara Sangraha... M Duraiswamy Aiyangar, Indology. Sanskrit, 1950. 566 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Tantra Trutiya Samputam

Sri bhagavad ramanuj Unknown Sanskrit 1951 380 pgs

70/167

2/14/2011

A list of scanned Sanskrit books at III… Tantra Trutiya Samputam... Sri bhagavad ramanuj, Unknown. Sanskrit, 1951. 380 pgs.

Tantraaloka 57... Abhinavagupta, Religion. Theology. Sanskrit, 1936. 374 pgs. Tantraaloka Dashamo Bhaaga Grantha 52... Gupta Madabhinava, Religion. Theology. Sanskrit, 1933. 400 pgs. Tantraaloka Ekaadasho Bhaaga Grantha 57... Gupta Madabhinava, Religion. Theology. Sanskrit, 1936. 377 pgs. Tantraaloka Grantha 30... Madhusudana, Religion. Theology. Sanskrit, 1921. 314 pgs. Tantrasara... , . Sanskrit, 0. 495 pgs. Tantrik Tests... Swamy Trivikrama Tirtha, The Four Vedas. Sanskrit, 1937. 132 pgs. Tarad'aga... Saagarikaa, Philosophy. Psychology. Sanskrit, 1940. 132 pgs. Taranatha's... Albert Grunwedel, Unknown. Sanskrit, 1914. 222 pgs. Tara~kataand-d'avama~ Chatura~tho San'put'ama~... Vyaasathiira~tha Shrii, Philosophy. Psychology. Sanskrit, 1943. 409 pgs. Tara~kataand-d'avama~ Da~vitiiyan' San'put'ama~... Vyaasatiira~tha Shrii, Philosophy. Psychology. Sanskrit, 1935. 417 pgs. Tara~kataand-d'avama~ Prathamasamput'ama... Shriivyaasatiira~ta, Philosophy. Psychology. Sanskrit, 1932. 564 pgs. Tarka Tandavam Vol I... D.srinivasacharya, Indology. Sanskrit, 1932. 557 pgs. Tarka sangraha... Acharya kedharnadh tripati, Religion. Theology. Sanskrit, 1974. 204 pgs. Tarkabhasa Of Moksakara Gupta... Embar Krishnamacharya, Unknown. Sanskrit, 1942. 140 pgs. Tarkabhasha And Vedasthana Of Mokshakaragupta And Jitaripada... H.r. Rangaswami Iyengar, Religion. Theology. Sanskrit, 1944. 144 pgs. Tarkasamgrahah... Shri Guru prasada shasthri, Unknown. Sanskrit, 1939. 308 pgs. Tarkasan'graha... Annambhat't'a, Philosophy. Psychology. Sanskrit, 1930. 225 pgs. Tarkatandava... , . Sanskrit, 0. 331 pgs. Tarkatandavam Of Sri vyasa Tirtha Ii... V Madahvachar, Dvaita Philosophy. Sanskrit, 1935. 407 pgs. Tarkatandavam Of Sri vyasa Tirtha Iv... V Madahvachar, Dvaita Philosophy. Sanskrit, 1943. 402 pgs. Tarkatandavam Of Sri vyasa Tirtha,3... V Madahvachar, Dvaita Philosophy. Sanskrit, 1938. 373 pgs. Tathava Teeka... Mahadesika, Geography. Biography. History. Sanskrit, 1934. 538 pgs. Tathvaprakasika Chapter1... , Language. Linguistics. Literature. Sanskrit, 0. 451 pgs. Tatparya Chandrika Part 2... Krishnacharya,t.r, . Sanskrit, 1913. 2011 pgs. Tatparya Chandrika Vol Ii Part Ii Iii Iv... Sri Vyasateertha, . Sanskrit, 1982. 213 pgs. Tatparya Chandrika Volume I... Sri Vyasateertha, Unknown. Sanskrit, 1981. 182 pgs. Tatparya Chandrika Volume Ii... Vyasateertha, Geography Biography History. Sanskrit, 1981. 211 pgs. Tatra Pratham Samputam Vedratha Geetabhasya Gadyatrey... Sri Mannarayanramanujayteendranamagya, Unknown. Sanskrit, 1980. 292 pgs. Tattva Pradipika With Citsukha Commentry... , . Sanskrit, 0. 294 pgs. Tattva Samkhyanam... Ramamurthy Sharma R, Philosophy. Sanskrit, 1980. 77 pgs. Tattva-kaustubha-kulisa... Dr.rnaga Raja Sarma, Unknown. Sanskrit, 1956. 324 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Tattvaara~thasuutrama~

Svamii Umaa Religion Theology Sanskrit 1944 324 pgs

71/167

1943. Tattvasamkhyanam. Geography. 1954.. . Religion. Sanskrit. The Alanka Asa Vasva Of Rajanaka Ruyyaka.2/14/2011 A list of scanned Sanskrit books at III… Tattvaara thasuutrama . Philosophy.. Tatvamukttaakalaapa Prathamasanput'ama~.. Geography Biography History. Psychology.. -. Vidya Manyatirth Swami. Philosophy. . 72 pgs.. 382 pgs.… 72/167 . The Abhijnana Sakuntala Of Kalidasa. The Abhidhana Sangraha. Unknown.. Sanskrit. Tatvapradipika Nyaya Prasakdika Vyakyanamu. 1954. 1944.... Tattvarthavartik Of Shri Akalank Deva. 1940.. Vedaantaachaara~ya Shrii.. Unknown.. 1981. Sanskrit. R S Panchamukhi.. Pandit Girijaprasad Dvivedi.. 1303 pgs.. Literature. ludwik sternbach. 375 pgs. 462 pgs.. . 1938. Tattvaraya Rahasyam. Sanskrit. Sanskrit.. 1933. Sanskrit. 329 pgs. 0. 1953. 99 pgs. 551 pgs. Nigamaantadeshika~. 1940. Linguistic. Sri Madhvacarya. 0.. Tatvodyota... 461 pgs. 110 pgs. Sanskrit. Linguistics Literature. Tatva Marchand Vimarja... Ramanuja. Tharkasangraha. Sanskrit. Tatva Prakasika Bhavadipa Volume I to Ii.. .. 554 pgs.. Language.. Sanskrit. . 1980. 0. 1948. 1953.. . Thaithariya Brahmanamu Dwithiya Bagamu. Tattvamukttakalaapa Da~vitiiya San'put'ama~. Krishnacharya.. Unknown. Psychology. Veeraraghavacharya. . Tatvaprakasika Bhavdiya. 538 pgs.r. Sanskrit. Sanskrit. Theology. Tatuabodhini Uttaraidha Gnanendra Saraswathi. Linguistics.. 117 pgs. Sanskrit. Tattvatika.t. Geography Biography History. Theology. 748 pgs.... kshitish chandra chatterji.. 324 pgs. Unknown. Unknown... The Akhyata Chandrika. Sanskrit.. Sanskrit... 1914. Veng-kat'anaatha. 342 pgs.. 1980. Sanskrit. Sanskrit. Sanskrit.. 0. 1938. Philosophy. Sanskrit.. Sri Jayatirtha... The Abhijnana Sakuntala of Kalidasa. 406 pgs. 198 pgs. 1953. Tattvamukttakalaapa Trxtiiyasamput'ama~. 347 pgs. Tattvamukttaakalaapa Da~vitiiyasan'put'ama~. Sanskrit.. 0. Technical Terms And Technique Of Sanskrit Grammer Part 1. Sanskrit. Raghava Bhatta. Sanskrit. 106 pgs.. Philosophy.. 1927.. Unknown. 554 pgs. Tattvasankhyanam.. 1964. 289 pgs. 157 pgs.. Biography. Thathvaprakasika Kavyankya Sharkara. G V Ramamurti. Sanskrit. -. kalan'kadeva Bhat't'aa. Vdaantaachaara~yaa. 1934. Language. Philosophy. Tattvamuktakalpa. 1999. Unknown... Sanskrit. Literature... The Amarakosha. 367 pgs.. sanskritdocuments.. Anantarama Sastri Vetal. Wasudev Laxman Sastri Pansikar. Sanskrit. .. Sanskrit. D Sreenivasachar. Sanskrit. Tattvatika. 1936.. bhattamalla. Mahadesika. Sanskrit. Tattvaara~thavaara~tika Bhaaga 1. 1939. 692 pgs. Linguistics Literature. 528 pgs. 1936. Unknown. Psychology. Mahendra Kumar Jain. Religion. Svamii Umaa.. Literature. Prof. 0. Unknown. 754 pgs.. Sanskrit. Sanskrit. . The Alankaramasekhara. 22 pgs. Texts On Courtezans In Classical Sanskrit.. Unknown. History... Sanskrit. Unknown. A B Gajendragadkar.. Unknown. 152 pgs. Linguistics. Sanskrit. 1940. 314 pgs.. Sanskrit. 0. 811 pgs.org/…/SanskritIIIT. 602 pgs. Telugu-savara Dictionary.

Ramakantha R. 560 pgs... Unknown. The Arthsastra Of Kautilyavol I.. Harihara Sastri.. Unknown. 1940.. 442 pgs. 1887. Ramakantha. 1934.org/…/SanskritIIIT. Bhagavadgita Sanskrit 1928 140 pgs sanskritdocuments. The Bhakti Candrika.. 96 pgs. 1984. Indology. 1943. The Ashtanga Hridaya Kosha With The Hridaya Prakasha. 1922. Sanskrit. T Ganapathi Sastri.. 1943.. Sanskrit. Sanskrit. 1930.. The Bhaminivilasa Of Jagannath Pandit. The Bhagavadgita. 1920. 521 pgs... Sanskrit.. 1943. 1963. G Rghavendracharya. Sanskrit... Sanskrit. Sanskrit. Unknown. The Brahmasutra Bhashya Volume I. Bhagavadgita. 160 pgs. The Aranyakanda Vol.. 216 pgs. Linguistics Literature.. Sanskrit. Unknown. 466 pgs.c. K. Unknown. Charudeva Shastri.. Sri Narayancharya Atreya. pgs. Sanskrit. Sanskrit. The Bhagavadgita.. Sanskrit. 1940. pgs. Unknown. The Atmatattvaviveka Of Sri Udayanacharya.. Ramakantha. 674 pgs. 1938.. 1943. Sujitkumar Mukhopadhyaya.. Sanskrit. 350 pgs. The Brahmasutra Bhashya Volume Iv. The Anargharaghava Of Murari Edition V.. Sanskrit. 630 pgs. 1940. 1922. Sanskrit. Rajanaka Ramakantha... 76 pgs. Sanskrit. Language. Raghavendracharya. Sanskrit. The Bhrngasandesa Of Vasudeva. Literature. 183 pgs.. 1928. 550 pgs.. The Balamartandavijaya. The Atmatattv Aviveka. Philosophy. Sanskrit.. Sanskrit.. 139 pgs. The Bhagavadgita.. The Andhra Pradesh Pension Code 1960. Sanskrit.. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… The Amarakosha. Jiva Natha Jhi. Dr Jatindra Bimal Chaudhri. 1956. Govinda Shankara Shastri Bapata.. Unknown. Unknown.. Unknown. 394 pgs. The Asokavadhana.I I I.. 433 pgs. 538 pgs. 1933. Pandit Durga Prasad.. The Aryabhatiya. Unknown. 1937. 243 pgs.. Brahmasutras. Sri Madhwacharya. The Brahmavada Sangraha. Unknown. Literature... Bhagavadgita..anant Shastri Phandke Vyakaranacharya. 1960. Unknown... Theology. The Boudhayana Dharmasutra. 0.. K Smba Siva Sastry. Linguistics Literature. Unknown. Unknown. Sanskrit.. Literature.. Govinda Swami. The Art Of Sanskrit Translation Or A Mirror To Sanskrit Usage. Linguistics. 1936. Sanskrit. Unknown. R. The Brahmavada Sangraha And Suddhadvaitapariskara. Sanskrit. Sanskrit. Sanskrit. The Arthasastra Of Kautilya. P. 648 pgs. Pandit Harisankara Sastru Vedabta Visarada. Unknown. k m vaidya. The Bhattikavyam Of Bhatti. Aryabhatacharya. Sanskrit. Pt.. 1930. 290 pgs. 644 pgs. Sanskrit.. Literature. Religion. Diavanji. 534 pgs. Vishnu S Sukthankar. Sanskrit. Sambasiva Shastri.. Sanskrit.. The Aranyaparvan Part 2. The Antagonist In Sanskrit Drama. 1937. Dhundiraja Sastry. 400 pgs.. 1963.. The Bijaganita Elements Of Algebra Of Bhaskrachrya... 162 pgs. The Bhaskarodhyam The Rising Sun. 1961. 162 pgs. Unknown. Kasinath Pandurang Parab. Sanskrit.. Wasudev Laxman Sastri Pansikar. 423 pgs. Unknown. Sanskrit.. Unknown. 494 pgs.. T Ganapati Sastry. 260 pgs. 1931.... .. The Brahmasutra Bhashya Volume Iv. 440 pgs. 396 pgs.… 73/167 . 1984. 1942. Unknown.. Sambasiva Shastri K. 1949. Sanskrit.. Abhay Mithra.. The Brahmasutra Bhashya Vol-3. G Raghavendracharya.. The Bhagavad Geeta Vol Lxiv.... The Balamartandavijaya. 1967..

The Ganitha Kaumudi. Pandit Anantaram Dogara Sastri.. 1000 pgs. The Charaka Samhita Volume 5. Dr.. 394 pgs. 1942. A Mahadeva Sastri. M M Sri Mukunda Jha Bakshi.. Unknown. Mangal Deva Shastri. Sanskrit.venkata Charya. Sanskrit. 1936. 184 pgs. sage agnivesa. 516 pgs.. Sanskrit. 140 pgs. 1928. sage agnivesa. 264 pgs.k. suryakanta. P Sathyavrata Samashrami. Sanskrit. The Dharmasindhu By Kasinath Upadhyaya. The Charaka Samhita Volume 1..… The Harasastra Sastri K S Unknown Sanskrit 4008 394 pgs 74/167 .. 1519 pgs. The Danadipika With Tha Bhavabodhini Hindi Commentary. 1987.. The Gospel Of Advaita.. The Harasastra. Unknown. Sanskrit. Sanskrit.. The Ganitha Koumudi Part Ii.. 661 pgs. Unknown. Social Sciences. Sanskrit. Sanskrit. 126 pgs. 56 pgs. Sanskrit. Ganganath Jha. 1987.kanakalal Sarma.. pgs. 1932.. Unknown.. 1942.. Unknown. Sanskrit. 170 pgs.. The Gospel Of Advaita. sulapani. The Elements Of Darsanas Of Sriharshas Naishadha.. Sastri. Unknown. Unknown. 1953. Sanskrit. The Dhatupatha Of Panini.. Sanskrit. sanskritdocuments. 4008. Sanskrit.. Duncan Greenless. 332 pgs.. L. The Harasastra. Sanskrit. Sanskrit. The Devinamavilasa. Sahib Kaul. The Gobhilagrhyasutra. 1949. Unknown. Sanskrit. Sanskrit. Unknown. Sanskrit. The Chhandogya Upanishad Vol Iii. T. 4008... 1949. The Grihaya Sutras Of Gobhil. The Collection of Sikshas by Yagna Valkya and Others.. 1924. Unknown.. 680 pgs. 1949. Narayana Pandita. Pandit Sri Sudama Misra. Pandit.. 296 pgs. Unknown. Sastri. padmakara dvivedi jyautishacharya. Pandit Sri Sudama Misra. 1969.rocher. 426 pgs. 140 pgs. Albrecht Weber.. Sanskrit... Sanskrit. 1936. The Charanavyuha Sutra Of Saunaka. The Ganita Kaumudi Part 1. Sanskrit.. 1900. Unknown. 1942. 30 pgs. The Dharma Sastra Vol I. Unknown. Sanskrit. Unknown. The Durghatavrtti Of Saranadeva. 296 pgs. Unknown... Unknown. The Elements Of Darsanas Of Shriharshas Naishadha. Dr M Jaya Seetha Rama Sastry.. The Chandraloka Of Shri Jayadeva. The Dipakalika. 340 pgs... 1936.jayaseeta Rama Shasthry. Sanskrit.. Unknown. Literature. The Danadipika... M.. 1986. Literature.. Sanskrit.. Unknown. 252 pgs. Unknown. Sri Gagabhatta. The Commentaries On The Prajnaparamitas Vol 1.. 283 pgs. Sanskrit... 0. Giuseppe Tucci. Sanskrit.. 1890. Sanskrit. The Ganapatha Ascribed To Panini.2/14/2011 A list of scanned Sanskrit books at III… Bhagavadgita.. Unknown. 1942. 160 pgs. Literature. Unknown.. 400 pgs. Religion. 1941.. pgs. 426 pgs. Sanskrit.. 68 pgs. sage agnivesa. Sanskrit. Manmatha Nath Dutt. Sanskrit.. Unknown. Sanskrit.. The Catapatha-brahmana. 1936. Ganapati Sastri. The Charaka Samhita Volume 4. T. 1969. Kasinath Panduranga Parab...s.. The Dasrupaka of Dhanamjaya. The Dasarupaka Of Dhananjaya. Unknown. Duncan Greenless. 668 pgs.s. 344 pgs.k..... The Dhatuvritti Vol I Part I.. Unknown. 1938. 430 pgs. Pt. 1934. Sanskrit. 1953. Upanishads.. Unknown. 1112 pgs. Sanskrit.. Unknown.. Yugalakishora Vyasa. 1938.org/…/SanskritIIIT.. 1176 pgs. 436 pgs. 1908... 1939. 1889..

Abhinavagupta. Unknown. Sanskrit.. The Jataka Mala.. Unknown. 413 pgs. Literature. 349 pgs. 0... The Kadambarikathasara Of Trivikrama...... 1940. Rama Deva. B C Benerjee. 4008. Gudharthatattvaioka. Sanskrit.… 75/167 . 1921. 538 pgs. Unknown.. Pandit Durga Prasada.. 1918.. Unknown. The Kasyapa Samhita. Sanskrit. J. The Harasastra. Sanskrit. The Isvarapratyabhijna Vivritivimarstni Vol Ii. 178 pgs. The Holi Gita. Unknown. Unknown. General. pandit bhavadatta shastri. 1941.s. Sanskrit.. 190 pgs... Unknown. 195 pgs. The Harililamrtam. 160 pgs. The Karna Sundari Of Bilhana. 94 pgs. Sastri K S. Sanskrit. Pandit.... 1902. Madhusudhan Kaul Shastri. Sanskrit... Gopal Raghunath Nandargikar. The Ishvara Pratvabhijna Vimarshini Vol I.org/…/SanskritIIIT. Sanskrit.. The Kashi Sanskrit Series. The Isvarapratyabijna Vivritivimarshini. Unknown. The Isvarapratyabhijna Vivriti Vimarsini By Abhinava Gupta.j. 539 pgs. The Kadambari Kathasara Of Trivikrama.. Pandit Durgaprasada. 446 pgs. . 638 pgs. vrddha jivaka.k. Sanskrit. Sanskrit. 4008... Sri Bopadeva. Abhinava Gupta. The Kasika Vivarana Paniyaka. Sanskrit. The Isvarapratyabhijna Vivritivimartni.. Pandit Durga Prasad. Srish Chandra Chakravarti. Sanskrit. Unknown.. 280 pgs... Sanskrit. Dr Hendrik Kern... Sanskrit.. Abhinavagupta. Sanskrit. Not Available. 446 pgs. Unknown.. Raghu Vira. Sanskrit. 396 pgs. Spiritual Experience And Uysticism. Sanskrit. Unknown. The Kalatattvavivechana. Sanskrit. Unknown.... Benerjee. Sanskrit. Vrdddha Jivaka. Unknown.pandya. The Jayantavijaya Of Abhayadeva. Sanskrit. 1925.. Sanskrit. Pandit Madhusudan Kaul Shastri..2/14/2011 A list of scanned Sanskrit books at III… The Harasastra.. Sanskrit.. sanskritdocuments.. 1957. Unknown.. The Janakiharanam Of Kumaradasa I X. Upanishad. Sanskrit. Unknown. 1953. 394 pgs. 1943. 1957. 1935.. 1930... Sanskrit. Unknown.c. Mukunda Rama Shastri. 1938. Upanishad. 1918... Unknown. Sanskrit... Abinava Gupta.. Sanskrit. 1933. 422 pgs. Mahamahopadhyaya. The Harsha Charita First Uchhvasa. General. Sanskrit. 195 pgs. The Isvarapratyabhijna Vivritivimarsini. 1943. Unknown. 394 pgs. 1943. The Ishvarra Pratyabhijna Vimarshini of Utpaladeva. Sanskrit. 307 pgs. 1023 pgs. B. 1907. Dakshina Murthy K. Abhinava Gupta.. Unknown.. Spiritual Experience And Uysticism. 1933.. 64 pgs. The Kama Kala Vilas Of Punya Nanda. Spiritual Experience And Uysticism. 1925. 281 pgs. The Jaiminiya Or Talavakara Upanishad Brahmana. 70 pgs. Unknown. 312 pgs.... 626 pgs. 1934. 1932.. 90 pgs. 1918. The Kalatattvavivechana. Sanskrit. 130 pgs.. The Kamsavadha Of Sesakrisna Edition I I I. 1867. Sanskrit. Sastri. 1941. 1944. pgs. 446 pgs. Unknown. Pandit Sri Nanda Kishore Sharma. The Journal Of Vedic Studies Volume 1 No 1. The Isvarapratyabhijna Vivritvimarsini Vol Iii. Sanskrit. The Journal Of Oriental Research Madras. The Kadambari Kathasara Abhinanda.. K Dakshina Murthy... 349 pgs. 186 pgs. 1933. 1941.. The Kasyapa Samhita. Unknown..

.. Sanskrit. 114 pgs..ramashastri. 106 pgs.. E B Cowell. 1936.. 728 pgs. P P S Sastri. Sanskrit.. Unknown. The Malavikagnimitra Of Kalidasa Edition V I I I. Literature. Unknown. Unknown. The Malatimadhava Of Bhavabhuti. 152 pgs.. The Krityasara Samuchchaya Of M M Pandit Sri Amritanatha Jha. 186 pgs. P.. Sanskrit.. Sanskrit.s. Pandurga Parad . The Mahabharata An Epic Poem Vol 4. 1935.. The Celebrated Vedavyasa Rishi. Unknown.. 1954... The Kavyakalpalata Vrtti. 154 pgs.... The Mahapurana of Puspadanta Vol. Unknown. Misra V. 1918. 822 pgs. r p kangle. 1934. Sanskrit. 557 pgs.. 640 pgs.2/14/2011 A list of scanned Sanskrit books at III… The Katyayan Srauta Sutra Part Ii.. Unknown..org/…/SanskritIIIT. 96 pgs. Sanskrit. 210 pgs. The Mahanaya Pkasha O Rajanaka Shiti Kanta. P P S Shastri. Vidhyasagara Vidhyavachaspati. Literature.. Unknown. Unknown.. The Kavyalankara Sangraha Of Udaha Bhatta. P P S Shastri. The Mahabharata Vol 10 Drona Parvan Part 2. Sanskrit.... Sanskrit.. 609 pgs.. Kashinath Pandurang Parab.. The Laws And Practice Of Sanskrit Drama Vol X I V Vol I.. 1918. Mangesh Ramakrishna Telang. 587 pgs. Unknown. A.. Literature. 974 pgs.. The Khadira Grihyasutra. Sanskrit. 1100 pgs. The Mahanaya Prakasha Of Rajanaka Shiti Kantha... Sanskrit. Sanskrit. The Madhaviyadhatuvritti Of Sayanacharya..l. Amara Chandra Yati.. Sanskrit.. 676 pgs. 184 pgs. 0. Unknown.. Sanskrit. K Sambasiva Sastri.. The Mahanaya Prakasha Of Rajanaka Shiti Kantha..-2. Vaidya. Sanskrit.. 1931. 1913. 0. Sri Gangadhara Misra. 1934. T R Chintamani.. Unknown. The Krityasaravol 1.. Unknown. Sanskrit. 1917.. The Madhvamukhalankara. Sanskrit. 390 pgs. P P S Sastri. Gopal Sastri Nane... Mangesh Ramakrishna Telang. 1936... Unknown. Unknown. Pandit Mukunda Rama Shastri. 1934. Sanskrit. The Mahabharata Vol 9 Drona Parvan Part 1. Unknown. Unknown. The Kausitaka Grhyasutras. Pandit Mukunda Rama Shastri. 388 pgs. 268 pgs.. 1960. Sanskrit. Sanskrit. 676 pgs. 1936. 1931. Vidan N. 1935. Unknown. The Mahabharatha Santi Parvan Vol X V Part I I I. Surendra Nath Shastri. Unknown. Unknown. Unknown. Sanskrit. 1935..Revised By T Srinivas Venkatarama.mahadeva Sastri.. Unknown.. Sanskrit.. Sanskrit. The Kavyarathna Of Arhaddasa. The Celebrated Vedavyasa Rishi. 442 pgs. 1944. 1935.… 76/167 . 696 pgs. 444 pgs. Pandit Ananta Sastri. The Kautiliya Arthasastra Part 1. The Kirtatarjuniya of Bharavi.. Sanskrit. 318 pgs. Unknown. Sanskrit. Sanskrit. Sanskrit. 1940. Pratap Singh. 154 pgs. 1953. 298 pgs. The Mahabharata An Epic Poem Vol 3. Literature.. Unknown. The Kausitaki Brahmana Upanisad. Sanskrit. 1939. Unknown. The Mahabharata An Epic Poems. 486 pgs... 154 pgs.. 0. 1968. Unknown.. 362 pgs. Rajashekhara. The Kavya Mimamsa. The Mahabharata Santi Parvan Vol Xviii Part I.. sanskritdocuments.. Sanskrit. Sanskrit. 1915. Unknown. The Mahabharata Vol 9 Salya Sauptika And Stri Parvans. 1935. 1918. The Mahabharata Vol Viii Bhisma Parvan. Sanskrit. 1961. P P S Shastri. The Celebrated Vedavyasa Rishi..

1957. Sanskrit..… The Parama Laghu Manjusha Pandith Nityananda Panta Parvatiya Unknown Sanskrit 1946 133 77/167 . Chinnaswamy Sastri. The Nyaya Darsana. Language. 1916. G A Jacob. Unknown.. 0. Unknown. 66 pgs. Dr V Raghavan. Unknown.. 1926. 1936. 1925. Sanskrit. 780 pgs.. The Padyacudamani Of Buddhaghosacarya.. 142 pgs... 135 pgs. Jaimini Sutras.org/…/SanskritIIIT. -. 1017 pgs.. Literature. Pandit. Unknown. Sanskrit. Unknown. Sanskrit.. P R Subrhmanya Sarma... 1917. Sanskrit. Sanskrit. The Paippalada Samhita Of The Atharvaveda..... Sanskrit.. Ramakantha. T Ganapat Sastri. Sanskrit. The Megha Duta Of Kalidasa. The Manidarpana.. 1933. The Mirichchhakatika Of Sudraka. Dalapati Raja. 0. T Ganapati Sastri. narayana ram charya. Mahamahopadhyaya Gangdhare Sasatri Tailanga. The Namalinganusasana Amarakosa Of Amarasimha. Linguistics. Gopi Natha Kaviraja. 200 pgs. 1924.. Religion Theology. Sanskrit. Literature. 1984. 0. 1921.. 1930. 471 pgs. Sanskrit.. 529 pgs. 1942... Literature. 134 pgs. Linguistics. Unknown. The Muhurtachintamani. Literature.... 60 pgs. Sanskrit. Unknown. 542 pgs. 676 pgs. Unknown.. 297 pgs. Kamalakar Bhatt. The Nyayaa Lilavati..... The Mimamsa Slokavartika.. krishnaji govind oka... Language. The Panchatantra Text Of Purnabhadra. Franklin Edgerton. Sanskrit.. 310 pgs. 342 pgs. Language. 1925.. 1898.. Unknown. 128 pgs. 1981.. 1924. Unknown. Unknown. 1930... Sanskrit. Sanskrit. 138 pgs. Sanskrit. . Sanskrit. 1913. Sanskrit. The Niruktam Of Yaska Muni. Unknown. The Nidhipradipa Of Sri Siddha Srikanthasambhu. Sanskrit. The Nirnayasindhu. The Megha Duta Of Kalidasa Edition I I. The Nyayavarttikat Paryatika Of Vachaspati Misra Vol Xiii. 52 pgs. Pandit Sri Hariram Shukla. Sanskrit. Pandit Kedarnatha.2/14/2011 A list of scanned Sanskrit books at III… The Mandaramaranda Champu Of Sri Krishna Kavi.. Unknown. 212 pgs. M Ranga Acharya. The Naiskarmya Siddhi. Sambasiva Sastri. Unknown. Sanskrit. The Orient Pearls Indian Folklore. Sanskrit. Sanskrit. Unknown. Literature. 1953. The Nareshvaraperiksha. The Mathuri Panchalakshani. 195 pgs. 906 pgs. Linguistics. Sanskrit.. The Panchatantra 1 To 5. Sanskrit. Late M R Kale. The Pancharatra Of Bhasa. 126 pgs. The Nirnaya Sindhu... 1954. 1912. Unknown. Unknown.. 1982. 1957.. The Mimasa Kaustubha. The Nirsinha Prasada. 416 pgs. 158 pgs. Sanskrit.. 475 pgs.. 194 pgs. A. 1940. K Sambasiva Sastri. Sanskrit. Mukund Jha Bakshi. sanskritdocuments. 331 pgs.. Sanskrit. The Nareshvaraperiksha... Johannes Hertel. The Nirukta Of Yaska Part Ii. Sanskrit. Ambadas Sastry. 297 pgs. The Memorial Verses Of Appaya Dikshita's Kuvalayananda. Unknown.. Dipak Bhattarcharya.. Sanskrit. Ramakantha. R G Bhadkamkar. sri kamalakar bhatta. 1903. 1934. 1926.. 484 pgs.... Sanskrit. Unknown... Sanskrit. Pandit Harihara Sastry. 80 pgs. 380 pgs.. Unknown.. 1966. The Nirsinha Prasada Tirtha Sara. . The Minimum Wages Central Rules 1950. Sushil Kumar De. Shovona Devi.. Unknown.. Unknown.

Philosophy. Rao Bahadur M. Literature. Linguistics Literature. 1938. 1950. Geography. 545 pgs. The Rupavatara Of Dharmakirti Part I I. 150 pgs.. 560 pgs. Biography. Pandit Shiva Datta.. Sanskrit. 321 pgs. 94 pgs. Sanskrit.. 1980. Sanskrit.. Unknown. The Ramayana Of Valmiki Ayodya Khanda.h. Sanskrit. The Rig Veda.. History.. Unknown.. Sanskrit.. The Pranjnaparijata Kavyam.. pgs.. The Prasannaraghava Of Jayadeva Edition I I I. The Rekhaganita Or Geometry Sanskrit. 154 pgs.. The Purvamimamsa Darsana With Khandevas Bhatta Dipika Vol I I. Kunhan Raja C. The Rasarnavasudhakara Of Simhabhupala. 1889. Sanskrit. Vishva Bandhu Shastri. Unknown.. 1935. Unknown.. Sanskrit. maithil pandit sri kanakalal sarma. Unknown. 1936. Sanskrit. Sanskrit. 1960. The Prakrta Prakasa Or The Prakrt Grammar Of Vararuchi. Pandith Nityananda Panta Parvatiya. E. 264 pgs.. sri nagendra narayana misra. The Prakriya Prayoga Suchi. 1928. Dr... 150 pgs. Pandit Ram Labhaya. Dharmasthala.. Sanskrit. 1911. Sanskrit.. Unknown. Unknown.. Philosophy. Sanskrit. Kshemaraja. 1935. 1946. 1928. Unknown. 1922. Thomas.. Sanskrit. Unknown.. Sanskrit.. 1931. vaman shivaram apte. Sanskrit..... 1962. 259 pgs. 1929. Sanskrit. 1982. The Queset Of Enlightenment. Unknown. 274 pgs.. The Parvati Parinaya. Unknown. Dr Juan Miguel De Mora. 1979. Unknown. Unknown. Sanskrit. 72 pgs. Kavi Ratna Pandith Shiv Dutta. Sanskrit. 553 pgs. 118 pgs. 64 pgs. Sanskrit. Sanskrit. The Pratyabhijna Hridaya. Vasudeva Laxman Shastri Paniskar... 1934.. 1986. The Practical Sanskrit English Dictionary Volume First.. Sanskrit. Unknown. 1902. 260 pgs. sanskritdocuments.. 108 pgs. 395 pgs. 1936. Kamalasankara Pranasankara Trivedi.... 133 pgs. Unknown.. The Philosophy Of Vallabha... 1950. Unknown. 1923.rasik Vihari Joshi.. A Mahadeva Sastri. The Patanjali Charita Of Rambhadra Dikshit. 1928. T Venkatacharya. 518 pgs. Unknown. Unknown..j. The Ram Charitha Of Bhatti. Unknown.. The Rgvedabhasya Of Skandavamin. The Rajaniti Ratnakara. 100 pgs. Sanskrit. 122 pgs.. K Sambha Shiva Shastri. Unknown.. Sanskrit.. Sanskrit. Unknown... The Ratnagotravibhaga Mahayanottaratantrasastra. 855 pgs. Sanskrit. The Sabda Kaustubha. 660 pgs.2/14/2011 A list of scanned Sanskrit books at III… The Parama Laghu Manjusha. Pandith Ramacharitra Tripathi. The Rasopanisat. The Principle Of Opposites In Sanskrit Texts. Sanskrit... E B Cowell. Radharani Sukhawal. 136 pgs.. Bhattoji Dikshit. 100 pgs. 54 pgs. 565 pgs. The Prakriya Kaumudhi of Ramachandra Vol iii. The Queset Of Enlightenment.. Sanskrit. Sanskrit. Bhana Bhatta.. Kamalashankar Prana Sankhar Trivedi.. The Parijataharanachampu Of Sesha Srisrishna. E.... 1926.. Mahamahopadhyaya Pandit durgaprasada... Unknown. 1926. 1950. Chandeswara. Sanskrit. Sanskrit. Johnston D Litt. The Phakkika Saralartha. Unknown. E J Thomas. Unknown. 1950.. The Parijataharana Champu.… 78/167 . Sesha Srikrishna. 580 pgs..org/…/SanskritIIIT. 1911. The Phakkikaratna Manjusa. 94 pgs.

Major B. The Sakta Upanisads... Theology. The Samskara Ganapathi. Unknown. Sri H. Sanskrit. The Sandilya Samhita Bhaktikhanda. 1935. 348 pgs.. 1938. 216 pgs.. Sanskrit... Sanskrit.subrahmanya Sastri. Sanskrit.... Upanishads. 554 pgs. A. Sanskrit. 1925. Rangaswamy Iyengar H R. 90 pgs. dhareshvara bhojadeva. 334 pgs. 671 pgs. Art.. Sanskrit. 438 pgs. 1950. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… The Sabdha Kausthuba.. 1951.. Sanskrit.. Sanskrit. 1938. Dhundhiraja Sastri. Sanskrit. 1930. Pandith Nava Kishore Kara Sarma. 1938. 300 pgs.. The Satapathabrahmana. Sanskrit. 1936.. Gopala Sastry N. The Samgraha Cuda Mani. 1954. 894 pgs. 410 pgs. 1935. sanskritdocuments. 563 pgs. The Sahridayananda Of Krishnanada. 132 pgs.. 1929. Shripad Krishna Belvalkar. 366 pgs. Unknown. Literature. The Saiva Paribhasa. 558 pgs.. 903 pgs. Gopinath Kaviraj. Sanskrit. Sanskrit. Sanskrit. The Samanyanirukti. 1950. Mahadeva Sastry A. The Sajjanendra Prayogakalpadruma. Sanskrit. Unknown.rangaswamy Iyengar.… Th S t th b h A di T Th M dh di R i U k S k it 0 694 79/167 . Linguistics. Religion. Mahadeva Sastri.. Pandith Nava Kishore Kara Sarma.. . Literature. Pandit A Mahadeva Shastri. 510 pgs. Unknown. P S Sundaram Aiyar.. 265 pgs. Unknown. m m sri gadhadara bhattaocharya. Unknown. 1929. 2002. Sanskrit. Sayanacarya. The Samskara Dipika Part 3. 1243 pgs.. Sanskrit. The Santiparvan Part Ii Apaddharma And Concordance. Unknown.... Unknown. Vidtasudhrakara Dr Har Dutt Sharma. 1921. Unknown. Upanishads. T. Sanskrit. T R Krishnacharya. Durgaprasa. 1934. 1960. 1933. Pandit A. 159 pgs..d. Mahadeva Shastri.. The Sanskrit Third Reader. 1947. Sanskrit.org/…/SanskritIIIT. The Saraswathi Kanthabharana. The Samkhya Karika. Sanskrit.. Unknown. The Saktivada.r.. Unknown. The Saktivada. Sanskrit. Sanskrit. The Samanya Vedanta Upanishads.mahadeva Sastri. Upanishads.. The Saiva Paribhasa. 1921. The Samskara Dipika Part 2.. 88 pgs. pandit nityananda panta parvatiya. 1950.. Unknown. 2002. 524 pgs.. 241 pgs. 1948.. The Satapathabrahamana. Upanishads.. The Samanya Vedanta Upanishads. 1930. Sanskrit.. The Samayamatrika. The Sangita Sudha.. 270 pgs. Unknown. Unknown.. 288 pgs. Unknown.r. 1933.r... Sanskrit. Linguistics Literature. The Saiva Upanisads With The Commentary Of Sri Upanisad Brahma Yogini. The Sacred Books Of The Hindus Vol Viii. Sanskrit.. Pandith Anantharam Sastri Vetal. . Sanskrit.chintamani Dikshit.. 272 pgs. Pandit Durgaprasad. 1938. Unknown.. The Sahitya Darpana. Unknown. 880 pgs. pandit nityananda panta parvatiya. 400 pgs. 64 pgs.. 146 pgs. Sanskrit. Pandit Sri Krishna Mohan Thakur..... The Sarasvata Vyakarana Part Ii. Sanskrit. 1940. Sanskrit.. 1929. 376 pgs.chintamani Dikshit. Unknown.... The Sarasvata Vyakaranam. 1950. Venkata Kavi. Unknown. The Samnyasa Upanishads. 1929. Language.. The Samnyasa Upanishads Vol Xii.... Unknown. The Saiva Upanisads.. 268 pgs. Sanskrit. 1950. Sanskrit. 546 pgs. The Samgraha Chuda Mani. 315 pgs.. Sayanacarya. Unknown. 1954. Sanskrit. Unknown. T. Sanskrit...... Shripad Krishna Belvalkar. S.. Pandit A.basu.. The Santiparvan Part 3...

Unknown. The Sree Narayana Vijayam. Sanskrit. Sanskrit.. Unknown. The Shantakuti Vedic Series Vol X I I I. Sanskrit.. The Sri Mrgendra Tantram. The Sivadristi Of Srisomanandanatha With The Vritti. Gita Devi Joshi. The Shantakuti Vedic Series Vol V I I I. 1958. 1940. Kavyas. Unknown. 1916. Sanskrit.. Sanskrit... The Srinivasavilasa Champu Of Venkatesa Kavi Edition Iii.. 260 pgs. Sanskrit. Unknown. Vishva Bhandhu. M M Shri Gangeshopadhyaya. Sanskrit. Viswabhandu. Pandit Madhusudan Kaul Shastri. K Balarama Panicker. Sanskrit. pandit sivadatta shastri. S S Surya Narayana Sastry. 64 pgs sanskritdocuments. The Shantakuti Vedic Series Vol Xv. The Silparatna Of Sri Kumara. Sanskrit. The Shantikuti Vedic Series Vol X I V.. Philosophy. Vishva Baandhu. The Siddhanta Kaumudi With The Tattvabodhini Commentary. Unknown. 412 pgs. 0. Unknown. Sanskrit.. 963 pgs. Unknown. Viswabhandu. Kshemaraja. 1962.. 652 pgs. Unknown. 1944. 809 pgs. 884 pgs. 1931.. Sanskrit. Narasimhachar. Pandit Kedarnath. Sanskrit.. 1913. 352 pgs. Unknown...… 80/167 . Sanskrit. 809 pgs. 282 pgs. T.. Philosophy. Utpaladeva. Narasimhachari. Unknown. -.... 1950. The Smriti Kaustubha Of Anantadeva. Social Sciences. 182 pgs. Unknown. 1963.. 1944. Pandit Udai Narayan Singh....... 1930. 0. 182 pgs. Sanskrit. 206 pgs. -. J C Chatarji Vidhyavaridhi. The Spanda Karikas With The Vivriti Of Ramakantha.. 830 pgs. The Savyabhichar Prakaranam. K Sambasiva Sastri.. 1921.. Narasimhachari.. Sanskrit. Sanskrit. The Siddhitrayi And The Pratyabhijna Karika Vritti Of Rajanaka Utpala Deva. 1983.org/…/SanskritIIIT. Unknown. Unknown.s. 240 pgs.. 1901.. Sanskrit. 1972. The Srungara Tilaka Bhana Of Amabhadra Deekshita. Sanskrit. Sanskrit. Sanskrit. 622 pgs.. M M Sri Rudradhara. Pandit Durga Prasada. The Siddanta Kaumudi Of Bhattoji Deekshit. 139 pgs. The Sidhant Shiromany. Sanskrit. Philosophy. Sanskrit. Unknown.. Sanskrit. The Shiva Upanisads.. The Satapathaprahmana. 1965. Sayanacarya.. Sanskrit. The Satapathabrahmana According To The Madhyandina Recension Vol V. The Sriharicarita Mahakavya Of Srihari Padmanabhas Astrin. The Srauta Sutra Of Apastamba. Chatterji J C. The Spandakarikas Of Vasugupta With The Nirnaya.. 1937.. 2002. Unknown... 1934.. A Mahadeva Sastri. 694 pgs. 1929.. Jayakrishna.. 201 pgs. 1925. 324 pgs. Sanskrit.. 360 pgs. 1933.. The Sri Bhramara Gita. 480 pgs.. The Siva Sutra Vartika Vol Iv And V.. 240 pgs.. Unknown. Philosophy... Sanskrit. 1944. Social Sciences. Unknown. 98 pgs.2/14/2011 A list of scanned Sanskrit books at III… The Satapathabrahmana According To The Madhyandina Recension...... Pandit Madhusudan Kaul Shastri. 848 pgs. The Sraddhaviveka.. Wasudev Laxman Sastri Pansikar. 440 pgs. 1909.venkatacharya. Unknown.. 1910. Unknown. Unknown. 385 pgs. The Siddhantalesasangraha Of Appayya Dikshita. Sanskrit. 1948. Sanskrit. The Srauta Sutra Of Apastamba. 1937. Unknown. 1971. 780 pgs.. pgs.. Sanskrit. 156 pgs... Unknown. . Sanskrit. The Srautasutra Of Apastamba..

. 1928. 142 pgs. 363 pgs. 1932.... 624 pgs.. Sanskrit. The Tantraloka. Sanskrit. Unknown. The Trikanda Cesha.. Sri Ramachandra Panasikara Sastri. 0. 1939.. Sanskrit. Unknown. The Udayavarma Charita. Madhusudan Kaul Sastri. . The Tilaka Manjari Of Dhanapala. 253 pgs. The Tantraloka Of Abhinava Gupta. Unknown.. Sanskrit. 232 pgs sanskritdocuments. Chinnaswami Sastri A. Jayaratha R.. Unknown.. 327 pgs. The Tantraloka Of Abhinava Gupta Vol I.annambhatta. Sanskrit. Unknown.. I S Pawate. The Tripurah Rashya. Shri Rupagoswami... Jagaratha.. 1943. Unknown. 0. A. The Structure Of The Ashtadhyayi. Madhusudan Kaul Shastri.2/14/2011 pgs. Unknown.. Unknown.. Kshem Raju. Philosophy. The Svacchandatantra With Uddyota Of Ksemaraja Vol I. 412 pgs. 1992. 913 pgs. 566 pgs.. 2002. The Taittiriya Brahmana Part Ii. Unknown. The Tautatitamatatilaka Part I. Sanskrit. Sanskrit... 1921. 630 pgs. Unknown. Sanskrit.. Sanskrit. 1936.. 170 pgs. Sanskrit. Unknown. The Unadi Sutras. Sanskrit. Sanskrit. Pandit Bhavadatta Sastri. Madhusudhan Kaul. The Svacchandatantra With Uddyota Of Ksemaraja Vol Iii. Unknown. Sanskrit. The Tantraloka of Abhinava-gupta vol Xii. 1881.. Vaman Shivaram Apte.rajanaka. The Sushrutasamhita Of Sushruta. Unknown... Mahadeva Shastri A.. The Students Sanskrit English Dictionary. Linguistic. 1938. Sanskrit. The Tantraloka Of Abhinava Gupta Vol X. 1986. Sanskrit. The Tantraloka of Abhinava vol Ii. 1950. Sanskrit. The Unadi Sutras In Various Recensions 2. 441 pgs. Sree Mukunda Bala Sastry.org/…/SanskritIIIT.. Religion.. 695 pgs. 1936. Sanskrit. 1932... 1913. Madhusudan Kaul Sastri. 356 pgs. 350 pgs.. T R Chintamani... The Ujjwalanilamani Vol 2. The Tautatitamatatilaka Part Ii. Religion. 266 pgs. The Students Guide to Sankrit Composition. The Tantraloka Of Abhinava-gupta Vol 5. Philosophy. Unknown. 48 pgs. 242 pgs. Jayaratha R. 1986. Sanskrit. Unknown. Religion. 444 pgs. Seelakkhadha Maha Thera. 368 pgs. K Sambasiva Sastri. Sanskrit.. Sanskrit. Sanskrit. The Trantraloka Of Abhinava Gupta Vol 3.... 1928... Unknown. Jadavji Trikumji Acharya.... 1986. 788 pgs. 678 pgs. Sanskrit.guruprasad Shastri.. Unknown. 1963. Sanskrit.. 142 pgs. 136 pgs. Harishankar Onkarji Shastri. Sanskrit. A list of scanned Sanskrit books at III… The Stapathabrhmana. 1918. Unknown. 694 pgs. The Svacchandatantra With Uddyota Of Ksemaraja Vol Iv. Mangal Deva Shastri. The Tattvatraya. 1916.... The Svacchandatantra With Uddyota Of Ksemaraja Vol Ii. 1933. 265 pgs.. 366 pgs.. 1918. Rajanaka Jayaratha. 306 pgs. A Collection Of Sanskrit Nouns... 1986. 1936. The Tandyamahabrahmana Part-ii. 392 pgs. Pandit Mukund Ram Shastri. Chinnaswami Sastri. Rajanaka Jayaratha. Sanskrit. Sanskrit... 1938.. Sanskrit. 502 pgs.m.. Madhusudan Kaul Sastri. 508 pgs... Sanskrit. The Tarka Sangraha Of M. Philosophy.… 81/167 . Madhusudan Kaul Sastri. 1936. The Stava Chintamani Of Bhattacharya. Unknown.. Sanskrit.... The Tattvartha Deepa-nibandana.. Pt. Unknown. Sayanacarya. Sanskrit. Sanskrit. 1921.. 1942. vaman shivram apte. Unknown.

285 pgs. 244 pgs. 1927. Unknown. The Vajasaneyi Samihita. The Veda Bhasya Bhumika Samagraha. 400 pgs... Sanskrit. 1968. The Unadisutras In Various Recensions Vi. Linguistics. 1917. Unknown.. Unknown. Sanskrit. Unknown. Sanskrit. Sanskrit. 1942. The Vishnu Purana A System Of Hindu Mythology And Tradition. 388 pgs.... The Vikramorvasiyam Of Kalidasa. Literature. H D Velankar. Sanskrit.. Sanskrit. 296 pgs. The Vidusaka. 338 pgs.org/…/SanskritIIIT. 1959. Sanskrit. Svetavanavasin.. 1893. 307 pgs. The Vidyaparinayana of Anandarya Makhi. Unknown. 414 pgs. Hari Raghunath Bhagavat. Linguistics Literature. 307 pgs.. The Upanishadbhashya Vol. B. 1927. Sanskrit. Sanskrit. 1972. 244 pgs. The Vrishabhanuja Natika Of Mathuradasa. The Vikramorvasiyam A Sanskrit Play Edition Iii. Art. 1891.. Arthur Venis.. S B Athalye. 1984. Language. 91 pgs. The Vasistha Darshanam.. Pandit Mukunda Rama Shastri.. 764 pgs. 66 pgs sanskritdocuments. Sir Ganganatha Jah. Madhusudhan Kaul. Unknown.. Sanskrit. T R Chintamani. Pandit Sivadatta. 374 pgs. K V Sarma.l.. 1992. Language.. Linguistics.. Unknown. Pandit Kedharinath Sarma.. The Upanishad Bashya Vol Ii Part I.. The Unadisutras In Various Recensions. 560 pgs.2/14/2011 pgs. The Vivadhachintamani Of Vachaspati Mishra. The Vishnu Bhakti Kalpalata Of Purushottama. Sanskrit. Sanskrit.. The Varaha Mahapurana. Pandit Surendra Nath Shastri. Unknown. Anand Swarup Gupta. The Vatulanatha Sutras. The Vivadachintamani Of Vachaspati Mishra. The Vizianagram Sanskrit Series Volume Ii Part I. Sanskrit. 587 pgs. 1942.. Sanskrit.atreya. T R Chintamani. 642 pgs. Unknown. 1942. 1961... 1980. ganganatha jha. Sanskrit.... Sanskrit. Sanskrit. Sanskrit.. T R Chintamani. 1993. Unknown. 1927. Linguistics Literature.. Vaidyasastranipunah. Unknown. Acharya Baladeva Upadyaya.. The Vikramorvasiya Of Kalidasa. Sanskrit.. Prof. Sanskrit. Unknown. The Vikramorvasiyam Of Kalidasa Edition I. 474 pgs... Unknown. Unknown.. 1918. 1901... Unknown. 236 pgs.... Unknown. Sanskrit. 1933. Pandit Sivadatta. Unknown. 64 pgs. Sanskrit. 279 pgs... 1923. Sanskrit. pgs. 122 pgs.. Linguistics. The Vrishabhanuja Natika Of Mathuradasa Edition Ii. H H Wilson. 1933. 1932.. Unknown. Language. Upanishads. Dr Albrecht Weber.. The Unadi Sutras.I I Part. A list of scanned Sanskrit books at III… The Unadisutras In Various Recensions. 1932. 400 pgs. Sanskrit. Pandit Sivadatta. 1942... 58 pgs... Sanskrit. Unknown. The Vamana Purana. The Varshakrityadipika With Kalanirnaya And Vratodyapan. Literature. Sanskrit.… 82/167 . G K Bhat. The Vijnana Bhairava. 104 pgs. Pandit Shankar Pandurang. Sanskrit. Upanishadas. The Vakyapadiya. Literature. 472 pgs.... 1985.. 1928..I I. The Unadisutras In Various Recensions 1 Of Svetavanavasin... Hari Raghunath Bhagavath.. 1096 pgs. pandit nityananda panta parvatiya. 1989.. Sanskrit.

Unknown.. History. Unknown... 68 pgs. Theology. 1910. Archicture. sanskritdocuments. Burke A Hinsdale.. 0.. Bhagavat Patanjali. 190 pgs.srinivasagopalachar. Tirthacinthamani Vol 1.. 305 pgs. The Yudhishthiravijaya Of Vasudeva. S C Sen Gupta. Brahmadattaji Jigyasu. Sanskrit. Sanskrit. Samarapungava Dikshita.. A list of scanned Sanskrit books at III… The Vyakarana Mahabhasya Part 1. 426 pgs... 272 pgs. Unknown.. T T Srinivasa Gopalachar. Mahamahopadhyaya Pandit Sivadatta. Mahdeva Sastri. 1944. 100 pgs. The Unadi Sutras. Language. 634 pgs. 1948. Tilakamanj-jarii Da~vitiiyaavrxtti. Philosophy.. 1936. Sanskrit. 1912. 1931. 516 pgs. 474 pgs. Sanskrit. 98 pgs. Kamalakrishna Smrititirtha. The Works of Sri Sankaracharya Vol Xvi. 234 pgs. Niharranjan Ray. Biography... Tinantarnavatarani. The Works of Sri Sankaracharya. 1948. Tirthacinthamani Vol Iii.. Language. Linguistics.. 622 pgs. 99 pgs. Literature. Art.… 83/167 . Unknown. Geography. 602 pgs. The Yoga Upanishads.. Sanskrit. Sanskrit. Art. Thruhan Sutr. 305 pgs. Kamalakrishna Smrititirtha. Sanskrit. Pandith Ramchandra Jha.. The Unadi Sutras. Tittriyopanishat Atharaiyopanipancha. Sanskrit. Thirteen Trivandrum Plays Attributed To Bhasa Vol Ii. The Yadavabhyudaya Of Sri Vedantacarya.. 1993. 1961. Subrahmanyakavi S. Language. 1944. 700 pgs. Literature. Sanskrit. T T Srinivasa Gopalachar. Religion. . The Unadi Sutras. 116 pgs. 1931. Tirthacinthamani Vol Ii. The Yatra Prabhanda.. Sanskrit. Geography Biography History. Sanskrit. Theravada Buddhism In Burma. Bhagavat Patanjali. Thrastadyayi Bhashya Vol I. The Works of Sri Sankaracharya. 1951.. The Works Of Sri Sankaracharya Volume Iv... 327 pgs. .. Unknown. 639 pgs. Sanskrit. Tiloya . 252 pgs.. History. W Redloff.. The Vyakarana Mahabhasya Part 2. Sanskrit. Thomas Hardy.. Sanskrit.. Sanskrit.. Sanskrit. 1911. Biography. Sanskrit. 1815.. 1911. Unknown. 0. Sanskrit. 350 pgs. 1983. 1950. 202 pgs.. 1920. Unknown.. Unknown. 1952. Linguistics. Sanskrit. Kamalakrishna Smrititirtha... Geography.. T. Sanskrit. Chaara~ya Yativrxshhabhaa... 1994. Shriidanapaala. Sanskrit. Thorale Shaahu Maharaaja Yaan'chen' Charitra Aavrxtti Da~vitiiyaa. Linguistics. Sanskrit. Tisastvustik.. Unknown.. Pandith A.. 162 pgs. pgs. 126 pgs. Literature. History. Dr P L Vaidya. 654 pgs. Chit'and-iisa Malhaararaamaarava.org/…/SanskritIIIT.. 0.... Unknown. Tirthacintamani. Unknown.chintamani. Sanskrit. The Yadhavabyudaya Of Sri Vedanthacharya. Geography. Sanskrit. Sanskrit.r. Thrikalavachedhikavadhaha. Tiloya Pand-nd-attii Dditiiyo Bhaaga. Geography Biography History.. T. Biography.2/14/2011 pgs. 1938. 451 pgs.. 1930. Sanskrit...Pannatti Part Ii.. 1883... 524 pgs. Unknown. Vishrug.... Sanskrit. 1965.. A C Woolner.. The Yadavabhayudaya Of Sri Vedantacharya. 0. Sanskrit..

. Religion. Theology. 1923. 237 pgs. 1934. Literature. Language. Und-aadisuutraand-i Bhojiiyaani Shhashht'ho Bhaaga Grantha 7. Unknown. Sanskrit... 283 pgs. Language. 233 pgs. 1933. P.… 84/167 ...org/…/SanskritIIIT. Philosophy. Unpublished Upanishads. 256 pgs. Sanskrit. 330 pgs. K M Munshi. 122 pgs. Sanskrit. Sanskrit. 201 pgs. Language. Toegyehak Libery Part I Vol 4. Sanskrit. A S P Ayyar. Tristhaliisetu 78.. Jagadgurvo Vijaynante Taramah. 316 pgs. 238 pgs.. Linguistics...... 532 pgs. Theology. Veeraraagaya. pgs. 1929. Language. 1937. C... Simhavira Dura~ga.. 1953. 1929. Tripurabhaaratiilaghustava granthaan'ka 1. Dr. 147 pgs. 1995. 1929. Literature. Sanskrit. 0. Linguistics. Sanskrit. Chintaamand-ii Ti Ra.. Sanskrit... Unknown. Gajanana~ Shambu Sadhale Shastrii. Itaruka.. Damodhara Pand-d'itavara. 284 pgs. Und-aadi Suutraand-i Ditiiyo Bhaaga Grantha 7.. Kumham Raja. Upadesha Sahasri. Upanishads.2/14/2011 A list of scanned Sanskrit books at III… Toegyehak Libery Part I Vol 4.. Sanskrit. 158 pgs.. Unknown. Religion. Unknown.. Sanskrit.. 508 pgs. Sanskrit. Two Plays Of Bhasa. Linguistics. 1929. 1961. 675 pgs. Sanskrit. Sanskrit.. 1925. Linguistics Literature. 1934. Und-aadi Suutraand-i Grantha 7. Unknown. Psychology... Unknown.. Sanskrit. 1952. Unknown. Literature. Upadeshasahasri Part I. 97 pgs.... Upadeshasahasri. 1941. Somatilakasuuri.. 210 pgs.. 1933.. Literature.. The Arts.. 1959. Art. rajendra swarup gupta.m. 1936.. Theology. Theology. 52 pgs. Sanskrit. Religion. A. 94 pgs. Vasudeva Lakshmana Sastri. Und-aadi Suutraand-ii Bhojiiyaani Shhashht'ho Bhaaga. 1933. Trikonamithi... Ukttivyaktiprakarand-a. K. Sri Sankaracharya... Unknown.. Linguistics. 60 pgs. Theology.. 720 pgs. Shriinaarayand-ashan'karaananda. Unknown. Sanskrit.. Triddnimathvibhodhini. Language. Ullagharaghava Nataka. 62 pgs.. Art. Sanskrit. 194 pgs. 1966. 1940. Sanskrit. Und-aadisuutraand-i. Sanskrit. 1953. Naaraayand-a Dand-d'anaatha. Upanisad Vakya Maha Kosa Vol 1. Sanskrit. Linguistics. Umas Mirror. 665 pgs. Theology. 1925.. Unknown.. Upanishhadaan' Samuchchaya Da~vitiiyoyamang-kanaavrxtti..modi.. Two Vajrayana Works. 1941. Shaastri Shan'kara. 544 pgs. Unknown.. Udararachavam of Kavimalla Mallacharya. 302 pgs. Sanskrit. sanskritdocuments.. 1982. 1933. Sanskrit. Upanishhada Samuchchaya. Religion. Udaya Vadantha Granthamala.. Aapat'e Hari Naaraayand-a. Literature. Unmattaraghava. Upakarma Paddhathi. 1946.. Religion. Benoytosh Bhattacharyya.. Sanskrit. V Krishnamacharya. Dinakar Krishna Gokhle... Und-aadisutraand-i Prathamo Bhaaga. 1952. Unknown. Upanishhada~vaakyamahaakosha Uttaraara~dhaha~. Sanskrit. Sanskrit.sudhakar Malaviya.. Naaraayand-a.. Religion.. 308 pgs. Sanskrit. Krishnaswamy Iyer. 314 pgs. Trin'shachchha~lokii Grantha 104. Agama Prabhakara Muni Punyavijaya. Religion. Pandith Sri Durgadutta Tripathi. 403 pgs. Sanskrit. Chintaamand-inaa. Chintaamand-inaa. Sanskrit. Sanskrit. shastri gajanan shambhu sadhale. Chintaamand-inaa Ti Raa.. Sanskrit.. Sanskrit. Theology. Religion. Translation Of Siddhanta Bindu.. Theology. 1984. 1933. 638 pgs.

1976. 1940... 450 pgs. Vaiiyakarana Siddhant Laghumanjusha... Philosophy. Sanskrit... Vaidik Sahitya Ka Itihas. Theology. Srinivasamakhi Vedantadesika. Upanishhaddaakya Mahaakosha Prathama Khand-d'a.. 1930. Unknown.… 85/167 . Unknown. Sanskrit. Vaidik Sathya Prakasha. 1987. 200 pgs.. Sanskrit. Vaakyaara~tharatnama~. Sanskrit. 411 pgs. Theology. 210 pgs.. Sanskrit. 541 pgs. sanskritdocuments. Sanskrit. Vaishmavism. Balakrishna Misra. Sanskrit... Sanskrit. 693 pgs. 1912. Narayan Ram Acharya.. Philosophy. 1943. Psychology.. Upanishhadratnaprakaasha Ratna Chhaandogyopanishhada~. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Upanishhadbhashhyama~ Dvitiya Bhaaga Dvitiya San'skarand-ama~. Vidwan Satyadhyanacharya. 296 pgs. Srinivasamakhi Vedantadesika. Sanskrit...... Unknown.. Bhagva Dutt. Vaidhyachandrodaya Vol Ii.. Religion. Sanskrit. 66 pgs.. 1943. 1940. 1925. Unknown. Shriimadahobalasuuri. 1997. Vaikhanasa Gruhya Sutram vol 1. Vaidika Padanukramakosa Vol 2 Part 1. Sanskrit. 1935. Religion Theology.. Uttara Purana Of Acharya Gunabhadra. 408 pgs. Sanskrit. Pandith Madhava Sastri Bhandari.. 375 pgs. 1941. Theology.. Gajaanana Shambhuputro. 1954. Unknown. Sanskrit. Sanskrit. 376 pgs. Sanskrit. Sanskrit. Uttararamacharitra. Pandarinathacharya. 161 pgs.. Psychology. M M Pandit Deviprasada Ravichakravarti. Gruhya Sutras. Sanskrit. Bhishkakavi Sri Rashachandra. 1921. Sanskrit. 348 pgs. Religion. Literature. Sanskrit.. 672 pgs. W.. Religion. Bhid'e Sadaashivashaastrii... Unknown. 1933.. 605 pgs.. Sanskrit.. Utsarjano Pakarmapaddhatih. Visva Bhandu Sastri. 420 pgs. 1934. Sanskrit. 576 pgs..... Unknown. 1931.. 2001. Unknown. Vaajasaneyipraatishaakhyama~ Kaatyaayanaprand-itama~. Vaidyakiyasubhasitasahityam. Sanskrit. Veng-kat'araamashara~maand-an. Sanskrit. 1971. Psychology. 1933. Natural Sciences. Advaitam. Shaastri Shamaa. Unknown. Unknown. Vaikhamsa Gruhya Sutram vol Ii. Sri Somadev Suri. 391 pgs.. 639 pgs. Dr Ram Murthy Sharma. 444 pgs. Theology.. Sanskrit. Appayya Dikshita. Urubhangam Breaking Of Thighs.. Unknown. S Subramanya Sastri.. 142 pgs. 0... Shriishan'karaachaara~ya. Tirunoymozhi. Vag Vallabha Of Sriduhkhabhanjanakavi.. 172 pgs. Vaalmiikiiya Raamaayand-ama~ Baala Kand-d'ama~ Paqs-chimottarashaakhiiyama~.... 1981. C R Devadhar. 516 pgs.. Subramanyamu V. 1997. Vaijayanthi Kosa Volume Ii. 1932. 1954.org/…/SanskritIIIT. Vada Varidhi.. 106 pgs. Vaalmiikii. 1949..caland. Vaidik Avem Vedottar Bharatiy Sanskruthi.. Vaidik Vadgamya Ka Itihas Vol I I. Paridath Kalarama Shastri. Bhid'e Sadaashivashaastrii.. Upasakadyayan. Sanskrit. Sanskrit. Sanskrit. Usaniruddha. 659 pgs. 766 pgs..... 64 pgs. Sanskrit.. Sanskrit. Sanskrit. 355 pgs. 44 pgs. Vaaraahagrxhma Suutra Bhaaga Xviii. 1945. 309 pgs. 1949. 1932.. Vedas. Unknown. Religion. Vaikhanasa .. Subramanyamu V. Upanishhadratnaprakaasha Ratna Chhaandogyopanishhada~. Vadavali. Unknown. 1928. Vadanakshatramala. Philosophy. Sanskrit..Srautasutram. Pandit Pannalal Jain. Dr Gaurishnakar Mishra.

. Literature. Sanskrit. Sanskrit.. 1929.. Sri Nagesa Bhatta. Unknown.. Literature. 2002. 0. 0. Indian Logic. . Religion.. Vyakarnopadhyaya And Sahitya Tirthac. Sanskrit. Sri Nagesa Bhatta. Vamanapurana. Sri Achyuta Krishnananda Tirtha.. Sri Nagesa Bhatta. 104 pgs.... Theology.. Unknown. 1925. Vaisakha Mahathyam. The Arts. Vaiyakarana Siddhanth Laghumanjusha.. 1925. 108 pgs. Sri Nagesa Bhatta. Sanskrit.. Sanskrit. 1938. Sanskrit. Vanshabhaskar.. Vaiyakarana Siddhanta Laghu Manjusha No 214. 1960. Sanskrit. Sanskrit...... Vaiyakarana Siddhant Laghumanjusha. Sanskrit. 414 pgs... Sri Nagesa Bhatta. Vakyartha Vivechanam. 190 pgs. 96 pgs. Literature. The Arts. 1929. Pandith Sri Sitaram Sastri.. Sanskrit. Sri Nagesa Bhatta. Unknown. 292 pgs. Kand-ada Mahara~shhi.. Sanskrit. Literature. Religion. Unknown.. Unknown. Sanskrit. 104 pgs. 102 pgs.. Sanskrit. Sanskrit.. 106 pgs.. Sanskrit. Vaishampaayananiitiprakaashikaa. Sri Nagesa Bhatta... Vanamala A Commentatory On The Taittiriyopanishad Bhashya. Sanskrit. . Philosophy. 326 pgs. Sanskrit. 1961. Sanskrit. Vamana Suktam. Vaiyakarana Siddhanta Laghu Manjusha No 253. Shriijat'aasin'hanandi.. Pandith Madhava Shastri. Sanskrit.. 1984. Vaiyakarana Siddhanta Laghu Manjusha No 212. Vaiyakarana Siddhanta Laghu Manjusha No 192. 227 pgs. 1929.. Vaiyakarana Siddhanta Laghu Manjusha No 238.org/…/SanskritIIIT. Vaishampaayana. 110 pgs. Language.. 360 pgs.. Vaiyakarana Siddhanta Laghumanjusha No 213. Language. 106 pgs. Unknown. Vaiyakarana Siddhanta Laghu Manjusha No 328.. govindlal hargovind bhatta. 1913. Language. Sanskrit. 1929. 1953. 1954.. Unknown. Varaang-gacharitama~ Prathama San'skarand-ama~.. Vanamala. 314 pgs. Dr Dhanurdhara Jha. 1924.... venkatrao rayasam. 1974.. Sanskrit. 354 pgs. 1928. Pandith Sri Sitaram Sastri. 1913. 0. Krishna Singh ji.. 1924. Literature. 508 pgs. Sanskrit. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Vairagy Shatak. Sri Achyuta Krishnananda Tirtha. Sanskrit. Muni Sri Jambuvijayaji.. Vaisheshhika Dara~shana. 1172 pgs. 88 pgs.. 114 pgs. Sri Parameswardin Pandey. 112 pgs.. Unknown. 222 pgs.. Linguistics. 186 pgs. Sri Ananta Sastri. Unknown. 144 pgs. Unknown. Sanskrit. Linguistics.… V h h L Li i ti Lit t S k it 0 502 86/167 .. 106 pgs. 110 pgs. Sanskrit. 1993. Vaiyakarana Siddhanta Laghu Manjusha No 237. Unknown... 376 pgs. 0. Vaiyakarana Siddhanta Laghu Manjusha No 227. Unknown. 1928. Linguistics.. Sri Nagesa Bhatta.. 1927.. 1961. Vaiyakarana Siddhanta Laghu Manjusha No 228. Vaiyakarana Siddhanta Laghu Manjusha No 211. Unknown. Vakrokti Jivita Of Raja Rathnakara. 1929. Unknown. Pandari Krishnacharya... Sanskrit.. Sanskrit. Unknown. Vaiyakarana Siddhanta Laghu Manjusha No 191. Sanskrit. Valmiki Ramayana Volume One.. 104 pgs. Vaisesikasutra Of Kanada. sanskritdocuments. Unknown. Psychology.. Sri Nagesa Bhatta.

. Sanskrit. Sri Giridhar Sharma Chaturved. 1986.. Unknown. Kaviraj Nagendra Nath Sen. 2004. Sanskrit. Vedanta Darsana. Religion.. Sanskrit. Psychology. Vedanta Sutramu Mdravali. 0. Veda Praveshah... Unknown.n.venkatesacharya. Language. 502 pgs.. Unknown. Sanskrit. 1911... Vedanta.. Literature. 522 pgs. 62 pgs.org/…/SanskritIIIT. 292 pgs. Vedanta Sutramu Mdravali. Sanskrit. Linguistics. 460 pgs. Vaishmavism. Vedaantaparibhaashaa.. 1952. Sociology. 1992. History. 1270 pgs. Pandit Harilal Jain. 1984. pgs. Unknown. Sri Yudishtara Mimansa. Sanskrit. Sanskrit. 1951. Vedaanta Tattva Viveka.. 363 pgs. Vararuchasangraha. 456 pgs. Veda Bhasya Bhumika Samgraha. 548 pgs. Aadhvrina~ Dhara~maraaja. Unknown. Psychology. Sanskrit. Vedaantasaara. Literature. A. 1986. Vedaantasutramukttaavali. 2000. 82 pgs.. 272 pgs. Linguistics. Philosophy.. Kaviraj Nagendra Nath Sen. Bhagavadraamaanujama.... 0. Theology. Sanskrit. Sanskrit. Ganga Prasad Upadhyay. Sanskrit. Sanskrit. ... Shivasahaaya. Vedakalija Narisiksha. Varahi(bruhat) Samhita. Sanskrit. Psychology. 1991. Psychology. 1973. 215 pgs. 504 pgs. Vasunandi Shravakachara. Sanskrit... 1967. 1872. Vatsaraaja Udayand-a. Veda Samiksa.. 237 pgs. Unknown. Unknown. 80 pgs. Geography.. Narayana A. Ganga Prasad Upadhyay. Sanskrit. 425 pgs. Philosophy.. Unknown. Dr.2/14/2011 A list of scanned Sanskrit books at III… Varahamahapuranam. 236 pgs. Sanskrit. Shri Brajnath Sharma..srinivasaraghava Aiyangar.. 413 pgs. Ramananda Saraswati Swami... Unknown. Philosophy... Philosophy. Vararuchasanghrahar. 1915.. 238 pgs. Baladeva Prasad.. Sanskrit.. 340 pgs. 234 pgs. 249 pgs.. 92 pgs..a.. Veda Pravachana. Sanskrit. Unknown. Vedanta Sutramu Mdravali. Vasantatilakabhaand-a.. Unknown. Vedakhasarodhar. 1986. 2000. Subramanya Sastri S. Narayana.... 1969. Mishra B N. Vedanga Prkasa. Religion.pandey.. 1942. Vedas.. Vedanta Prakasa. Sanskrit.n..... Namitha Garg. 440 pgs. Shriinrxsin'hashrami. 1955. 1998.. 81 pgs... Unknown.. Vedantanayabhushanam. Sanskrit. 190 pgs. 193 pgs.j. Vedantakaustubhaprabha Accn0 478. 1948. Unknown.. 1976. Vararuchi Avam Hemachandra Virachitha Prakrutha Vakarna 2739. 1965. 101 pgs. Vasu Caritram.… 87/167 . Sanskrit. Dr B Rama Raju. 0. 1998.. Unknown. Sanskrit.r. Sanskrit. S S Suryanarayana Sastri. 872 pgs... Vaydyak Sabdasindhu. Sanskrit. Varivasya Rahasya Accn0 1281. Sanskrit.. 1984.. 81 pgs. 106 pgs. Sanskrit.... Unknown.. . Sanskrit. Vedandak. 1838. B.. 130 pgs... 1942. Sanskrit. Sanskrit. Sanskrit. Philosophy. Unknown. Language. Sanskrit Samhitas. Biography. 1971. Kaat'adare Maadhavakeshava. Shriivaradaacharayaa. 1964. Vedanta Sara Cintamani. 1953. Dr. Sarasvatii Bramhaananda. Sanskrit..e. Unknown. Pramodini Pandu. Varahamihira Horasastram. R K Prapannacharya.. Vedaanta Raamaayand-a Bhaashhaat'ikaa Sahita...sree Krishna Sarma. Religion. sanskritdocuments. Sanskrit. Chenna Reddy. Sanskrit.

.. 362 pgs. 55 pgs. Unknown. 2001.. Sanskrit. Vemabhupala Charitram.. 1962. Sanskrit.. Sanskrit. Vedanthasindantha Mukthavali. Unknown. 758 pgs. Venkatasuris Nauka Charitram In Sanskrit. 362 pgs. 1947. P Sambamoorthy.krishnamurthy Shasthry. 644 pgs.. Jambhaladatta.. Unknown. Veeramithrodaya. Srimath Paramahamsa Parivrajakacharya. 1989.. Sanskrit.. Sanskrit.. S. 366 pgs. 292 pgs. Pandit Shada Shiv Sharma.. 666 pgs. Vedantha Paribashaa. Vedic Kosha. 1959. 115 pgs. Vedic Padhanukrama Kosah Part 3.. Vedantnamaratnasahasram.. Unknown. 1971. . Sanskrit. Unknown. Venkatachala Ithihasamala Anantarya. Sanskrit. 1964. Vedhaththa Suthra Mukthavali.. T. 1975. 0. Vishva Bhandu.. Venkateswari Thatkruthinam Adhyayanamu. Sanskrit. Vedic Padhanukrama Kosah Vol 3 Part 2. Unknown. Unknown. 520 pgs. 1959.. 76 pgs. Prakasanamba. 846 pgs. Vedic Padhanukram Kosah. Pandit Mitra Misra. 892 pgs.. Sanskrit. Unknown. 1958. 1992. Vedic Padhanukram Kosah Vol 1. Panchanana Bhattacharya Sastry. Art. Sanskrit. vishva bhandu. Philosophy. Sanskrit.. visva bandhuu sastri. Sanskrit.. Unknown. visva bandhu sastri. Sanskrit. Unknown. Unknown. Unknown.. 892 pgs. Sanskrit. Sanskrit. 1992. Brahmanadha Saraswathi. Unknown. Sanskrit... Unknown.. 1998. Somraj Krishna Das. Wasudev Laxman Sastri Pansikar. Vaman Bhattacharya.. Vedic Hymns. 209 pgs.. Krishnamurthysahastryvarya. Literature. Sanskrit. vishva bandhu.r. 1945. 1988.. Vedic Padhanukrama Kosah Part 1. Vedic Padhanukrama Kosah Part 2.... 338 pgs.... Sanskrit. Visva Bandhu Sastri. Dr Kunwar Lal.. Sanskrit.. Vedic Padhanukrama Kosah Vol 1 Part 2.. Krishnamurthysahastryvarya. Vamana Bhatta Bana.. Vedavyasaparampara. sanskritdocuments. Sanskrit. Srimithra Mishra. vishva bhandu. 1984. Vedic Padhanukrama Kosah Vol 4. Sanskrit. Sanskrit.. Unknown. 1969... Language. Dr G Swaminath Charyulu. Vedardhasamgraha Geetha Bhashya. Visva Bandhu. 998 pgs. Literature. Vedhantha Paribhasha. Unknown. 261 pgs.. Sanskrit. 1969. 700 pgs. 1970. 1952. 1988. Veershaivendru Shaker. 290 pgs. P Bhagaddatta amp Hamsaraj. 1961. 240 pgs... Unknown.. Unknown. 1945. 258 pgs.. Vedic Padhanukrama Kosah Vol 5 Part 1. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… Vedantaparibhasa Accn0 583. Vedanthanamaratnasahasram.. Linguistics... Philosophy. 1910.. 150 pgs.k. 201 pgs. Unknown. S N Srirama Desikan.org/…/SanskritIIIT. Sanskrit. 1867. Sanskrit... Sanskrit. Sanskrit. Vemanapadyamulu In Sanskrit Slokas. 117 pgs. 238 pgs. Literature. 1945. Veeramitrodaya. S S Suryanarayana Sastri. Vedharya Sangrahah Geetha Bashya Gadyayatra. G Swaminadhacharyulu. Linguistics. ... vishva bandhu.. Vedic Hymns. Unknown... Vetaalapanj-chavin'shati.… V t l P h Vi h tih S N Sh ti U k S k it 1949 66 88/167 . Sanskrit. 500 pgs. -. Unknown. 1942. Venkatadvari Tatrkuthinam Adhyayanam.. Sanskrit.krishna Swamy Aiyar.... 390 pgs.. Sanskrit. 704 pgs.. 1955. Vede Ashvinau Asvins In The Vedas. 290 pgs. Vedastuti Volume Iii. Sanskrit. 500 pgs. 260 pgs. 1969. Language. 1979. Unknown. 1939.. Vema Bhupala Charitam. Philosophy. 1864.. 806 pgs... Sanskrit.

Giridhara Upadhy.. Viira Vinaayaka. Biography. Vidyamadhaviyam Of Vidya Madhava. Sanskrit.. 1923. Vimarshamruthamu. 1901.. Shriikaalidasa~. Unknown. Unknown.. Vishnupurana With 2 Commentry amp Tika Vishnucitta amp Sridhara. Sanskrit. 123 pgs. Vishnu Dhrmoattara Puranam. Vibhaktyarthanirnaya... Vikramorvasiyam Of Kalidasa. Literature. 58 pgs. Vidhyaamaadhava. Bhat't'a Shriinrxsin'ha. 1925. 1966. Vidagghamukhamand-d'anakavyama~. Unknown. 110 pgs. 0. Sanskrit. 304 pgs. 419 pgs. 0. Dr B R Shastry. Unknown. Sanskrit.… 89/167 . Unknown. Vibhaktyartha Nirnaya.. 677 pgs. 330 pgs. Pandit Mukunda Shastri. History. Sanskrit.dalsukh Malvania. Vishnu Prasad Sharma. 1901. Sanskrit. Pt.. 334 pgs... Visesavasayakabhasya Part 1. Deshapaan'd'e Ga Vi. Vishampadh Vakya Vritti. Sanskrit. sanskritdocuments. Unknown. Vidhi Rasyana.. Vidhyaamaadhaviiyama~ Trxtiiyasan'putama~ 11-15 Adhyaayaa. Sanskrit. Virodha-varuthini. Viramitrodaya Samaja Prakasha Vol X.org/…/SanskritIIIT. 1645. Sanskrit. Sanskrit. 106 pgs... Giridhara Upadhy. 364 pgs. Vikramarkandeva Charitram. 0. Sanskrit. Religion. Vikramora~vashii trot'akama~ Chatura~tha San'skarand-ama~. Unknown.. 94 pgs. 108 pgs...2/14/2011 A list of scanned Sanskrit books at III… Vetala Pancha Vimshatih. 1952. R Shama Sastry.. Religion... Vishnu Prasad.. 230 pgs.... 151 pgs. Shri Ram Sharma Acharya... Unknown. History. 257 pgs. Swamy Vivekananda. Vidura-niti. Jyotira~vichchhridayaanaatha. 1987. Viramitrodaya Bhakti Prakasha Vol Xi... Sanskrit.... Sanskrit. S N Shastri. Sanskrit. Sanskrit. Unknown.. Sanskrit. Sanskrit. Unknown. Natural Sciences. 0.. Theology. Natural Sciences. 1920. Somraj Krishna Das. 172 pgs. 1949.. Unknown. Shriidhara~madaasasuuri. Sri Giridhara Bhattacharya. 1901. 106 pgs. 194 pgs. Vibhaktyarthanirnaya V. Sanskrit. 1978. Sanskrit. 1901. Vidhura Nithi. Theology. 1954.. 0... Unknown. Vikrantabharatam. Giridhara Upadhy. . Unknown.. Vibhaktyarthanirnaya Iii. Unknown. V. Somraj Krishna Das... Visakhadattas Mudraraksasa Edition I I. 1948. Unknown. Pandit Madhava Prasad Vyasa.. 1987. Sri Paripurna Prakashnanda Bharathi Mahaswamin. Visesavasyakabhasya With Srikotyaryavadiganis Vivarana Part Iii. Sanskrit. Geography. Unknown. Literature.. 106 pgs. 156 pgs.... Sanskrit. 1986. Sanskrit. Venkat Ramana Reddy. Sanskrit. . 101 pgs. Vishnu Prasad Sharma. Vidhiviveka.. -.. Sanskrit. 1939. Sanskrit. R R Deshpande. Visheshik Darshan. Vibhaktyarthanirnaya Iv. 1901.. 1964. Linguistics. Virodha Varuthini. Jagannath Sastri Hosinga. 202 pgs. 67 pgs.. 400 pgs... Sanskrit.. 1997. Vimand-d'alavakravichaarah.... V Venkataramana Reddy. Geography. Unknown. Sanskrit.. 1916. 240 pgs... Viramitrodaya Vol Xx. Sri Giridhara Bhattacharya. Sanskrit.. 124 pgs. . Literature.. Sanskrit. 1986. Language.. 1926. 1966. 428 pgs. 290 pgs. 382 pgs. Mahaprubhu Lal Goswami. 1867. Sanskrit.. shriramavathara sharma. Sanskrit. Unknown.. Nanuji Bhatt. 66 pgs. Vidhaanamaalaa Grantha 86.... Unknown.. Literature. 0. Biography. 390 pgs... Vichara Ratnakara Kirtivijana. Dalshuk Malvania. Sanskrit. 170 pgs. Unknown. Unknown. 168 pgs. 1926. Sanskrit. Sanskrit.

Acharya Madhusudhan Shastry. 1818.. 166 pgs. Sanskrit. Natural Sciences.. V Rangaswami And Krishna. 240 pgs. Philosophy. Swami Madhavananda. 146 pgs.shiv Dutt Mishra. P. Unknown.. Dr.. 338 pgs.. Sanskrit... 1957.k. Vishyanukramanika. Vivahapatlam Sarasamuchaya... Bhat't'aachaara~ya Gadaaghara. 1942.. Sanskrit. Vyakarana Mahabhasyam Of Patanjali Muni. Linguistics... 1926. 284 pgs. 538 pgs... 1940. 605 pgs.. Sanskrit.. Unknown. Unknown. Vyakarana Siddhanta Kaumudi. Veng-kat'araamashara~maa Ve. 1969.org/…/SanskritIIIT. Sanskrit. Religion. Jinaprabhasuuri.. 1891... Sanskrit. Sri Ramachandra Kavi Bharati. 1935. Vrttaratnakara. Sanskrit. 610 pgs. Vyavahaaramayuukha. Vrittaratnakara Edition Vi. 1929. Vyakaranabhushanasara. 0.. Sanskrit.. Ramasastri Bhagavthacharya. 1954. 336 pgs. Unknown.. Vrttaratnavali. Literature.. Theology. 1914. Visvamitra Samhita. Visnusmrti Ii.. 616 pgs. 535 pgs. Religion. 277 pgs. Vyayasasidhanta Marthandam. Viveka Chudamani Of Sankaracharya.. 234 pgs. Sanskrit. Unknown..shiv Dutt Mishra. 1948. 1942.. bhattoji dikshita. Pandit V.. Sanskrit.. Ganga Vishnu Sri Krishnadas. 1983... Sanskrit. Unknown.krishnamacharya. Sanskrit. 1934. 81 pgs. Sanskrit.. B V Narasimhacharya. 1921. 362 pgs. Vrataraja. 909 pgs. Sanskrit. Anant Ram Shastri. 1994.. Vyutpattivada Of Gadadhara Bhattacarya. 624 pgs.. Pt.. . Sanskrit. Unknown.. Somraj Krishna Das.2/14/2011 A list of scanned Sanskrit books at III… 1967. 1943.. ...… 90/167 . Visuddhimaggo Prathama Bhaaga. Vyakarana Koumudri. Sri Rudradharajha. Sanskrit. Buddhaghosaachariya.. 1964. Sanskrit. 645 pgs. Sri Giri Sharma Chathurved. Shriibhagavatpatan'jala. Unknown. Visnuvilasa. Visukipuranam.. 430 pgs. Sanskrit. 246 pgs. Sanskrit. Vyavahaaramaalaa. Psychology. 1954. Sanskrit. Literrature. 506 pgs. 1983. Sanskrit. . 1993.. 1957. Unknown. Religion. Vyasasidhanta Marthandam. Sanskrit. 1981. Theology. Unknown.. Unknown.. Unknown. 1988. Unknown.. 312 pgs. Sanskrit. Mohamahapadyaya Kapisthalam Desikachariar.. 1951. Vizianagaram Sanskrit Series.. 562 pgs. 0. Unknown. 541 pgs. Vritharatnakaram. sanskritdocuments.. 865 pgs. Undemane Shankara Bhatta. Unknown. Sanskrit. Vyakaran Maha Bhasyam. Vyutpattivaadah Lakaaraara~thavichaarah. Sanskrit. 1948. Theology.aryendra Sharma.. Vyutpattivada. Mahadev Chimanaji Apte. 245 pgs. 168 pgs.. Religion. Vyakaran Siddhanta Kaumudi Balmanorama Pradhamabagamu.. sri vasudev dikshit.. Sanskrit. 837 pgs. 115 pgs. 304 pgs.narayana Pillai. Sanskrit.. Vyaakarand-amahaabhaashyama~ Tatraang-gaghikaara Da~vitiiyo Bhaaga.. Unknown. Vyavahara Nirnaya Of Varadaraja. Language. Unknown. 339 pgs. Literature. Viwahsopangvidhi.. Eluu Eluu. Vividha tiira~thakalpa.. 0. Religion.. 668 pgs. Philosophy. Pt. Sanskrit. Psychology. 1991. 228 pgs.... Sanskrit. .. P Gopalachandra Vedanthashasri.. Sanskrit. -. Visnudharmottara Mahapuranam.. Srinivas Ayyangar.. 1929. . Sanskrit. Sanskrit. Somraj Krishna Das.

Yatinder Matdipika. 1934.. Philosophy. . . 1954. 0.. Sanskrit... Yatidhara~masan'grah Grantha 60. Sanskrit. Yajurvedha Maithrayani Samhitha.. Damodar Bhattasununa. Wasudev Laxman Sastri Paniskar. Yagavasista Vuthu Paryay Prakasika Part 1. 1953. 0. Sanskrit. Parashuram Shastri. Narendra Nath Sharma. 246 pgs.. Yashodhara Mahakavyam. . Sanskrit. 89 pgs. Appayya Dikshita. 1953. Sanskrit... Yagavasista Vuthu Paryay Prakasika Part 3.. Sanskrit.. 0.. Taitriya Samhita. Philosophy. 2003. .… 91/167 . Sahibji Maharaj Sir Anand Sarup. 136 pgs. Sanskrit. Yekankavalih.. 360 pgs. 0. Yajurvediya Kataka Samhita.. Sanskrit. Yoga Vedanta Dictionary. Philosophy. Pandit A.. Sanskrit.. Unknown. 1980.... Theology. .. Sanskrit.. Maiva Ram Kattara Padka. Sanskrit. Girish Chandra Sharma. Sanskrit. Sanskrit.. 186 pgs.. . 132 pgs.. Yoga Karnika.. 196 pgs. -. 1956.. Unknown. 0. Bhat't'a Daamodara. 204 pgs. 1950.. 196 pgs. 258 pgs.. Philosophy.. Yekankastakamu. Dhamodar. Shriinivasadaasa. Unknown.. Religion. Sanskrit.. Sanskrit. Yajna Tattva Prakasa. 124 pgs. Yajura~vediiya Kaat'haka San'hitaa. 0. Philosophy. 152 pgs. 0. 1164 pgs. Unknown. Religion. 0. Unknown. Kesava Rao Sarma. Yadnyavalkyasmriti Of Yogishvara Yadnyavalkya Fourth Edition. Yathara Prakasa Part 1. 529 pgs. Acharaya Ram Kishore Misra...k.. Yajurvedasanhita Vol Iv. 0. Unknown. Yoga Chikista. .. Sanskrit.. 1930.chinnaswami Sastri. Yajura~vediiya Maitraayand-ii San'hita. 266 pgs. Sanskrit. Philosophy-22.. Linguistics. 251 pgs.. Sanskrit. 119 pgs. Paraaditya.o. 748 pgs. 1904. Psychology. Philosophy.. Sanskrit. Sanskrit. Theology. 162 pgs. 1981. Literature. 598 pgs. Sanskrit..v.. 2000.. 508 pgs. 101 pgs.. Sripad Damodar Saatvalekar. Yagavasista Vuthu Paryay Prakasika Part 2. Sudarsanacharya. 1951. 1953.. Yayathi Aakhyaan. Sanskrit. Yajnavalkyasmrti. 746 pgs. Unknown. 202 pgs. Sanskrit. 176 pgs.. Yatiindramatadiipikaa.. . 1976. . Sri Swami Sivanandh. Yajura~veda San'hitaa Dditiiya Vaaran.. 1977. 1998. Yagavasista Vuthu Paryay Prakasika Part 4. Sanskrit.. Sanskrit. Language.. Unknown. Theology. 1936. Yogachintamani Ki Anukramanika.. 1949.org/…/SanskritIIIT. Aapat'e Vinayaka Gand-esha. 600 pgs.. Yajhu Shakiyasanthikanda Pradeepa... Yajna Valky Smtuthi. 1864.. Religion. Philosophy.. 1868. 506 pgs. Umesh Chandra Pandey. Sanskrit. Yathiraja Vijaya Natakam.. Philosophy. Religion. 716 pgs. Unknown.. Sanskrit. 1924. Unknown.. 162 pgs.. Theology. Narayana Shastri Khiste. Philosophy.2/14/2011 A list of scanned Sanskrit books at III… Word Index To Taittriya Samhita.. 331 pgs. Parikshit Sharma. . Sanskrit. 439 pgs. 1927. Religion. Sanskrit. Sanskrit. Theology. sanskritdocuments. Yatindramatadipika. Yekanki Saptakam. Yajnavaikya Smrti... Yaanj-avalkya Smrxti Granth 46. 2000. Saan'tavalekara. Mukunda Sharma. 548 pgs. . Philosophy.. Sanskrit.. Srinivasadasa. Sanskrit. Saatavalekara~ vi esa~. .. 1945. 635 pgs. Yadavabhyudayam Sargas I To I V... Sanskrit. Literature.. Sanskrit.t. 183 pgs..

1987.. Literature. aanandamaalaa. 319 pgs. 1961.padmanaabha.. 456 pgs. 1929. Religion. Sanskrit. 1970..m. Shri Krishna Patna Shasthri. 906 pgs. Philosophy. 268 pgs. Kesav Srinivasulachari Kati. 172 pgs. Yuddhakandam Part Ii. Vasu Deva. . 352 pgs. Language. Language. Sanskrit. Sanskrit. Linguistics. 1500.. edward delavan perry. yamunaachaarya svaami. Yukthi Mallika Guna Saurabham. aadunika san'skrxta naat'aka nae tathya nayaa itihaasa bhaaga 1. 1937. Yogi Nihrdayam. Literature... 1964. Language..a. miimaan'sakashriiniilakan't'habhat't'a. Sri Madra Namikmaharshi.. 1067 pgs. 0. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… Yogavashishtahah Panchama Bhaga. 1979. 408 pgs. sanskritdocuments... Bannanje Govindacharya. Sanskrit. Linguistics. Language.. Linguistics.m.. Theology.. Sanskrit. Sanskrit. 1915. Philosophy. LITERATURE. Youginithantr. 244 pgs. Literature. Language. Pandit Dinanad. a sanskrit composition and translation manual.. 0... aahnikapaddhati.. Sri Krishnupanthshakina. Linguistics... Unknown. Sanskrit.. Literature. Literature. Literature. Language. 392 pgs. 183 pgs. 0. 854 pgs. Gopinatha Kaviraja... shriidharaachaarya.2. aanandaashramasn'skrxtagranthaavali gran'nthaang-ka 70. aabhaarapradashainamu. Language... 105 pgs.. 220 pgs. aagamapraamaand-yamu. Literature. 1953. Sanskrit. Sanskrit. Yogavasisht Bhasha. Yougachikithsa Indication Of Drugs. aagniveshyagrxhyasuutramn. Gandhi. Religion. Sanskrit. Unknown. Literature. 1909. 1912. pandit sarada prasad bidyabhushan. Aathrideva Vidhyalanker.. aagamarahasyamu vaatulashuddhaaravyamu. Sanskrit. 288 pgs. Unknown. Linguistics. Sanskrit. Linguistics. Language.. 172 pgs. Sanskrit.. aanan'dalahari No.. Language. a sanskrit reader.. Bhagavadgita. Sanskrit. Pandit Navya Chandidasa.. Sanskrit. Sanskrit. 0. Sanskrit. Art. Language.. aachaarendu.org/…/SanskritIIIT. 1917. 1940. Not available. a consolidated glossary of technical terms.. Literature.. 1888... Shriibhoja Mahaaraaja~. Sri Pahvadatthareya Sastri. Linguistics. 1614 pgs. aadipuraanama.. Theology. aagamashaastramu gaud'apaadiiyamu. 0. Yudhishthira Vijaya. 248 pgs.. Literature.. 0. Linguistics. Literature. Social Sciences.k. aachaaramayuukha dvitiiya. bhat't'aachaaryend-a vidhushekharend-a. Language.. Linguistics. Yukttikalpataru.. Sanskrit... 100 pgs. Yogini Jatakam. Sanskrit. 370 pgs. Sanskrit..… 92/167 . Ravi Varma. 1950. Literature. LANGUAGE. Ganga Vishanu Sri Krishana Dasini. a sanskrit primer. Unknown. Linguistics. Sanskrit. 740 pgs.. Sanskrit. LINGUISTICS. Sanskrit. Unknown. p... 1089 pgs. Linguistics. Social Sciences. Sanskrit.. Linguistics. Sanskrit. 346 pgs.. raamajii upaadhyaaya.. Philosophy. 0. Sanskrit. Sanskrit.. 1932. 0. Yogavasista Vol 1. 1908. L. charles rockwell lanman. Sanskrit.. Language. 1979.. 1932... 526 pgs. 1943. 440 pgs. Yogavasishtu Dwithiya Bagamu. aadaitabrahmasid'i. Literature. khemraj sri krishna das... Linguistics. Unknown. Philosophy.. Jaggu Venkatachari. 142 pgs.. 40 pgs. Sanskrit. gurucharana. 1983. appayyadiikshita.m. Language. 321 pgs. 576 pgs. 98 pgs.

Bhattacharya. Theology. Unknown. Science. suryanarayana. Sanskrit. 1931. Sanskrit.. 270 pgs. Sanskrit. . Language. 1933.. 1944. 402 pgs.. . aapastambadharmasuutramanj-jarii.. aanandananandinii. 1932.viswanatha Sarma. 130 pgs. 228 pgs... 1928. Literature. Literature. 1909. aaryemanju qs-imulakalpa prathamoo bhaaga... 216 pgs. aaryemanju qs-imulakalpa ddhitiiya bhaaga. aapastambadharmasuutramanj-jarii. 196 pgs. 373 pgs. mahaadevashaastri. 278 pgs. Language. Sanskrit. 1923. 0. sanskritdocuments. Sanskrit. aarogyachintaamand-ii. 233 pgs. Sanskrit.. 742 pgs.. Yasneswara cimana Bhatta.. 1940. aatakam. 1970. Sanskrit.. Language. aashvalaayanagrxhyasuutran' shriiharadattamishravirachita anaavilaakhyayaa vrxttyaa sametn. Language... 1924. aapastambiiya dharmasuutramu. r. Literature.. Linguistics. 318 pgs. Linguistics. Linguistics. -. 1898. Dr.. Linguistics.. S. Psychology. Sri Ganapathi Sastri. 0.. 340 pgs.. 513 pgs.… aatma kathaa prathama khand-d'a mahaatmaa gaan'dhii General Sanskrit 0 421 pgs 93/167 .. Sri Bhavani Shankara Sharma.. 1970. aaryaividhaasudhaakaran. aapastambadharmasuutramu. aangiirasasmrxtii.. 1973. Literature.. Religion. Philosophy. Sanskrit. Language. 1920. Ganapathi Sastri.. Language. Ganapathi Sastri. Language.. Religion.. Linguistics. 340 pgs. 122 pgs. T. Linguistics. haradatta mishra. Linguistics. Narasimhachar. aashvalaayanagrxhyasuutran. n. Sanskrit. aaryabhadt'iiyam'of Aryabhattacarya Part 1 gaanitapaada. Literature.. . Sanskrit. aapastambiiya dharmasuutramu. Linguistics. Natural Sciences. 1930.mlampalli Chandra Sekhar Sarma.. Sanskrit. 314 pgs. Sanskrit. Religion. Pandith Sri Seetharam Bhakruth.. aaryemanju qs-imulakalpa tuutiyo bhaaga.. Sanskrit. Literature. Linguistics. aasechanakaraamaayand-amu. Language. Linguistics. Literature.. 814 pgs. 1933. Linguistics. a n krishna aiyangar. aapastambiiyam' shraotasuutram. 1922.. d srinivaasaacharya. Sri Ganapathi Sastri. Sanskrit. Sanskrit. Linguistics... r. e.org/…/SanskritIIIT. n. Linguistics.. Sanskrit. Sanskrit. Literature. Theology. 90 pgs.. Sanskrit. 1953.. not availabe. 0. D.. Linguistics. 1931. Language. Sanskrit. aang-agatvanirukti naama prabandha etatpustakan.. 1951. Linguistics.. aapastambashulbasuutramu. Sanskrit. 307 pgs.. Sanskrit. 370 pgs. Literature. aapastambasulbasuutran' kapaaradibhaashhyend-a karavindi sundararajavyaakhyaabhyan' cha sahitan. kapardisvaami.2/14/2011 A list of scanned Sanskrit books at III… aanandamathaadhikarand-amaaramya pradhaman' paadan. Language.. 130 pgs.. Language. suryanarayana. Sanskrit. Literature.. shriimanmuraarimishra. Srinivasachar. Brahmasri Subrahmanya Suri. Science. 1893.. Language. aapastambhagrihyasuutra anakula tatparyadarshana. Sanskrit. not availabe.. aatha sankhya darshana bhashanuvaada. 177 pgs. Language. Language.. Literature. Literature. 236 pgs. 308 pgs. Literature. T. 472 pgs. Literature.. Literature. 0. 76 pgs... aapastambaparibhaashaasuutramuu. Sanskrit. Ganapathi Sastri. Sanskrit. Sanskrit. 0. aashvalaayaniiyaguhaasutraand-aa suchiipatramu. Language. T. Linguistics.. Literature.. Language.

ad'agatvanirukitan.. Linguistics. 1926. 131 pgs. Sri Ananta Krishna Sastri. Sanskrit. Sanskrit. diipikaa ghosha. 1926. 62 pgs. Sri Udayana. 216 pgs. Sanskrit. Linguistics. abhilashhitaayrachintaamand-i. LANGUAGE.. 421 pgs.. 158 pgs. Religion. 268 pgs. 288 pgs.. 2000. Sanskrit. adhikaarand-a saaraaval'i. 1925.. 1926. LINGUISTICS. Literature. 385 pgs. 440 pgs. adbud vijay.. 1974. 1984.. Sharma Sastri. Language. Technology.. aavyamimaan'saa.. abhinana shakuntalam. 1973. Literature. abhilashhitaartaaryaichintaamand-in. abhinava chandrikaayaamu. Literature.. mahaatmaa gaan dhii. Linguistics. Sanskrit. Sanskrit. Sanskrit. aayaisaptashati.org/…/SanskritIIIT. 42 pgs. Philosophy. shriigovadhainaachayai. abhijnaashaakuntala. LITERATURE.. aatmatattvaviveka. Psychology. ramanath jha. Sanskrit. 1926..... 1957. kalidasa. addvataamakaranda. Literature.. addvatamaatend-d'a. Linguistics. 100 pgs. Satya Nidhi Theertha. 1973. vaidha yaadavaji trikamaji aachaaryai. adhikaara kaa prashna. abhaavavimarsha. someshvaradeva. 238 pgs. bhagavatiprasaada vaajapeiyi. soomeishvara deva. 1944.. mukula bhatta. abhijnana sakuntalam of kalidasa.. Sanskrit. Psychology. ven'kat'a subramand-ya shaastri.. Sanskrit. aayurveidamahoodadhau annapaanavidhi. LITERATURE.. LINGUISTICS. abhinava san'skrta pravesha.. adhikarand-asaaraalalin.. Sanskrit. 1630. Unknown. R. sanskritdocuments. Religion. 72 pgs. 498 pgs. Sanskrit. Rajasekhara. Sri Natesh. 276 pgs. Language.. Psychology. Triveni Kavi. 0.. Sanskrit. 1969. Sanskrit. 1926. Sanskrit. 0. achala meraa koii. Technology. 136 pgs.. Literature. LINGUISTICS. 154 pgs.. Linguistics. 161 pgs. Theology. 92 pgs.. General. Psychology.. Sanskrit. Linguistics.. Sanskrit. 1926. 1948. 1972. LANGUAGE. aatmoduugaara.. Sanskrit.. Literature. Language. Language... addvatatarand-i. Murari Mishra. abhiraajasahastrakamu. Linguistics. 438 pgs. Language.... Sanskrit. Sanskrit. 440 pgs.. Language. Philosophy. 0. Sanskrit. srimad vedaanta desikulu. Language. Sanskrit.. Linguistics.. General. Theology. aatmatattva vivekaa. Sanskrit. Literature.. Literature.. abhilekhamaalaa vishvavidhyaalayapariqs-aanirdhaarita abhilekhasan'graha raama hindiivyaakhyopetaa. 1942. virachitayaa.. vendaachanalaala.. 142 pgs. pandit shri bellakonda ramaraya kavindra. 1875.. Lakshmidhar. abhidhaavrittimaatrika shabdavyaapaara vichaara. Linguistics. 0. Language... Sanskrit. Kumaravedantacharya. pan' ramaakaanta jhaa. Language. 296 pgs. 1934. Literature. Literature. 561 pgs. Language. Literature.. 829 pgs.2/14/2011 A list of scanned Sanskrit books at III… aatma kathaa prathama khand d a.. Sanskrit... Not available. Linguistics. 1950.. Philosophy. Sanskrit. LITERATURE. abhinava vikrutivignaana.. 1895. 242 pgs. LANGUAGE. 428 pgs. Sanskrit. abhilaashhitaarthachintaamand-i prathamabhaaga aadita trxtiiyaprakarand-antamu..… adhikarand asaaraavali shriivand shat'hakopashriilaqs 94/167 .. Sanskrit. Sanskrit. 0. Philosophy.. Literature. Religion. Linguistics.. Language. 336 pgs. ma shri deshapaan'd'e.. Literature. 174 pgs. 1916.. Literature. shrii kaasinaatha dviveidi.

1905.. shriimatparamahan'samadhusuudanasarasvatii. Narasimha Sarma.. 445 pgs. 362 pgs. adhikarand-asaraavali. 0. Religion.. 1935. Language. 302 pgs. Linguistics. Psychology. advaita siddi Vol.. shiromand-ishriimadhusuudanasarasvatii. Theology.org/…/SanskritIIIT. Literature.. Sanskrit. shriinivaasaachaari. 120 pgs. 882 pgs. 0. d'aa bii gopaalared'd'ii. 0.. 491 pgs. Sanskrit. Sanskrit. Language. Language. Literature. Sanskrit. Literature. Theology. Mahamahopadyaya Hariprasad Sastri. advaitasabhaasuvarnd-amahotsave. 0. vidvan s narayanaswami shastri. Linguistics. adhyaatmapat'alamam. 1960. Linguistics. d'i.. Literature. Not available.. advatatatvasudhaa dvitiiya bhaaga. Literature. Literature. 1969. Literature... advaitaaqs-aramaalikaa. Religion. Language. Language. Linguistics... 118 pgs. Literature. Sanskrit. Linguistics. 0... advaitaanyamatakhand-d'anamu. shriivand-shat hakopashriilaqsmiinrxsin'vashat'hakopayatiindramahaadeshikaa. 0. 1940. Language. 1997. Literature. Language. advatatatvasudhaa prathamoo bhaaga.. adhvaramiimaan'saa kutuuhalavrxtti.. 120 pgs.. Sanskrit. 1927. Language. adhyaatmakalpadruma adhirohand-iit'ippand-isahita.. 1962. advatadipikaa..… agamakoshaa dvadasho bhaagan S k ramachandra Rao History Sanskrit 1994 402 pgs 95/167 . advaitasiddhi guruchanddrikaasavyakhyaayasamalang-krxtaa dvitiiyasamput'amu. Linguistics. Narayana Sharma. Literature. Psychology. 1928.. advaitasiddhi. Sanskrit.. Language. Linguistics.. Linguistics.. advatatatvasudhaa prathamoo bhaaga. Not available... Theology. Sanskrit.. Linguistics.. Sanskrit. Language.. Linguistics. 1946. Literature. I.. 250 pgs. Sanskrit. Literature. Philosophy. 660 pgs. 617 pgs.. 891 pgs.. Sri Ganapathy Sastri. Not available. advaitibhraan'tiprakaasha.. 1937.. Art. Sanskrit. Literature. 487 pgs. Language.. Philosophy. 252 pgs. shriimunisundarasuuri. 99 pgs. advaitibhraan'tiprakaasha. Linguistics.. Sanskrit. Linguistics. 204 pgs. sanskritdocuments. advaitasiddhi mithyatvamithyaatvaanto bhaaga. Philosophy.. 44 pgs. 0. Linguistics. Sanskrit.. Religion. Not available. advatacsiddddhaantagurucchandrikaa. Sanskrit.. Language. Linguistics. advatadipikaa tutiiyo bhaagan. Sanskrit. Sanskrit. Ganapathi Sastry. Sanskrit. 77 pgs. 1915. Sanskrit. Sanskrit. Religion. advaitamanj-jarii brahmavidhyaabharand-amu. Literature. Language. 1915... Religion. Not available. Sanskrit. Sanskrit. Language.. advatadipikaa dhvitiyo bhaagan. Sanskrit.. Sanskrit. 195 pgs. 92 pgs. 386 pgs. Literature. Narayanasrama. 1933. Sanskrit. adhyaatmaraamaayand-amu.. Not available. 0. Sanskrit. 78 pgs. 1893. Language.. guruchandriikaa... 396 pgs. 1984. 1960. Sanskrit. Literature. advaitaamoda. advaitadiipikaa dvitiiyobhaaga. 678 pgs. Language. Social Sciences.. Literature. vaasudevashaastrii. 0.. 842 pgs. advatamajjarii nyaayaraqs-aamand-in.. Chintamani. advayavajrasan'graha.. 373 pgs. sri Paramahamsa perivrajaka Chandrikacharya. Linguistics. Psychology. 524 pgs. Sanskrit. Not available.. advaitasiddhi trxtiiyaasamput'amu. Not available. 1987. Literature..2/14/2011 A list of scanned Sanskrit books at III… adhikarand-asaaraavali.. Theology. Not available. Pandit Anantha Krishna Sastri. 1939. advatasiddhaantasaarasam'grah. Sanskrit. 92 pgs.. Linguistics...

ramachandra Rao..aar. Haragovinda Sastri. Language. 139 pgs. 1973. alang-kaaramand-ihaara chaturtho bhaaga.. 1916. 54 pgs. Literature.. L. anargharaaghavamuu. Linguistics. 1917. Language. anang-garang-ga kaamakalaa hindiivyaa gopaniiyama. 1929.. Maharshi Vedavyas. alang-kaaramand-ihaara dvitiiyobhaaga. aitareyaalochanan. alang-kaaramand-ihaara prathamo bhaaga. 732 pgs. Sanskrit. akalanka grandhatrayamu. 306 pgs. History.. Sanskrit.. Language. Sanskrit.. History. 540 pgs. Jinvijaya Muni. ajit' gaamaa Vol. aitareyabraahmand-a. 1940. sanskritdocuments. Language. Literature.. Literature. Sanskrit. 1968. amrxtavaand-i. amarakoshhan. Language. 321 pgs. LITERATURE. r. Sanskrit. Linguistics. 1994.. The Arts. parakaalasan'yamiindrai.. Literature. 1937. Linguistics. Sanskrit. Literature. 1968. Sanskrit. Sanskrit.. 230 pgs. Linguistics. Sanskrit. Vishvanatha Balakrishna Sastri.. Language.. 874 pgs. Acharya Satyavrata Samasrami. alang-kaaramand-ihaara trxtiiyobhaaga. 1942. Language. aitareyaarand-yakan. LINGUISTICS.. Sanskrit.... 0. 100 pgs. 1944. Religion. Sanskrit.. aitareiya brahmanama. ananthabharathi. Linguistics. Literature. 104 pgs. ananthakrishna sharma. agniveshyagruhaasutre. LITERATURE..ii.. shiivadatta. Language. 1958. amitaa. Literature. Linguistics. 30 pgs.. Language.. Literature.2/14/2011 A list of scanned Sanskrit books at III… agamakoshaa dvadasho bhaagan. an'cdhaa yuga samiiqs-a. Sanskrit. LITERATURE. 512 pgs.. Linguistics.. yan. Literature.. Linguistics.. 358 pgs.. Language.… 96/167 . Literature. jiivana. Sanskrit.. 505 pgs. LANGUAGE.a.. Religion. 0.. Sanskrit. LINGUISTICS. Not available. Literature. Literature.. agnihotrachandrikaa.. Linguistics. 222 pgs. Literature. aitareyabraahmand-amam. LANGUAGE.. Sanskrit. yashapaala. 39 pgs. mahaakavikalyaand-amalla.k. 402 pgs. 1957. vaamana shaastri.. agnihotrachandrikaa vaamana shaastri krxtaa. Linguistics. 1967.. Language. Language.ravi Varma. Sanskrit.org/…/SanskritIIIT. vinaayaka gand-esha aapat'e.. banerji projesh. amarkosh. Not available. 236 pgs. Sanskrit. Sanskrit. Not available.. shriikrxshhnd-abrahmatantraparakaalasan'yamiindrai. Sanskrit. Sanskrit. LANGUAGE. Language. 0. 1898.. Linguistics. 226 pgs. Linguistics.. Literature. agnipuraand-amu vedikaa.. d'urghaprasaada. Literature. en' .. shriikrxshhnd-abrahmatantraparakaalasan'yamindai. Linguistics. 1906. Baba Sastri Padake. 884 pgs. Sanskrit.. Sanskrit. Language. aln'kaarakaustubhamuu.. 1921. Sri Mathsayana Aacharya. Linguistics. Sanskrit.. 443 pgs. Sanskrit. 1956. 1977. ambikaalaapa umaalaapa. 1898. dr. 0. an'bigara chaud'ayyana vachanagal'u. 750 pgs. Language. not available. LINGUISTICS.. 1921.. Theology. 238 pgs.. shriikrxshhnd-abrahmatantraparakaalasan'yamindai.. Linguistics. Literature. Linguistics. Sanskrit. 1923. Language... Literature. 550 pgs.. aitareyabraahmand-a. 1937.. Linguistics. S.. Sanskrit. 302 pgs. Sanskrit. Literature.. Literature. Language. pro laqs-mand-adata gautama. Language. Linguistics.. bhat't'a. 312 pgs.. 386 pgs. Literature. 1921. Sanskrit.

Sri Laugakshibhaskara. 1932.. 224 pgs. Sanskrit. 0. 1912. d'aa shriikrxshhnd-amanditripaat'hii... Sanskrit. 182 pgs. ashht'adhyaayii bhaashhya pradamaavuti. Linguistics. Ramaswami Aiyar.. 143 pgs.. H. Sanskrit. ar^thasan'graha. anubhuutiprakaasha. 1950.. Sanskrit.. Sanskrit. 459 pgs. Linguistics. . Theology. andhradesiahasyakatha. Sanskrit. 320 pgs. Language. 139 pgs. .. Language. 1926. Language. Sanskrit..org/…/SanskritIIIT. Athridev Gupta. Linguistics.. Religion. aparoqs-aanubhuuti savyaaravyaa. Religion. Language. shriimadvaagbhat't'a. Literature. Literature... Language.. 346 pgs. 448 pgs. Theology. 292 pgs. Language. Sanskrit. Theology. 1931. Religion. Linguistics. anubhaashya baalaboodinii bhaaga 2. Literature. Sanskrit. Sanskrit. andhra baghvath parimal. anyottayullaasan. anuvaad kala. Sanskrit... ar^thashaastram' Part Iii.. ashht'aadashasmrxtaya ang-gira aadi 18 smrxtiyon' kaa san'graha. 82 pgs. 92 pgs. vaachaspatii upaadyaaya.p..malledevaru.. Sanskrit. 1932. shriimadvallabhaachaarya. anubhuutiprakaasha. arthasamgraha. Literature.. raajya jyootishhi pan' devaraaja jii. Sanskrit. Linguistics. Theology. Not available.. Not available. Language. Language. 258 pgs. Literature. 2002. Philosophy.… 97/167 .. arya san'graha. Sanskrit. Literature. Sanskrit. Sanskrit. ashht'aaadashapuraand-aparichaya pauraand-ikaprabhaaparishiilanamu.. 400 pgs.. ashht'aan'gatddadayamu suutra shariira nidaana chikitsaa kalpa uttarasthaanavibhaktamu. Religion. 1921. apastamba s aphorisms. 1985.. 142 pgs. Literature. Sanskrit. Sri Vidyaranya. 0. Religion. 1980. Linguistics. Sanskrit.. 1929. Sanskrit.. 1951. ashht'aad'asagrand'aha. Linguistics. Literature.. 0. 0. Sanskrit.. Linguistics... suryanarayana shastri.. ashht'adashapuraand-aparichayan. 432 pgs... Linguistics. Sri Ganapathy Sastri. ashht'adashapuraand-a darpaind-a.. Literature. archaavaatara vaibhavam.. Unknown. 0.. 672 pgs... Literature. 274 pgs. H P Malledevaru. 789 pgs. 0. Language. Psychology. Language. Not available. Psychology. General. Philosophy. A. 138 pgs. Linguistics. Sanskrit... 1915.. charu deva shastry. 1964. asatmatattvodhyotaprakarand-amu. 252 pgs. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… 399 pgs. Sri Krishna Tripati... and-ubhaashhyamu.. 1964. Literature.. Sanskrit. 254 pgs. 194 pgs. 1844. 291 pgs.. 258 pgs. pandit r v krishnamaachaarya. sanskritdocuments. Sanskrit. Religion.. Sanskrit.. varnasi ramamurty renu... 145 pgs. asalii tejii mandii sat't'aa... 438 pgs. Athridev Gupta. Theology.. apastambagrxhyasuutran. Sanskrit. shri laugakshi bhaskara. ashht'adashashmutuyahan. 871 pgs. Chinnaswami Sastri. arpand-a patrikaa. Literature. Language. 312 pgs. 1983. Linguistics. Religion. 88 pgs. aramelakalanidi. 1985. anekartha sangraha.. george buhler dr. Not available. Social Sciences.. Sanskrit. Religion. 1990. 1998. Lakshminarayana. 1925. acharya hema chandra. Religion. 1955. Sanskrit. Literature. Sanskrit. Literature. 504 pgs. 1928.. Sanskrit. shriimadvidhyaarand-ayasvaami.. Yudishtar Mimamasat. Theology. ashht'aadashapuraand-a darpand-a. Religion. 1935...

. Language.. Sanskrit.. Language. not Available. 0. Sanskrit. . -. 0... Sanskrit. Religion. 474 pgs. 195 pgs. 621 pgs. Somraj Krishna Das.. 1929. Theology. Literature. Sanskrit. 46 pgs. vagbhatta.. atha jaatakaabharand-an' praarabyate. Sanskrit. 213 pgs.. . . . 0.. ashtangahridaya.. Linguistics. 1960. Language. . atha bruhjjyaatishhaand-aivaishhashht'omishhrasakandhochakaavalisan'grahaa. atha pradhamamudrand-akaalikiiprastaavanikaa. . Somraj Krishna Das. 1929. Sanskrit... . . Sanskrit. 258 pgs. Linguistics. Somraj Krishna Das. Literature. 146 pgs. Treble. Language. Sanskrit.a. Sanskrit.. not available. Literature. 466 pgs. 0... Sanskrit.. . . Sri G Ramaswami Sastrigal. . H. 1892. atha gurubhavaprakaashikaa rukminishaa vijayamu. vaagbhata. Sanskrit. Literature. Religion. 278 pgs.. Sanskrit... 512 pgs. 342 pgs. Theology. atha shikqs-aadiveidaang-gachatushhuta praaran'bha. 810 pgs.. atha saamaanyakakqs-and-aa prakarand-amu. Literature... 558 pgs... 602 pgs... atha haayanarantapurvaihai. atha dugaipaasanaakalpadgumaavishhayaanukramand-ikaa.. Sanskrit. 0. Literature. asvaalayaana gruhama suutramu. Sanskrit. atha shriibhaavataat'appand-ii satyadhamayan'tikrutaadvadaso kandhan.... ...g. 0. asvasastram. Sanskrit.. Language. atha kiiraanya keshoyammatrasamhitaa. 1983. 0..2/14/2011 A list of scanned Sanskrit books at III… ashht'apraasashatakatrayamu. Literature.. 1962. Sanskrit. 279 pgs. 974 pgs.. Somraj Krishna Das. Literature. 311 pgs. Sanskrit.r. Literature. atha krumaimahaapurand-an. 1929. Theology. 630 pgs.. . 1146 pgs. Religion. astaangahridaya. Linguistics. 95 pgs.a.a. 0. Technology...… 98/167 .m. Sanskrit. 254 pgs. H. Religion. Sanskrit.. Sanskrit. Sanskrit.. 338 pgs. atha shriibhaavataat'appand-ii satyadhamayan'tikrutaa. 156 pgs. atha pradhamaadi chaturdaishaadhyaayaanaan. Sanskrit. Theology. atha maanasasaqs-aipaddatii.. Language.. atha shraamadbhagavataan't'oppand-ii man'danan'diniisaptaman' sn'kadhan. Linguistics. atakam. Sanskrit.. kaviraj shrii athrii dhev guru.. Acharya Sri Pandith Laxmanlal. 177 pgs. 0.. H... 1917. ashtan'daghadhyaayam.. ashtajai bhashya pradamavruti. atha kaasi khandaa dhvitiyo bhaagan.. . Ramachandra Savath. Sri Krishna Das. Somraj Krishna Das. Religion. Literature.. Savanur. 267 pgs. Linguistics. Ramalingam. 1939. Literature.. 348 pgs. Unknown. atha shriikaashakhid'an' puvaathai.. atha shraamadbhagavataan't'oppand-ii chet'tityaakhyaa. Linguistics. Linguistics. Linguistics. . 1950. 800 pgs. 0. Sanskrit. Not Available. Literature. .. Language. atha shriikaalalokprakaasho ashht'avishatitaman.. 196 pgs. Sanskrit. Sanskrit. Sanskrit. 1867. . 1948. 1858.. sanskritdocuments. 0. Sanskrit. 1968. dr p srinivaasarao. Theology.. atha pramaand-apudvatan. 0. Language. . Sanskrit. atha kalikaa puraand-amu. Sanskrit.org/…/SanskritIIIT. 638 pgs.... 0. 0. 1867. atha govidrchanaa chandrikaa. Treble. 1936. . Treble. 379 pgs.

390 pgs.r.. . Sanskrit. 1929. Sanskrit.g.. 197 pgs. Gangavishnu amp Khemaraj. 475 pgs. 0.. Language.. Literature. Literature... atharvaveida san'hita... athashriimadgagavatat'ippand-ii yadupativirachitaa chatuthai skadhan. Religion.. saayand-aachaarya....org/…/SanskritIIIT. 0. Literature. Sanskrit... Sanskrit. Linguistics. Sanskrit. Religion. Sanskrit. Sanskrit. Not available. Literature.. athashriimadgagavatat'ippand-ii shriinivaasatiithaiyaa ekaadashan. 600 pgs. Venkatachala Sastry. .. . Sanskrit. atha shriimudgalpuraand-an. Linguistics. atharvaveda san'hitaa.. 549 pgs. 1959. athabrahaasutrabhaashhyan.. . 64 pgs. 190 pgs. . 554 pgs.a.. Linguistics. Sanskrit. Language... 0. Sanskrit. 565 pgs. 1963. 0. H. Sanskrit. . athashriibhaagavatat'ippand-ii t'ikaa shriidharaa. Religion.. 342 pgs. Sanskrit. Sanskrit.. atharvaipraatishaakhayamu. 353 pgs. 88 pgs. Sanskrit. 460 pgs.. 0. atha shriimadhyaayasudhaat'ippand-i. Sanskrit. atha shriimadbhagavate ashht'amaskan'dhan.. . 1957. 1860.. 41 pgs. . Sanskrit. Literature. Literature. . . Linguistics. Sanskrit.. Linguistics.. Sanskrit. H. Sanskrit. 0.. Language.... atha shriimadhbagavataa vijayadavaaja ekaadasobhaagan. Literature.a. Sanskrit..g... atharvaveidasan'hitaa bhaaga 4.. 0.. Sanskrit. . sanskritdocuments. . 0. 398 pgs. Somraj Krishna Das.. Religion. Linguistics. Theology. Sanskrit.. Sanskrit. Literature. 0. . Savanur. 258 pgs. Surya Kantha. atharvaveda san'hitaa. 0.. not available. Literature. Sanskrit... 0. 1093 pgs. Sanskrit. Not available.. 1858. athamn'tramahodadhigranthasyasyaivashhayaanukramand-ikaa. 203 pgs. Sanskrit... .. 352 pgs.… 99/167 . athamn'tramahodadhit'okaanokaayan'trasahita.. Sanskrit. 0. 327 pgs. 538 pgs. Treble. 1929.g. 1929.. 395 pgs. athaitareyopatishhatu. 0. atha shriimannyaayasudhaa. atharvaveida san'hitaa rxshhyaadi savalitaa.. Literature. . atha shriimannyaayasudhaa.. 856 pgs. 206 pgs. 620 pgs... 579 pgs. Language.r.. Literature. General. . 0. Sanskrit.. 1939. athaaprabdhanoyaanamimaan'saa. atha shriimannyaayasudhaa. bhat't'aachaarya. athabrahaapuraand-asithatavishhayaanukramand-ikha. 342 pgs. atha shriimadvagavate dvadashaskan'dha.. . atharvavedasan'hitaa bhaaga 3. saayand-aachaarya.. 484 pgs. H.2/14/2011 A list of scanned Sanskrit books at III… atha shriimadbhagavadgiitaa. 1858. Savanur. 627 pgs. atha tatpurushhaprakarand-amu. Language. Sanskrit. Linguistics. 184 pgs. 1898.. Shankar Panduranga Pandit. 0. 0. Treble. Literature. Sanskrit. Sanskrit. Literature. Literature.a.. athabadariimaahaatmya... athaa hymaratanaa baalabhaadraa. . Treble. Theology.. Literature. 370 pgs. Language. 1989. Language. 1929. saan'tabalekarakulajena daamodarabhat't'asuununaa shriipaadasharmand-aa..a. krishna Das. Language. sadaachaara. Linguistics. athashriibhaagavatat'ippand-ii satsadhamaikrutaa. athashriibhagavathat'ippanii karmakat'ikaa vijayavaad'aa tirtaa trayodase kandan. athashriimadgagavatat'ippand-ii yadupativirachitaa ekadaso skadhan. Savanur. . Theology. Treble. saan'tabalekarakulajena daamodarabhat't'asuununaa shriipaadasharmand-aa. H. . 1898.r.k. 1860.

0. Sanskrit. 2000. 727 pgs.l.. Literature. Sri Raghunathasiromani. Technology. Linguistics. 447 pgs. vaachaspati. Philosophy. Sanskrit. 1973.. 864 pgs.. Religion. Literature. Religion. Theology. 77 pgs.. 1916.. 1901. 639 pgs. avadaanakalpalataayaa mand-ichuud'aavadaanan' naama trutiiya pallava. krishna Das. Language. 613 pgs. baalaraamaayand-aannama. 672 pgs... Sanskrit. K Vasudeva Sastri.. Linguistics. Theology. Literature.. 351 pgs. shriiabhinavakaalidaasa. avataaravaadaavalin' pradamo bhaagan. Sanskrit. 1894. 323 pgs. 515 pgs.. Literature. 856 pgs. 1940..org/…/SanskritIIIT... Religion. THEOLOGY. 675 pgs. Sanskrit.joshi. 0.2/14/2011 A list of scanned Sanskrit books at III… athashriimadgagavatat'ippand-ii yadupativirachitaa trutiyo skadhan. athavaivediiyaa poppalaada san'hitaa ek kaandaa. athashriimadgagavatat'ippand-ii yadupativirachitaapanchamo skadhan. 1934.. Language... 644 pgs. Jithendra Bajaj. Literature. Panduranga Pandit. Literature. ayurveda vijnanam. Krishnacharya. 122 pgs. Religion. 34 pgs.... 142 pgs. Not available. Psychology. 126 pgs. Religion. 1936. 298 pgs. Technology. Sanskrit. Shankar Panduranga Pandit. 284 pgs.. Religion. Linguistics. Sanskrit.. 810 pgs. 1959. Sanskrit.. 1985.. Sanskrit. govindadeva.l... Language.. Sanskrit. Goswami.. Language. 1933. Linguistics. atran' bahu kurviita. 0.. -. 1989.. baalabodha san'graha.. Language. athavaivedasan'hitaa dusara bhaagan. Literature. K.. 1908. 2000. Sanskrit. Linguistics.. Unknown. athavaiveda san'hitaa pehalaa bhaagan. 1985. Religion.joshi. shriigang-geshopaadhyaaya. Acharya Mukunddevagya. 1977.. bhaagavatachampuu. Linguistics. Sanskrit. 0.. Literature. ayurveda bhashym panch khandm. avayava diidhityaa diidhitiprakaashikamu. Sanskrit. bahudarmaipuraand-amu. Raghu Veera. 1957. Art. . bhaamatii brahmasuutrabhaashya katusuutri... 0.. 1908. Sanskrit. baalabhaaratamu. Sanskrit. athavaiveda san'hitaa.. avachchhedakataaniruktti diidhityaasaha.k. d. 1929.l. Sanskrit. tataachaarya siroomani..… 100/167 . avmanjari. Sanskrit. Literature. Not Available. Raghu Veera. 26 pgs. Religion. Linguistics. RELIGION. Sanskrit. Sanskrit. . 1954. .. Language. 110 pgs.... athavaiveda san'hitaa. 26 pgs. Religion.joshi. Language. . Sanskrit.. 351 pgs.. 1996. t. Sanskrit. Literature.. aachaarya dand-d'i. athashriimatryaayaamutodhvitiyan'parichchhaidan.. Religion. K. sanskritdocuments. shriimadamarachandrasuri..r. athavaiveda san'hitaa trutigo bhaagan. Sanskrit. Religion. 2000.t. athavaivedasan'hitaa tisaraa bhaagan.. Sanskrit. . mahaamahoopaadhyaaya shriigadaadharabhat't'achaarya. P Beniram Sarama Gaup. avantisundarii.. Sanskrit. 171 pgs. 1869... Sanskrit. aumaapatamu. Sanskrit. 590 pgs.. K. bhaamahiiya kaavyaalang-kaara udyaana vritti. baadhan. 0.. Sanskrit. 170 pgs. 257 pgs. Linguistics.. binod lall sen. Language.. Theology.. 2000. athavaivediiyaa poppalaada san'hitaa navii kaandaa. shrii machchhang-karaachaarya. Sanskrit.. Sanskrit. Sanskrit.. athashriimatsayapuraand-akramaand-ikaa.. 358 pgs. 122 pgs.

.. bhadranyaka upanishad. 0.. bhaavaprakaasha bhaavabodhiniihindiivyaakhyaayopeta. Sanskrit. mand-d'anamishra. Linguistics. Literature. LITERATURE. Not available. 0. Linguistics. 1913. 439 pgs. 1999. 1921. Biography. sanskritdocuments. Linguistics. 430 pgs... Geography. gaanjan chintaman deo. Sanskrit. LINGUISTICS. Sanskrit... Literature. Sanskrit. 1915. bhaavanaaviveka sat'iika. 584 pgs.. Language. vaasishht'a gand-apati. Linguistics. Anantha Krishna Sastri. bhaaratiiya raajaniiti prakaasha. Literature.. Sanskrit. bhagavadgiitaya luupanyaasagal'u eran'd'anaya bhaaga. bhaarata charitra pariikqs-aa. Linguistics. Language.... 387 pgs. Sanskrit. bhagavadanudhaavananaamaa champuprabandha. Sanskrit. Sanskrit. 300 pgs.. bhaashhyaatheratnamaalaa.. 348 pgs. 432 pgs.. bhaarata ko janagananaa 1981 part Iii B. Linguistics. bhagadattajalhand-a virachitaa sukttimukttaavalii.… 101/167 .padmanaabha. Sanskrit. Literature. 146 pgs. 1938. 1951. bhaat't'adiipikaa uttarashhat'ahamam. Sanskrit.. Social Sciences. Literature. Linguistics.. shriijagatraaya.... Literature. Not Available..padmanaabha.. Sanskrit... bhaashhyagaambhiiyothenind-eyamand-d'anaaraye grantha. Literature. Language. u krxshhnd-ashaastrii. 1921. 82 pgs. 310 pgs... bhaashhyaayairatnamaalaa. Dravida Rajesvar Sastri. Language. 1955. Literature.... 1998. Language. Literature. Language. 560 pgs. Not available. Sanskrit. 0. -.. shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru.. Language. Sanskrit. 0. 230 pgs. Linguistics. harinaaraayand-a.s. Philosophy. Language. 332 pgs. 0. bhaaratiiya vana adhiniyam miimaan'sa. 624 pgs. Literature. bhaarata ko janagananaa 1981. 0. Philosophy. Sanskrit. niilakand-t'habhat't'asuunupand-d'ita. shrii gn-aanaanandendrasarasvatiisvaamii. Literature. Sanskrit. p.. Philosophy... Language. 0.. bhaat't'adiipikaa shriimatkhand-d'adevaprand-iitaa.. Sanskrit.. Venkararaghavan Sastri. 1894. Language. p. Sanskrit.padmanaabha.. bhaarata chaampuu. anantakushhnd-a. 206 pgs. Sanskrit.. laqs-mand-a sin'ha khanna. bhaat't'amiimaan'sakaanaan' sarvasvamu shabdapramaand-asya vaishiptyamu. Psychology. bhagavadgiitaa.... Literature. Psychology. 144 pgs. Linguistics. bhaarata ko janagananaa 1981. N. Literature. 70 pgs. 194 pgs. Religion. 426 pgs. Psychology. Language. History.. 90 pgs. Philosophy.. Linguistics. Sanskrit. Language. 0.. 0. Literature. 708 pgs. Sanskrit. Sanskrit. Language. 174 pgs. Literature. Sri Subramanya. Linguistics. 1914. 1961. bhaaminivilaasan. 156 pgs.2/14/2011 A list of scanned Sanskrit books at III… bhaamatiisamaaloochanamuu. Language. 1280 pgs. Language. 0. Sanskrit. Linguistics. LANGUAGE. Pachamukhi. p. Hari Narayan Apte. 0. Theology. Sanskrit. Linguistics.org/…/SanskritIIIT.. Literature.. Sanskrit. 0... bhagavaan daasa.. Linguistics. bhaat't'adiipikaa Part I. Philosophy. 1936. bhaashhyaartharatnamaala. Embar Krishnamacharya. 902 pgs. Sanskrit. Psychology. 156 pgs. Sanskrit.. Linguistics. Psychology. Literature.. bhaaratiiyamu athaishaastramu. bhaaskarodayaa tarkasan'grahadiipikaa prakaashasya vyaakhyaa padavaakyapramaandapaaraavaariind-a. 1926.

96 pgs. Literature. Language. Psychology.. bhatta bhasha prakash.. bhakttisudhaataran'gand-ii. Language. Philosophy. bhamahas kavyalankara. shriikshemendra. Sanskrit. Religion. Linguistics.. Language.t. 282 pgs. bhaishhajyaratnaavalii. shriigovindadaasa. Philosophy.. Sanskrit.. naanyabhupal. Literature. Linguistics. 1914. Sanskrit. bhat't'achintaamand-estar^kapaada. bhat't'achintaamand-i. bhat't'ikaavyamuu. Sanskrit. Sanskrit. bhedasaamrajyamuu vedaantabhaaga. 120 pgs. Psychology.org/…/SanskritIIIT.. bhartrxharisubhaashhitamu. venkat'asubrahmand-ya. 1912. Linguistics. Sanskrit. bhasasastrapravesini... -. Sanskrit. shrii koliyaalamu svaamina:. Linguistics. bhedajayaqs-i. Language.. 1900. Language. bhedadhikkaara upakaaramapaarkarma vyaakhyaayasahitamu. Linguistics. bhaktamaalaa raamarasikaavalii. 0. Literature... Language. 0. 2000.. bhedojjiivana. 294 pgs. 1983. Language. 511 pgs. khemaraaja shriikrxshhnd-adaasa. bhat't'ikaavyamu chandrakalaa vidyotinii san'skrxta hindii vyaakhyaadvayopetamu dvaadashaadi dvaabin'shatisarmaparyantamu. Literature.... Literature. 424 pgs. sanskritdocuments. 1957.. 670 pgs. 1952.. bhagavadraamaanujavijaya gadhyaprabandha. Language. Sanskrit. 188 pgs. g k bhatt ed.. shaataanandasunu. Literature. bharatamajjari.. mand-d'ikala raamashaastriind-a. Sri Rama Subramanya Sastri. 222 pgs. Sanskrit. 0. Language. 1915...... d.. shriimadbhat't'i. Krishhnd-akumaari. Sri Visvesvara Siddi. Psychology. Sanskrit. 1914. Literature. Literature.. Not Available. 128 pgs. Linguistics. 1898. Linguistics. Linguistics. Linguistics. Sanskrit. Psychology. Not available. Sanskrit. 857 pgs. 580 pgs. 1954.. bhat't'ikaavyamu. Language. Language.. bhaimiiparind-ayannaama naat'akamu nalavijayaaparanaamakamu. 130 pgs. god'avarti shat'hakopaachaarya.. Language.. Philosophy. venkata ramana sastri. Language. Psychology. Literature. 96 pgs. 661 pgs. 1961. Sanskrit. 1942.. Religion. 1930... 420 pgs. 252 pgs. Linguistics. Theology. bharatabhasyam part 1 chapt 1 5. Language. LITERATURE.. 84 pgs. tatachary siromani. Linguistics. mahaakavishriibhat't'i. 1952. Literature. 1999. 322 pgs.. Sanskrit. Sanskrit.. Philosophy. Sanskrit.. Sanskrit.. Literature. 0. Linguistics. bhavana viveka. Sanskrit. shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru. Sanskrit. 1904.2/14/2011 A list of scanned Sanskrit books at III… bhagavadgiitaya luupanyaasagal'u on'danaya bhaaga. Sri Tarkavagisa Bhatta Venidattacharya. Language. Mandana Misra.. jayamangalayaa.. 0. Sanskrit. bhedasaamraajyamu... 1169 pgs. LANGUAGE... 462 pgs. Literature. The Arts. bhasa svapnavasavadatta. Sanskrit. Sanskrit. 1934. Philosophy. 1933. Linguistics. Not available... 138 pgs. Sanskrit. 1934.. Philosophy..… 102/167 . Sri Ranga Ramanuja Desikan. 74 pgs. 1938. Linguistics. Literature. Language. bhat't'akalpataru. 260 pgs.. Sanskrit. Sanskrit. Psychology.. Literature.. shriivatsaangkamishra. Linguistics. bhagavadgund-adapand-aakhyamu shriivishhnd-usahastranaamabhaashhyamu. Sanskrit.. bhagavadgiyaanasopaanamu. 1271 pgs. Literature.... Theology. Linguistics. Religion. 1947. Sanskrit. LINGUISTICS. shriimannrxsin'gaashramamuni. Literature. 66 pgs. 71 pgs. Sanskrit.. 178 pgs. Theology. 1964. Religion. bhiimaparaakraman.

Literature.. Sanskrit. 1984. gokarnd-a saan'badiiqs-ita. bhuddhabhuushhana. Psychology. bhoojanakutuuhalamuu. 306 pgs. Philosophy. brahamiman'shatrishati. Language. 324 pgs.p. 0. Sanskrit..org/…/SanskritIIIT.. 649 pgs. Language. 452 pgs.. 1926. History. 42 pgs. Philosophy. 236 pgs. 994 pgs... Philosophy..d'i alan'kaar..subramanyasaastri. 106 pgs. Mahadeva Sastri Bakre. 1991. Sri Anantha Krishna Sastri. Philosophy. brahaasuutrashaan'karabhaashhyamuu Part Iii With 9 Commentaries. . Sri Gnana Bikshu. baskaraachaarya. Psychology. Sanskrit. 650 pgs.. Literature. 1932.. Philosophy. Unknown. 73 pgs. Philosophy. Psychology. 494 pgs. Language. brahaasuutrashaan'karabhaashhyamuu Part Iii With 5 Commentaries.l. Sanskrit. Sri Sankara Bhagavatpadacharya. 1984. Literature. Psychology. shrii madhvaachaarya. Sri Nimbakacharya... Linguistics.. 534 pgs. Psychology. Sanskrit. 1908. boodhaayanaguhaya suutramu. Sanskrit. shriiballaala. Language... vi. 0. brahaasuutrashaan'karabhaashhyamuu Vol I Chatussutri. 1959. 354 pgs.2/14/2011 A list of scanned Sanskrit books at III… bhonsle vamsa charitra. Sri Anantha Krishna Sastri. brahaamanhikamuu. 357 pgs. Philosophy.. bijn'panaya. Literature. Rangaswami. Linguistics. Linguistics. Psychology. 1977.. LANGUAGE. Not available. Sanskrit. 938 pgs.. Linguistics. LINGUISTICS.. 1937. Religion... brahaasuutrashaan'karabhaashhyamuu With Commentaries of Shri Givindananda Vachaspati Anandagiri. Language. Sanskrit. Language. Linguistics. brahadhogatarad'ugind-i asyaan' dhvitiyo bhaagan. bhramasuutrabhaashya bhaaga 1... Sanskrit.. Sri Subramanya Sastri. Wasudev Laxman Shastri Pansikar. 1933. 1941... 126 pgs. Psychology. brahaasutrashaan'karabhaashhyamu dusaraa bhaagan. Language.. Sanskrit. 269 pgs.s. LITERATURE.. Sanskrit. bhushanam.. Brahmasutras. Linguistics. bhuhajjaatakamu. Sanskrit... Philosophy. 524 pgs. 0.. Literature. Language. 1901. Psychology. brahaasuutrabhashhyamuu.. hech. Sanskrit. 100 pgs. Dr Sureshchandra Mishra. aar. Language. R. Sanskrit. Linguistics. Literature. Linguistics. Sanskrit. 444 pgs. brahaasureabhaashhyamu. Psychology. gopalan s tr.. Sanskrit... Linguistics. Sanskrit. raghunaatha.. Literature. 708 pgs. Biography. Linguistics. Sanskrit. bhoojaprabandha.. 90 pgs. 1929. brahaasuutrabhashhyamuu Text with Tippanis. bodhaayaniiyagrxhyasuutra. Religion. Literature.. 1934. 1951. 557 pgs. 441 pgs. 1927. Sanskrit.… 103/167 . 1923.. Sanskrit.. shrii madhvaachaarya. sanskritdocuments. brahaasutrabhaashhyamu. Language. Sanskrit.. Philosophy.. bhucvaneishalaukikanyaayasaahastrii.. 0.. Narayana. Geography... t'haakuur. Sanskrit. 1989. 646 pgs... 1956. 1949. brahaasutrashaakarabhaashhyamu bhaamatiikalpataruparimalopetamu.. Linguistics. bhuukailaasanaat'akamu. Literature. Sanskrit. Literature.. 344 pgs.. Theology.. shaama shaastri. 0. 80 pgs. 355 pgs. Sanskrit.. Bhaskaracharya. 1918. Geography. Sanskrit.panchamukhi. Language. brahamiimaan'saabhaashhyamuu. Sanskrit. 1955. 1920.. Literature. bhramasuutrabhaashya bhaaga 1.. Sanskrit. boddhi san'skruta grandaavalii 21. Vaidya. Sri Vasudeva Brahmendra Sarasvati Swamigal. Sri Sankara Bhagavatpadacharya. Sanskrit.

322 pgs. sanskritdocuments. brahmasutraa nimbaakaibhaashhyamu panchamo bhagan. 200 pgs...2/14/2011 g A list of scanned Sanskrit books at III… p y y gy pg brahasuutraanugund-yashiddhi.. Sanskrit. Religion.. brahmasuutrabhaashhyaalochanasya prathama chatu suutrii. Literature. Not available. 203 pgs. 278 pgs. shriimajjayatiirtha vyaasatiirtha.. Sanskrit. Religion. 340 pgs. Language. Sanskrit.. Language.. Literature. 441 pgs. Sanskrit.. shriividhyaarand-ya. Sanskrit. 441 pgs. 1922. Not available. Hari Narayana Apte. Linguistics. 416 pgs. 1894. Upanishads. Religion. 245 pgs. Brahmasutras.. Literature.. 1909.. 510 pgs. 1937. shaastri. brahmasutrabhasya of sri madhvacharya vol 1.. Sanskrit. Psychology. 1954. brahmasuutrashaang-karabhaashhyamu sat'ippanan' muulakaatramu. Sanskrit.. Literature. Sanskrit. 0. Sanskrit.. Prof. brahmaasuutraand-i. brahmasutraa nimbaakaibhaashhyamu. Literature. 2003. Theology. Sanskrit. 30 pgs.. 198 pgs. 1984. je. Philosophy. V. Linguistics. vaasudevasharma. vidhyaabhaaskara shriimand-ishang-karo vasantaraamaatmaja upaadhyaaya. t'i gand-apati saastri. 185 pgs. 1967. brahmasutraavabhavamu vrittimit'aksaraa. brahmavidaashiirvaada.. Literature. Sanskrit. Sanskrit. Brahmasutras. 0. Psychology. bhaaskararaaya. 1983. 1915. 315 pgs. 530 pgs.… bh ti ti k i i L Li i ti Lit t S k it 1941 188 104/167 .. Kuppuswami Sastri. 290 pgs.. brajavilaasa. brahmasuutrabhaashhyamu prathamo bhaaga.. Language. Theology. gan'gaavishhnd-u shriikrxshhnd-adaasa... S. brahmasutraa nimbaakaibhaashhyamu. Linguistics. brhamasuutra vrutti. brahmasiddhi Of mand-namishra Vol 1 brahmakaandaa. 1981.. 0. brhadaarand-yakopanishhatu.org/…/SanskritIIIT. Psychology.. 1933. brahmatatvaprakashika... T.. Sanskrit. Linguistics. Linguistics.. Religion. brahmaand-d'apuraand-ettarabhaagiiyan' lalitaasahasranaama saubhaagyabhaaskaraaravyabhaashhyan. brahmasutraavabhavamu.. Brahmasutras. sri bhagavad ramaanuja. Yogeswara Dutta Sharma. Literature. Venkataramana Reddy. Language. balagangadar tilak l. 266 pgs. Sanskrit.. brahmasuutrabhaashhyamuu samalang-krxtamu. 1984. 1991. 596 pgs. Sanskrit. Vira Raghavachaya. Language. 2000. Not available. 1991... 1957... Philosophy. V.prabanjanacharya.. brahmasutraa nimbaakaibhaashhyamu charma bhagan. Sanskrit. brahmamiimaan'saabhaashhyamu. brahmasuutrashaan'karabhaashhyamuu. Theology. Linguistics. Sanskrit. 461 pgs. shriinimbaarkaachaarya. 2000..yal. Literature. Literature.. Linguistics. Philosophy. 1927. Language. Brahmasutras. Sanskrit... 102 pgs. 340 pgs. Philosophy. Krishnasastri. Linguistics... hari naaraayand-a. Language. Theology. Sanskrit. Sanskrit. Language. Literature. Literature.. bran'hmaan'd'a puraand-amu.. Sanskrit. Language. Madanmohan Agarwal.. 604 pgs. Brahmasutras. 191 pgs.. 2002.. Sanskrit.. Linguistics.. Language.t. Linguistics. Sanskrit. Linguistics.. 246 pgs.. Sanskrit. 453 pgs. brahma sutra sariraka bhaaga 1. 1963. 1923. brahma suutraand-i. Madanmohan Agarwal. Chandrasekharan. Language.. Sanskrit.

Literature. 1875.. bhoja. Sanskrit. Language.2/14/2011 A list of scanned Sanskrit books at III… brhaspatismrti. 0. Language. 330 pgs. budhabhuushhand-aman.. Unknown. Linguistics. 480 pgs. 0. 0. 0. Religion. chaand-akyashatakam. Sanskrit. 82 pgs. THEOLOGY. Social Sciences. brxhatakathaaman'jarii. 560 pgs. Sanskrit. Linguistics. Language.. 1943. Linguistics. budgat 1966-67 finance minister's speech part -a. Psychology.. Language. Language. Linguistics. qs-hemendra... brxhatstotraratnaakara sachitra. champubhaaratamu. Sanskrit. Language. 664 pgs. 158 pgs. Language. Sanskrit. hari naaraayand-a. LINGUISTICS. Linguistics. brxhadaarand-yakopanishhatkhan'd'a. Literature. 295 pgs. 1955. Language. Language.ma.. 552 pgs. Linguistics. Literature. Not available. rangaswami aiyangar.padmanaabha.. Sanskrit. Literature. buhadaarnd-yakopanishhanmitaaqs-araa. Literature. Language. Sanskrit. Literature. Literature.padmanaabha. champuramayana kiskindha kanda and sundara kanda. Sanskrit.. Linguistics. champuuraamaayand-amu yuddhakaand-d'amu vyakhyaaya sametamu. 1979. Linguistics. 460 pgs. 0. LANGUAGE. 650 pgs.. brxhatii shaabarabhaashhyavyaakhyaa.. Linguistics.. Sanskrit. 0. 643 pgs. 1941. 110 pgs. census of india 1981 series 1 part V A amp B... Language. THEOLOGY. Language. 0. Linguistics. Literature.. Sri Raghavendra Tirtha. brihadaranyakopanishhat'a khandarthaa. champuuraamaayand-amu kalyaand-ii san'skrxta hindiivyaakhyaadvayopetamu. Sanskrit.. Literature. prabhaakaramishra. t'i aar krxshhnd-aachaarya. Language. Sanskrit. Sanskrit. 256 pgs. King Sambhu.. 188 pgs. 1933. Literature. Not available. 290 pgs.. 1941. Philosophy. v. 256 pgs.. 290 pgs.. RELIGION. Linguistics.. Literature. Sanskrit. k. RELIGION. Literature. buhadaarand-yakopanishhadushhyavaatokamuu.... Sanskrit. Not available. 32 pgs.. Linguistics. 1924... Literature. 1891. Linguistics. 1895. Sanskrit. 132 pgs. narayana raam acharya.… 105/167 .. Linguistics. Sanskrit.. 1979. Literature. p. trimallabhat't'a. Sanskrit. kaviraj shrii athrii dhev guru. Sanskrit. 283 pgs. shriibhojaraajasaarvabhauma. 1246 pgs. Sanskrit. champuramayana. Sanskrit. t. brxhadhdaan'turuupaavali. LITERATURE. 34 pgs. Literature.. p. shriiraamachandra budheindra. 1843. chimand-aajii aapat'e. Linguistics... Language. Language.. Theology. Linguistics. Sanskrit. Sanskrit. Sanskrit. sanskritdocuments. Jwalaprasad Misra... 1901. census of india 1981 series 1 part Viii... 1326 pgs.. 0. 643 pgs...viswanatha Nayak. 1926.. 122 pgs. shriibhoojaraajasaarvabhauma. Language. 1946. Sanskrit.. bruhadhyaavanaajaathakama... 1914.. bulletin of the goverment oriental manuscripts library madras. Literature.sudhaakara diveidi. champuuraamaayand-amu ayodhyaakaand-d'amu. Not available. brxhadhyogatarang-agind-ii dvitiiyobhaaga..... chaalukyacharitamu. 0. chalaraashikalanama. brxhaddhaan'turuupaavali.. Art. Sanskrit. ma.. Natural Sciences. P. chandrashekhran.org/…/SanskritIIIT. t'ii aara krxshhnd-aachaaryand-a..

. Language. chandra loka. chaukhambaa saahitya 1996 97. Literature. 115 pgs. Language. Religion... 88 pgs. 1960. chandrakaantaa santati paan'chavaan' hissaa. Linguistics. Not available. shriimattaatparya. Linguistics. 194 pgs.. sanskritdocuments. Technology. chandrasyasaarand-iiraashyaadi 321404. 142 pgs. Sanskrit. Linguistics. Sanskrit... Literature. 526 pgs. Language. 1914. Sanskrit. 1843. Not available.. chhaan'dogyavedeshiiyat'iikaa... Literature. 1926. chandraprabha charita.. Sanskrit. Krishnacharya.. Sanskrit. Theology. 1937..org/…/SanskritIIIT... Linguistics. LANGUAGE. Linguistics. 322 pgs. Sri Vallabhacharya. Language. chaukhambaa saahitya.2/14/2011 A list of scanned Sanskrit books at III… Language. Linguistics. 1941. Language.. 142 pgs. 86 pgs. Sanskrit. 127 pgs. Language. 1912. Chakripanidatta. Language... 386 pgs. chandrakaantaa santati saatavaan' hissaa. Sanskrit. Not available. subramanya shastri s. 1977. LANGUAGE. 251 pgs. Literature... Linguistics. 106/167 . Sanskrit. chandrakalodaahaara. devakiinandana. Linguistics. 0. Sanskrit. Literature. Language. Linguistics. chatushshlekii stotraratnanj-cha.. Not available. Sanskrit. bhat't'oojidiikqs-ita. Hemadri. shriibhoojaraaja. Sanskrit. paurnamasi katha bhatta. 0. Literature. LINGUISTICS. LINGUISTICS. Linguistics. chaturvin'shatiimatasan'graha.. Language. Language. Sanskrit. Not available. Linguistics. Not available. chaturvaand-ii. Literature... Linguistics. LITERATURE. viiranandii. 810 pgs. LITERATURE.. Literature. Sanskrit. 0. 230 pgs. Linguistics. chhaan'dogyopanishhatkhan'd'aartha. champuuraamaayand-amuu baalakaand-d'amuu. chatur^thiikar^mapaddhati. 342 pgs.. 0. 1861. 0. Theology.. chaturdandi prakaashika. Sanskrit. Not available. Literature... Sanskrit. chan'drikaaprakaashaprasara. Language.. 112 pgs. Religion. Language. 1904.. . Gopala Lala. Language. Sanskrit. 0. Sanskrit. 1962. Not available. Social Sciences. shriimadyaamunamuni.. Unknown. Sanskrit. 0. Language. Literature. Linguistics. 112 pgs. chaukhambaa saahitya 1996 97. chhaan'dogyavedeshiiyat'iikaa. Language. Linguistics. 37 pgs.. Linguistics. Linguistics. Sanskrit. chan'drikaaprakaashaprasara.. Sanskrit. Not Available. 126 pgs. chaturvaand-ii. Not available. Sanskrit. Literature. chatun'shlokii. Not available. chaukhambaa siiriija saahitya 1999 ii. Not available. 112 pgs. 0... Linguistics. Language. 394 pgs.. 190 pgs. chaukhaambaa sahitya. Literature.. shriijayadevakavi.... Sanskrit. 1934. Sanskrit. charudattam.t. 108 pgs. devadhar g r tr. 1959... Social Sciences. chandraaloka savimarsha prakaasha hindiivyaakhyaya panj-chamo mayuukha. Literature.. 1907. Sanskrit. 1999. Literature. Literature. Linguistics. Sanskrit. Literature... Language. devakiinandana. 398 pgs. 1993.. Sanskrit. Linguistics.. Literature. Sanskrit. Literature.. Sanskrit. 0.. 1843... Language. 1962.. 156 pgs.. 184 pgs.. charakasn'hitaa by agnivesha.r.… chhaandogya braamhand-amu trxtiiyobhaaga.. Sanskrit. 461 pgs. 0. 112 pgs. 106 pgs. Linguistics. 672 pgs. Literature. Language. Literature... Language. chatur^var^gachintaamand-e Part Ii.. Not available. Literature. 0.

chikitsaa saahitya. Sanskrit. 1932. 82 pgs. shriimadappayadiiqs-ita. chitranibandhaavalin. 209 pgs. chhaandoogyabraahmand-amuu. subrahand-ya shaastrii.. Sanskrit. 1873. contribution of andhra to sanskrit literature. Language. Linguistics. Literature. Language. Linguistics. Sanskrit. LINGUISTICS. 1962.. 0. ching-iyaaghara... 212 pgs. Language. Religion.. 2002. Linguistics. K.. 1980. 80 pgs... 232 pgs. hari naaraayand-a aapat'e. 1932. Sanskrit.. Sanskrit. 645 pgs.. Literature. 470 pgs. chitramiimaan'saakhand-d'anamu marmakaashena vimarshinyaa baalakriid'ayaa. The History Of Philosophy. 322 pgs. divaakara. Sharma. daanachanddrikaa. sanskritdocuments... LANGUAGE. Language. Linguistics. Literature.. 2001.. Rangaswamy. chitraprabhaa. Language.. Literature.. The History Of Philosophy.… 107/167 . sri pingalanaga.. Vacant. 0.. Linguistics. Linguistics.. 1956.. Raghunath Sharma. Theology. Sanskrit.. 530 pgs. Sanskrit. daanakelichintaamand-in.s. Linguistics. Linguistics Literature. 160 pgs. vord'ana d'ila. RELIGION. 411 pgs. yash dev shaalya. 2000.. pan' harishang-kara sharmma. 1938. chhandobhyastaa.org/…/SanskritIIIT. Sanskrit. Not available. Language. mand-d'itaraaja shriijagannatha. Literature. Psychology.. 1991.t. Psychology. 1902. chidagaganachanddrikaa kramaprakaashikaavyaakhyaaya.. d'anavaara kii ghaat'ii.. 125 pgs. shrii durgaamoohanabhat't'aachaaryaind-a. bhiqs-u. chhandas sastra. 256 pgs. Language.. LITERATURE.2/14/2011 A list of scanned Sanskrit books at III… chhaandogya braamhand amu trxtiiyobhaaga. chitramiimaan'saa sudhaa vyaakhyaasamalang-krxtaa. 1964. 208 pgs. Linguistics.. LANGUAGE. Literature. 127 pgs. Sanskrit. 1971.. Sri Gopala Shastri Darsanakesari. Sanskrit. Literature. 579 pgs. Literature. daarshaanik pancham varshik shanaak. Sanskrit... Sanskrit. 90 pgs.sharma. Literature. LINGUISTICS. 1958. Ayurveda. Language. 213 pgs.. 1908. Sanskrit. 0. 1948. chitramiimaan'saa. Literature.. 1980. shivadat't'a. 366 pgs. 1965.. Linguistics. THEOLOGY. 120 pgs. Sanskrit. 0.. Literature.v. 152 pgs. chhaandogyopanishhatuu. 628 pgs. 1938. 1941. Language.. Linguistics. Language. Language.. 1941. Philosophy. Sanskrit.. Bhabgavata Hari Sastri.. Religion. LITERATURE. chhandovichitin... Ananthanarayana. chhaandogyopanishhatuu saamaveidaa. Sanskrit. Linguistics.. 830 pgs.. kalidasa.. Linguistics. Sanskrit. chitraprabhaa. 1943. The Four Vedas. chidagana chandrika sanskrit commentry and english translation. Sanskrit.. Linguistics.. Sanskrit.... Sanskrit. 282 pgs. daanakaand-d'amu panchamo bhaagan. Sanskrit. daasakuut'a... Banamali Biswal. 326 pgs. daharavidhyaaprakaashikaa. Language. chhanda shaastramu mrxtasan'jiivanyaa vrxttii. B.. Linguistics. Language. Linguistics. Literature. shriiping-galaachaarya. shriijovaanandavidyasaagarabhat't'aachaaryaa. Literature. 244 pgs. raamaraaju b. Sanskrit. Language. Sanskrit.r. 1937. 162 pgs.m.. 459 pgs... Sanskrit. Sanskrit. shriiping-kalanaaga. Sanskrit. Literature. daarubrahaa. Sri Paramasivendra Saraswati. daasacharitamu. 1989. shriitaaraanaathatakivaacha. Technology. Sanskrit. mahaakavikaalidaasa. Literature.. chhandashaastramu.. Language.. 218 pgs.. Sanskrit. Sanskrit.

. 631 pgs. Sanskrit. 1924. naabaadarsgabaoaranaachaaryya. dashanirnd-ayii. dasha upanishhada prathamabhaaga vyaakhyaayutaa. Literature. Language. 1936. Sanskrit. Linguistics. 519 pgs. LINGUISTICS. LITERATURE. ke.. 0... 1976. dasharuupakamu kaavalokaaravya t'iikaa sahitamu. Upanishads. Literature. 1947. Sanskrit. dashaavataarastotramu. G. Literature.. Philosophy. LANGUAGE. Sanskrit. maarulkarashaastri. Linguistics. 363 pgs. Religion. 518 pgs. 652 pgs. dharmaakuutamu 2 ayodhyaakaand-d'a prathamo bhaaga.. Linguistics. Theology. lakshmipuram srinivasachar. Literature. dashainashaastrasyaitihaasan..shashibala Gouda. Literature. dattaka chan'drika. Literature.. 1998.kunhan Raja. Language. 1898. Language. 520 pgs. C. sanskritdocuments. 1926.. 352 pgs.. Sanskrit. dhar^masaastraa Part Ii. Linguistics.. dhamaupadeshaamaalaa vivarand-a. Sanskrit. dhananj-jaya.. Upanishads. 1954. 402 pgs. 1935. shriikaakhanaayai. 545 pgs.. 1949. 126 pgs. Sanskrit. Language... 0. 1924. Sanskrit. Religion. kaviraja rakhaldaasa kavyaatiirtha. B. 341 pgs. Kashmir. 1983.ramachandra Sharma. Sanskrit. 98 pgs. tryamn'baka raayamakhi..… 108/167 . dashanind-aiyai. Theology. dhaaturuupa prakaashikoopoodhghaata. 24 pgs.. 1987.. dhanan'jayavijayan. Sanskrit.. 120 pgs. dattakamimaan'saa 1976. 1934. devabhaashhaa. 254 pgs. mahaadeiva chimand-aajii aapt'e. LANGUAGE. Sanskrit. 131 pgs... Psychology. Literature. Language. 1996. Linguistics. Sanskrit. Bhagavdgita. Sanskrit.. Sanskrit. shrii upanishhadbrahmayogi.. The History Of Philosophy. 370 pgs. Kunham Raja.achari. Sanskrit.. Not available. Sanskrit. Literature. 106 pgs..2/14/2011 A list of scanned Sanskrit books at III… dakikhanii kaa padha aura. LINGUISTICS. Sanskrit. dharma kuut'amu Vol. Language. Religion. darshapuurnd-amaasaprakaasha prathamo bhaaga. 976 pgs. Linguistics Literature. Sanskrit. Social Sciences. Sanskrit. dharmaakuutamu 1 baalakaand-d'a. dasha upanishhadan' pradamo bhaagan. Sanskrit. 0. Philosophy. Religion. dharma shastra.. Sanskrit. Sri Jayasimha Suri. 602 pgs. Theology. Sanskrit. dhaaturatnaakara. Iii Part Ii. Linguistics. Theology.... 352 pgs. dasha upanishhadan' pradhamo bhaagan. Literature. deha prakriti vignyan.org/…/SanskritIIIT.. Not available. devataadhyaaya san'hitopanishhadu van'sha braahamand-aani. Linguistics. Unknown. 1936. dasha upanishhadan' dhvitiyo bhaagan... Sanskrit. shriiraama. Dr.. Language. 290 pgs.. Language. Literature. ddvaitokttiratnamaalaa. 202 pgs.. 1935.. yashaavanth vaasudhev paatnkar.. Sanskrit.. 575 pgs. 1111 pgs... 0. Linguistics. Not available. Sanskrit.. vaad'iilaala. 101 pgs.. 426 pgs. darsanodaya. 1998. Sanskrit. Literature. Venkatanathacharya. Language. Language... C.... Manmatha Nath Dutt. Sanskrit... shriivaidikasaarvabhaumai. pan'd'it chamaraajanagar shriikaan'ta shaastri. C. deshopadesha namaimaalaagrantho. vinaayaka gand-esha aapat'e. Linguistics. Art. Linguistics. Religion. Language. 1895. Sanskrit. 1933. LITERATURE...kunham Raja... Theology. 0.. Linguistics.. 1909. 1878. 1928. 130 pgs..

. Sanskrit. 0.. Literature. LITERATURE. mahaakavishriiharichandra.. Literature. Sanskrit. Sanskrit. Sanskrit. 1988. dharmasuutramu bhaashhya sahitamu.. Sanskrit. 1935. draahyaayand-agrxhyasuutramu rudraskandavrxttisahitamu. dhvanyaalokasaara. dhvanyaa looka. Language.. dharmatattvanirnd-ayaparishishht'amu.. mahaamahopaadhyaaya vaasudevashaastrii. diinaarkaraajakukaarahemalekhamu.. 1968. Sanskrit. Linguistics... Ganesha Sastri Ghokle. Literature. 1954. thakur udayanarayana singh. Linguistics. lakshminarayana. 1955. 162 pgs. Theology. Sanskrit. Vacant. Language. shrii badhiriinaatha sharma. p.. Linguistics.. Literature. Sanskrit. Language.. 1914. diipikaasaahitamuu. 1938. 1050 pgs. Literature. 831 pgs. Literature. Sanskrit. kurugan't'i shriiraamashaastri. 120 pgs. shriisubhat'a. Linguistics. laqs-mandashaastrii joshii. Theology. Sanskrit. Literature. sripati sastry. 1056 pgs. Vacant. laqs-mand-a shaastrii. . LANGUAGE. Language. Language. shriikaashiinaathopaadhyaaya... 694 pgs. LINGUISTICS. Linguistics. Sanskrit... 390 pgs. shriimadaanandavardhanaachaarya. LANGUAGE. 200 pgs. Sanskrit. ravisheikhara pan'd'ita badariinaatha sharma. Sanskrit.. gautama. dharmasharmaabhyudayamu. Literature. Literature. Literature.. Sanskrit. Language. Linguistics. dravyagund-asan'graha dravyagund-asan'grahat'iikaaravyakhyaaya trxtiiyavrxtti.. dhvanyaalooka. 270 pgs. Language. Linguistics. laqs-mand-a shaastrii. Sanskrit... 114 pgs. draahyayaand-agrxhyasuutravrxtti. sanskritdocuments. dhvanyaaloka baalapriyaadivyaanj-janaabhyaan' lochanena.. Sanskrit.. diipikaasarvasvamuu.. Language. vaidhyamahaamahopaadhyaayashriichakrapaand-idatta. 214 pgs.. Linguistics. Literature.… 109/167 .. Sanskrit. Language. Sanskrit.. Linguistics. Linguistics.. 640 pgs. Literature. Not available. Religion. dharmasuutra.. Literature. mahaakavishriiseqs-apivara. dharmakosha Vol I Part I... Sanskrit. 1934. Linguistics. 0... 1968. 0.. dhvaivajnj-abharanamu. dharmasindhu dharmadiipiikaa vishaadahindiivyaakhyaaya sudhaat'iippand-ya. Language. gautama. Literature. Linguistics. Language.. Language. p. Sanskrit. 116 pgs. dhatu sagara tarani. 1937. Language. Literature.. dharmakosha varnd-aashramadharmakaand-d'amu prathamo bhaaga kramaanka 5. 712 pgs. 1972. Linguistics. LITERATURE.. LINGUISTICS... Linguistics..2/14/2011 A list of scanned Sanskrit books at III… dharmaishaastrasan'graha. Linguistics. Language. Sanskrit. Linguistics. 1922. 20 pgs. Linguistics. 526 pgs. 1968. 373 pgs.. dharmoottarapradiipa volume Ii.. 98 pgs. sripati sastry. 250 pgs. 1954. 1971. Sanskrit. 1933.org/…/SanskritIIIT. Language. 1940.. 504 pgs. 1969. dharmakosha Vol I Part II. Literature.. Language.. Sanskrit.. shriipurushhottamasharma chaturveda. Literature. Language. dhatu sagara tarani. 107 pgs. Linguistics. 1937. pan'd'ita durveika mishraa.. 601 pgs. Religion. Language. dutaangadamu. Literature.. 1832. Sanskrit. 855 pgs. 224 pgs. 1900.

eitareya braamhand-aa. Literature. Sanskrit. Language. Sathavahana. giita govinda rasikapriya rasamanjari. ekaviiraa. dvatasiddaantasaaran. Literature. 1950... Sanskrit. Linguistics.. 766 pgs. Religion. 452 pgs. c. gand-itaadhyaaya vyaakhyaaya samanvita. Language.. 666 pgs.2/14/2011 A list of scanned Sanskrit books at III… dvadashaaran' nayachakramu. eitareyaarand-yakamu. chimand-aajii aapt'e. Sanskrit. Literature. Sanskrit. Sanskrit. 298 pgs. jotindra mohan chatterjee. THEOLOGY.r... 190 pgs. 1942. 1908. Gadadhara Rajaguru. 276 pgs. Sanskrit... Sanskrit. .. eclipse cult in veda's bible and koran. kavisaamraat'u vishvanaatha satyaanaaraayand-a. Sanskrit. Shadguru. Art.. 1944. 1910. Literature. Linguistics.. 149 pgs. Linguistics. Religion.. Language. Linguistics.. Literature. 1942. omaprakaasha.. Sanskrit. eitareya braamhand-aa. 0. Linguistics.mathuranath Shastri.. gaathaasaptashaatii.. Sanskrit. Hulagi Sripathyacharya.. ti ve shriinivaasaashaastrind-aa. Language. 120 pgs. Language. 1970. d. Sanskrit. 149 pgs. 1895. 1932. gadaadharapadvatau aachaarasaara. Literature. 1998. Sanskrit. 1920. Religion. Linguistics. gaathaashaptashaatii. Language.. shyamasastry r.. 1927. 262 pgs. Sri Mad Ramanuja.. Linguistics. sanskritdocuments. Language... Sanskrit.. 458 pgs. Sanskrit. Sanskrit. 202 pgs. Language. Sanskrit.. Sanskrit.. 516 pgs. gadaadhaarii. Language.vindhyeswari Prasada Dvivedi. Social Sciences. Religion. Sanskrit. Unknown. 232 pgs.. 1912... Sanskrit. 228 pgs. Linguistics. Sanskrit.. Linguistics. Sanskrit.org/…/SanskritIIIT. 380 pgs. Language. Pandith Gopeshkumar. 82 pgs. 0. shriigadaadharabhat't'aachaaryachakravartti. gaadaadharii.yam. Literature. Religion. gadhatrayamuu. Literature. B. gadya bhaaratii. Anantakrishna Sastri. Theology. M.. Sanskrit. Sanskrit. Literature. Linguistics. Philosophy. 134 pgs. Sanskrit.m. yam... 240 pgs. Language. Aurobindo.. 1978.. Sanskrit. omaprakaasha.. 680 pgs. gaayatriivyaakhayaa. Literature. 1908. Religion..r. epika Bhavaarth Bodhini. dvatadhumand-in... Sanskrit. Literature.. mitaddara. Literature. 1911... Linguistics. Linguistics.. shriinivaasachaarya. Sanskrit. 1902. dvisan'dhaanamu. S. 1969.krishnacharya.pi vandeishvari. 108 pgs. 1906.. Sanskrit. 432 pgs. gaadaadharii tattvachintaamand-yaa diidhityaa cha garbhitaa. Psychology. Language.… giitaagn aana prathama adhyaaya arjuna kaa vishhaada pan' diinaanaatha bhaargava dinesha 110/167 . 168 pgs. ganesh siddi.. 240 pgs. Linguistics.. gautamaprand-iita dharmasuutraand-ii. -. 1978. 240 pgs.. 1915. Language. Literature. 1950. dvijakanyaanamu vivaahakaalivimarsha. 446 pgs.. dalal. RELIGION. 1983... gand-akaarikaa. Literature... 770 pgs. 1940.. 72 pgs. T. Sri Aurobino. K Vasudeva Sastri. 1875. giita goovinda aur abhinaya.. Sanskrit. Sanskrit. Linguistics. Sritaranath. Linguistics. Literature. Language. gathaa bhrxgvajirasaatmakasya atharvavedasya upasthaanaamake bhrxgukhand-d'e. 1881. ekaagnikaand-d'a... Language.. 0.raghuthamacharya. Religion. jayadeva.. Munichaturvijay Pandit lalchandrsrva Bhagavan Sresthitanuj.. gadya bhaaratii.. 554 pgs. 1929. Literature.. badarinaada. eitareya taamaraaparinayamu. 522 pgs.

Religion... Language. 140 pgs.. 0. Sanskrit. gramaand-avaatikabhaashhyamu pradhama puraand-amu. han'sasan'desha... Sanskrit. 1972. Religion. bhat't'akumaarilasvaami.. Sanskrit. Theology... 228 pgs. svaamii raamadaasajii kahaaraaja.. grantharatnamaalaa. Sanskrit. giitopadesha. Language. goopikoonmaada. Sanskrit. 188 pgs. LINGUISTICS. gobhilagrxhyasuutran. Bommakanti.. 170 pgs. Art. LANGUAGE. Sanskrit. Linguistics.. shuuranaad'uu krxnjanuu pilla.. 1986. Literature. Sanskrit. Unknown. 0. giitaasamiqs-aa. Linguistics.. giitaashaastraarthaviveka. 384 pgs. Sanskrit. guurvarthadiipikaa prathamaadhyaaya. Sanskrit. Not available. goobhila graahya suutra. haaralataa.. 374 pgs. Linguistics.. Sanskrit. 45 pgs. Literature. 504 pgs. M. Literature. Language. Sanskrit. 814 pgs.. 1892. 0. 1971. Linguistics. Literature. Linguistics. Not available. giitaapadmavikaasa.. giitaasandesha. Language. Language. 662 pgs.. gurushushruubaa san'vargavidhyopadeshashcha. Linguistics. Aniruddha Bhatta. shriimadaanandatiirthabhaagavatpaadaachaarya. Literature. Benoytosh Bhattacharyya.. Sanskrit. Sanskrit.. shriidevaboodha. Literature.. Literature. Not available. pan diinaanaatha bhaargava dinesha. Language. 257 pgs. Sanskrit.. Not available... Sanskrit. goomiliiyaguhakarmaprakaashikaa. gootaavalii sat'iik.. subrahand-ya vidushha. Literature. 1931. 1846.. 43 pgs. Literature... Linguistics. Literature. Language.. Language. Linguistics. Language. Sanskrit. Language.. guptapaashupatamu amrxtasharmishht'hamu.. Linguistics. 352 pgs. gn-aanadiipikaa mahaabhaarata bhiishhmaparva. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… giitaagn-aana prathama adhyaaya arjuna kaa vishhaada. Marunda. 1936. 0. Linguistics. Language. Literature. 1969. 219 pgs. 0. Sri Rama Sharmacharya. 288 pgs. guurvaarthadiipikaa dvitiiya pushhpamuu. Sanskrit. 1948. jayadeva. 38 pgs. ma daa khare. 390 pgs.. 62 pgs.. grahalaadhavan' karand-amu t'iikaa. gobhiliiyagrxhyasuutramuu. K. 514 pgs... 186 pgs. Language. 1952. Bhagavadgita.. gand-eshadaivagn-aani. Theology. Literature... Language. Sanskrit. 226 pgs.. gruhaasutra san'graha. Sanskrit. Sanskrit.. Anil Varan Roy. Language. Literature. Not Available. Linguistics.. 1936. Language.org/…/SanskritIIIT. Sanskrit. 0. grxhyasuutramu grxhyaparishishht'amu grxhyakaarikaashcha. Social Sciences. chintaamaand-i bhat't'aa. Srinivasacharyulu. Literature.... Linguistics. Sanskrit. 266 pgs. Shambhusinghji Suthaliyadheeshkruth. Linguistics. gopurasandesaa.. LITERATURE. Language. 422 pgs.. kavisamraat'a vishvanaatha satyanaaraayand-a. Sanskrit. Literature. 1955.. Ramamurthi. Language. Literature. Literature. 1956. sanskritdocuments. 0. 0. 182 pgs. Linguistics. guhyasamaajatantamuu.. 1909. 34 pgs.. Literature. Linguistics.m. h Kalpmudram. 0. 1947.. Linguistics. Linguistics. 330 pgs. Literature. 256 pgs. Sanskrit. Sanskrit. Language. 57 pgs. Religion. Sanskrit. Tripitakacharya Mahapandita... gopeenauth pathuk.… 111/167 .. Sanskrit. 1995.s. Literature. Language. 1869.. gitagovinda mahakavyam. Sri Mukunda Jha Bakshi. Linguistics. Sanskrit.. 1936.. 1815.

. Sanskrit. 1971.. k.. hariharaadotabhushhand-amu... harivamsa. .. Linguistics. hashhacharitasan'grahan. shriikrxshhnd-adaasaa. Literature. ramaswami shastri. Theology. 246 pgs. Religion..… 112/167 .. harameikhalaa maahukaviracchitaa sat'ikaa. 96 pgs.. Literature. 0.. higher sanskrit grammar. Literature. 0.. hindhi patra lekhan. 38 pgs. 1967. Bhana Bhatta.. Language. R. shrii manimshradaamodarene. haridiiqs-itakrutaa brahaasuutravt'anti. Sanskrit. Sanskrit. T P Upadhyaya. 1850. 1950. 1960. harivaasamu.. 108 pgs. Literature.. Literature... ramchandra kale m. Sanskrit. 1935. Literature. Sudarsana Sarma And Sahitya Siromani. 1917.. 476 pgs. Subramanya Sastry. heitriiyoopanishhadi shiqs-aavalli. Language. hastalikhitagranthaanukramand-ikaa. Hari Narayana Apte... Sanskrit. Linguistics. hastalikhitagrandhavivarand-apajjikaayaan. 1933. harshcharitamu. Sanskrit. Religion.. 1900.. Religion.. Literature. Not Available. Linguistics. shriivibhuutibhuushhand-aabhat't'aachaarya. goodaavaramishra.org/…/SanskritIIIT.2/14/2011 A list of scanned Sanskrit books at III… hanumada rahasyamu hindiivyaakhyaaya vibhuushhitamu hanumatpuujaapaddhati. hariharachaturang-gamuu.. Sanskrit. hayata. Theology. Sanskrit. K. 336 pgs.. hashhaicharitan' eka saan'skrutika gradhyayana. Theology. Religion. 0. 1822. 196 pgs. Literature.. 1932. Literature. Language... Linguistics.s. Language. khare kulotpanna harisuunu gand-esha. Linguistics.. Sanskrit. 900 pgs. 1897. 1772. Language.. 718 pgs. hashhachaaratasan'grahan. Linguistics. gode p k. Psychology. Philosophy. 272 pgs. Language. bodhendrasarasvati. Sanskrit.. Sanskrit. Sanskrit. 268 pgs. 414 pgs. hashhaicharitamu. 238 pgs. bodhendrasarasvati. 1960.. Religion. Linguistics. 218 pgs. haridiqs-atakrutaa buhaasutravutin. 197 pgs. 1964. shan'karakrutayaa san'ketaakhyayaa. Literature.. Literature. 262 pgs.. hanumanatakam. 93 pgs. harikavi alias bhanubhatta. Sanskrit.. Language.samba Shiva Sastri. bhanabatta.. Language. Sanskrit. Linguistics.... Sanskrit. Sanskrit. Literature. Language. Sanskrit. Hari Narayan Apte. Sanskrit.. Language. 941 pgs. 1934. Philosophy. Hathayoga..... hashhaicharitan. 1954. Religion. Linguistics.. Linguistics Literature.. Sanskrit. 264 pgs. hariharaadvatabhushhand-amu. Bhana Bhatta. Sanskrit. Sanskrit. 0. Sanskrit. shriidevimalagand-i.. Linguistics. Sanskrit. 112 pgs. 1946.. Literature. harishrchandropaakhyaanama~.. 1933. Sanskrit. 934 pgs. hat'hayogapradiipikaa dhvitiyo bhaagan. 336 pgs.. Sanskrit. aachaarya pandd'ita shriishivadattamishrashaastrii. Literature. Bhana Bhatta. Linguistics Literature.. Sanskrit. 1938. Psychology. Theology. Language. 0. Language. parushuram lakshman vaidya. Vasudeva Agarwal. 198 pgs. Theology... Linguistics Literature.. 372 pgs. Language. Language. 1791. 190 pgs. Literature. Sanskrit. hariharadvaita bhusanam with karika. 102 sanskritdocuments. Linguistics. Bodhendrasarasvati. Linguistics. hanumannaat'akamuu... 249 pgs. Linguistics. Literature. Sanskrit. Linguistics. harisowbhaagyamu. 97 pgs. 1954. 1946..

Sanskrit.. 238 pgs. Hiriyanna... Sanskrit. Language.. 1917. Sanskrit. 152 pgs. Language. Literature. Linguistics.. Linguistics. pandashiikaropahvavidvadddaralaqs-kand-asharma. Linguistics. 1980. Language. iishvaradarshanamu tachchaitatu. 750 pgs.. 1963. Linguistics.. naarayanachandra jyotirbhushan bhattacharya. Literature. 266 pgs. Linguistics. Sanskrit. Theology. Linguistics.... 1908. 62 pgs. Linguistics. khemaraaja shriikrxshhnd-adaasashreshht'inaa. 445 pgs.. hitopadeshan. iishaadyashht'itarashtopanishhada aadyantatatachchhaantiyuj.. 1894. 1916. Psychology...... 0. 1959. 122 pgs.. Literature. Philosophy. Language. Sanskrit. Linguistics.… 113/167 . Sambasiva Sastri. Literature. 42 pgs.. 42 pgs. Language. iishvarapratipattiprakaasha qs-imadhusudanasarasvatiprand-ita. Sanskrit. 166 pgs.. Literature. Sanskrit. M. 26 pgs. vimuktaatma. 1981. 103 pgs. pandit narayanan. Sanskrit. Sanskrit.. 0.. shriinaaraayand-apand-ita. 456 pgs. iishvaraanumaanan. Language.. Sanskrit. Technology.. Sanskrit. Literature. Language. Psychology. Philosophy. Language.. ishaadidashopanishhada bhaashhya sametamu. paalakaapyamuni. Literature. sanskritdocuments. iishaavaasyat'iikaaraghunaathariirthiiya.. 1933. Religion. 0. 1020 pgs. Sanskrit. 0.. 1825. hoorabijnaanrahasyam jyotishkalpabriksha. 0. Sanskrit. 1921. Sanskrit. Linguistics.. 1964. jayakaanta mishra.. Literature.. shriijaganaathapand-d'ita. hitopdesh. 1928.. Literature. Literature. pand-d'ita baladeivapraasaada.. Theology.. Linguistics. Not available. Psychology. Language. hindi zou vacabulary. Language.. Literature. K . shriimatparamahan'sabrahmaanan'dasvaaminaa. Linguistics. vasudevasharamand-aa. shankar bhashya. iishaavaasyoopanishhada.. Sanskrit. 1915. Philosophy. 231 pgs. Language. Literature. Language.. 1975. Sanskrit. Sanskrit. hindusthaanakaa dand-d'asn'grah. Linguistics.. Sanskrit. 1972. hrxdayaamrxtamu. shrii naaraayand-a pan'nd-d'it'a. Sanskrit. Literature.... 1933. 145 pgs.. dasharatha sharma. Language. Literature. Sanskrit. 138 pgs. 1932. Literature. Linguistics.. Ganapathi Sastri. Religion.. Sanskrit. Linguistics.. yashaavanth vaasudhev paatnkar. Language. Linguistics. 1931. Literature. indraprasthaprabandha. iishaadhyaashht'ottarashatopanishhada aadhyantatattachchhaantiyuja. 0. iishaavaasyopanishhatuu khan'd'aartha. Technology.. Literature. shriimadugadgasheipaadhpaadhhyaya. hrxdayapriya of parameshvara. 413 pgs. Sanskrit. Sanskrit. 382 pgs. Sanskrit. Sanskrit. Language. hstyaayuveda book 1.2/14/2011 A list of scanned Sanskrit books at III… pgs. Language. i tsin'ga aura bhaarata yaatra. 306 pgs. 574 pgs. shrii shang-karaachaarya. 163 pgs. 192 pgs... Language. 64 pgs. hitopadeshan.. Linguistics. 1935. T. Language. Not Available. Religion. Theology. ishht'aasiddhi savivarand-aa. Vishnu Sarma. ishht'asiddhi.. Sanskrit.. 335 pgs.. indrajaalavidyaasan'graha. Not available. Linguistics.. hitoopadeisha. ht'hayoogapradiipikaa. Literature. 55 pgs. irishadi dashopanishada.org/…/SanskritIIIT. Linguistics. Not available.

Linguistics. 322 pgs. kai jyotishhaachaarya dvaarakaanaatha naaraayand-a raaje. Language. utpaladeva. 242 pgs. Theology. jaiminiiyashrotasutravrutin. Language.. Sanskrit. Unknown.. 1937. jaatakapaarijaata adhyaaya 11 15. Sanskrit. 298 pgs. Sanskrit. pundit ramanatha anda sarma.. Sanskrit. Ramakrishna Bhatt. Venkataramaiah.. Literature. Sanskrit.. pat't'abhiraama. Language.… 114/167 . 0.. shriimadvachaasa. Linguistics. Literature. sanskritdocuments. 0. Religion. LITERATURE. LANGUAGE. Sri Kasinatha Sastri.. 1947. jaataka ratnaakara. utpaladeva. Vacant. Literature. sa raajavallabha sastrigala. aachaarya shrii pan' lashhand-alaala bhvaa.. 1918.. Sanskrit. Sanskrit. 1904. 1844. Linguistics. History. Sanskrit. Biography... 178 pgs. 0.. Sanskrit. Not available. 365 pgs. iya Kunadali Vigyan. 178 pgs. 397 pgs. Philosophy.. 0. Linguistics Literature. R. Literature. Religion. Sri Meethalal Himmatram Oojha. Sanskrit. 446 pgs. jaatakaabharan. shriikaalidaasa. jyotirgand-itamu.. Raghavendra Acharya. 476 pgs. Language.. Literature... jagadaguru shriisachchidaanandasivaabhinava nusin'habhaaratiivijayakaavyamu.... Sanskrit.. Language... 1966. Language... 295 pgs.... jiivavichaara prakarand-amuu. -. Religion. 428 pgs. Sanskrit. 133 pgs. Sanskrit.. 352 pgs. 0. Theology. Sanskrit. maharshhi shriijaiminimuni. be raamachanddrasharmand-aa. jauminiiyanyaayamaalaa Part I. LINGUISTICS. jaanakiiparind-ayanaat'akamu. 1873.. Language. 434 pgs. jaiminiiyaarshheya jaiminiiyopanishhada braahmand-e... Linguistics. 84 pgs. jyotirvidaabharand-aamu sukhabodhikaa. 42 pgs. utpaladeva.. 1891.. 52 pgs. A Collection Of Essays On 21 Temples Located In Tamil Nadu.. ishvara pratyabhijna vimarshini vyaakyaayasahitamu bhaaga 2. Linguistics. Sanskrit. Religion. Linguistics. 0. Sanskrit.... 1973. Sanskrit.... 1980. 296 pgs. 1934. Sanskrit. jaagadiishiivyadhikarand-amu. Literature.. 160 pgs. v.. jayapura raja vamsyavali. ishwarapratyabhijnaa vimarshinii. Language. -. Sanskrit. Vacant. Literature.. Religion. Language. Sanskrit. Linguistics. 357 pgs. jiivandharachampun. 1996. Literature. Linguistics. 1938. Sanskrit. 428 pgs. Sanskrit... Literature.. Sanskrit. Language. 405 pgs.. Pannalal Jain. Literature. Language. Linguistics. jaa ta ka t'a ka thaa padamo bhaago. Linguistics.. Literature. Raghu Veera. 1992. 468 pgs. Sanskrit. Theology. 1890. jiind-iidvarahavanapaddatin' san'praaqs-and-avidhitra.2/14/2011 A list of scanned Sanskrit books at III… ishvara pratyabhijna vimarshini vyaakyaayasahitamu bhaaga 1.. Geography. Madhvacharya.. 1921. 288 pgs. 380 pgs. jaagadiishiisaamaanyaniruttki (manuscript). Not Available.. jaatakaabharan.org/…/SanskritIIIT. 1969. Linguistics.. Vacant. janmapatra vidhaanamu sodaaharand-a tattvaprabhaa hindiivyaakhyaaya. Theology. 0. Literature. 1957. Sanskrit. krishnadevaraaya. jiivasaj'jivijnaat'akamu. Sanskrit. pn' ... Linguistics. 1969. Sanskrit. 290 pgs. Psychology. subrahmanyashastri. jaiminiiyanyaaya maalaavi. 1921. 82 pgs. Language. Sanskrit. Philosophy. jaambavati parinayam.. itihaasasamuchchaya. jaiminiiyasuutraand-i subodhiniit'iikaasametaani prathamamadhyaayadvayan' sat'iikamagriman. Dr R Latcha Raman. shrii shaantisuuriisvaraji. Literature.

1924.. Language.. shriivaatsyaayanamuni. kaarikaavalii nyaayasiddhaantamuktaavali. 419 pgs.. Sanskrit.. Sanskrit. shriichannaviirakavi. vishvanaatha panchaanana bhatta. Literature. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… 1988. 0. 854 pgs.. Sanskrit. 1903. 675 pgs. 1895. kaadambarii. Sanskrit. Natural Sciences. Philosophy.. durgaaprasaada. 1965. kaarikaavali siddhaantamukttaavali t'ippand-ii. Philosophy.. LINGUISTICS. Literature. Sanskrit. 374 pgs. 534 pgs. vidvaanu khan'd'avilli suuryanaaraayand-ashaastrii. Sanskrit. Language. Linguistics. 1803. Language. 89 pgs. Literature.. Literature. Linguistics. Not available. shriivishvanaathapanj-chaananabhat't'aachaarya. kaarikaavalii. Literature. kaamasuutramu... Language. Linguistics.. Literature..… 115/167 . 0. Linguistics. shrii chokkanaatha makhi... Sanskrit. rabhaasanan'di. Social Sciences.. 0. Language. Linguistics. jyotishhatattvasudhaarnd-ava bhaashhaat'ikayaa. kaashaakrxtsna dhaatuvyaakhyaanamu naat'akat'ikaa san'skrxtaruupaantaramu. Sanskrit. kaadambarii kalikaataaraajadhaanyaan. Sanskrit. 1900. Sanskrit.. Not available.. Sanskrit.org/…/SanskritIIIT. 1932. 1951.. kaarikaavali nyaayasiddhaantamuttkaavalii. vishvanaathapachaana. kaadambarisaaraa. kaalidaasakaavyasaurabhamu. Language. Not available. Not available. sanskritdocuments. 0. Theology. kaarikaavali nyaayasiddhaantamuttkaavalii cha chitravali. Mahadev Shivaram Apte.. Linguistics.. Literature.. Sanskrit. shriiraamaanan'dayativara. LANGUAGE. 596 pgs. Psychology. 306 pgs. Sanskrit. 0.. kaamasuutramu t'ikayaa sametamu. Religion.. Sanskrit. jyotishha shiromand-i bhaaga duusaraa drxshht'aan'ta vibhaaga 4625 janmakun'd'alike shaata nirayana chitraan'sha. Language. 560 pgs. 360 pgs. 338 pgs... Literature. Language. Sanskrit. Sanskrit. Linguistics. Psychology. 1889. 90 pgs. Linguistics.. 1984. shah. 422 pgs. 1848.... 64 pgs. kaalagn-aanamu bhaashhaat'iikaasametamu. Language. Sanskrit.. kaashiikhan'd'an' t'iikaa.. Language. kaarikaavali siddhanta muktavali. 0. Sanskrit. kaarakasan'bandhodhyota. 1973.. Peterson.. Linguistics. kaan'timati parind-ayamu. Literature. Literature.. Literature. Linguistics. kaashikaa. 286 pgs. Vishwanatha Panchanan Bhattacharya. Literature. Linguistics. shriivishvanaathapanj-jaananabhat't'aachaarya.. 1939. manubhai s. 0... 228 pgs. Literature. Language. Language. 0. daralaalasharmand-a. 280 pgs. Sanskrit. shriimanmahaamahopaadhyaayavidhyaanaathapanjchaananabhat't'aachaarya. Linguistics. kaalaamrxtei savyaakhyaanei... 98 pgs. 0. 1933. 108 pgs. Literature. 344 pgs. Linguistics. Literature. Language. Literature. Vishwanatha Panchanan Bhattacharya. Sanskrit. Sanskrit. Language.. Literature.. 218 pgs. kaalatattvavivechanamam' Part Ii. Not available. Theology.. 392 pgs. kaamandakiiyaniitisaara bhaashhaat'iikaasahita.. Linguistics. 516 pgs.. 194 pgs. Language. 1956. Linguistics. LITERATURE. 350 pgs. Sanskrit.. 1915. Sanskrit. Raghunatha Bhatta. Social Sciences. Language.. kaarikaavalii muktaavalii. 556 pgs. Sanskrit.. Raghunatha Bhatta... Religion. Sanskrit. kaalatattvavivechanamam' Part I..

Not available.. kaavyakalaapan. Temples.. Linguistics. 624 pgs. Language. kaavyadapaind-an. kaasmiiragranthaavali Vol. Religion. kaavyaadarsha.. Linguistics.. Narayana Iyyar. Literature. 270 pgs.. J.. 312 pgs. vaagbhat't'aa. 359 pgs. aaryeindhra sharma. 540 pgs.. 327 pgs. Sanskrit. kaavyaalaa chatudaishoo gun'chchhakan.si.. Sanskrit.. 69 pgs. Language. Language. 160 pgs. kaavyamaalaa dashamoguchchhakan.… 116/167 . 1953.. kaatyaayanashrautasuutramu bhaashhyasahitamu.. Linguistics.. Sanskrit. 0. 0.. Not available.iii. Sanskrit.. 1903. Language. 0. LINGUISTICS. Sanskrit. kaashmiirasandhaanasamudyama..org/…/SanskritIIIT. kaavya ke ruupa. Sanskrit. LITERATURE. Literature. Sanskrit. S... Language. LANGUAGE. 1933. 1915.. Sanskrit. 1936. 1894. shriijagadiishachandra chat't'opaadhyaaya. Narayana Daso Banhatti. Literature. aachaaryadand-d'i... 114 pgs. 1948.. S. 238 pgs. Language.. Language. kaavyaalan'kaarasuutrand-i svavrxttisamalan'krxtaani. 102 pgs. Sanskrit. kaavyaalan'kaarasuutrand-i svavrxttisamalan'krxtaani. Sri Yathiraja Sampathkumaramuni. Sanskrit. Ranga Swamy. Language. 0. 100 pgs. Language.. Sanskrit. 1948. Linguistics. kaavyamaalaa haravijayamu. 1924. 484 pgs.. kaavyaavali ke ratnaapaanchaalikaa. Linguistics.. kaashikaand-d'a grantha. Sanskrit. kaashikaa dvitiiya bhaaga. parameshvaraananda. durgaiprasaadena. Linguistics..singaraiyengar. Literature. 1911. -.. 235 pgs. kaavyaanushaasanamuu... maithilashriigang-gaanandakavindra. . Literature. Sanskrit. LITERATURE. 70 pgs. 220 pgs. 122 pgs.. Linguistics. 32 pgs. 1925. Linguistics. Sanskrit. 1933. Language. Sanskrit.. Literature. 1941. Sanskrit. Language. Banhatti N d. 1941. kaashyapa san'hitaa. Not available. LANGUAGE. Not Available. Singabhupala. 0. Sanskrit.. Linguistics. Temples. Literature. shriiratnaakara. 1970. Ranga Swamy. Linguistics.. kaashyapasan'hitaa.. 1958.. 1968... pand-d'itavaravaamana.. Literature. kaavyaalan'kaarasaarasan'grahan.. chat'arjii. mahaamahopaadhyaaya shriikarkaachaarya. 174 pgs.. Linguistics.. Linguistics. 176 pgs. pand-d'itavaravaamana. Linguistics. kaavyad'aakinii. 1953. Sanskrit. Linguistics.. 216 pgs.. Sanskrit. 905 pgs. Literature.. Literature. Literature. Sanskrit. Literature. Sanskrit.. Language. 1911. sanskritdocuments. Language. Sanskrit. Linguistics.. je. 1891. Sanskrit.. gulaabaraaya. kaashmiiragranthaavalii prathamakhand-d'amu. shivad'at't'a. Literature. LINGUISTICS.. 214 pgs. kaavyamaalaa Part X. Literature. 1908. kaavyadiipikaa. Language. Linguistics Literature. 1938.. Psychology. Sanskrit. 712 pgs. kaasyapasan'hitaa. Literature. Linguistics. 82 pgs. durgaiprasaadena. Language. Sanskrit. Language. Linguistics. Literature.. Language.. 246 pgs. Theology. Sanskrit. Literature. 1952....2/14/2011 A list of scanned Sanskrit books at III… kaashikaa. Language. Sanskrit. Philosophy. 400 pgs. Linguistics. Literature. kaavyadarshanamulyam.. Sanskrit. Linguistics. kaashyapajnaanakaand-d'an. Econo Politics.. 1292 pgs. kaavyamaalaa ashht'amoguchchhakan.

… 117/167 . Sanskrit. Linguistics... Not available. LANGUAGE. Not Available. 1947. Literature. kamaikaarad'akramaavalii. Language. 0.. Linguistics.. Sanskrit. Language. 0. . LINGUISTICS.. -. Sanskrit... kadhambari. Linguistics.... topalli ven'kat'araamadaivagn-ena. Not Available... Linguistics. 0. 299 pgs. Natosa sastri. 584 pgs. kaavyaprakaashakhand-d'ana. kaavyaprakaasha naageshvarii t'iikayaa samalang-krxta... 1932.. t'i gand-apati saastri. shriimammat'aachaarya.. 166 pgs. 0. shriibihand-a. Literature. Linguistics. Not available. Sanskrit. Sanskrit. Language. 608 pgs. Language. Sanskrit. 68 pgs. Literature.. Language. 1967. Sanskrit. 1913.. 770 pgs.. Sanskrit.. Language. LANGUAGE. Literature.. kadaliimanj-junaathamaahaatmyamuu. kalapasuutramu. mahaamahopaadhyaayashriigovinda. vinnakoot'a maadhava raavu. 207 pgs. K. keshava. Sanskrit. Literature. 1967. 0. Sanskrit. 184 pgs. Social Sciences. Sanskrit. Language. kaavyonmoshhan. Literature.. Literature. kalaamaadhavaa. 1980. 1932. kaavyaprakaasha naageshvarii t'iikayaa samalang-krxta. mammat'aachaarya.. Literature. 1986. 0.org/…/SanskritIIIT.. Literature.. . Linguistics. karand-aratnamu subodhinii samaakhyavyaakhyaaya.. Sanskrit. naaraayand-aacharya. kanakaavalii. Linguistics. Language.. 178 pgs. Sanskrit. 311 pgs... 80 pgs. 1939. kar^mapradiipa. Sanskrit. Linguistics. Linguistics.. Language. kaing-karyaratnaavali. Sanskrit. Sanskrit. Language.. 280 pgs.. Sanskrit. kalpadrukosha Vol II.. Linguistics. kalyaand-apiiyuushhavyaakhyaasametaa pan'chadashii tattvavivekaprakarand-amu. Linguistics.. durgaiprasaadena. paravastukrxshhnd-amaachaarya. 1838. Literature. Literature. punyananda.. Linguistics. kand-aisundarii. 296 pgs. 372 pgs. 524 pgs. 268 pgs. sanskritdocuments. Literature. 329 pgs. LITERATURE.g. 477 pgs. kamakalavilas. shriimammat'aachaarya. 280 pgs. Sanskrit. Sanskrit. Natural Sciences... mammat'a. kaavyaprakaasha kaavyaprakaashavistaarakaaravyayaa vyaakhyaaya vibhuushhita. 0. Sanskrit. kadambari kalyanam.. Poems. kaavyashilpamu. Linguistics. narasimhakavi. 1893.2/14/2011 A list of scanned Sanskrit books at III… kaavyamaalaa navamoguchchhakan. 1993. suryanarayana sastri... 1918. LINGUISTICS. kanadasiddaantachandrika.. kaavyapradiipa. Linguistics.. Literature. Rasikalal Chotalal Parikh. 165 pgs. kaavyaprakaasha... kadambari. Theology. Language. Sanskrit. 244 pgs. Linguistics. Language. Sanskrit. 502 pgs. 224 pgs.. Language. Sanskrit. Language. 1963. 329 pgs. bhaaradvaja. Literature. Sanskrit. kalapurnodaya. 1976. 1918.. Sanskrit. Literature. Sri Krupa Chanda. LITERATURE. Literature. Linguistics.... Sanskrit. 616 pgs. Language. Literature. Chandrakanth. 1932. 60 pgs. 39 pgs.. kaavyasaarasan'graha.. Sanskrit. Language. kalyaand-avaartikamuusiddhaantaniddddaana. Literature. Linguistics. Language. Language. Harishchandra Renupurakar. Literature.. 631 pgs.. Linguistics.. . Linguistics. 2002. 1968. Technology.. Religion. banabhatta... Sanskrit. Sanskrit.. 1936. Somashambhu. Language. 1895. 1812. 143 pgs. kaavyaprakaasha krxtayaa vivrxtti.

... kat'hakagrxhyasuutran' bhaashhyatrayasaarayutan. Sanskrit. 396 pgs. Linguistics. Sanskrit. Literature. Linguistics. ubhata.. Language.. Linguistics.. Language. Literature... khaadiragrxhyasuutramu vyaakhyaayasahitamu. Language. Linguistics. kaumudiisharadaagamamu dvitiiya bhaagamu. Literature. kavikalpalataa. Sanskrit. Literature. Language. 1881. sankara rama sastry c. Literature. Sanskrit. Linguistics. 1944. kenoo upanishad. Sanskrit. 98 pgs. 1968. Linguistics. rangaraamanuja. 106 pgs. kelikutuuhale prathamastarang-ga. 1956. Language. kathaka upanishad. Language. shang-karaananda. 480 pgs.. Literature. Sanskrit. Religion. rudraskanda. 0. Language.. 1913. Sanskrit. Not available. 1925. Linguistics... kavalamkara sara samgraha. khaadiragrxhyasuutramu vyaakhyaayasahitamu. Sanskrit. Literature.. 158 pgs. Sanskrit.. Language. 1913. Sanskrit. Literature. Linguistics. 1955. kaumarabhrityam with navya balaroga. Language. Linguistics. khaadiragrxhyasutrama~.. Pt. Sanskrit. Language. acharya hemachandra. 104 pgs. kaushhiitaki braahmand-opanishhatu diipikaa... karnd-aamrxta prapaa... kathaakallolini paand-iniiyalaukikavyaakarand-asamaapaniiyaa. 61 pgs..anann'ta krishhana saastri. pandit durgaprasada ed. kenopanishad bhashya. Sanskrit. 194 pgs. 1987.... t'i ara chintaamani.. Linguistics. 54 pgs. Literature. Linguistics. swami satchidanandendra saraswathi. 1921. Linguistics.. Sanskrit... Language. Literature. Language. puraatattvaachaarya jinavijaya muni. Linguistics. Sanskrit.. Theology.. Linguistics. Literature. Theology. Theology..… 118/167 . swami satchidanandendra saraswathi. kavayadarsha. Sanskrit. Linguistics. 217 pgs. 1963. Willem Caland. Literature. 1950.. 1964.. 1942. 78 pgs. 204 pgs. kavyaprakash Rahasyam. Literature. Language. Language. Sanskrit.. 62 pgs. mahaakavi shriideveshvara. Sanskrit. 730 pgs. 1966. 230 pgs. Linguistics. keshava saahitya mein' samaaja san'skrxti evn' darshan. Sanskrit.. kavyanusasana.seetharam Jayramjoshi. Sanskrit. 1913. Language.. Shriipat't'abhiramachara~ya. Linguistics. 1942. Psychology. 185 pgs. Religion.. kavyamala. Linguistics. Language. kavimanoranjakachampu. Sanskrit. 190 pgs. Language. Language. Literature. kaun'shhiitakagrxhya suutraand-i. T. 322 pgs.org/…/SanskritIIIT.. keivalyaratnamuu.. 1895. Unknown. Literature. Literature. 174 pgs.. Literature.. raghuveera prasad trivedi. kavalayananda... Sanskrit.. raamasharand-ashaastrii. 0. Sanskrit. 1961. 1911. 344 pgs. 152 pgs. 57 pgs.. Literature. 2000. Dr. 402 pgs. Sanskrit. Literature. Sanskrit. Literature. vikrama deiva varma. Sarat Chandra Sastry. 184 pgs. 1932. Language. 133 pgs. 1885. 1978. Sanskrit.. Religion..k ramachandra aiyar. rudraskanda. Vasudeva Jnana Muni. Linguistics. Philosophy. Sanskrit.. karnd-akutuhala.. siitaaraaamasuuri.. kavikalpalataa. Sanskrit.. kaviindraacharyasuchi patramu. Technology. bilhana. Linguistics. bhat't'a someshvara. Language. 512 pgs. 0. Sanskrit.. Linguistics... 1925. sanskritdocuments.. Literature. Literature.. aar. Language. 140 pgs. d'aa en gn-aanappa naayud'u..2/14/2011 A list of scanned Sanskrit books at III… karnasundari. 368 pgs.

kishhkin'dhaa kaand-d'amuu. kriyaasaara panj-chamaadichaturdashopadeshaanta dvitiiyobhaaga. Literature. 1913. shriiniilakand-t'hashivaachaarya. Literature. 1934. Psychology. Literature. Literature.… 119/167 . Language. Bhrga Samhita. 1954.. kriyaasaara upadeshachatushht'ayaatmaka prathamobhaaga. Theology. THEOLOGY. kruushhnd-ayajuvaidiyataittiriiyasan'hitaa bhaaga 8.. Literature.. Sanskrit.. 1924. shriiniilakand-t'hashivaachaarya.. Sanskrit. Religion. Literature. Mahadeva Sastri.. 434 pgs. Language. Religion. Linguistics.. Literature. Sanskrit. 542 pgs. shriiniilakand-t'hashivaachaarya. hari naaraayand-a aapat'e.p. Language. 1997.. 502 pgs.. Language. 1964. 1954. 125 pgs. kriyatmaka ausadahiparichaya vijnan.. khand-d'anakhand-d'akhaadya Part 1. 428 pgs. Sanskrit. Language. Ramanuja Swamy. 294 pgs.. Sanskrit. 588 pgs. Language. Literature. Sanskrit. Linguistics. shriiniilakand-t'hashivaachaarya. sri vishvanath divedi. Samhita. hari naaraayand-a aapat'e.org/…/SanskritIIIT.. 1917. Sanskrit. 1937.2/14/2011 . krxshhnd-a bhakti saahitya vastu srota aura san'rachana. pg A list of scanned Sanskrit books at III… khaadiragrxhyasuutramu vyaakhyaayasahitamu. Language.. kiraataarjuniyamu.. kaashinaatha saastri. khilaadhikaaran' bugusan'hitaa.. kaashinaatha saastri. Technology.. Linguistics. khaadiragrxhyasuutrn' rudraskandavyaakhyaasahitan. 1954. krishhnd-a yajurveidiya taitiriiya san'hita.. Mahalinga Sastry. Literature. 204 pgs. 128 pgs. Economics. 315 pgs.. Language. 580 pgs. Sanskrit. Language.. khand-anakhand-akhaadhamu. A. Linguistics.. 1953. kriyaasaara upadeshachatushht'ayaatmaka prathamo bhaaga. Sanskrit. 442 pgs. Sanskrit.... 0. 1913. kiskindhakanda... Linguistics. Language. Literature. krishhnd-a yajurveidiya taitiriiya san'hita. 248 pgs. Literature. kokasandesa. Sanskrit. Sanskrit. 584 pgs. Sanskrit. kowt'iliiyan' arthaishaastramu.. Literature. 1905. kaasmiirika keishava bhat't'a. shriishriiharshha. 1905.. 318 pgs. sanskritdocuments.. RELIGION... Sanskrit. 438 pgs.. Linguistics. 1957. Theology.. Language. Sanskrit. bhaaravi. Bhrugu Maharshi. Sanskrit. 1936. chan'd'iiprasaada sukla. rudraskanda.. kiraataarjunaayamu.. Sanskrit. kinkind-ii maalaa. Sanskrit. Kasinatha Sastri Agase. Linguistics.. 0.. Language.. Literature. Literature.. Sanskrit.. Linguistics. G. Sanskrit. kruushhnd-ayajuvaidiiyataittiriiyasan'hitaa_bhaaga_7. Linguistics. Literature. 1917.. Sanskrit. 586 pgs. Ganapati Sastri. Language. Linguistics. Philosophy. krama diipika. 586 pgs.. 1965. Linguistics.. kriyaasaara upadeshachatushht'ayaatmaka prathamo bhaaga... bhaaravi. Jha. 1940. Linguistics. khand-d'anakhand-d'akhaadhyamu. THEOLOGY. Sanskrit. Sanskrit. 868 pgs.. 1901. Language. Religion. Language. 100 pgs. Linguistics. 0.. 522 pgs. 217 pgs. kanhaiyaalaala krxshhnd-adaasa. 642 pgs. Theology. 1905. Sanskrit. d'an' chandrabhaana raavata. Sanskrit. visnutrata. kriyaadhikaaran' bugusan'hitaa.y. 180 pgs. RELIGION.t... 88 pgs. Literature. Linguistics. valmiki. 1904.v. Linguistics. 1966. Sanskrit.. krxshhnd-aayajuvediiyataittiriiyasan'hitaa Kanda Ii Part Iv.... 584 pgs.

kundmala. Language.2/14/2011 g . krxyajuraveda. Bhatta Lakshmidhara. Religion. 1961. ksemendra.. 646 pgs. krxshhnd-ayajuvaidiiya taittiriiyasan'hitaa ddhitiiyo bhaaga. Linguistics. 1962. Literature.. 1901. 390 pgs.. varadaraaja.. Linguistics. Sri Kasinath Sastri. Theology.. 1943.. 1901. Philosophy. 276 pgs. ksemendra. 1922. Literature.… 120/167 . Literature.. Raghu Vira. 580 pgs. krxtyakalpataru raajadhar^makaand-d'an' Vol 11. shriiratnapaand-i. Linguistics. Literature.... Social Sciences. Literature. krxshhnd-ayajurvediiyataittiriiyasan'hitaa bhaashhyasametaa etatpustakamu. Theology. kushhnd-agiiti... Linguistics.. Social Sciences. Sanskrit. 1948. Language. Pandit Laxman Sastri Dravid. Literature.. krxshhnd-ayajuvaidiiya taittiriiyasan'hitaa prathamo bhaaga. Shriimatsaayand-aachaara~yaa. Sanskrit. Sanskrit. bhakta Darshan. Literature.. 1937. Sanskrit.. Sanskrit. 300 pgs.... Language.. 402 pgs. 1961. Sanskrit. Linguistics.. kumarasambhava. Social Sciences. kumaarasambhavan' mahaakaavyamu pun'savaniivyaakhyaaya sanaathiikrxtamu. 0. Sanskrit. Literature.. Sanskrit. Language. kutuuhala vrxtti. 176 pgs. Sanskrit. 1941. 468 pgs. Linguistics. Linguistics. 268 pgs. krxshhnd-ollaasa champuukaavyaprakaand-d'amu. Sanskrit. shrii vaasudeivadiiqs-ita. Sanskrit. krxtyasaagara. Psychology. Sanskrit... Sanskrit. kusumaanj-jalibodhani. 1901. 646 pgs. 340 pgs. Language. Bhatta Lakshmidhara. Language... Language. kutuuhalavrxtti... Sanskrit. 1944. Linguistics. krxshhnd-ayajuvaidiiya taittiriiyasan'hitaa trxtiiyo bhaaga.. 566 pgs. Linguistics. 478 pgs. 0. Not Available. Language.. 1950. 178 pgs.. Language. soomanaatha. Sri Kasinath Sastri... Sanskrit. Kasinatha Sastri Agase... 420 pgs. Psychology.. Social Sciences. sanskritdocuments.... 1956. Language. 1901. kun'damaala. Sanskrit. kalidasa. Literature. Sanskrit.. Sri Varadaraja Mishra. Linguistics. 1951. krxtyakalpataru daanakaand-d'an' Vol 5.. 358 pgs. Linguistics. Language. 1900. Sanskrit. 1932. 1977. Language. Religion. kusumaanj-jali shriimadudayanaachaar^yavitachita. 1922. ksemendralahukavya sangrha. 32 pgs. Sanskrit. Religion. Literature. Literature. A listpg of scanned Sanskrit books at III… krxshhnd-aayajuvediiyataittiriiyasan'hitaa Part Ii. Theology. Sanskrit... kusumaanj-ajalibodhanii. krxtyakalpataru shraddhakaand-d'an' Vol 4. Language.. Literature. Bhatta Lakshmidhara. Bhatta Lakshmidhara. krxshhnd-ayajura~vediiyataittiriyasan'hitaa Shhashht'ho Bhaagah. shri paa raa subrahmand-yashaastriind-aa. 646 pgs.. 1950. Literature. Language. 406 pgs. dinnaaga. Theology. Linguistics. krxtyakalpataru niyatakaalakaand-d'an' Vol 3.. Literature. Sanskrit. krishna kumar davan. Philosophy. 297 pgs. 354 pgs. Language. Linguistics. Sri Kasinath Sastri. 1912. bhat't'a lakshmidhara. krxtyakalpataru grahasthakan'd'aa vol 2. 659 pgs. Literature.. 0. Sanskrit.. 1908. Religion. 422 pgs.. Sanskrit.. Sanskrit. Language. Linguistics. Linguistics. krxshhnd-ayajuravediiyaa kapishht'ala kat'ha san'hitaa. shriimatsaayandaachaarya. Linguistics.. Sanskrit. Literature.. Language. 58 pgs. 1960. Literature.. mahaakavishriikaalidaasa. 486 pgs. 545 pgs. 308 pgs..org/…/SanskritIIIT. ayendra sharma gen ed. Sanskrit. Sanskrit. Linguistics.

2/14/2011

A list of scanned Sanskrit books at III…

kutuuhalavrxtti... bhakta Darshan, Language. Linguistics. Literature. Sanskrit, 1960. 526 pgs. kutuuhalavrxttisaarasam'graha... Not Available, Philosophy. Psychology. Sanskrit, 0. 368 pgs. kuvalayaananda chanddraalokasahita alang-kaarachandrikaavyaakhyaaya cha vibhuushhita... budhavarashriimadappayyadiiqs-ita, Language. Linguistics. Literature. Sanskrit, 1833. 282 pgs. kuvalayaanandachandrikaachakairan'alad'akaaratatvaj'ja... Venkatachari, Art. Sanskrit, 1943. 319 pgs. kuvalayaanandakaarikaa alan'kaaradiipikaavyaakhyaayaa san'valitaa trxtiiyaavrxtti... shriiyutaashaadharabhat't'a, Language. Linguistics. Literature. Sanskrit, 1927. 114 pgs. kyo uttaraadhai... Madavacharya Sastri, Religion. Sanskrit, 1982. 693 pgs. laayanashrautasuutramu vrxtti... naaraayand-a, Language. Linguistics. Literature. Sanskrit, 1917. 471 pgs. laghu upanishad... narayana swamy aiyar k tr, Religion. Theology. Sanskrit, 1967. 302 pgs. laghukaumudii... varadaraaja, Language. Linguistics. Literature. Sanskrit, 0. 415 pgs. laghukomudii... 0000, Linguistics Literature. Sanskrit, 0. 147 pgs. laghumaanasamuu... Gangadhar Bapurao Kale, Philosophy. Psychology. Sanskrit, 1944. 40 pgs. laghupaaniiyamu... Rajaraja Varma, Sanskrit Grammer. Sanskrit, 1911. 228 pgs. laghupaaraasharii bhaashhya... diivaana raamachandar kapuura, Religion. Theology. Sanskrit, 0. 396 pgs. laghusabendusekjara... nagojibhatta, Language. Linguistics. Literature. Sanskrit, 1927. 846 pgs. laghushabdedndushekhara vyaakarand-avibhaage saptadasan'pushhpamu napadaantasuutraanto bhaaga... mahaamahopaadhyaayashriinaageshabhat't'a, Language. Linguistics. Literature. Sanskrit, 0. 264 pgs. laghushabdendukalaa... pand-d'ita shrii shobhaakaanta jhaa, Religion. Theology. Sanskrit, 1970. 144 pgs. laghushabdendusekhara... khuhiijhaa, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1938. 264 pgs. laghushabdondushokhanamulapuvedhve... , . Sanskrit, 0. 163 pgs. laghushabdondushokhanamulapuvedhve dvitiyo bhaagaha... , . Sanskrit, 0. 163 pgs. laghusiddaantakomudii... Kaushika Venkatanarasimhachari, Linguistics Literature. Sanskrit, 1937. 186 pgs. laghusiddanta kaumudi... varda raja, Language. Linguistics. Literature. Sanskrit, 1948. 180 pgs. laghusiddhaantakaumudii anuvrxttyaadisuuchakena t'ippand-ena pratyaahaara varnd-avyavahaaragnaapaka koshht'akau... shriivaradaraajapand-d'ita, Language. Linguistics. Literature. Sanskrit, 1894. 176 pgs. laghusiddhaantakaumudii san'skrxta hindiit'iikaa... shriivaradaraajaachaarya, Language. Linguistics. Literature. Sanskrit, 1970. 382 pgs. laghusiddhaantakaumuditattvaprakaasha sottaraa prashnaavali 20 varshhaand-aan' prashnapatrasahita... pand-d'itashriiraamagovindashukla, Language. Linguistics. Literature. Sanskrit, 1974. 248 pgs. laghustuti... t'i gand-apati saastri, Language. Linguistics. Literature. Sanskrit, 1917. 63 pgs. lalitamaadhavan' naat'akamu t'ikayaa... shriiruupagoosvaamiprabhupaada, Language. Linguistics. Literature. Sanskrit, 1969. 310 pgs. lalleishvariivaakyaani... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 36 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

laqs-and-aavimashe... V. Subrahmanya Sastri, Philosophy. Psychology. Sanskrit, 0. 32 pgs.

121/167

2/14/2011 A Sastri, list of scanned Sanskrit books at III… laqs and aavimashe... V. Subrahmanya Philosophy. Psychology. Sanskrit, 0. 32 pgs.

laqs-miisahasramu... Not available, Religion. Theology. Sanskrit, 0. 813 pgs. laqs-miitantramu... vi. krishhnd-amaachaarya, Language. Linguistics. Literature. Sanskrit, 1959. 389 pgs. laqs-miitantramuu volume 87... pan'dita vi krxshhnd-amaachaarya, Language. Linguistics. Literature. Sanskrit, 1959. 391 pgs. lat'akamelakamu... shriishadgadhara, Language. Linguistics. Literature. Sanskrit, 1900. 36 pgs. laugaaqs-i grxhya suutraand-i bhaashhyopetaani dvitiiyobhaaga uttaraarthamu... devapaala, Language. Linguistics. Literature. Sanskrit, 1937. 460 pgs. laugaaqs-i grxhya suutraand-i devapaalakrxtabhaashhyopetaani Vol 2... Madhusudan Kaul Shastri, Language. Linguistics. Literature. Sanskrit, 1934. 448 pgs. laukikanyaayaanj-jali dvitiiyobhaaga... colonel g a jacob, Language. Linguistics. Literature. Sanskrit, 1925. 94 pgs. laukikanyaayaanj-jali trxtiiyobhaaga... colonel g a jacob, Language. Linguistics. Literature. Sanskrit, 1911. 158 pgs. lectures on patanjali s mahabhasya vol I... subrmanya sastry p s, Language. Linguistics. Literature. Sanskrit, 1944. 384 pgs. life divine... aurobindo, Language. Linguistics. Literature. Sanskrit, 1942. 160 pgs. liilaavatii uttaraardharuupo dvitiiyobhaaga... shriimadbhaaskaraachaarya, Language. Linguistics. Literature. Sanskrit, 1937. 180 pgs. ling-ganushaasanamam... Panini, Philosophy. Psychology. Sanskrit, 1885. 192 pgs. ling-kapuraand-amuu... mahaarshhi vedavyaasa, Religion. Theology. Sanskrit, 1885. 848 pgs. list'as aaph manuscript's... Not Available, General. Sanskrit, 1925. 106 pgs. lokaparalokakaasudhaara bhaaga 2... hanumaana prasaada, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 0. 244 pgs. lokaparalokakaasudhaara bhaaga 4... hanumaana prasaada, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 0. 288 pgs. lokikanyaayaatralin' tutiyo bhaagan... jaakobha, Language. Linguistics. Literature. Sanskrit, 1904. 169 pgs. maadava vijaya... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 457 pgs. maadhamaahaatmaya... , Religion. Theology. Sanskrit, 0. 134 pgs. maadhavanala kaamakn'dalaa... shriikrxshhnd-adaasaatmaja, Language. Linguistics. Literature. Sanskrit, 1889. 214 pgs. maadhaviiyaa dhaatuvrxtti paand-iniiyadhaatupaat'havyaakhyaanaatmikaa... shriisaayand-aachaarya, Language. Linguistics. Literature. Sanskrit, 1964. 720 pgs. maadhurii darshanamu... raayaproolu subbaaraavu, Language. Linguistics. Literature. Sanskrit, 0. 69 pgs. maadhvamukhabhad'ga... Sri Surya Narayana Shyam Sukhla, Philosophy. Psychology. Sanskrit, 0. 48 pgs. maal'avikaan'gnimitramu naamanaat'akamu... shriimatkavikulashiromand-inaa shriikaal'idaasamahaakavi, Language. Linguistics. Literature. Sanskrit, 1892. 282 pgs. maalatiimaadhavan' prakarand-amu vyaakhyaaya... mahaakavishriibhavabhuuti, Language. Linguistics. Literature. Sanskrit, 1864. 500 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 122/167

2/14/2011

A list of scanned Sanskrit books at III…

maalatiimaadhavan' prakarand-amu vyaakhyaaya... mahaakavishriibhavabhuuti, Language. Linguistics. Literature. Sanskrit, 1864. 310 pgs. maanameyarahasyalokavaatvikamu... Srinivasa Charya. L, Sanskit Sastras. Sanskrit, 1925. 672 pgs. maanameyoodaya... t'i. ganapati saastri, Language. Linguistics. Literature. Sanskrit, 1912. 133 pgs. maanasaprachaarikaa... Not available, Language. Linguistics. Literature. Sanskrit, 1885. 156 pgs. maanava dharma saara... Not Available, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1943. 285 pgs. maand-d'uukyaadhupanishhatrayii... pn'. raamadevaachaaye, RELIGION. THEOLOGY. Sanskrit, 0. 474 pgs. maatukaabhedatantramu... Pandit Amareswar Thakur, Lord Hanuman. Sanskrit, 1933. 153 pgs. maayaavaadakhan'd'anamu... Srimadananda Theertha, Art. Sanskrit, 1875. 165 pgs. madanapaamnidhant... krishna das, Technology. Sanskrit, 1954. 192 pgs. madanapaamnidhant... krishna das, Technology. Sanskrit, 1954. 328 pgs. maddhvamukhaalankaara... Vanamali Misra, Philosophy. Psychology. Sanskrit, 1936. 148 pgs. madhthasida ntakaumudii... prabhaakara, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1939. 693 pgs. madhuraan'jali... G.ramacharya, Literature. Sanskrit, 1996. 346 pgs. madhusuudanasarasvati kruti advatasiddhi... Sri Harihara Sastri, Philosophy. Psychology. Sanskrit, 1893. 344 pgs. madhuvidhyaa shriivishvakarmapaaramyaparend-a sauparnd-ena vyaakhyaanena samaalin'gitaa... durishet'i ven'kat'araamaachaarya, Language. Linguistics. Literature. Sanskrit, 0. 70 pgs. madhvanidanmu... shrii sudarshan sharma, Technology. Sanskrit, 0. 530 pgs. madhvasiddaan'tasaarasan'grahada vishhanurxmand-ii... Not available, Language. Linguistics. Literature. Sanskrit, 0. 253 pgs. madhvatantramukhamadarnamu... shriimadappayadiiqs-ita, Language. Linguistics. Literature. Sanskrit, 1940. 156 pgs. madhyakaaliina san'skrxta naat'aka... raamjii upaadhyaaya, Language. Linguistics. Literature. Sanskrit, 1974. 516 pgs. madhyamavyayoga... bhasa, Language. Linguistics. Literature. Sanskrit, 1948. 56 pgs. madhyasiddhaantakaumudii... shriimadvaradaraaja, Religion. Theology. Sanskrit, 1906. 312 pgs. madyakalin sanskrit natak... ramji upadya, Language. Linguistics. Literature. Sanskrit, 0. 522 pgs. mahaaban'dho... Sripati Sharada Misra, Literature. Sanskrit, 2001. 493 pgs. mahaabhaarata aranyakaparvam bhaaga 4... vishnu s sukthankar, Language. Linguistics. Literature. Sanskrit, 1942. 610 pgs. mahaabhaarata sabhaaparvamu gn-aanadiipikaa... shriidevabodha, Religion. Theology. Sanskrit, 1949. 55 pgs. mahaabhaarata san'skrxta muula hindii anuvaada... Not available, Religion. Theology. Sanskrit, 0. 1282 pgs. mahaabhaaratama~ shaantipar^vand-i Part I... P. P. Subramanya Sastri, Language. Linguistics. Literature. Sanskrit, 1935. 690 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

h

bh

hh

k

j hik

d

bh

d d' l

t

t'h

d'hii

i

i

d

123/167

1979. 1928. mand-isaara anumaanakhand-d'a. 190 pgs.. 330 pgs. Language. Sanskrit. Language. Linguistics. 0. Sanskrit. Linguistics. sheishhasharma. 1901. Sanskrit. manmahaabhaaratamu bhiishhmaparva 6. shrii vii svaaminaathana. mantramahaidadhigrandhahaa. manu smruti. Literature. Literature. Linguistics. Theology. Language. Sanskrit. Theology... 1964. 1914. 0. king someswara. 166 pgs.… i t N t il bl L Li i ti Lit t S k it 0 350 124/167 .. shrii raajanaaraayand-a shaastri. Language.. mahaabhaashhyamuu. 0. . 151 pgs. 248 pgs. Sanskrit.. Language. Language. Not available. Literature. 1971. 1961.... 894 pgs.. Sanskrit. 110 pgs. 1066 pgs. Literature.org/…/SanskritIIIT. Sanskrit. majamuuaajaabtaa phaujadaarii. 804 pgs. Sanskrit. 0. mand-d'ala braahmand-opanishhatuu. Literature... Sanskrit. mal'aya maaruta part Ii.. manasollasa vol Iii.. Language.. Sanskrit. shriibhavabhuti. 456 pgs. Literature. Literature.. 0. Literature. Literature. sridhar venkatesh kethkar.. Language. 1896. Language. Literature. 0. bhat't'avaadiindra. 1926.. V. malayamaarutan' dhvitiyan' spandan. Sanskrit. 1828. manusambhava. mahaapuraand-apanachamapathalakaand'aa. 1970. Damodar Jha. 1891. sanskritdocuments.. 1971. vyasa. Linguistics.raghavan... 112 pgs. . mahaakavibhaasa eka adhyayana.. Language. Linguistics. Linguistics. vi. 575 pgs. mahaavidhyaavid'ambanamu t'ikaabhyaan' dashashlokii vivarand-a t'ippand-i.. 790 pgs. Literature. mahaabhaashhyat'iikaa chaturthaanhikaparyantaa bhaaga 1... raaghavan. 302 pgs. manoramaashabdaratna praqs-aittaraava liipradhamakhand-d'an. 1971. Somraj Krishna Das. Linguistics. Linguistics. Language. shriidaqs-ind-aamuurti. 170 pgs.. .... Linguistics... Linguistics. Linguistics. THEOLOGY. Literature. .. 1965. Linguistics. 1968. 0. Language. Spiritual Experience And Mysticism. Not available. trivikramabhat't'aaraka. Linguistics. 310 pgs. Literature. goopiinaatha. Sanskrit.. Literature. Sanskrit. Language.. Literature. mantraratna manjushhaa. Language. Sanskrit. 482 pgs. Linguistics.. Linguistics. mahaaviiracharitamu... Linguistics. mantroddhaarakosha saubhaagya tantrashcha.... Ramakrishna Harshaji Sastri. 50 pgs. Sanskrit. 48 pgs. 50 pgs.. 1982. Language. Linguistics. pandd'itashriiharishang-karatbhaasharmand-aa. Sanskrit.. Sanskrit. 173 pgs. 1926.. mahinmastotramu madhusuudanii vyaakhyaa trxtiiyan' san'skarand-amu. t'ii aara krxshhnd-achaarya. 190 pgs.. 202 pgs. Religion. ke. Sanskrit. mahaaradha padakooshaa.. Sanskrit. Language. Language.2/14/2011 A list of scanned Sanskrit books at III… mahaabhaashhyakunj-chikaa darabhang-gaamand-d'alaantargara t'haad'hii graamanivaasinaa... Language. Not available. shrimadhusuudanasarasvatii. mahadeva.. 1920. mantraayechandodaya. Sanskrit.. Language. Religion. Linguistics. mahabharat sahitha pradma kand. Sanskrit... Linguistics.. 0.. Literature. baladeva upaadhyaaya. Sanskrit. General. Sanskrit. manu. Sanskrit. Literature. maharastriya gyan kosh sharir khand. malavikamitra naatakamu. Sanskrit. Sanskrit. maitraayand-iiyamaanavagrxhyasuutarman.. Language.. 301 pgs. Literature. 442 pgs. Literature. 795 pgs. Linguistics. 163 pgs. 1941. Linguistics. Pandit.. -. Literature. Sanskrit. Sanskrit. Literature. 554 pgs. Language. mahaakaavyaa ratnaavalii. RELIGION.

mediniikosha. 645 pgs. Theology. Sanskrit. 238 pgs. General.. . 1831. maraat'i gran'thaan'chii bayaajavaara yaadi bhaaga nowlaa. aapadeva.. Language. Sanskrit. kevalaanandasarasvatii. miimaan'saaprakarand-agrantha miimaan'saanyaayaprakaasha t'ippand-yaadisamalan'krxta. LANGUAGE. LINGUISTICS. 246 pgs. shriimatkumaarilabhat't'apaada. gan'ganatha. Literature. Language. Literature. kevalaanandasarasvati.. 740 pgs. 1956. 48 pgs. shriishang-karabhat't'a.. LINGUISTICS.org/…/SanskritIIIT.. Language. 0. 536 pgs. Literature.. Sanskrit. 405 pgs. Sanskrit.d. LITERATURE. 541 pgs. Sanskrit. LANGUAGE. Language. LANGUAGE.. 1940. manusmuuti Vol I. Language. Sanskrit. miimaan'saakoshha Part 3. Language. Linguistics. Literature... LITERATURE. Literature. 1914. Linguistics. 96 pgs... meghasandesa. Language. 1898. miimaan'saakoshha Part II. Linguistics. Language. 1021 pgs.t. Linguistics. 0.. gan'ganatha jaha. shrimajjaimini. miimaan'saadarshani. miimaan'saadarshanamuu.. 1934. Language. mimaan'saamand-d'anena mand-id'ataa.. manuscripts. Halayudha. Sanskrit. Linguistics.. 1954. LINGUISTICS. Linguistics. aapadeva. 551 pgs. 570 pgs. 1930. Psychology. 554 pgs. miimaan'saabhyudayan. kevalaanandasarasvatii. mimaan'saanukramand-ikaa. LANGUAGE.. Linguistics.. Sanskrit. Not available. Language. Language.. manusmrxtivishhayaanukramand-ikaa. Philosophy. LINGUISTICS. Sanskrit. 214 pgs... Language... 238 pgs. Literature.… 125/167 . Sanskrit. . 1953. 427 pgs. Linguistics.. mimaan'sha darshanam pada I. LITERATURE. Ganganatha Jha. 1898. Literature... LINGUISTICS. 0. Not available.. Sanskrit... Not available. kevalaanandasarasvatii. LANGUAGE. shriimadaapadeva...2/14/2011 A list of scanned Sanskrit books at III… manuscripts. 210 pgs. 1932. Sanskrit. 531 pgs. miimaan'saanyaayaprakaasha aapodevii... 1940... LITERATURE. Religion. 1930. Sanskrit. Sanskrit. Sanskrit. 502 pgs. 0. 90 pgs. Sanskrit. Sanskrit.. Sanskrit... kalidasa. Malkuluka Bhatta. Literature.. 1980. Sanskrit. miimaan'saanyaayaprakaasha saaravivechinyaakhyaayaa.. Literature.... 216 pgs. 1948. miimaan'saanyaayaprakaasha saaravivechinyaakhyaayaa. manusmrxte. Literature.. 86 pgs.. Sanskrit. Sanskrit. Linguistics. Literature. 1948. LANGUAGE. Philosophy. LITERATURE. LITERATURE. 0. not available. 1928. shriimadaapadeva.. Linguistics. Tatacharya. mevad'a patana. 350 pgs.. mimaan'saanukramand-ika. miimaan'saashlokavaartikama... 1909. 613 pgs. shriimatkrxmaarilabhat't'a. 638 pgs. Sanskrit. Literature. Sanskrit.. Literature. Language. 142 pgs. manusmaruthihi. miimaan'saakoshha Part IV. miimaan'saashlokavaartikamu nyaayaratnaakaraaravyayaa vyaakhyayaa. shriikrxshhnd-adaasaatmaja. Sanskrit. Linguistics. 1961. Linguistics.. Literature. Linguistics. Sanskrit. LANGUAGE. 120 pgs. 1943. Religion. LITERATURE. 1948... Language... Sanskrit. Theology. LINGUISTICS. sabhara bhaasya. 1925... mandana mishra. raamachandra. miimaan'sasaarasang-graha. Sanskrit. Linguistics. Literature. miimam'saashaastrasavasve. Sanskrit. LINGUISTICS. 539 pgs. 0. sanskritdocuments.

. mudraraksasa.… 126/167 . 1999.. Linguistics. Literature. Linguistics. 128 pgs. Language. varashudrakaraaja.. Not available. ke e krxshhnd-asvaani ayyara. Linguistics.. Linguistics. mudrakshasa.. mudraaraaqs-ase pradhamo kand'khaha. Sanskrit.. visakhadatta. Literature. 1961. Sanskrit. Linguistics. 30 pgs. 1962. Sanskrit.. Literature. mitaaqs-araat'iikaayaa. Not available. muhurta chintaamand-i. mulagadaadhariyo shabdakhand-d'an. shriiraamaachaarya. Astrology.... 0. General. -. Literature. Theology. mnut'iikaasad'gahan.... 156 pgs. mukttipradiipa. mugendraagaman. Visakadatta. 433 pgs. Sanskrit. Sanskrit. Language.a. Language. mishrabandhuvinoda bhaaga 3. 382 pgs. Kastnath Trimbak Telano. muuhuurtamaartan'd'a maartad'avallabhaaravyavyaakhyaasahita. 1945. Linguistics. Sanskrit. Sanskrit. Sanskrit. 1850. Language. 0. 501 pgs. LINGUISTICS. 138 pgs. Literature. Literature. Not Available. Sanskrit. 0. na ii hindii rachana pahalaa bhaaga. LINGUISTICS. 0. 2000.. 490 pgs. 1925. Sanskrit. Language. mishrabandhuvinoda bhaaga 1. Linguistics. Literature. 1986. LANGUAGE.. Language. not available. Sanskrit..... Literature. 386 pgs. Linguistics.. mitralaab. Sanskrit.org/…/SanskritIIIT.2/14/2011 A list of scanned Sanskrit books at III… miman'sadarshanei. Literature. muhuurtachintaamand-i pramitaaqs-araat'iikaasameta.. Literature. 130 pgs. Linguistics Literature. Language. 382 pgs. saahityabhuushhand-a shriijonnalagad'd'a satyanaaraayand-amuurti.. shrudrakavi. Sanskrit.. subramanyasharmand-a... moqs-akaand-d'amu chatudaisho bhaagan. 394 pgs. LINGUISTICS. Language. LITERATURE. Sanskrit... Julius Jolly. 380 pgs. 278 pgs. 82 pgs. 0. Literature. Language. Language. Sanskrit. Linguistics. 1943.. Literature. Mimamsa Shastram.rangaswami.. Language. 336 pgs. General. 433 pgs. Language. 466 pgs. Language. Linguistics..... Sanskrit. shriikaashipati. Sanskrit. Sanskrit. 1970....v. Not Available. Language. 84 pgs.. LANGUAGE. Linguistics. 146 pgs. mrxgendragam. 390 pgs. 1918. 1948... Literature.. naaraayand-araam aachaarya. 320 pgs. mulaavidhaa bhaashhyavaartikavirudva. muulavidayaa niraasa. Linguistics. 1894. 1970. Sanskrit. 1975. Sanskrit.. . bhatta naaraayand-akaant'a. mudraaraaqs-ase. Linguistics. 1882.. Religion. 580 pgs.. mumuksu savasvaasaraa sangrahaa.. Sanskrit. 1962. Sanskrit.. LANGUAGE.. Sanskrit. Literature. Linguistics.. ramnaraya lal beni madhav. mundaka upanishad. Language. Linguistics... mrxchchhakat'ikei... Linguistics.. muchchhakat'ikan. 1937. 1918. 453 pgs. Sripada Bhat. Visadhadatta. Sanskrit. K. 0. muhutairatnamu. 107 pgs. mukundaanandabhaand-an. swami satchidanandendra saraswati. Sanskrit. naa mahaaraashht'ra yaatra. 0. mruchhakatikamu. Language. 228 pgs. Not available. 274 pgs. Literature. 1904. sanskritdocuments. .. Sanskrit. Literature. Not Available. Literature.. Sri Gadadara Battacharya. Sanskrit. Linguistics. N R Bhatt.. Language. LITERATURE. 330 pgs. Literature. 798 pgs. Literature. Not Available. Linguistics. Language. 1882... Sanskrit. Sanskrit.. muulaavidyaniraasa.. LITERATURE. 1893..

Literature. -.ramakrishna kavi..krishna Das. Sanskrit. Language. naat'yadarpeind-amuu volume 1. nalacharitranaat'akamu. Sanskrit. Language. raamachandra.. Linguistics.. Linguistics. Language. Language. 270 pgs.. Linguistics. Linguistics. Sanskrit. Theology. 676 pgs.. Linguistics. 274 pgs. -. K. Geography. 204 pgs. .. bharatamuni. 1899. Literature... Literature. Sanskrit. Sanskrit. Linguistics. Linguistics.org/…/SanskritIIIT. 550 pgs.. naaradapancharaatran. 0. 84 pgs. Language. mahaakavi shriiharshha. Language. 518 pgs. narasin'gapuraand-amu. Language. Literature. 0. 1962. Linguistics. naaradhiya mahaapuraand-amu. Language. 1961. Sanskrit.. Literature. Linguistics..... Literature. 18 pgs. Literature. raamachandra. naushada charitam. shriimachchhiromand-isudhii.. 1929. Sanskrit. 254 pgs. 0. Sanskrit. Literature. Literature. Linguistics. Sanskrit.... Language. -. Literature.. Literature. 0.. 1911.. 724 pgs. Sanskrit. Linguistics. 1956. 292 pgs. 220 pgs. Language. naishkarmya siddhi. kheimaraaja shriikrxshhnd-adaasane. Literature. 584 pgs. venkataramaniah. Sanskrit.. narapatijayacharyaasvarodaya jayalaqs-miit'iikaasameta. 77 pgs. Sanskrit. naishhadhakaavya. 1925. naishhakarmya sidhdhi.. Linguistics. Literature. natyasastra with the commentary of abhinavagupta vol-iii. baabulaal shukla...... sanskritdocuments. Literature.. Linguistics. natyasastra. 242 pgs.. 135 pgs. Sanskrit. 366 pgs. Sanskrit... 1932. 0. ta gand-apatishaastrii. 350 pgs. Literature. namalinga sasanam. dharmasuri.. 267 pgs.. 1929. Language. vyasa. Sanskrit. Sanskrit. naanaartharnd-avasan'qs-eipa. Linguistics. 216 pgs. 612 pgs. Literature. The Arts.. nalooparavyaanamuu. 1964. 1913.… 127/167 . Sanskrit. naat'uuyadarpand-amu prathamoo bhaaga. chan'drika. navagiitaakusumaanj-jali. Language... 265 pgs. shriimadvedavyaasa. naaraayand-iiyan. 1940. Literature. nandisuttram. naaraayand-abhat't'a. sri bharatamuni. Sanskrit. naat'yashaastramu vivrxtisametamu bhaaga 1.. nagananda. 1927.. shri devavaccaka. Language.. 54 pgs.. Linguistics. Sanskrit... naat'akachandrikaa. Religion.. Sanskrit. 1966. 460 pgs. Linguistics. Literature. Narayana Sastrigal. Not available. Sanskrit. Linguistics. naatyashaastram. Language. 1912... Language. 1951. 396 pgs.2/14/2011 A list of scanned Sanskrit books at III… Language. Linguistics. Literature. c. 0. Literature. Literature. Sanskrit. 1817. 380 pgs.. shriimannarapatikavi. 1943. amarasimhudu. Sanskrit.. Sanskrit. 252 pgs. Literature. Linguistics. Literature. Linguistics. 0. The Arts. 90 pgs. Linguistics. Language.. History. 2005. Literature. Language. Literature. naasikeita paakhyaanamu. 1954. Sanskrit.. 1965. Sanskrit. Sankara Rama Sastri C. Language. naageshaashayanind-aiyan' pradhamo skandhahan. Language. 184 pgs. Sanskrit. nalopakhyanam. Linguistics. 1956. m.. Sanskrit. Language. Sanskrit... Language. Language. nanj-avaada nanj-avaadasan'gn-akayinaddigajatna t'ikayaa. Linguistics.. shri suresvaracarya. 1903. bharata. Literature.. Language. naishhadhakaavyam vyaakhyayaa sameitam.. narakasuravijaya vyayoga. 1506 pgs. Linguistics.. Sanskrit. Biography..

bhaavanaatha mishraa. nipaataavyayopasagaivuttin. Social Sciences. LITERATURE. Sanskrit. Sanskrit. Sanskrit. Krishnacharya.. 68 pgs... nirnayasindu. Sanskrit. 321 pgs. 133 pgs. Sanskrit. nrxgamooqs-aprabandha.. Language. shrii kamlakar bhatt.. Literature. Linguistics. Literature.... 1925. Language. 1936. . niruttkalaghuvivrxti panj-chapaadikaa.. shriimanmaharshhivarayaaskiiya. 1956.. 1950. 166 pgs. Literature. Philosophy. Bhavanatha Misra.. Theology. Language. Literature. Literature. Sanskrit. Sanskrit. Srimad Appaya Diksita.. neiminirvaana. 283 pgs. Sanskrit. nayaayakusumajjalii. niitipaat'han.rangaswami.. Linguistics. neetisataka. Linguistics. 482 pgs. naaraayana bhat't'aa.. Language. 1972. vaagbhatta. 1955. nirnayasin'd'hu.. nidraa vign-aana kyon' kahaan' kaise aura kaba sonaa chaahiye. meighanaadaarisuuri.. A.... Sanskrit. Literature. nayamanjarii. 1951. 1940. niruttkmn. 768 pgs. 320 pgs. Linguistics.. 86 pgs. nayaviveka. Vasudeva Sarma. Narasimha Vajapeyin. Sanskrit. nityaachaaradapaind-an. se . Literature. 1967. Literature.org/…/SanskritIIIT. Sanskrit.r. Social Sciences. Philosophy.shankara Rama Sastri. Sanskrit. niitimayuukha. Language. 76 pgs. Linguistics. Literature. Sanskrit. 158 pgs. 1951. 226 pgs. Narayanarya. 1827. niilakand-t'havijayan... Sanskrit. Language. Sanskrit. nayadhyumand-i.. 365 pgs. 649 pgs.2/14/2011 A list of scanned Sanskrit books at III… nayaayaamrutamu dhvitiyo bhaagan. LINGUISTICS.. Language. Sanskrit.v. Literature. Literature... 746 pgs. Literature. Psychology. T.. Linguistics. Linguistics Literature. Language. Sanskrit. niitimaalaa.. C. 174 pgs. Sanskrit.. Linguistics. Sanskrit. 545 pgs... Sanskrit. 456 pgs... Pandith Priyanath Vidyabhushan. 1918. kuu. 1927. Mahamuni Vyasakcharya.. 0.. Sanskrit. Literature. P V Ramanujaswami.. pan' prabhunaaraayand-a tripaat'hii sushiila. Religion... Linguistics.t.… 128/167 . 1926. 91 pgs. Literature. 1907. ng-aapakaasan'grahamuu. 0. K. nayaviveika. 179 pgs. shriimadhyaarakaachaarya... 1928. Mahesvara. 625 pgs.. Linguistics. nagesha bhatta. Social Sciences.. Natural Sciences.. jvaalaapraasaada mishra. Language. nityotsavan..mahadeva Sastri. 1926. Linguistics. Language. Bhatta Nilakantha. Sanskrit. Linguistics.. Language. Psychology. Literature.. niyatakaalakaand-d'amu trutiyo bhaagan. nityaachaarapradopan. Thallahtanath Pandit.. A. 480 pgs. Linguistics. 1912.. 1942. Sanskrit. Someswara Sarma... Religion. swetaranyam narayana sastriar.. 248 pgs. 1940. 127 pgs. .. Sanskrit. 1949. Language. nayachandrikaa praaramyate. sanskritdocuments. Narasimha Vijapeyt Vol Ii. Language. 85 pgs. 1908.. Social Sciences. Linguistics.. niruttk bhaashhyat'iikaa.viraraghavacharya. nir^nd-ayaamrxtamam. 140 pgs. Sanskrit. Psychology. niruktan' nighand-t'upaat'hasamupetan' dvitiiyobhaaga. Brahmanandaji. Philosophy. 1951. 76 pgs. nayadviveka. Sanskrit. Linguistics Literature. Theology. Language.. 86 pgs. 768 pgs. nipaataavyayopasagraivuttin' t'ilaka.... Philosophy. nir^nd-ayasindhau. Sanskrit. Sanskrit.. 1937. 1930. 1941.. 246 pgs. Linguistics. Sanskrit. LANGUAGE. Sanskrit. 1937. Literature. 1937. Psychology.. raamanaathashaastri... Literature. 1941. 1967. 286 pgs. Sanskrit. 330 pgs. Sanskrit. nityaachaarapradiipa Part I..

Sanskrit. 0. Psychology. Sanskrit. Sanskrit. 218 pgs. Religion. 291 pgs. Philosophy. 299 pgs. 432 pgs. Psychology. nyaayakusumaanj-jali Part 2. LINGUISTICS. sanskritdocuments. 118 pgs. Psychology.. 0. Psychology. Psychology. 0. 1931.. shekhara. Sanskrit. 350 pgs. Theology. 204 pgs. Psychology. nyaayarakqs-aamand-i. nyaayakalaapasan'graha. Theology.. Not available. Literature. Sanskrit. 315 pgs... 432 pgs. Religion. 168 pgs. Chandrashekhar Shastri. Language.. T. 178 pgs.. nyaayabindu qs-idhamakiirti prand-iita.. Philosophy. 1915. 0. 421 pgs. nyaayaparishudin. Not available.. Philosophy. Religion. nyaayakusumaanj-jali Vol 1. 1010 pgs.org/…/SanskritIIIT.. Sanskrit.. 94 pgs. Literature. Literature. 0. nyaayadarshanamu bhaashhya vrxttisahitamu.. 1953. Linguistics. Sanskrit.. 461 pgs. nyaayaratnamaala.. . nyaaya muktaavali raaghavendra yati.. nyaayasaara shrii bhaasar^vagn-aprand-iita. 1956. Sri Senesvaracharya. Philosophy. Sanskrit. Sanskrit. Linguistics. Philosophy. Not available. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… nrxtta san'grng-aha. 68 pgs. Viraraghavacharya. Language.… nyaayasudhaamand-d'anamu. nyaayakulishamu. 1934. 444 pgs.. Sanskrit. Sanskrit. . shriiseneshvaraaryai. ti . Nyayasar. 534 pgs. Literature. Philosophy. Satyapramotheertha sripada. Sanskrit. Theology. nyaayaprakaasha nyaayashaastra.. d'aa priyabaala shhaa.. Sanskrit. Saktism. Sanskrit. chidaghanaanandagiri. 1925.sambashiva Sastri. Sri Appayah Dikshita. vaatsayaayanamuni.. 1938. Sanskrit.. Sanskrit. 222 pgs. Sanskrit. 0. 1938.. 90 pgs. Venkatanath Sri Vedantacharya. 379 pgs.... 1937.. K. Philosophy. Literature. 1969. Language. LANGUAGE. Atreya Ramanuja. nyaayaboodhini baakyavrxtti. Literature.. nyaayadarshana suutras bhasya.... 0. Linguistics. Sanskrit. Not Available. 1941. 1935. Psychology. nyaayaliilaavati. nyaayaratnaakarakhyaavyaakhyaasahite shlokavaartike.. Sanskrit. 298 pgs. 1941. Linguistics. Language. 96 pgs. Sanskrit... 1962.. LITERATURE. Sanskrit. nyaayaratnamala.. 1937. 1919.. 0000. Literature. Sanskrit. Language.. Language.. nyaaya parishuddii. Literature. Language. anuruddhaachaarya. Philosophy. Language. Sanskrit... 1918.. nyaayakulishamuu. Psychology. 1970. 426 pgs.. paarthasaarathimishraa. 426 pgs. Sanskrit. Literature. viiraraaghavachaayaund-a. nuutanadhrmmaniyamasya... 1941... Literature. nyaayakusumaanj-jali Vol I.. Sri Kamakshi Amma. 524 pgs. Linguistics. Philosophy. Athreya Ramanuya.. T. Linguistics.. pat't'aabhiraama. 1924. shrii vallabhaachaarya. 1923. gautama... Linguistics. Theology. Dwaita Philosophy. Sanskrit. Sanskrit.. si. nyaayanibandhaavalii. Literature.. nyaayabodhinii niilakan't'hiiya vishhauamaalaa. Language.. Sanskrit. Viraraghavacharya. Linguistics. 91 pgs.. Psychology. Sanskrit. Sanskrit. 363 129/167 . nyaayabhaashhyavaarttikataapyarya vivarand-apanj-jikaa 2 5. 1940. Philosophy. Language. 1912.. nyaayakaalaapasang-agraha. Sanskrit.. nyaayabodhinii vaakyavrxtti nirukti.. nyaaya jaagadiishiivyadhikarand-amu.. Language. Parthasarathi Misra. 592 pgs. 622 pgs.. lakqs-mand-aachaaryand-a. Psychology. Religion. Linguistics. Linguistics.. nyaayaashiddhaajnaamuu.

vishhnd-u sharma... Sanskrit. Dwaita Sanskrit. Vidyasekharalu. Literature. padmapuraand-amu tatraadimamaadikhand-d'an' dvitiiyan' bhuumikhand-d'an' chetyetaddvayaruupa prathamabhaaga.r. Language. Sanskrit. pachchatantrakamuu. Literature. not availabe. Sri Mad Ramakrishna. Linguistics.. Language. shriivaasudevaanandasarasvatiit'embesvaami. Sanskrit. Language.. Vamana Daji Oka. saishasrikrishna. 1941. Literature. Language. 1894. Geography.. Sri Sadasiva. 1889... Literature.. paaribhaashhikapadaaryasan'graha. pajjadashii. paadukaapat't'aabhishhokamu.. 342 pgs. Linguistics. panchadashii. Language. Linguistics. Language. Sanskrit. Sanskrit. 1902. 579 pgs. . Sanskrit. paarijaataharanachampu. Sanskrit. Philosophy. Rama Murti.k. paat'hashodhanamuu. 1962. Language. Language.. 654 pgs. Sanskrit. panchadashagiitaa. 1946. Literature. Psychology. Literature. 54 pgs. Sanskrit Grammer. Sanskrit.. Not available. 1896. Psychology. T. 568 pgs. Sanskrit.. Sanskrit. Linguistics Literature. panchatantramu 1.. Philosophy. padasan'grahan' bhaaga pahilaa. History. mahaamunishriimadvyaasa. Linguistics.. Linguistics.. kurugand-t'i suryanaaraayand-ashaastri. pancharatnakaarikaa. Sanskrit. depatment of pali. Sanskrit. 1983... nyayakhosh. Philosophy. 0.. Sanskrit.2/14/2011 A list of scanned Sanskrit books Philosophy. Linguistics. Literature.. paaia sadda mahand-nd-aavo praakrxta shabdamahaarnd-ava. 1818. Language. 1874. panchaman' pushhyamu. paand-iniiyavyaakarand-ebhinavavaarttikaani. kielhorna. 338 pgs. Literature. trinaatha sharma. 1893. Sanskrit. Language.u. Psychology. Literature. Chintamani. Linguistics. at III… nyaayasudhaamand d anamu. Language. Sanskrit. Sri Koliyalam Swami. Sanskrit. 0. 0.. 0. 1104 pgs. Not available. 60 pgs. Satyapramotheertha sripada. paavaitiiparind-ayamu.. LITERATURE. 487 pgs. 77 pgs.. Literature... 363 pgs. Natural Sciences. Language. Linguistics.. paat'hakamukhavispot'akamu... Sanskrit. paarijaataharand-achampu. Literature.. LINGUISTICS. 1930.. pan'chamapushhpamu shriiguruchartrikaavyan' shriidattachan'puu sat'iikaa. varaaha mihiraa. khemaraaja shriikrxshhnd-adaasa. Sanskrit...s. Literature. 390 pgs. 172 pgs.… 130/167 . Literature... 175 pgs. 1900. shriibaand-abhat't'a.. nyaayatatvaalokan. Language. Literature.... Kishore Nath Bha. 1954. 716 pgs. Philosophy. pan'chaadashi bai vidyaarand-ya. LANGUAGE. Sanskrit. Literature. 1953. paarijaatahrnacampa. 88 pgs. 118 pgs.. bhimacharya jhalakikar... 1939. pan'chaprakriyaa. Sanskrit. 1926.. Vacant. Language.. Literature.. Linguistics.. Sanskrit. Philosophy. Linguistics. Biography.. 324 pgs. 1973. 56 pgs. 38 pgs. 144 pgs. 538 pgs. 408 pgs. Literature. Psychology.. Sanskrit. 0.. Language. 204 pgs. Linguistics.. paarabhaashondradipikaa. nyaayasudhaamand-d'anamuu.. 64 pgs. Sanskrit. 1944. Sanskrit. Sanskrit.. panchasiddaantikaa.. Linguistics. Linguistics.. Ramakrishna. 64 pgs. Sanskrit.. Psychology. Linguistics. 1992. 258 pgs. 1200 pgs.. 364 pgs.. vishvabhandhu. Linguistics.. 1953. Sanskrit. 1918. 1972. ruupalaala kapuur.org/…/SanskritIIIT.. sanskritdocuments. pandit durgaprasaada. 0.. palitipitakasassanukkamanika part 2.

.. Linguistics. shriibhagavadaadisheshha. 60 pgs.a. 1943. Sanskrit. Sanskrit... LANGUAGE... Literature... 1114 pgs. Language. 1923... 1995. Literature. 1900. panj-chalaqs-and-iisarvasve.. LITERATURE. S. Linguistics. Sanskrit. Sanskrit. 1946. paramaarthasaara. Linguistics. Literature. Linguistics.. Religion. jayadeivasharma mishra.. vaamanasharma. shriimadhdighaarand-yamuni. Language.. Literature. Language... Sanskrit. Sanskrit. 1306 pgs. pashavalaan'ba mimaan'sa.. Literature. . Religion. panj-chatantramu. Philosophy. Sanskrit. 136 pgs. Sanskrit. 1949. Sanskrit. shivadatta. 518 pgs. 1926. paramaarthabhuushhand-amuu. 1916.. paramaayesaaran.. Sanskrit. Language. parasara dharma samhita vol 2 part 1.. parijataharanachampu. 581 pgs. 1958. 1989.. Abhinava Gupta. Literature. Sanskrit. veind-imaadhava shaastri. parishhkaaradarpand-a saastraarthakalaasahita. Sanskrit. 234 pgs. vishhnusharmaa. parishhkaaradapaind-an. paqs-ataaprakarand-amuu... 140 pgs. Linguistics. Linguistics. parashuraamakalpautramu. Language.2/14/2011 A list of scanned Sanskrit books at III… panj-chadashii. Language. 0. Language. Sanskrit. paramaarthasaara. Language. Literature. 282 pgs. Language. Krishnaswami Aiyangar.. Sri Venumadhava Sukla. Sanskrit. Parasara Samhita. Literature.. Literature.. paramasan'hitaa.. 578 pgs. panj-chatantramu. Sanskrit. Linguistics.. Literature. Language. 370 pgs. Literature. Language. 412 pgs.. shriiraamashaastriind-aa. Ropahavvamana Sastri. 505 pgs.. vinaayaka gand-esha aapat'e. sayana madhvacharya. 0.. parijata natakam. Literature. Linguistics. Linguistics. 1898. 434 pgs. Abhinava Gupta. vinaayaka gand-eish. Linguistics. 1940. 0000.. Sanskrit. 202 pgs. 1959.. Literature. paraashara san'hitaa. Linguistics. Language. Psychology.. paribhaashhendrashokharan. kumaratatacarya.. Sanskrit. Sanskrit. 1923. Sanskrit. paraasharadharmasn'hitaa vyavahaarakaand-d'amu practhamoodhyaaya. Literature. Language. not available.. Language. parayaayaratnamaalaa. 1934. Not available. pashht'aalambhamiimaam'saa. 216 pgs. Linguistics.. Theology. Sanskrit. Philosophy. 1923. 1916. Psychology. Literature. Language. Sanskrit.. 2000. Sanskrit. Linguistics. Linguistics. Theology. 1992. 62 pgs.org/…/SanskritIIIT. Linguistics.. paribhaashheindu sheikhar vyaakarand-a vibhaagamu.. Sanskrit.. Philosophy Psycology. 162 pgs.s. Psychology.… 131/167 . 68 pgs.. shrii viiraraaghavaachaaryaind-a. 1911. Linguistics. Saktism.. Literature... Sanskrit. Sanskrit. 56 pgs. vaiyaakarand-ashiromand-i sukla shrii vendiimaadhavashaastrii. Sanskrit... 60 pgs. paribhaashheindu sheikhar. Dr.. LINGUISTICS.. Linguistics. Linguistics. Sri Bhagavad Adesesha. 1935. 1868.. Language. Literature.. paramaarthasaaramu vivarand-ena sametamu. 280 pgs. nagojibhatta. sanskritdocuments. Language. Philosophy. Sanskrit.. paribhaashheindu sheikhar 1938. 0. Padmanabhan. Sanskrit. 144 pgs. 1938.. sesha srikrishna. paribhaashendusekharaa. Literature. 1923. pashvaalambhamiimaan'saa. Language. 344 pgs. 114 pgs. 200 pgs.. maadhavakaravirachitaa. 1105 pgs.. 389 pgs. 1833. Mahadeva sastry..

2/14/2011 A list of scanned Sanskrit books at III… patanj-jalayogasuutraand-i vaachaspatimishravirachita t'iikaavyaasabhaashhya sametaani.. Theology. pand-d'ita vishveishvaranaaya reit'ha.. d'aakt'aru jagadiishachandra jaina. 134 pgs. 257 pgs..... Linguistics. prabhakaradijaya. 1968. praayashvattamayuukha dashaman. Linguistics.. LITERATURE.. Linguistics.. 674 pgs... Language. krishna chandra acharya. Sanskrit. Psychology. Sanskrit. 585 pgs. laqs-minaadabhat'a... raamadaasa.. -. 0. 1915. Sanskrit. Sanskrit. Literature.. Linguistics.. praakrxtasarvasvamu. Linguistics. Sanskrit. praathamika san'giita. 1932. Language.t.. 1968. LINGUISTICS. Not available. 1974. 1908.. Literature. Sanskrit... 1937. 174 pgs. 1940... bhagavatiiprasaada vaajapeiyii. Literature. Philosophy. Linguistics. Language. yas n shriiraama deishikana. Philosophy. Sanskrit. shriibhat't'aniilakand-t'ha. 365 pgs. patyadarshii. pro shan'kara gand-eisha vyaasa.. Sanskrit. Literature. Language. Sanskrit. prakrita sarvasva.. prabodhachandrodayamu chandrikaavyaakhyaa prakaashaakhyavyaakhyaabhyaan' shhashht'haavrxtti. 285 pgs. 256 pgs. 292 pgs. Linguistics. praakrxta pushhkarind-ii prastaavanaa sahita. Language. prakiirnd-aaprabandhaa prathama khand-d'a.. Kasi Nath Sastri. Philosophy. Language.. Psychology. 292 pgs. Literature. T. Sanskrit. Sanskrit. Language. Literature. 0... 280 pgs. 612 pgs. 132 pgs. Sanskrit. Literature. Linguistics. Sanskrit... 1862. 430 pgs.. Sanskrit. Literature.. Linguistics. sanskritdocuments. Sanskrit.chinatamani. Sanskrit. LANGUAGE. Psychology. 230 pgs.org/…/SanskritIIIT. pattuppaat't'u san'skrxtaanuvaada.… prakriyaasarvasvan' savyaakhyamu prathamo bhaaga. Literature. prakat'aathaivivarand-amu. Sanskrit. Language. Sanskrit. 308 pgs.. prakarand-apajjikaa.. Literature. b. 246 pgs. Language. Language. praakrutamand-idipan. Linguistics. 1949. 1935. 1956. patanjali yoga sutrani..srinivasagopalacharya. Language. 116 pgs. prajnapaaramitaas abhisamayalankaaralooka bhaaga 1. Linguistics. mantreshvaraa.. Sanskrit. Literature. Sanskrit. phaladiipikaa adhyaaya 1 28. praakrutapingalasutraand-i. Literature.. Buddhism. prakriyaasarvasvan' dvitiiyo bhaaga. 1972. 1932. Vaishnavism. 160 pgs. Linguistics... 259 pgs. LANGUAGE.. 1968. Language.. 0. pragnaapaaramitaasa pradhamo bhaagan.. krishna chandra acharya. 132/167 . 71 pgs.. swmi vivekananda. Religion. pracya pascattyam. LITERATURE. The Arts. 1961.. 1935. LINGUISTICS. 0..r. pradhikaara kaa prashna. Literature. T. 1894.. Sanskrit. Sanskrit. Psychology. Language. prakaasha shriimadbhaagavatadashamaskandha. 1904. 1973. pand-t'itapravara shriiraamaavataarasharma.. Language. shriipurushhottamajiisahaaraaja. Language. praaryavidhaanamuu. Sanskrit. shriimatkrxshhnd-amishrayati. shriinaaraayand-abhat't'apaada.. shriimaddidhaarand-yamuni.. 101 pgs. Linguistics. Psychology. Sanskrit. 470 pgs. Philosophy.. 670 pgs. Language. 1953.. Sanskrit. Sri Ramnath Sastri. prakrita sarvasva. prabodhachandrodayamuu. Literature. 119 pgs. Linguistics. Sanskrit. Linguistics. 252 pgs. bhattacharya. Philosophy. shriinaaraayand-abhat't'apaada. Literature. B.. 1935.. mukunda.. Bhattacharyya.

T. 350 pgs.org/…/SanskritIIIT. prajnaakaragupta.. Language. Sanskrit. Sanskrit. Language. Literature.. Linguistics. Literature.. Literature. Sreenivasachariar. . 82 pgs. prand-avavaadan' pradhamabhaagan. raghunaatha kavi. Linguistics. pramaand-amajjarii.. Sudara Chary... Literature.. Linguistics. 1949. Linguistics. prataaparudriiyamu alan'kaarashaastramu vyaakhyaaya.. ratna gopala bhat't'a. Sanskrit. . Language. 690 pgs. The Arts.. Sanskrit. 1984. prasnopanishhatuu.. 160 pgs.. pramaand-ayavaada. 123 pgs. Language. Religion. 1973. pramaand-amajjarii granthaan'ka 4. LINGUISTICS.. prataaparudrayashobhuushhand-an' ratnaapand-aaravyat'iikayaa. Language. Linguistics..... san'kara bhagavatpaada. 1964. Pandurangacharya Srinivasacharya Waiker. Theology. Anandagiri. 0.. T.. Sanskrit. 1953.. 126 pgs. 1896. Literature. Linguistics. prashnashiromand-i bhaavaarthabodhiniibhaashhaat'iikaasahita. pan'd'itarudramund-i.. prasang-kavign-aanaatsiddhamu.. 1909.. Literature. Vaishnavism. Linguistics.. prashnootararatnamaalikaa.. Sanskrit. 0. Sanskrit. 1999. Language. H. 121 pgs.v. Not Available. Language. RELIGION. Jayadeva. 694 pgs. Sanskrit. Theology. Not available.. pramaand-a vachana sadgahan' tutiyan'samput'amu. 0. Sanskrit. 1950. prapannaparijatam. prashropanishhatan't'iikaasan'valita san'karabhaashhyasametaa.… 133/167 .. hari naaraayand-a. Language. vidhyaanaatha... Bellokoth Ramachandra Sharma. Literature... Not available.k. 215 pgs.. Sanskrit. Language. Jayadeva. Language. 0. 1954. 360 pgs. 390 pgs. Religion. 1950. LANGUAGE. Literature.. prasannaraaghavaa. Literature.shastri. pratidvarasutramu.. Jinaviya Muni. Tantras. . Sanskrit. prameya kaamalamaarthanda prabhaachandraan. prameyakamalamaarataand'aa. Sanskrit. 1945. Literature. 1896. 106 pgs. 1954. 106 pgs. Not available. 1942. Sanskrit. Linguistics. 121 pgs.. ... Language. prakrutaananda. Sanskrit.. Sanskrit. Sanskrit. maheindrakumaar shaastri. pramaand-avaattaka bhaashhyamuu. 426 pgs. Language.. 1953.. 1894. 0. Sanskrit. Literature. Literature. THEOLOGY. LITERATURE. subramand-ya saastri.. Linguistics. 916 pgs. prameiyakamalamaarttaand-d'a. Linguistics.. Language. 1915. Pattabhiram Sastri. 323 pgs. Sanskrit. 73 pgs. Sanskrit. 1963. .. Sanskrit... Language. Sanskrit. prasthaanaratnaakara. Theology.. pramaand-aprameyakalikaa. 223 pgs. 342 pgs. Sanskrit. Language. 146 pgs. 529 pgs. Literature. Sanskrit.. sanskritdocuments. Literature. Linguistics... Linguistics. 1979... Religion. Sanskrit. Sanskrit. 194 pgs. pramaanavaartikabhaashyam vartikalankaarah. 1992. scanned Sanskrit books at III… prakriyaasarvasvan savyaakhyamu prathamo shriinaaraayand abhat t apaada.. Philosophy. 391 pgs. Sanskrit. girvanendra saraswathi. Linguistics. Language.. Linguistics. shriividhyaanaatha.v. Linguistics. prapatrapaarijaatan. 1964. 140 pgs. Linguistics. 858 pgs. K.2/14/2011 A list ofbhaaga. Sanskrit. prashanj-aanamu.. prasannaraaghavamu sat'iikamu.. 104 pgs. prapan'chasaara saara san'graha bhaaga 2.. pramaand-ayavaada. Sanskrit. 48 pgs. Sanskrit. Literature. 1973. 668 pgs. Literature. 0. Literature. Pandit. sri vatsya vardacharya....n.

Unknown..chandrasekharan. Linguistics. 1922.. 679 pgs. krxshhnd-adatta maithila. Linguistics.. Language. Sanskrit Grammer. Sanskrit. 35 pgs. Linguistics. Sanskrit. Literature... Linguistics.. 1914. 1992. 1961.. puurvamiimaan'saadarshanamu trxtiiyasamput'amu.. shriikhand-d'adeva. Sanskrit. 174 pgs. 64 pgs. 646 pgs.. 1911.. Linguistics Literature. Linguistics. Sanskrit. Sanskrit. purushhasitramu. Language. purushhaathaisudhaanidhin. 1935. 319 pgs. 1955.. puraand-akaavya stootra sudhaa.. Literature. puurvamiimaan'saadarshanamu dvitiiyasamput'amu. Literature. . 1943. 608 pgs. Linguistics. Literature. Language. Language. Sanskrit. purajjanacharita naat'akamuu. Sanskrit. Language...... pratyabhijnahrdayam. 109 pgs. Theology. Language. puraand-aparyaloochanamu bhaag Ii.. purushhaarthachintaamand-i. Literature. Language. No..Religion. Sanskrit. pravachanasaara. 1942. pratistaa sangrahn.. sanskritdocuments. Sanskrit . shriikushhnd-amand-itripaat'hii. 443 pgs. Philosophy. Sanskrit. 0. puraand-aparyaloochanamu. 138 pgs. 0. Sanskrit. prayaaga mahaatyamu. priitilataakusumopetaa vrxttamaalaa.. purushhaathaichin'taamand-o.. Literature. Unknown. Literature.. Sanskrit. Sanskrit. purushhaarthachintaamand-isthavishhayaanukrama.. . 0.. Linguistics. 324 pgs. Language. praud'hamanooramaakhand-d'anagranthasya. Hanumacharya. 346 pgs. prodamanoramaa. 17 pgs. 488 pgs. 0. purchryarnav.. Sanskrit. Sanskrit. Literature. Linguistics. Linguistics. 1962. hari naaraayand-a.. premarasaayana.. 1928. Language. 1991. 596 pgs. Linguistics.. 1976. Sanskrit. 248 pgs. Language. 1941.. Sri Sadanandha Vidyadhar.ramanuja Tatacharya. 134 pgs. Psychology. 320 pgs.. not available. Sanskrit. Religion.. Sanskrit. 1975. si ar deivadhar. 1956... Literature.2/14/2011 A list of scanned Sanskrit books at III… pratijnj-ayaugan'dharaayand-amu. Pandit Ramlal. visvanaatha pandit. Sanskrit. Linguistics.. Sanskrit.. sayaana kaarya. 1955.. pratap singh. Linguistics.. Sanskrit.. Linguistics. Literature. Literature. Literature. emil baer ed. Language. 0. Shaacharya Shidarajamaloki. 0.. Sanskrit. Sanskrit. Unknown. Language. 0. 1955. . Sanskrit.. Literature... sundareisha sharma. Linguistics. shrikhand-d'adeva. prayogaratnamaalaa. Linguistics. Sanskrit. Sanskrit. 608 pgs. Sanskrit. 674 pgs.org/…/SanskritIIIT. shriikund'akund'aachaarya. 1917. Language. puraand-amu. pratyaqs-attvachintaamand-ivimashain.. Language. preimavijaya. 1938. Language... 100 pgs. e pi karmaarkara. 140 pgs. Literature. Language. T. . shriikushhnd-amand-itripaat'hii.. 454 pgs. 392 pgs. K. Religion.. Not available. 388 pgs. Linguistics. Literature. Vasudeva Sarma. Sanskrit.… 134/167 ... 432 pgs.. pratyakatvachintaamand-i Vol 2. purushhaarthasudhaanidhi.... N S Ramanuja Tatacharya. 626 pgs. Literature.

2/14/2011

A list of scanned Sanskrit books at III… puurvamiimaan'saadarshanamuu chaturthasamput'amuu... shriikhand-d'adeva, Language. Linguistics. Literature. Sanskrit, 1916. 428 pgs.

puurvamimaan'saa darshanamu Vol.i... e mahaadeiva saastri, Language. Linguistics. Literature. Sanskrit, 1908. 372 pgs. qs-airatarad'agnd-ii... Kshira Swami, Sanskrit Grammer. Sanskrit, 1955. 417 pgs. qs-i bhagavadraamaanujavirachite qs-ishaarirakamiimaan'shaabhaashhye Part 1... Sri Lakshmi Narasimhakumar, Philosophy. Psychology. Sanskrit, 1936. 434 pgs. qs-i bhuvanadevaachaayevirachitaa aparaajitaprachha... Popatbhai Ambashankar Mankad, Religion. Theology. Sanskrit, 1950. 791 pgs. qs-ibhaashhyamuu chatushuutribhaaga... Maha Mahopadya Sudarshana Vyasabhatta, Philosophy. Psychology. Sanskrit, 1916. 290 pgs. qs-iimada naarand-yamuniprand-iitaa panchadashii... Narayana Ram Acharya, Philosophy. Psychology. Sanskrit, 1949. 580 pgs. qs-imaddhekhaanasekaasyapajaanakaand-d'a... Parthasarathi Bhattachar, Philosophy. Psychology. Sanskrit, 1948. 214 pgs. qs-imadraamaanujaachaayeprand-iitan' qs-ibhaashhyamuu Part Ii Introduction And Notes... Vasudev Shastri Abhyankar, Philosophy. Psychology. Sanskrit, 1916. 368 pgs. qs-imatsanatsujaatiiyamuu... B. Gururaja Rao, Religion. Theology. Sanskrit, 1940. 144 pgs. qs-inad'apaadavirachitaa seikodheshat'iikaa... Mario E. Carelli, Religion. Theology. Sanskrit, 1941. 148 pgs. qs-ivanamaalivirachitaabrahaasuutrasiddhaantamuktaavali... Not Available, Religion. Theology. Sanskrit, 1942. 252 pgs. qs-utiratnaprakaasha qs-itimateudyota... Tryambaka Sastri, Philosophy. Psychology. Sanskrit, 1910. 102 pgs. raadhaaparind-aayamuu mahaakaavyamuu... Not Available, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1931. 304 pgs. raagaratnaakara... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 706 pgs. raagaratnaakaraa... khemaraaja shriikrxshhnd-adaasane, Language. Linguistics. Literature. Sanskrit, 1966. 702 pgs. raagatattvaviboodha... shriinivaasa, Language. Linguistics. Literature. Sanskrit, 0. 84 pgs. raaghavanaishhadhiiyamu savisheshhavimarshinii prakaashasan'skrxta hindiivyaakhyopetamu... shriiharadattasuuri, Language. Linguistics. Literature. Sanskrit, 1969. 95 pgs. raaghavanaishhadhiyamu... shriiharadattasuri, Language. Linguistics. Literature. Sanskrit, 1896. 74 pgs. raaghavapaand-d'aviyamu... shriikaviraaja, Language. Linguistics. Literature. Sanskrit, 1897. 216 pgs. raajadhamaikaand-d'amu... K.v. Rangaswami, Language. Linguistics. Literature. Sanskrit, 1944. 117 pgs. raajadhamaikaand-d'amu ekaadasho bhaagan... K.v.rangaswami, Language. Linguistics. Literature. Sanskrit, 1943. 410 pgs. raajatarangind-i... durgaprasada, Language. Linguistics. Literature. Sanskrit, 1892. 393 pgs. raajatarangind-i Ii... durgaprasada, Language. Linguistics. Literature. Sanskrit, 1894. 308 pgs. raajatarangind-i Iii... durgaprasada, Language. Linguistics. Literature. Sanskrit, 1896. 410 pgs. raama charchaa... premachanda, Language. Linguistics. Literature. Sanskrit, 1948. 168 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

d

kh

j

h iik

hh d d

L

Li

i ti

Lit

t

S

k it 0 920

135/167

2/14/2011

A list of scanned Sanskrit books at III… raamaayand-a... khemaraaja shriikrxshhnd-adaasa, Language. Linguistics. Literature. Sanskrit, 0. 920 pgs.

raamaayand-a baalakaand-ad'a... tulasiidaasa, Language. Linguistics. Literature. Sanskrit, 1886. 553 pgs. raamaayand-a sampuurnd-a qs-epaka... khemaraja shriikrxshnd-adaasa, Language. Linguistics. Literature. Sanskrit, 1827. 753 pgs. raamaayand-amajjari... shriikshemendra, Language. Linguistics. Literature. Sanskrit, 1903. 519 pgs. raamaayand-amu ayoodhyaakaand-d'amuu... shriimayaakavishrivaalmiiki, Language. Linguistics. Literature. Sanskrit, 1923. 316 pgs. raamaayand-amu baalakaand-d'amuu... shriimayaakavishrivaalmiiki, Language. Linguistics. Literature. Sanskrit, 1867. 224 pgs. raamaayand-amu kishhkindhaakaand-d'amu... shriimadvalmiiki mahaamuni, Religion. Theology. Sanskrit, 1915. 318 pgs. raamaayand-amuu arand-yakaand-d'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 0. 342 pgs. raamaayand-amuu baalakaand-ad'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 1912. 426 pgs. raamaayand-amuu sundarakaand-d'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 1916. 354 pgs. raamaayand-amuu uttarakaand-d'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 1920. 362 pgs. raamaayand-asan'qs-eipasagrarasasvaada... Not Availble, Language. Linguistics. Literature. Sanskrit, 0. 124 pgs. raamakarnd-arasaayanamu prathamo nishhyanda... Not available, Language. Linguistics. Literature. Sanskrit, 0. 74 pgs. raamakathaa... vaasudeva, Language. Linguistics. Literature. Sanskrit, 1929. 66 pgs. raamasandesha padaarthaprakaashaakhyayaa t'iikaayaa sameta... shriiraajaraajeshvarapuujyacharanda, Language. Linguistics. Literature. Sanskrit, 1917. 140 pgs. raamasvayan'varsya vishhayaanukramand-ikaapraarambha... mahaaraaja shriiraghuraajasen'hajii deiva, Language. Linguistics. Literature. Sanskrit, 1822. 1006 pgs. raavand-aarjuniyamu... shriibhat't'abhima, Language. Linguistics. Literature. Sanskrit, 1900. 218 pgs. raghunaathavilaasamu naama naat'akamu... yagn-anaaraayand-adiiqs-ita, Language. Linguistics. Literature. Sanskrit, 1958. 174 pgs. raghuvan'shamuu... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 576 pgs. raghuvan'shavimarsha... ra. krxshhnd-amaachaaryend-aa, Language. Linguistics. Literature. Sanskrit, 1908. 168 pgs. raghuvansh... kalidasa, Language. Linguistics. Literature. Sanskrit, 1944. 360 pgs. rasa mitra... tryambak nath sharma, Technology. Sanskrit, 1965. 276 pgs. rasa mitra... tryambak nath sharma, Technology. Sanskrit, 1965. 382 pgs. rasachandrika... pande v, Language. Linguistics. Literature. Sanskrit, 1913. 110 pgs. rasachandrika... parbatiya pandita vishweswara pandeya, Language. Linguistics. Literature. Sanskrit, 1926. 108 pgs. rasadiirdhikaa... kavi vidhyaaraama, Language. Linguistics. Literature. Sanskrit, 0. 102 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 136/167

2/14/2011

A list of scanned Sanskrit books at III… rasadiparigyan... jaganath prasada shukla vaid, Natural Sciences. Sanskrit, 0. 174 pgs.

rasagan'gaadharahrudayamu... jnj-aanachandrastyaagii, Language. Linguistics. Literature. Sanskrit, 1964. 138 pgs. rasagangadhar... jaganath, Language. Linguistics. Literature. Sanskrit, 0. 430 pgs. rasamajjarii... bad'ri natha, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1929. 222 pgs. rasamiimaan'sa... aachaarya raamachandrashuklaa, Language. Linguistics. Literature. Sanskrit, 0. 516 pgs. rasasadanabhaand-an... yuvaraaja, Language. Linguistics. Literature. Sanskrit, 1893. 70 pgs. rasavilas... bhudeva sukla, Language. Linguistics. Literature. Sanskrit, 1952. 162 pgs. rasen'drasaarasan'graha bhaashhaat'iikaasahita... mahaamahopaadhyaaya gopaalakrxshhnd-abhat't'a suuri, Religion. Theology. Sanskrit, 1844. 528 pgs. ratiratna Pradiipika... liilaadhara sharma, Language. Linguistics. Literature. Sanskrit, 1930. 148 pgs. ratna samuchchaya... not availabe, Language. Linguistics. Literature. Sanskrit, 1928. 504 pgs. ratnaavali kii kathaavastu... Not available, Language. Linguistics. Literature. Sanskrit, 0. 366 pgs. ratnaavalinaat'ikaa... shriiharshhadeva, Language. Linguistics. Literature. Sanskrit, 1953. 216 pgs. ratnaavalinaat'ikaa... shriiharshhadeva, Language. Linguistics. Literature. Sanskrit, 1953. 270 pgs. ratnakiirtinibandhaavalii volume Iii... anantalala t'haakuura, Religion. Theology. Sanskrit, 1957. 220 pgs. rattamatam... h. sesha iyengar, Language. Linguistics. Literature. Sanskrit, 1950. 174 pgs. rauravaagaamaa Vol.i... yan.aar bhat't'a, Language. Linguistics. Literature. Sanskrit, 1961. 277 pgs. rauravaagaamaa Vol.ii... yan.aar bhat't'a, Language. Linguistics. Literature. Sanskrit, 1972. 366 pgs. rig veda samhita volume Iv mandala X... max muller f ed, Religion. Theology. Sanskrit, 1892. 732 pgs. rigbhaashhya bhuumika... vi. kapaali saastri, Language. Linguistics. Literature. Sanskrit, 1952. 284 pgs. rigveda samahita (manuscript)... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 830 pgs. rigveda samhita... f max muller ed, Religion. Theology. Sanskrit, 1890. 974 pgs. rigvedasanhitoupanishadchatakam... -, Religion. Theology. Sanskrit, 0. 490 pgs. riitikaalina kavitaa men' abhivyaan'janaa evan' shilya... Not available, Language. Linguistics. Literature. Sanskrit, 1966. 491 pgs. rudraadhyaaya bhaashhya etatpustakan... saayand-aachaaryabhat't'a, Language. Linguistics. Literature. Sanskrit, 1976. 186 pgs. ruupamaalaayaamu bhaage Iii... not Available, Language. Linguistics. Literature. Sanskrit, 1982. 70 pgs. rxgbhaashhya... Not available, Religion. Theology. Sanskrit, 0. 73 pgs. rxgbhaashhyasan'graha... sva d'aa devaraaja chaananaa, Language. Linguistics. Literature. Sanskrit, 0. 440 pgs. rxgveda prathamos-shht'aka chatuthes-shht'ake shhashht'os-dhyaaya... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 952 pgs. rxgveda san'hitaa Part I... daamodara bhat't'a, RELIGION. THEOLOGY. Sanskrit, 0. 776 pgs. rxgveda san'hitaa Part II... daamodara bhat't'a, RELIGION. THEOLOGY. Sanskrit, 1940. 978 pgs. rxgvedaanukramand-ii... kunjanuu raajena, RELIGION. THEOLOGY. Sanskrit, 1932. 160 pgs. rxgveida bhaashhyamu volume 15... udgita aachaarya, Language. Linguistics. Literature. Sanskrit, 1935. 124 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 137/167

j. Sanskrit. Literature.. Sanskrit.. Sanskrit.. saahitya darpand-a. 313 pgs. Sanskrit. Sanskrit. Language.. Language... 1951.. Language. Language. saamaveda uuhauuhyagaanamu anubandhasahita trxtiiyo bhaaga san'put'amu 2. Language. saahityadarpand-amu. Language. Linguistics. Language... Linguistics. 426 pgs. durlabhaa. Literature. vidhyabhushand-a. 1900. Sanskrit. 0. krxshhnd-amoohan shaastri. 234 pgs. Sanskrit. Not available. 362 pgs. Literature. shrii vai raamamuurtishrautii. 20 pgs. Language. saamavediiya ashht'a braahmand-e saamavidhaanan' aarshheyan'cha gn-iiqs-aadi san'valitamu dvitiiyo bhaaga. 2002. shrii vai raamamuurtishrautii. 1908.. Sanskrit. rxgveidasan'hitaa prathamoo bhaaga. Linguistics. 193 pgs. rxktantran' saamapraatishaakhyam.. uppalla someshvarasharma... Prof.. Sanskrit.. rxgveidasan'hitaa dvitiiyoo bhaaga. 1955. Literature. Language. Language.. LANGUAGE.chenna reddy. 1024 pgs. Literature. Religion. Not available. Language. Sanskrit. s. Theology. Not available. Linguistics.. raamachandravinaayaka pat'avardhana. Linguistics.. 939 pgs. Language.. Linguistics. Language. shriikrxshhnd-asuurind-a... Linguistics. Linguistics. rxvedavyaakhyaa bhaaga 2 ashtaka 1 adhyaaya 5 8. shriimadhvaachaarya. Not available. 2002. rxtuvarnd-ana vyaakhyaaya. saahityakaumudi. 0.. 1947... Theology. Linguistics. Language. Sanskrit. 0. 644 pgs. madhava. C. Literature..2/14/2011 A list of scanned Sanskrit books at III… rxgveida prathamoshht'aka. Linguistics. 217 pgs. 1873... 0. saamaveda uuhauuhyagaanamu anubandhasahita trxtiiyo bhaaga san'put'amu 1.. Linguistics.. shriivishvanaathakaviraaja. LINGUISTICS. Sanskrit. 180 pgs. Language. Language. rxveda san'hitaa bhaaga 1. Language. saamaveidasan'hitaa aagneiyakaand-akamuu prathamoo bhaaga.. Literature. LITERATURE.. Religion. Not available. Literature. Linguistics.… 138/167 . Literature. Literature. Sanskrit. Literature. 299 pgs.. Sanskrit.. Sanskrit. Literature. Sanskrit. rxgveidasan'hitaa chaturthoo bhaaga. Literature. Literature.org/…/SanskritIIIT. Sanskrit. saahityavimarsha sakalasaahityaan'shasang-grahatmaka. 639 pgs. 64 pgs. 1056 pgs. 1863. Literature. 772 pgs. Language. 1933. Religion. Language. Not available. 1958.. 1969. 500 pgs. 1062 pgs. rxgveidasan'hitaa trxtiiyoo bhaaga. 100 pgs. Surya Kanta Shastri. 1933. Sanskrit. Linguistics. saamaanyaniruktti. Sanskrit. 1897. Linguistics. Indology.u oriental journal vol-1. 1858. rxkuusuuchii... Linguistics Literature Sanskrit 1973 327 pgs sanskritdocuments. Literature.. Not available.. 1941. 1982. saamavedasan'hitaa. 1148 pgs.. 630 pgs. saamavediiya ashht'a braahmand-e taand-d'yamu pad'avin'shabraahmand-an' prathamo bhaaga. Sanskrit. 1867. prof.. shriimatsaayand-aachaarya. Literature. Sanskrit. Theology. Linguistics..... Literature. Linguistics. Sanskrit. t'iikaachatushht'ayasanaathii. Linguistics. shrisaayand-aachaarya. Language. Linguistics... saahityadarpand-amu vyaakhyaamavalambaa samudbhaasitamu panj-chamasan'skarand-amu. saahityaratnamanj-jushhaa.. Sanskrit. 0. Sanskrit. 1981.v. Linguistics. 516 pgs.. rxgveidasan'hitaa panchamoo bhaaga. Kunhan Raja. Literature.. 1147 pgs. 1111 pgs.. Not available.

Language. 0. sahityaratnakosh pradama kand. sahityaratnakosh abhilekha sangrha. Theology.... Sanskrit. saamavidhaana braahmanamuu. not Available. Linguistics. saata inakalaabii itavaar bhaaga tiisaraa. Psychology. 751 pgs.. Sanskrit. Linguistics. 1973. Sanskrit. Sanskrit.. 414 pgs. baabuu raamachandra.. saayand-iiyargvedabhaashhyabhuumikaayaa vaadashiinaathii t'iikaa. Language.org/…/SanskritIIIT. 342 pgs. 208 pgs. Linguistics. 98 pgs. Literature. saambapuuraand-amu upapuraand-amu. Language... 140 pgs. Language. 194 pgs. Sanskrit. 476 pgs... t'haakura jyotishhaachaariyaa. 1937.. Literature. thibaut'a.. Linguistics. 1939.. shriipataraaya. Sanskrit. Sanskrit.. Literature.. Literature. LINGUISTICS. 0. Theology.. Sanskrit. Language.. sahaavein' pustaka. Sanskrit. Sanskrit.. Linguistics. kausun'varavaastavyapand-d'itavara vaasudeva. saastradiipikaa. shriimatkalyaand-avarma. 1913. Linguistics.. Literature.. saarasiddhaantakaumudii raakaa san'skrxta hndiivyaakhyaaya dvitiiya khand-d'a. Not available. Religion. LANGUAGE.. 1907. 1930.. Sanskrit. 1906.. Linguistics. saariirakanyaayasan'graha By Prakasatmayati. Language. Religion. saaravyaayanagrxhyasang-graga kaushhiitakigrxhyasuutrand-i. saang-khachaayanagrxhyasang-graha. 0. Language. 327 pgs. Linguistics. 370 pgs. 511 pgs. Linguistics... Not available.. brahmha charya raam. Philosophy. shriimatkalyaand-avarmaa. Literature. Psychology... Language. Sanskrit. 310 pgs. 96 pgs. 1890.. Sanskrit. Philosophy. d'aa bii aar sharmaa. Sanskrit. Language. 572 pgs. kai pan' vishhnd-u naaraayand-a bhaatakhan'd'ei. Sanskrit.. saaraavali kaantimati hindii vyaakhyaa sahitaa. Sanskrit. 0. Literature. 108 pgs. 0.r.. saarasvatiikand-t'haabharand-amu. 0. 1908. Language.chintamani. Linguistics. Philosophy. 208 pgs. 1964. 1966. LANGUAGE. saaraavalii. Sri Amalananda. Sanskrit. Sanskrit. 1919. 222 pgs. LITERATURE. Literature. 1989. Literature. sabhaashhyarxksan'hitaayaa varnd-anukramasuuchii.. saarasvatavyaakarand-amuu. sachitra jyotishha-shiqs-aa.. Linguistics.. d'aa shriikrxshhnd-amand-i tripaat'hii. saastradapend-amuu. 1916. 62 pgs. Sanskrit. Language. 1908. vishva bhandu ed. LINGUISTICS. saan'khyaakaarikaa... Literature.. shriimadvaradaraajaachaarya. Language. sachithra yogaasan. Religion. laqs-and-a. 1992. 138 pgs. Language. LITERATURE.. Sanskrit.. Sanskrit. sanskritdocuments.s.. 1942. Literature.. 430 pgs. Sanskrit. Sanskrit. saariirakavyaaravyaaprasthaanaani. 164 pgs. Literature. 202 pgs. 1940. V. Linguistics. Sanskrit.. 1983. Guruswamy.v.. Linguistics... shriisachchidaanandashivaabhinava. Literature.. Language. Linguistics. saang-kaadarshanamu. Linguistics. pan' shriitrilokanaathamishra. shriivaasudevavidvadvara. Literature. Literature. 252 pgs.2/14/2011 A list of scanned Sanskrit books at III… Linguistics. Psychology.. Theology. Religion. Literature. T. 1941. Linguistics. 580 pgs..… 139/167 . 266 pgs. Literature. ji. Sanskrit. bhadhur chand chhabra. Sanskrit. sadaashivendrastuti. naaraayand-a raama aachaarya.. saamyavaada. Theology. Language. 272 pgs.. Language.

Linguistics. sam'skaararatnamaalaa Part Ii. Sanskrit. Social Sciences. Literature. 75 pgs.. Literature.. Religion. 508 pgs. sakhyakarikaa... Linguistics. san'qs-epashaarirakamuu with Thatvabhodini Part 3.. Literature.. Sarvajnatma Muni. sam'skaaragand-apati Fasciculas Vi and Vii. 1948. krishand-amaachaari.. Sanskrit... Linguistics. 82 pgs. sam'skaaradiipaka Part I. san'kalpasuuryodayanaat'akamuu Part I. san'qs-epasaariirakamu vyaakhyaasamalang-krxtamu prathamobhaaga. 0. Sanskrit. Linguistics.. Sanskrit. san'kalpa suuryoodaya. Mahamahopadhyaya. Literature. Language. samskruthapadamaala trutiiya kusumam. shrii a vi narasin'haachaarya. 236 pgs. Literature. Linguistics. samayasaara bhaaga 8. 1864.. Sanskrit.. 820 pgs. gangadhara krishna draavida. Philosophy.. samraat'uu shubhaagamana. Theology. pg saitubandhamu. sakalapuraand-aabhyarhita shriibhaagavata dashamaskandha puurvaardhamu.. shriimatsarvagn-amuni. sakalaagama saara sang-graha shaiva aagama.. Linguistics.. Language. Psychology. 490 pgs. Linguistics. Language. 1910. Language. shrii kuruganti veinkataramand-a shaastri.. Literature. san'giitaratnaakara kalaanidhyaaravyat'ikaa prathamo bhaaga. Psychology. 1953. Linguistics. 1936.. Sanskrit. Language. 1899. Sanskrit. 830 pgs. samkalpa suryodaya part-2. Language. Language.2/14/2011 y p A list of scanned books gy at III… . Sanskrit. vimand-d'alavakra. Sanskrit. Language.org/…/SanskritIIIT. Sanskrit.. Yajnika Srirama Krishna Sarma. 1930. Literature. adi sankaracharya. sam'skaararatnamaalaa Part I.... 600 pgs. LANGUAGE. 1899. Literature. sampaadhya prakaashataan' niita. 1919.. 1895.. Linguistics. 296 pgs. 110 pgs.. 1974. jaiminii... shrii vein'kat'anaatha. Sri Ramnath Sastri Vaidye. 1912. Srirama Krishna. shri kunda kunda acharya. Literature. Sanskrit. Language. 48 pgs. Literature. 644 pgs. Not available. Literature... 1938. Sanskrit. 194 pgs.… 140/167 . 514 pgs. 263 pgs.. Sanskrit. Sanskrit. Linguistics. shriinirang-kashaang-giideva.. Social Sciences.. 1897. 1955. raajen'dranaatha pan'd'ita. Sanskrit. Literature.. Linguistics.. shriini shang-kashaang-giideva... Sanskrit. 417 pgs.. Language. Literature. Linguistics. Social Sciences. 1973.. krishnamacharya.. LINGUISTICS.. Sanskrit g . Language. 202 pgs. san'giitaratnaakara etatpustakan' kalaanidhyaaravyat'iikaasan'valita. 1932. san'qs-epa shaarirakamuu Vol 2 Adhayas 2 . mahaamahopaadhyaaya pan' raamashaastribhaagavataachaarya svaamii.4.. 1948. Sanskrit. Kasinath Sastri. samasyaasamajyaa. Linguistics. Sanskrit. Sanskrit. Literature. Philosophy. Literature.. Sanskrit. Kasinath Sastri. 1937.. Literature.v. Sanskrit. Linguistics.. samayochita padamaalika. 250 pgs. Language. Language. shriiraamadaasabhupatiprand-itadhaa.. 1917. Literature.. sam'skaaragand-apati Kandika Xii Of Kanda Ii.. Linguistics. Sanskrit. 143 pgs. 460 pgs. Language. Sanskrit. 1896. 1971. Language. 84 pgs. 255 pgs. LITERATURE. Linguistics. 855 pgs.. san'karshha kaand-d'amu shhod'ashaadhyaaya sheshhachaturadhyaayiisvaruupamu. Language. sanskritdocuments.

Sanskrit. Sanskrit. 172 pgs. 439 pgs. Sanskrit. Theology.... 0. san'skaaravidhi shhod'ashasan'skaarai. Not available.. Literature. san'skuuta kal'aapuurnd-odaya. Sanskrit. Literature.. Literature. Religion.. Sanskrit. Literature. 248 pgs. 528 pgs. vilayat hussian khan. mallikaarjuna raavu. Sanskrit.. 432 pgs. suuryanaaraayand-a shaastri.. shriisholataataachaayaind-a. 1933. 86 pgs. sangeethgnan ke sansmar. Literature... Sanskrit. Psychology. 0.. sankshepa sarirpaka. 1956. 1954. yam... 1996. Psychology. 858 pgs. Sanskrit. Language. san'skrutakaadambarikathaa. sanaatana vign-aana samudaya. Sanskrit. Literature. Literature. Philosophy.. Linguistics. Neelakanta Shankar... 1959. LINGUISTICS. san'qs-epashaarirakamuu with Thatvabhodini Part 5. General. 1934. 274 pgs. sankhya sara. sanskritdocuments. san'skrxtadvitiiyapaat'ha san'skrxtabhaashhaayaan' san'bhaashhand-ashiqs-aka. 48 pgs. not availabe.. Linguistics. Not available. 308 pgs. Language. Sanskrit. 630 pgs. Literature. san'qs-epashaarirakamuu with Thatvabhodini Part 4.. Pandit Sri Rama Krishna. 770 pgs. berriedale keith. isvara karikas. Language. Literature.. shriiveng-kat'aramand-aaryend-a. Not available. 1946.. miimaan'sakashriinilakand-t'habhat't'a. Linguistics. a.. san'skrxta naat'aka udabhava aura vikaasa siddhaan'ta aura prayoga. Linguistics.. 1950. Linguistics. san'skrutaavataaran. Sanskrit.. Not available.. san'skrxta vyaakarand-a shaastra itihaasa trxtiiya bhaaga. san'skruta saahitya itihaasan.org/…/SanskritIIIT.. Sanskrit. Philosophy. Sanskrit. Language... Literature. Language. 1947. sankaravijaya. Literature... 338 pgs. Language. vyasa. Sanskrit. san'skrxta vyaakarand-ashaastra kaa itihaasa prathamabhaaga. Linguistics. Language.. Sanskrit. Linguistics. LITERATURE.… k it lf t h t2 d t l k L Li i ti Lit t S k it 1971 60 141/167 . 1958.. Sanskrit.. 76 pgs. Sarvajnatma Muni. Sanskrit. 0.. The Arts.. 126 pgs. 127 pgs. malliyan' raamaachaaryasuununaa. Theology. Linguistics.. Linguistics. 1934. Linguistics. Language. Literature. san'skrxta saahitya men' saadrxshyamuulaka alan'kaaron' kaa vikaasa. vyasacala. 498 pgs.. Sanskrit.. Literature. Sanskrit. 183 pgs. Language. Language. Sanskrit. 68 pgs. 1941. savanjatma muni. san'skaaramayuukha ekaadasha.. Venkataramana Sastri. Linguistics.. Literature. Religion. Language. yagn-adatta. Sanskrit.. Linguistics. san'skaaragand-apati. Sanskrit. Philosophy. Linguistics. d'aa brahmaananda sharmaa. Linguistics.. 1913. 650 pgs. Sarvajnatma Muni. Literature.. Sanskrit. Linguistics.. 340 pgs. Sanskrit. Language. 264 pgs. sanskrit pravaahini shabd kosh.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit. Language. san'skrxta kavi jiivitamu. Vijnana Bhikshu. 1965. Sanskrit.. Literature. Literature. 1955.. Language. Literature. 292 pgs. Language.. 1926.. san'skrxtaan'dhranighan't'uvu. sanshipt mahabharath dritya kand.. 1979. 522 pgs. 1938. Language. 1984. 0. 370 pgs. Psychology. 1939. 1977.. anjinyea murthi. san'skrxta vyaakarand-a shaastra kaa itihaasa dvitiiyabhaaga.. sankhya karikas. 430 pgs. LANGUAGE.. 1884. 0.. 100 pgs. Sanskrit. sang-aameshar krodamu. Linguistics.

arya bhadanta asvaghosa. Sanskrit. sarvadarshanasan'graha prasthaanabhedashcha.. LANGUAGE. satapathabrahmana. jayantkrishna h dave. bhiqs-ugauriishang-karend-a. 62 pgs. LITERATURE. Literature. Sanskrit.. 1970. 1912. Literature.. Language.. Psychology. Not Avaliable... 1937. 88 pgs.. Linguistics. Linguistics. Sanskrit. 162 pgs. Linguistics.. 150 pgs. Literature. Shankara Sastri Marulkar. Literature. Sanskrit. Language.chennareddy.. Sanskrit. shriimanmaadhavaachaarya. 438 pgs. Sanskrit. 1928..2/14/2011 A list of scanned Sanskrit books at III… sanskrit self teacher part 2.dhaprashratrayaatmaka prathamo bhaaga. Sanskrit. Linguistics.. Linguistics. sarvavedaanta siddhantasaarasan'graha. Linguistics. sanskritdocuments. 60 pgs. Linguistics. Language. sarangadhara samhita. Sri Shankaracharya. Linguistics.... Sanskrit.. 60 pgs. 1965. Literature. 600 pgs. Unknown.. Literature. Linguistics. satyaatheprakaasha. satyaashhaad'haavirachitan'shrotasuutran' panchchadashashhod'ashaprashraatmaka shhashht'amo bhaaga.. Literature. 60 pgs... Sanskrit.… 142/167 . 468 pgs. Linguistics. -. 0. 0. 426 pgs... 0. Language. 1939. Language. Philosophy.. satyaashhaad'haavirachitan'shrotasuutran' saptadashaashht'adashaa prashraatmaka saptamo bhaaga. saral sanskrit shikshak bagh 2. -. sat'iikaamarakoshasya. Language. Literature.. Language. LINGUISTICS.. Sanskrit. Literature. Literature... Linguistics. Sankara Sastri Marulkar. Sanskrit.. Shankara Sastri Marulkar. 1962. Language. Language. LITERATURE. Sri Kasinatha Sastri Ahhore... Sanskrit. s d satwalekar. Sanskrit. satyashhaad'havirachitan' shootasuutran. Linguistics.. Sanskrit. Language. satyaashhaad'haavirachitan' shrotasuutran' tatraas-s.. Sanskrit. 1971. LANGUAGE. Linguistics. Philosophy. 202 pgs. Sanskrit. -.. Biography. Literature. 52 pgs. Language.. 1997. sri sarangadhara acharya. 1928. 0. saundarananda kaavya. 1965.. sarvalaqs-and-asang-graha hitachintaka. Linguistics. Language. Sanskrit. Vacant. Sanskrit.. Linguistics. Linguistics. Language. m. Linguistics. harinaaraayand-a aapt'e. saral sanskrit bala bhodh.. 130 pgs. 724 pgs. Language. 222 pgs. Language.. Sanskrit. sarakaara tumhaarii aan'khon'men'. History... Sanskrit. sarasvatiivilaasa vyavahaarakaand-d'a.. LITERATURE. saral sanskrit shikshak bhag 4. 372 pgs. Sanskrit. -. satyaashhaad'haavirachitan'shrotasuutran' dashamo bhaaga. sapal jiivan ki mahatvapoorn gatnaaye. Language. 150 pgs. Literature.. Literature. Literature. Language. 1994. 1908... 0. santhrajshakunam. Not Available.org/…/SanskritIIIT. sarala kahaaniyan' bhaaga 2. 930 pgs. 1932. Sankara Sastri Marulkar. saral sanskrit sikshak baag 8. Sanskrit. 204 pgs. 1927. Sanskrit. 166 pgs. 60 pgs. Language. Geography. 1927. Literature.. satya shodhanam. 155 pgs.. 0. satyaashhaad'haavirachitan'shrotasuutran' ekaadashaadichatudeshaantaprashraatmaka panchchamo bhaaga.. Sanskrit. Not Available. 537 pgs. Literature. 396 pgs. 1942. Not available. LINGUISTICS. Linguistics. 0. paand'eya bechana sharma. Literature. LANGUAGE. 1927... mahtma gandhi. 308 pgs.. Not available. -. Literature. Sanskrit.. Literature.. Psychology. shriiprataaparudramahaadevamahaaraaja. satyaartha prakaasha.. 1907. Sanskrit. LINGUISTICS. 394 pgs. 0. sarvaveidaan'tha sidhaan'ta saara san'graham. Sanskrit. Language. Linguistics...

Sanskrit. LANGUAGE. Literature.. LANGUAGE. Not available. Literature. Sanskrit.. shaastrarambhasamarthanamu. 0.. Social Sciences. 1913.. Language. Sri Radhanath Suri.. Language. 1969. shaastradiipikaa. savyaakhyonind-aiyasindhoo pradhaman' parichchodan. Not Available. Literature.. Psychology.. Linguistics. bhat't'ojiidiiqs-ita. 1938... 0. LANGUAGE.. 238 pgs.. Psychology.. shaastradiipikaa. 1974.. Sanskrit. Language. shriimadabhat't'ojiidiiqs-ita. Not available. Linguistics. Linguistics. mahaakaal'isubbaaraaya. Linguistics.. Sanskrit.. 51 pgs. Sanskrit. 1935.. Sanskrit.. Linguistics. Not Available. Sanskrit. Sanskrit. shaan'karapaadabhuushhand-amuu. 563 pgs. 294 pgs.. 1917. Sanskrit. Language. 1971. gand-apati. savesamavrxttaprabhaava. shrii shriisachchidaanandendrasarasvatii.. LITERATURE. Linguistics. saurapuraand-a. Sanskrit. 476 pgs. Literature. 296 pgs.2/14/2011 A list of scanned Sanskrit books at III… saundaryalahari bhaavanopanishad devi panchastavi vyakhyaaya sahita. 0. Sri Venkatraman. 307 pgs. LINGUISTICS.. shaastradarpand-amu.. 383 pgs... shabdakaustubhe. Literature. Theology.. Religion. 1896. Somanatha. 394 pgs.. Sanskrit.. shabdakaustubha Vol II. sautasuutramu san'kalitaprayokachandrikaa.. Linguistics. Sanskrit.. Lokesh Chandra. shaastrasiddhantaleshaasan'graha of Appaya Dikshita.. shaastrasiddhaantaleshasan'graha. Language. 400 pgs.. Sanskrit. Literature.org/…/SanskritIIIT. Language. Psychology. 560 pgs.. Linguistics. sevantikaaparind-ayamuu. Language. 1937. 1913. Not available. Sanskrit. Language.. shaarirakanyaayasadgagrahan' pradhamodhyaayan. Language. sri shankaraacharya.. Sanskrit. Linguistics. Sanskrit. gn-aastradarpand-amu. sanskritdocuments. Linguistics. Sanskrit. Literature. Language. 98 pgs.. Linguistics.. LITERATURE. 1924. 356 pgs. Linguistics. shaastradarpand-amuu. LINGUISTICS. 320 pgs. shabdaarthachan'drika aan'dhranighan't'uvu. Sanskrit.. Language.… shabdashaktiprakaashikaa shriijagadosha takailadkaara Language Linguistics Literature Sanskrit 143/167 . shaastrashuddhapan'chaan'ga ayanaan'sha nirnd-aya. Sanskrit. Language. Language... pat't'abhirama. satyashhaad'ha.. 0. Literature. 1933. shriimadden'kat'anaatha vedaantadeshikulu. Literature. Linguistics. Sanskrit. shaatpit'akamu. Religion. seshvaramiimaan'saa miimaan'saapaaduke miimaan'saapaadukaa parittraand-amu. Literature.. LITERATURE. Linguistics. Language. vyaasa. 1074 pgs. 1921.. 1052 pgs. Philosophy. Linguistics. shaastramuktaval'ii.. 0. Literature. shriimadven'kat'anaatha vedaantadeshika. shaang-karn' vedaantamiimaan'saabhaashhyamuu kramaang-ka 1.. 414 pgs. 1930.. Sanskrit. 240 pgs.. 174 pgs. Philosophy. 1971.. Language. Literature. Linguistics. 2258 pgs.. 1992. Theology. bhagavadamalaananda. 0. 152 pgs.. Appaya Dikshita. 1915. 141 pgs. . Philosophy. Sanskrit. shabdakaustubha trxtiiyobhaaga. laqs-mand-a shaastri. Literature. Sanskrit. 1982. Sanskrit. Literature.. seshvaramiimaan'sa miimaan'saapaaduke. Literature. 1822. 1281 pgs. Sanskrit.. Language. 510 pgs. Literature. 386 pgs. LINGUISTICS.

1340 pgs. 218 pgs. Literature.. 1971.. Linguistics. Psychology. Linguistics. 1951. shabdashittkprakaashikaa. shaktivaada manjusha vivrxtti vinoodhini. Literature... shaindravilasa. shevan'tikaaparind-aya naat'akamu. A Sreeenivasa Iyengar. 1956. V. Linguistics. Language. shhad'ashiiti. Language. Sanskrit.s. 421 pgs.. Sri Barthruhari. Linguistics. Psychology. Sanskrit.. Language. Language.. pan' raamalochanashaastrii. 29 pgs. Literature. 0. 1900. Philosophy. not available. aanandagiri.. shiddhitaryamuu. shattlivaada. Philosophy. Literature. 1958. Sanskrit. 226 pgs. Literature.. Sanskrit. shriimajjagadiishatarkaalang-kaarabhat't'aachaarya.. 0. 567 pgs.. Psychology. shishupaalavadhamuu... Sri Uttamur Viraraghavacharya. aadityaachaarya. Sanskrit. 1947. 185 pgs. shabdendusudhaa.. shivasan'hitaa. Sanskrit. shhrii vishnusahasranama. shatakataryam shrii bhatrxharivitachitam.. Literature. 240 pgs. 182 pgs.. Literature. Sanskrit... Sanskrit. Sanskrit. Linguistics. Literature. 68 pgs.. appayya diiqs-ita... 169 pgs. 104 pgs. 148 pgs. Sri Gadadhara Bhattacharya. 1904. 239 pgs. shhrii an'daal tiruppavai. 1881.. Sanskrit. 188 pgs. Linguistics. Not Available.. Religion. Literature. Philosophy. Sanskrit. Language. 1911. Narasimhacharya. shriijagadosha takailadkaara. 0. Sanskrit. Language. Linguistics. Language.. 484 pgs. Linguistics. Sanskrit... 1825. Linguistics. shabdashakttiprakaashikaa krxshhnd-akaanti t'ikayaa prabodhinii vyaakhyaaya tippand-yaa. Language. Language. Linguistics. Sanskrit.. shishht'aprayegasn'graha. Language. Language. Linguistics. 260 pgs. shishhyadhiivrxddhidamu vivarand-a. 1981. Religion. 100 pgs. shriimadiishvarapratyavitgnakacharyachakravarthi. Theology. 1960. shatapathabraahaand-a Part 5. shiqs-aamanovinj-aanamu.. jagadiish. Literature.. shivaadvaita nirnd-ya. khemaraaja shriikrxshhnd-adaasane shreshht'inaa. Sanskrit... Language. Sanskrit. Religion.org/…/SanskritIIIT. 1973. Literature. Literature. 1929. 249 pgs.2/14/2011 A list of scanned Sanskrit books at III… shabdashaktiprakaashikaa. Sanskrit.. shhrii aniirud'ha samn'hita. 186 pgs.. Language. shivastotraavalii. Literature. Linguistics. 0. shrii chokkaanaatha.... 0.. shrii sridahara venkateshakrutha. Sanskrit. Sanskrit. Sanskrit. 264 pgs. shang-karavijaya. Literature..… hi t ttik bh k R li i Th l S k it 1970 210 144/167 . Language. Literature. Linguistics. 1961. Linguistics. Sanskrit. Sanskrit. Literature. khemaraja shriikrxshnd-adaasa.... 1927. Linguistics. Linguistics. Language. Language. 386 pgs. shriilallaachaarya. Linguistics.. Language. sri gadadhara bhattacharya. Sanskrit.. Literature. shhood'asa raamaayand-a san'grah a..... shiroomand-iikutadiidhitya anumitigrantha. Theology. 334 pgs. Linguistics.. shatapathabraahaand-a Part 3.. Literature. 90 pgs.venkata Raghavacharya. 1984. Motilal Sharma Bradwaj. 1927. Language... 1935. 124 pgs. sanskritdocuments. shrii dattakasuunumahaakavi shriimaaghaprand-iitan. Sri Yamuna Muni. 1956. 1952. Literature.. Linguistics. Sanskrit. Psychology. Sanskrit. Language. Philosophy. Sanskrit. 194 pgs. S N Sriramadesikan.

500 pgs. 566 pgs... Language. Literature.. 1956. 1939. Sanskrit. Language. Language. Sanskrit. Literature. Language. Linguistics.. Sanskrit. shrautasuutramu devayaagn-ikapaddhati. Religion.. Literature.. 1968. Sanskrit... Literature. Literature. shraaddhamayuukha chaturtha. Literature. Sanskrit.. Sanskrit. Language. Linguistics. Rangaswamy. Literature. 96 pgs. shri vyaasa paanini bhavanirnaya. 1959. Sanskrit. Language. 34 pgs. Theology.... 77 pgs. 475 pgs. 1972. san'patkumaar. 300 pgs. Linguistics. 1970... ramaswami shastri. Literature. 210 pgs. The Arts.. 0.. shrii krishna leela tarangini.. Linguistics.. ramarayakavi bellamkonda. Language. Linguistics. daamoodara.. shrii guruvaayupureishvara. shlokavaar^tikat'iikaa shar^karikaa. Language.. Sanskrit. suryakant tripathi.. Sri Bhattaputra Jayamishra. Linguistics.. shri deisikaashatakamu. Not available. shrii mahaabhaaratamuu.. Linguistics. not available. Language. Linguistics. Literature. Philosophy. Language.. Not avilable. shrii harikathamrutham. Theology. shrii dgargaachaaryasan'hitaa dashakhand-d'atmikaa mahaatmyasametaa. 1946. Linguistics. Linguistics. sanskritdocuments. ramtej pandeyan. 0. Linguistics.. Religion.. 0. K. Literature. 1962.. 616 pgs... Literature. 212 pgs.. Linguistics. shriimanmaharshhikaatyaayana. Literature.. Linguistics..org/…/SanskritIIIT. shonakiiyamn' rxgaveda pratishaakhayamn. K. 266 pgs. 0. gopinath kaviraj. shivatatvaratnaakara. Linguistics. Sri Pasupathi Sastri. 242 pgs. shrii paanj-charaatre mahoopanipadi utsava san'graha prathama bhaaga. Sanskrit. shrauta sutras and prayogas. styanarayana raju. Linguistics. Religion. shrii harikathamrutham. ubhayabhaashhaasanaatha dvibhaashhi somanaatha. 1960. 200 pgs. 0. Language. Linguistics. Literature. 188 pgs. Sanskrit. shriiniilakand-t'habhat't'a. Language. 1939. Sanskrit. Literature. k. Sanskrit. 256 pgs. The Arts.. Sanskrit. Sanskrit. Sanskrit. Literature. 1972. Sanskrit. shrii raajaratnakaamaachampuu. Sanskrit.. Sanskrit. Language. 244 pgs.. sethumadhavaacharya. 64 pgs. Sanskrit.. Linguistics. shrii bhaaskaroodaya.… 145/167 . Venkata Raman. 176 pgs. shrii raamakrishnavachanaamruth. 528 pgs. 1946... Theology. Linguistics. 1933. 0. 1950. Sanskrit. Religion. Literature. narayanadasa adi bhatta. Literature. Language.. shrii prabhudev vachanamrut.. s. s. Language. 0. Theology. shrii raamaayand-aasaar kaavya tilakamu.. Theology. Linguistics. Religion. 232 pgs. Literature. Language.. 322 pgs. aar krxshhnd-asvaami ayyar. Sanskrit. Language. shivavilaasakaavyamuu. Sanskrit. 1942. shrii hanumat shahastri naamaan'jali. Not available. 421 pgs. Language... Literature. amrxtaanandayogivaryand-a.. shrii ramakrishna maha kavayam.... Sanskrit. bhaaskaraa.. Sanskrit. narayanadasa adi bhatta.r. shrii phakkika ratna manjusha. shivatatva ratnakaramu. 1955. not availabe. 1920.v. madhuravaand-i.. Language.. 99 pgs. 1927.. Sanskrit. shraadvakaand-ad'amu chatutho bhaagan. Psychology. 104 pgs.. 530 pgs. Sanskrit. 253 pgs. 1942. Sanskrit. 132 pgs. 0.2/14/2011 A list of scanned Sanskrit books at III… shivasuutravaarttikamu..

... Linguistics. Sanskrit. 1989. 170 pgs. 0. Theology.. Linguistics.. Linguistics. 266 pgs. shriimadhusuudanasarasvatii.. Language.. shrii yatipativaibhavadiipikaa cha. shrii tyaagaraaja shatavaarshhika smrxti gran'thaaval'i 1947. 1943.. Language.. Religion. shriigiitaasvaamivijaya. Sanskrit. madhuravani. 1926. Linguistics. 1984. Literature. Language. 735 pgs. Literature. 1362 pgs. shriibhagavannaamakaumudii miimaan'saa prakaashat'ikayaa sahitaa. Sanskrit. Sanskrit. 1948. 448 pgs. 240 pgs... Literature. shriibhagavadbhakttirasaayanamu t'ikayaa premaprapayaa. shrii venkatachalamahatyam. Sanskrit. Sanskrit. Religion. Linguistics. Language. sii ema paadmanaabhaachaarya. Sanskrit.. 1989.. Theology... shrii kun't'imahi sheshhasharma. 255 pgs.. Language. Sanskrit. Theology. General. bhagiirathaatmajena.. Linguistics. shriibhagavatpaadaabhyudayamu.. Language.. 1974. Linguistics. 1989. 1954.. shriigautamamuniprand-iitanyaayasuutraand-i. 111 pgs. Sri Padmaprasad Sastri. Sanskrit. Linguistics. shriibhuvaneshvariimahaastotramu. Language. shriibhagavadraamaanuja. yas seitumaadavaachaarya. Lakshmana Suri. shriigiitaagovindakaavyamu. 74 pgs. 856 pgs. 1972. Language. Literature. shriigitaa bhaavachandrikaa.. Literature. Literature.. Sanskrit. Sanskrit. esa anantaachaaryand-a. Psychology. shrii rxgyaju shaavri vaishhnd-avaanaan' brahmakarma. Literature. shriimachchrakachaturaanana shriichakrapaand-idatta. 1917. 222 pgs. 1944. Literature. 186 pgs.. shrii sitarmayanam. Sanskrit. Literature... Language. shriicharakasan'hitaa taatparyetyaparaparyaaya aayurvedadipikaakhya vyaakhyaaya samalang-krxtaa prathamavrxtti. Not available. Linguistics. Language. Theology. Linguistics. Language. Linguistics. 159 pgs.. Sanskrit. Literature. Sanskrit. 0. 1926. Sanskrit. Literature. shriigautamamuniprand-iitan' nyaayadar^shanan. -. shriiprxthviidharaachaarya. shriibhagavadraamaanuja. vinaayaka gand-esha aapat'e. Religion. 234 pgs. Language. 0. shriivaasudevaanandasarasvatiit'en'besvaami. Literature. Literature. Literature. 1922... 690 pgs.. shriilaqs-miidhara... shrii shankara shankara bhasya vimarsha. 416 pgs. Linguistics.. 1947. bellamkonda ramaraya kavi. shrii vyaasa panni bhavanaaraayand-a. Sanskrit. Literature. Theology. shriibhaashhyamuu shrutaprakaashikaaravya.. Literature. 145 pgs. Language. 1942. Sanskrit.. Sanskrit. Linguistics... Language. shrii shaang-akhaayana grxhyasuutra. Language. 222 pgs. shriibhaashhyamuu. shriiyuta raa raa mootiilaala ravishan'kara ghood'aa. shrii vimaanaa charna kalp. Language... 1922.2/14/2011 A list of scanned Sanskrit books at III… shrii ramayanasaar kaatha tilakamu. Sanskrit. Sanskrit..org/…/SanskritIIIT. Religion. 478 pgs. shriidattapuraand-amu sat'iikamu. Linguistics. 1954.. Sanskrit.. aar ran'garaamaanuja ayyan'gaaru bi ye yal t'i. 286 pgs.. Sanskrit.. 210 pgs. sanskritdocuments. Sanskrit. 564 pgs.… shriigurucharitamu dvisaahastrii sat'iikamu sachuurnd ikan'cha shriivaasudevaanandasarasvatii 146/167 . Literature.. tyagaraja. 0. Sanskrit. 1960. 746 pgs.. 727 pgs.. Linguistics. Not available. Philosophy. Linguistics. shrii vishhnd-uchitiiyamuu. Religion. 0... shrii keshri kant sharma.

Language. shriimadaand-ubhaashhyamu. Theology. 1936. shriikand-t'hacharitamu t'iikayaa.. 120 pgs. 0. Philosophy. Linguistics.. shriimatpuujya shang-kara bhagavatpaadaachaarya. 1997. Sanskrit. Language. Theology.org/…/SanskritIIIT. Not available. Sanskrit. Not available. Language. Sanskrit.. 1987. shriilokaprakaashan' dhvitiya bhaagan. Language. maharshhi vedavyaasa. shriimadbhagavadgiitaa bha t't'aatmajasham'karashaastrind-aa sam'shodhitam. Linguistics. Language. 0... Sanskrit. 330 pgs. shriimadanuvyaaravyaanan.. 0.. 1958. Sanskrit. Linguistics. Sanskrit.. Theology. Language. 1921. 1954. Sanskrit. Sanskrit. 166 pgs. Theology. Sanskrit.. Literature. Language.. LITERATURE. Sanskrit. Language. Literature. shriilalitaasahasranaamastootramu. 467 pgs. Language... Sanskrit. shriimadavaalmiikiraamaayand-amu saralagadyatmakam. 1923. shriimadbhaagavatamahaapuraand-amu muulamaatramu. Sanskrit. 1985. 397 pgs. shriimadbhagavadagiigaa. shriimadamarasin'havirachitei. Language. LANGUAGE. Theology. si . 1935... shriimadbhagavadgiitaa. shriikushhnd-avilaasakaavyamu. Religion. 614 pgs. Language. Sanskrit. Language.... Sanskrit. shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru. Literature. Literature. Psychology. shriimadadvaita siddhaanta krama prasthaanatraya bhaashhyaanusarend-a. Not available. Literature. Not Available. Linguistics. shriimadbhaagaravamu pan'chama khand-d'a. shriimadbhagavadgiitaa. Sanskrit. 0. pand-d'itaratna rayapaalya raaghavendraachaarya. shriimadbhaashhyat'iikaabhaavadiipedditiiyaadhyaaya. kedaaranatha.. Sanskrit. Sanskrit.. Sanskrit.. Literature. Language. Religion.. Literature. Sanskrit. kaaluuri hanumantaraavu. Linguistics.. 570 pgs. Sri Madramanujacharya. Literature. Linguistics.. 610 pgs. 156 pgs. 748 pgs. sukumaara kavi. Linguistics. 1928. Literature. sanskritdocuments. LINGUISTICS. 1942. 114 pgs.. shriikoshha. kapaali shaatri. Literature. shriimaatrxtattvaprakaasha.. Linguistics.. Religion. 599 pgs. 480 pgs. Linguistics... 0. GENERALITIES. 601 pgs. Linguistics. 1923. Language.. 590 pgs... 233 pgs. Not available. Sanskrit. Linguistics. Sanskrit.. 1110 pgs. shriimadraamaanujaachaarya. hayavadanaravuu... Literature. shriimadbhagavadgiita san'put'a 2 ( 10 rin'da 19 adhyaayagal'u ).. 1997. maharshhipravara shriikrxshhnd-aadvaipaayana. 317 pgs. Language. 492 pgs. .. 1997. Literature. Sanskrit. Linguistics.. moot'e aqs-aravaalii. Linguistics. 2004. maagad'i shriiveng-kaachaarya.. Religion. Literature. Not available.. Sanskrit. 1983. Religion. 284 pgs.. 26 pgs. 0. shriikand-t'hacharitamu t'iikayaa. shriimadbhagavadgiitaa.. 768 pgs. shriivaasudevaanandasarasvatii. Language. Sanskrit. 1953. Linguistics.. shriiharivan'shachampu. Sri Rajagopal Shastri.. shriikarabhaashhyamuu. Language. Linguistics. Literature. 279 pgs. Language.. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… shriigurucharitamu dvisaahastrii sat iikamu sachuurnd-ikan cha.. 1946. Literature.. shriilokaprakaashan. 67 pgs. . Linguistics. 62 pgs. Sanskrit. shriimabrahmasuutrand-i saadhanaadhyaaya... Linguistics. 1902. Literature. 274 pgs.… h ii dbh d iit bh hh kh b dhi ii d'h th t tt l k 147/167 . Linguistics.. Literature. shriimadbhagavadgiitaa. Literature.. 0. shriimadvallabhaachaarya..

org/…/SanskritIIIT... vidvaanu a san'patkumaaraachaarya. harinaaraayand-a aapat'e. 324 pgs. Vadiraja. Language. Language. Literature. t'ii aar krxshhnd-aachaarya.. t'ii aar krxshhnd-aachaarya. 1964. Sanskrit. shriimadvalmiikiraamaayand-ama~ ayodhyaakaand-d'a Part I. Language. Sanskrit. Sanskrit. Sanskrit.. shriimadvalmiikiraamaayand-ama arand-yakaand-d'a. 270 pgs. shriimadbhagavata pan'chama skan'dha. Literature.. shriimachchhaang-kara. Language.. 392 pgs. 1940. 1965. Literature.… shriimadveidaantadeishikagranthamaalaa shrii kan'chi pi bi annangaraachaaryaara Language 148/167 . Religion.. viddaanu a san'patkumaaraachaarya. Literature. 1834. Literature. 420 pgs. Linguistics. Sri Brahma Yogin. 958 pgs. Language. 449 pgs. 0. Literature. 1917. 1827.. shriimadbrahmasuutratadaabhaashhya trxtiiyaadhyaaya... 338 pgs. Linguistics. Religion. 1912.. Philosophy. Language.. Linguistics. 1941. 0.. 476 pgs. Literature. shriimadbhahmasuutraand-i saadhanaadhyaaya. Linguistics. Theology.2/14/2011 A list of scanned Sanskrit books at III… shriimadbhagavadgiitaa bhaashhya vyaakhyaaya subodhinii guud'haarthatattvalokan. Religion. 0. Language. Sanskrit... shriimadvalmiikiraamaayand-amuu yuddakaand-d'amu 6. Language.. Linguistics. Sanskrit. Sanskrit. shriimadbhagavatamu ashht'ama skn'dha. Not available. shriimadbhrahmasuutraand-i saadhanaadyaya. 782 pgs. Literature.. Not available. shriimadgand-eshagiitaa.... Language. Religion. 353 pgs. shriimaddeidaantadeishika granthamaalaayaan. shriimadbhagavatgiitaa. Theology. Not available. shriijakannatha. Sanskrit. shriimadvalmiikiraamaayand-amu yuddakaand-amuu 6. shriimadbhagavadgiitaa gn-aanakarmasamuchchayaakhyayaa vyaakhyayaa samaln'krxtaa... Sanskrit. shriimadvalmiikiraamaayand-amu prathamoo bhaaga... 1926. Language. Theology. shriimadvalmiikiraamaayand-ama~ uttarakaand-d'a~.. 386 pgs. Language. Theology.. bala gangadhara tilak. 1903. 949 pgs. Linguistics. Theology. Theology. Religion. Sanskrit.. t'ii aara krxshhnd-achaaryand-a. 273 pgs. 1917. 0. 1955. Sri Valmiki. aanandagiri. shriimadbhraahmasuutraand-i samanvayaadhyaaya. Sanskrit. 170 pgs.. Religion. Sanskrit.. yadupatii. shriimadvadiraajiiyagrandamaalikaayaan' ashht'aman.. Linguistics. Sanskrit. Linguistics. Language. Sanskrit. 1911. shriimadbhagavadgiitaa shriimachchhang-karabhaashhyayutaa.. Sanskrit. Literature. Linguistics.... Linguistics. 783 pgs. Theology. Religion.. Not Available. Sanskrit. Sanskrit. Language. 1834. Literature.. 202 pgs. 346 pgs. shriimadbhagavadgiitaa dvitiiyyashhat'kamu. 130 pgs.. 492 pgs. Literature.. Linguistics.. Sri Valmiki. Psychology. 1941. 0. Sanskrit. 155 pgs. shriimaddeidaantadeishikagranthamaalaayaan. shriimadragavadraitaa. shriijagannadthaya. Literature. 0. Sanskrit. 591 pgs. 144 pgs. shriijagannathayatii. Sanskrit. Sanskrit. Linguistics.. Sanskrit. Linguistics. Literature. Philosophy. Linguistics.. Language. 1887. Not available.. Language. 309 pgs. 807 pgs. 0... sanskritdocuments.. 1941. Sanskrit. Linguistics. Literature. vidvaan a san'patkrxmaaraachaarya. shriimadveidaantadeishikagran'thamaalaa.. Sanskrit.. shriimadbhahavadgiitaas-r^thaprakaashikaa. Literature. aanandavardhana..

Literature.... Sanskrit.. Theology. 1941. Sanskrit. Not available. Linguistics. Literature. Sanskrit. Sanskrit. Sanskrit. Language.. t'ii. Linguistics. Language. shriimana nyaayasudhaa. Literature. Literature. 276 pgs.. 1940...… 149/167 . Linguistics.2/14/2011 A list of scanned Sanskrit books at III… shriimadveidaantadeishikagranthamaalaa.. Religion. Religion. shriikaanj-chi prativaadibhayang-kara and-ndan'garaachaarya. 1934. Sanskrit. Not Available. Sanskrit. Linguistics.. 1912. 842 pgs. sanskritdocuments. Not available... shriimaath kapilananda swamy. Linguistics.. Literature. 1914. 368 pgs. shriimajjeiminiiprand-iite mimaan'sadarshind-i.. 0. Linguistics. shriimaggavth kapila githa. t r krishnaacharya. Language. Theology.. 789 pgs. 0. Linguistics. Literature. Literature... Not available. Sanskrit. Sanskrit. 262 pgs.. Sanskrit.. vinaayaka gand-esh.. Theology.. Religion. Sanskrit. shriimahaalaqs-myupaaravyaana. Linguistics. shriimahaabaarataantargata shriimadbhagavadgiitaa dvitiiyyashhat'kamu. Sanskrit. 238 pgs.. 860 pgs. Sanskrit. pan' jvaalaaprasaadajii sharma.. shriiman mahaabhaaratamu anushaasanaparva 13.. Sanskrit. 0. Religion. Linguistics. Sanskrit... Literature. Language. Linguistics... 251 pgs. shriimallalitaraamacharitramu baalakaand-d'an' sat'iikamu.. Religion.. shriimanmantraarthamanj-jarii. 1901. Religion. Not available. Language.. Language. shriimahaabhaaratamu shaan'tiparvamu. 207 pgs. Literature. 1909. 538 pgs. Sanskrit. 215 pgs. Maharshi Vedavyasa... 341 pgs. P. Sanskrit. yer'r'aapreggad'a rachiyin'chinadi. 1932. Subramanya Sastri. Sanskrit. shriiman mahaabhaaratamu upoodghaatamu. shrii a vi narasin'haachaarya. Sanskrit. shriimadvishhnd-utattvavinirnd-aya. Theology. Theology. 86 pgs.. Language. Not available. Language. Sanskrit. shriimanmahaabhaaratamu. 292 pgs. 508 pgs. shriiman mahaabhaaratamu vishhayaanukramand-i. Not Available. Not available.. 0.. 0. shriimanmaharaaja san'skrxta mahaapaat'hashaalaa patrikaa. 1907. 1811. Theology. Literature. Religion. Language.. Theology. 431 pgs. 225 pgs. 0. 0.org/…/SanskritIIIT..... 1911. 1905. 419 pgs. 1832. 716 pgs. Literature. Linguistics.. shriimadviddyapayonidhitiirtha shriipaa. Sanskrit.. 200 pgs. Not available. Language. Linguistics. Literature. Not available. shriimadveidaantadeshikagranthamaalaa. Theology. Religion. Linguistics. 0. 310 pgs.. 722 pgs. 1951. P. Language. Religion. Literature. t r krishnaachaarya.. Religion. shriimahaabhaaratamuu drond-aparvamu. Language. 0. shriijaanakiivallabha. shriimata jayatiirtha. shriimanmahaabhaaratama~ anushaasanar^vand-i. shriimahaabhaaratamutoojeirina 1901. Sanskrit.. 540 pgs. shriimahaabhaaratamu shaan'tiparvamu. shriimanmahaabhaaratamu udyoogaparvamu. shriimanmantrarthamanj-jarthaa. shriimanmahaabhaaratama~ bhiishhmapar^va. Language. Religion. Sanskrit. 1846.. Sanskrit. Theology. aara krxshhnd-aachaaryan. 822 pgs. Linguistics. Theology. 0... shriimanmahaabhaarahamu. Not available. shrii kan chi pi bi annangaraachaaryaara. Sanskrit.. 727 pgs. Language. Theology. Literature.

shrii mudigond-d'a subrahmand-yasharmand-aa. Linguistics. Literature.. Language. Not available. Not available. 0. n ramaswamy iyer. shri direndra tirth. 411 pgs. Literature. Sanskrit. Sri Raghvendra Swami. shriimannyaayasuudhaa sheshhavaakyaarthachan'drikaat'ippand-i. shriimannyaayamrxtataran'gind-i. Psychology... Philosophy. Linguistics. 1829. Literature. 48 pgs.. Sanskrit. shriimatsarvamulan'san'puurnd-a. Literature. 1960. Literature. Literature. Language. Linguistics. 0. Linguistics.. Sanskrit. Linguistics. shriinaaraayand-iiyamuu. 240 pgs. 391 pgs. Sanskrit. Linguistics. Literature. Literature. Sanskrit.. Language.. 240 pgs. shrii vaadiraajabhagavatpaada. madhuravaand-ii. shriimadraaghavendragurusaarvabhauma. shriimanyaamutan. Linguistics. Theology. THEOLOGY. . Language. Sanskrit. Seshasayi Iyengar. 0. Sanskrit. 226 pgs. Language... raamachan'dra. Not available. Sanskrit. 128 pgs. Literature. 1958.. Sanskrit. shriimanu nyaayasudhaa prathamoobhaaga. Linguistics. shriinaaraayaneupanishad. Sanskrit. shriiraamaayand-a mahaakaavya bhaaga 5. Sanskrit. 402 pgs. 38 pgs.. Sanskrit. 1986. 1930. mootiilaala jaalaan.. Language. shriimatuu saathand-aachray. shriiraajaratnamaalaachampuu. .. Literature. Language. 0. 485 pgs. 267 pgs.. Sanskrit.. 120 pgs.. Sanskrit. m. 0.. Linguistics. shriimatryaayasudhaaparimat't'an. saqs-mand-a raamachan'dra paan'gaarakara... Pandit R... sanskritdocuments. Linguistics. Literature. Literature. Sanskrit. Not available. Linguistics. Language. 1110 pgs. 101 pgs. Sanskrit. shriiraamaayanama. 1974.. Language. Sanskrit. khemaraaja shriikrxshhnd-adaasa.… 150/167 .org/…/SanskritIIIT. Literature. shriirahasyatrayasaarasan'graha. 1942.. Sanskrit. Linguistics. Sanskrit. Sanskrit. Language. daamodara saatavalekara. dvibhaashhi somanaatha.. Language. shriinyaayamutttaavalin. 584 pgs. 260 pgs. 1929. Language. Linguistics. shriimannigamaantamahaadeshikaa. Not available. 0. LINGUISTICS. Language. Sanskrit. 308 pgs.. shriiraamaayand-asaara kaavya tilakamu.. 0. 1987. shriimattan'trasaara chhallaarii vyaakhyaana... Language. Sanskrit. Linguistics. 153 pgs. shriiraamalin'gheishvarasthavaraaja. 1972.. Sanskrit.... ... 0.. shriiraamadaasasvaamiin'che samagra gran'tha shriisamarthagran'thabhaan'd'aara. 0.. 1952. shriiraamaliilaa raamaayand-a sat'iika. Sanskrit. shriipanj-charaatraraqs-aa paanj-charaatragamasya. Religion.. 0. Religion.. Linguistics. 0. 228 pgs. 244 pgs. 248 pgs.. 760 pgs. 0. shriimatyaagaraajavijayamu prathama sn'skarand-amu. Theology. Language.. Sanskrit.. Not Availble. Linguistics.. 1940. Literature.. Literature.. Literature. siddheswar jena.. shriipaadukaasahasramu muulamaatramu. shriimatsanatsujaatiyamuu kramaang-ka 8. 1100 pgs.2/14/2011 A list of scanned Sanskrit books at III… shriimannaaraayand-iiyamu. shriimadvedaantadeshika.. LANGUAGE. LITERATURE. 424 pgs. Language.. 1968. Literature. 408 pgs. Language.. Dwaita Philosophy. 617 pgs. shriimannyaayasudhaaparimal'e dvitiiyadhyaaya prathamapaada. Religion.. not availabe. Sanskrit. Literature. Theology. Linguistics. 1956. Linguistics... shriinarasimhapuraanamu. Language.. RELIGION.

Sanskrit.. shriivign-aanabhairava. shriishriichaitanya charitaavalii bhaaga 2. Language. shriisvachchhandatantramu. Theology.. shriiveng-kat'aachalamaahaatmya prathamabhaaga hindii anuvaada sahita. prabhudatta brahmachaarii. Language.. Literature. Linguistics.. 1925.. prabhudatta brahmachaarii. Linguistics. 1929. 288 pgs... shriishang-karadigvijaya hindii anuvaada vistrxta t'ippand-e tathaa vivechanaatmaka bhuumikaa. Language. Sanskrit. 2000. 376 pgs. shriishaantikalpadruma vaastushaantisahita. 1950.. Literature.. LITERATURE. Sanskrit. Not available. shriimadabhinavagupta. Linguistics. shriishriichaitanya charitaavalii bhaaga 4. 814 pgs... Religion.2/14/2011 pg A list of scanned Sanskrit books at III… shriiramayansaar kavya tilakam madhurvani. Sanskrit.. 340 pgs. LINGUISTICS. Language. Linguistics. shriitantralooka vivekaakhyat'iikopeta dvaadashobhaaga.. Not available. Sanskrit. 1955.. 279 pgs.. bhaalachandra jagannaatha dvivedii. Linguistics. Literature. LINGUISTICS. Language. 1898. Literature. 1947... Literature. Literature.. shriishriichaitanya charitaavalii bhaaga 5. LANGUAGE. shrii krxshhnd-adaasa. Sanskrit. 749 pgs. 0. shriirang-garaamaanujamuniiprand-iitaa.… 151/167 . Literature. Linguistics.. Linguistics. LITERATURE. 0. Theology. Sanskrit. Sanskrit.. shriiveng-kat'aachalamaahaatmya dvitiiyobhaaga hindiibhaashhaamayt'ikopeta. Sanskrit.. 108 pgs. Sanskrit. 0.. shriisubodhinii t'ippand-isahita sampradaayavidushhaa.. ti viiraraaghavaachaaryaind-a. Sanskrit. LANGUAGE. Sanskrit.. jagannaatha parashuraama dvivedi. Linguistics. Sanskrit. maadhavaachaarya.. 1921. shriivishhnd-enaamasahasramu. 0. Not Available. 318 pgs. 1918. Linguistics. Literature. Literature. shriivishhnd-uyaagapaddhati navagrahamakhasahitaa.. prabhudatta brahmachaarii.. LITERATURE.. LITERATURE. 568 pgs. 244 pgs. 0. LANGUAGE.. Language. 0. Linguistics. LINGUISTICS. 190 pgs. Literature. Language. Hari Raghunath Bhagavat. Literature. 1937. Not available. shriiupaasanaatrayasidddhaan'ta. Linguistics. Literature. LINGUISTICS. LANGUAGE.. Language. shriishan'karaachaayaivirachitagran'thasan'grahan'prakarand-agran'thaan.. shriishriichaitanya charitaavalii bhaaga 3.. Sanskrit. Sanskrit.. Sanskrit. 170 pgs.. Literature. 1986. 242 pgs. Sanskrit.. shriiyaajnj-avalkyasmrxti. 338 pgs. 224 pgs. shriiven'kat'aachaletihaasamaalaa. 1972... 789 pgs.. shriiveidaantaachaaryavijaya. shaaravot't'ai kushhnd-aasvaamyayya. 230 pgs. Language. shriishivasvaroodaya. Language. 0. 384 pgs.org/…/SanskritIIIT. 0. Language. prabhudatta brahmachaarii. pand-d'itavara shriikeshariikaantajiisharma. LINGUISTICS. Literature. Linguistics. Linguistics. sanskritdocuments. Language. 368 pgs. shriikrxshhnd-adaasaatmaja. 1852. LITERATURE. khemaraaja shriikrxshhnd-adaasa.. Sanskrit. Literature.. Language. Sanskrit. prabhudatta brahmachaarii. Linguistics. shriimahaamaheshvarachaarya... shriivallabhaachaarya. Religion.. shriishriichaitanya charitaavalii bhaaga 1. Language. 299 pgs.. ramaraju b ed. Sanskrit. Literature. Sanskrit. 120 pgs.. 0. Sanskrit. LANGUAGE. 300 pgs. 1938. 274 pgs. Language.. Sanskrit. Linguistics.

Sanskrit. 283 pgs. shung-garatilaka. Rangasawami Aiyangar.. 108 pgs. Bhrga Samhita. Language. 1964. Literature. Language. Philosophy. Literature. RELIGION. Literature... LANGUAGE... 744 pgs.. 240 pgs. siddaantaratnamusat'iikamu.. 164 pgs. shuklayajurveda sahitpani shachhtakamu. siddaantalaqs-and-amu.. Literature. 171 pgs. shriiraamabhadra. Theology.. 0. Sanskrit. THEOLOGY. Literature. shripati. shrudikaand-d'amu dashamo bhaagan. 1968. shriimadgang-geshopaadhyaaya. Language. Not available.. Sanskrit. Linguistics.. Linguistics. 1862. Sanskrit.. sidantabindu. Linguistics. 480 pgs. shrxn'gaara haaraavalii. 1950.. shriibaladevavidhyaabhuushhand-a. Sanskrit.. Language.. jiivaanandavidhaasaagara. shrungarasarvasvasvabhaand-an. Language. shukasaptati agn-aatakartrxkaa kathaakrxti. 1950.. 1912. Language.. 1937. shrundgaratilakamu. sahadayaaliila.. 154 pgs. 1896. 1923. Linguistics. 200 pgs. Sanskrit. 107 pgs. vi . Literature. shuddhiprakaasha. mahaadeivashaastri. shukraniitisaara. Literature. Sanskrit. Language. swamy maheshvarananda giri.. shrxng-gaarasundarabhaand-a. 68 pgs.v. 1945. 1936.. shriinallaa. 23 pgs. 1965.. e . 632 pgs. Theology.. Language. K. shrudhikaand-d'amu dashamo bhaagan. Literature.. Sanskrit. Sanskrit. e. Sanskrit.. Literature. 294 pgs. 65 pgs. 282 pgs. Psychology.. Sanskrit. Linguistics. shrimadbhrahmasuutraand-i. Literature. hiiraalaala.. shrikaara bhaashya vol 1. krishnajanth panth. Sanskrit. gad'gan'prasaadajii... 0. Sanskrit.. LINGUISTICS. shrishang-karabhagavatpaadiiyaprakarand-aprabandhavali trxtiiyasan'put'amu. Language. shukraniiti. shrii harshha. 846 pgs. Language. 0. Sanskrit.. shrii madanan'da jagapati. 240 pgs. Linguistics. 46 pgs. 352 pgs.. Literature..2/14/2011 y j j y A list of Sanskrit books at III… gscanned g g pg shriiyatiindrapravand-aprabhaava.. ilaivilli jagguu veng-kat'aachaarya. maagad'i shriirang-ganaathaachaarya. Language. LINGUISTICS.rangaswami. 1932. Sanskrit.. subrahmanya shastri. 486 pgs. Sanskrit. shrungarabhushhand-amu. sanskritdocuments. pn' . shriivaamanabhat't'a. Literature. 1899. iishvarasharma. Sanskrit. Sanskrit. shrishivamahaapuraand-mu.. Religion. Literature.. 1894. 1968. 1890. Language. Language. Sanskrit..… 152/167 . Sanskrit.. Theology. 232 pgs. Linguistics. Linguistics. Sanskrit. LANGUAGE.. Not Available. shuddhadhar^ma mand-d'alam' shriimadbhagavadgiitaa. bhat't'aachaaryend-a shrii paadasharmand-a.. shripatipaddhati adhyaaya 1 8 bhaaga 7. Theology. v.. Linguistics.. shuudrakamalaakaramu. Linguistics. Literature. 1919. Linguistics. Religion. LITERATURE. 1956. Linguistics..v. Language. Sanskrit.... 1902.org/…/SanskritIIIT. Religion. Sanskrit. 0. LITERATURE. Religion. shuklayajurvediiya kaand-va san'hitaa. 232 pgs. Linguistics. Linguistics. 1959.. 640 pgs. Language. Not available... Literature. Linguistics.. Language. Sanskrit. K. Sanskrit. 946 pgs. Literature. Linguistics.

Not available. smritichandrika 3 vyavahaara khanka bhaaga 2. Not available. 562 pgs. sidditrayii.. Sanskrit. Philosophy. shrii yaagn-ikadevand-abhat't'opaadhyaaya.. Philosophy.. Sanskrit. Sanskrit.. 1919. Linguistics. Linguistics.. smrxtichandrikaa san'skaarakaand-d'a 1. siddhaantachandrikaa san'qs-iptabaalabodhinii t'iikaa. siddhantasiddhaajann'part 2. 1918. Psychology. 1917. Linguistics. Philosophy. smrxtichandrikaa aahnikakaand-d'amuu 2. siddanta rahasyam. 1921.. Language. 1914. Literature. Sanskrit. siddhaantaleshasan'graha sat'ippand-abhaashhaanuvaada. Not available. 156 pgs.. Philosophy.2/14/2011 A list of scanned Sanskrit books at III… siddanta kaumudi. Literature.. Language. Language. Language.. Language. THEOLOGY. Sanskrit. Language. 152 pgs. 170 pgs. Sanskrit. Psychology.. Language. Sanskrit. Sanskrit. Literature. 0. 0. Linguistics. Sanskrit.. 170 pgs.. 410 pgs... Literature. Linguistics. madhusudana sarasvati. shrii yaagn-ikadevand-abhat't'opaadhyaaya. 1940.. Theology. 156 pgs. 1993. Language. LINGUISTICS.... Literature. Literature. Linguistics.org/…/SanskritIIIT. Sanskrit... 132 pgs. 404 pgs. Linguistics.... vasudev lakshman shastri pansikar ed. Linguistics... 1917.… smrxtichandrikaa shraaghdakaand-ad'a. Linguistics. RELIGION. Literature. Sanskrit. 596 pgs. 1916. Linguistics. 0. Religion. Language. Linguistics.. pandit durgaprasada ed. Language.. siddhaantabindu of madhusuudanasarasvati. Language. Sanskrit. 153/167 . sindhukaustubha.... Not Available. devana bhatta... sitaaraavand-asamvadaajharya uttarabhaaga. siddhanta kaumudi. Sri Krishnananda Sarasvati. 1914. Psychology. Sanskrit. Language. 566 pgs. Sanskrit.. Tryambakam Sastri. Sanskrit. 469 pgs. Sri Krishnananda Sarasvati.. 1928. 112 pgs. Literature.. parashuraama shaatri. 1911.. 236 pgs. 1925. Sanskrit. 54 pgs. Philosophy.. sisupalavadha of magha. prataap sin'ha.. Psychology.. Language. siddhaantashiromand-e gorlaadhyaayo vaasanaabhaashhyasahita. Sanskrit. 1919. siddhaantasiddhaanj-janan' trxtiiyo bhaaga. shriimadappayyadiiqs-ita. shriikrxshhnd-aanandasarasvatii. Linguistics. sidditrayamu vedaantaprakarand-amu vishishht'aadvaita brahmaniruupand-aparamu. riitaaraamashaastrii. Not available. 490 pgs. siddhantabindu nyayaratnavali laghuyakhya. siddhaantasiddhaanj-janamu. Sanskrit. 358 pgs. balabhadra. Psychology.. Sanskrit. 1932. Language.. Literature. 1917.. shrii yaagn-ikadevand-abhat't'opaadhyaaya. Literature.. Literature. Language. Language. sri ramnatha shastri tr. Literature. Literature.. siddhaanta shiromand-e grahargand-itaadhyaayo vaasanaabhaashhyasahita. 146 pgs. 90 pgs. siddhantasiddhaajann'part 4.. wasudev laxman sastri pansikar ed.. 810 pgs. 1929. 380 pgs. Linguistics. Linguistics. LANGUAGE. nilakanta dikshita. Linguistics. siitaaraavand-asan'vaadajharyu ttarabhaaga.. pan' svaamishriiraamamishrashaastrind-aa. Sanskrit. 0. sanskritdocuments. Sanskrit. 0. LITERATURE.. Linguistics. 242 pgs. 0. Literature. Literature. Language. 810 pgs.. Sanskrit.. sivalilarnava. siddhasiddhaantasan'graha. 1928. Sanskrit. Literature. 102 pgs. Sanskrit.

Language... damodar s. ramanujacharya.. sanskritdocuments. Linguistics. Linguistics.. Literature. Literature.. Linguistics. Sanskrit. 1918.. 1931. g krishna shaastri. Language.. smrxtikaustubha. Language. 852 pgs. Literature. aachaarya mand-d'anaamishra. Linguistics. Language. khemaraaja shriikrxshhnd-adaasane shreshht'inaa. Language. 42 pgs. Sanskrit. -... smurichandrikaa asaucha kaanda. Literature. 478 pgs. Literature.. Linguistics. smrxtichandrikaa yaamaashauchakaand-d'e. 1902. Sanskrit. Literature. Language. Religion. 490 pgs. 386 pgs. Linguistics. Language.. vemana. 0. Sanskrit. sphoot'asiddhi. Literature. tukaaraam. Literature. Language. Linguistics. 208 pgs. 222 pgs. sribhasyaprakasika. Literature. 1986. Linguistics. Literature. Not available. Sanskrit. Sanskrit. sri suresvaracarya. Sanskrit. Literature. Not available. Religion.. veda vyas. shrii yaagn ikadevand abhatat t opaadhyaaya. 0.. 230 pgs.. Linguistics. Linguistics. Literature. Language. Sanskrit. 809 pgs. srimad bhagavatam tasya dritya bagh. 1970. Linguistics. 1970. 1921. 1244 pgs. Linguistics. shrii yaagn-ikadevand-abhat't'opaadhyaaya. Linguistics.. Sanskrit. spandakaarikaa. srimad bhagavatam. Language. 0. sri svayamvaraa paarvatii man'tramaalaa stootram. sri bhaashhya paart' I. Language. 1885. smrxtyarthasaagara... 148 pgs.. Literature.. 1969. Language.. 0. 1914.. Sanskrit. Sanskrit. Language. spandakaarikaa. 1909. Literature.2/14/2011 A list of scanned Sanskrit books III… smrxtichandrikaa shraaghdakaand ad a. sri vemageeta prathama sahasram. 236 pgs. aapstaan'baa. Language. 610 pgs. 1961. kallat'a.. sri tuurvaasamunivar. Sanskrit. Sanskrit. Linguistics.. 184 pgs. 222 pgs. smuti kaustubhan. prashnapatrasahita. Sanskrit. 824 pgs. sragii. srautasuutra 1-5.. Literature. 497 pgs. srimad bhagavatam tasya chatutho bhag... Language. 326 pgs. shriimada aapadevatmaja anantadeva... sowgandhikaaharand-amu. Theology. Theology.. 1852. Sanskrit. 1902. 1944.. smrxtinaan' samuchchaya. 776 pgs. 314 pgs. smrxtichandrikaa vyavahaarakaand-d'a 3 bhaaga 1.. 158 pgs. Linguistics. Sanskrit. Linguistics. 439 pgs. Linguistics. Sanskrit. 1969.. Sanskrit.. Language. Linguistics.. Sanskrit.. veda vyas.… 154/167 . srimad bhagavadgita purushaarth bodhani bhaasha tika.. shriimadvidhanaada. Literature. 29 pgs.. Sanskrit. Sanskrit. Literature.. Sanskrit.. Language. 232 pgs. Language. sottaraaprashnaavalii dvitiiya khand-d'a 23 varshhaand-aan' prashnapatrasahita. spandakaarikaa.. raamaanujaachaarya.. Language. Theology. Sanskrit.. Theology. Literature. vinaayaka jand-esha aapat'e. Srinivasagarya. 0.. 0. 1914. 1835.. Language. Literature. veda vyas. Sanskrit. Linguistics. Literature.. Literature. Sanskrit.org/…/SanskritIIIT. Linguistics. sri raamaanuja champu. 514 pgs.. 1974. Linguistics. 1942. Language. Linguistics.. Religion. 339 pgs. Language. Language..... Sanskrit.. Not available.. 40 pgs. Literature. Religion. Sanskrit. 1930.. Linguistics. sri raama giita. devanabhatta. Literature. Not available.

Literature. Sanskrit. P. Literature. 1941. srimad valmiki ramayanam. 1917.. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… srimad ramayan dritya bagh..v. Language. 1971. subhaashhitaniivii.. Literature. 1886. Literature. Sanskrit. 0... 569 pgs. sundararaamaayand-amu aura satiivilasitamu.. Sanskrit.. 1940. Language. srimadbhaagavatam skandhas 8 . krishnaachaarya. Sanskrit. Linguistics. si sundara shaastriyaara. Literature.. 1925. Literature. Language.. 1891. Unknown. Literature. 218 pgs. Language. Language. Linguistics. 1971. Linguistics. 422 pgs.org/…/SanskritIIIT. 138 pgs... 890 pgs. 84 pgs. Sanskrit.. Sanskrit. Linguistics. Sanskrit. 812 pgs.. Literature. Linguistics. 0... Sanskrit. suutraarthaamrxtalaharii. Sanskrit. Literature. Sanskrit. Language. t. suurasaagara. kaashinaatha panduranga paraba. kulashekara varmaa. suttanipaato.. 1955. Psychology. Literature. Literature. srngarasekhara bhana... Literature. 1968. Language.. 1961. 1899.. Language... 25 pgs. Not available. 556 pgs. Language. Literature.. subhaashhita sudhaanidhi. -. Sanskrit. kaasiinaatha paan'd'uran'ga paraab. Language. 1924. veidaantadeishikulu. 1911.. Linguistics. subhaashhitaniivii. 0..… 155/167 . Language. sri vedanta desika. 1961. subhaashhitaniivyaan' durvrxttapaddatishchaturthii 4. 1931.. shriirang-kanaatha. 0. 198 pgs. 0. Sanskrit. 156 pgs. sushrata sanhita sharira staanamu.. 498 pgs. 1988. Linguistics. sanskritdocuments. Religion. subhaashita trishaati vyaakhyaayasahita. abhinava kaalidaasa. Literature. Psychology.12. Literature. 412 pgs. subhadraaharand-amu. naaraayan ram acharya. Not Available. Sanskrit.. 322 pgs. valmiki. Sanskrit. bhartrihari.. 416 pgs.. subhaasita ratna bhaand'aagaaramu. 916 pgs. Sanskrit. Sanskrit.. srngara sekhra bhana. subhashita ratna bhaandaagaaram. Linguistics... 1935. Linguistics. Language. Language. Language. Philosophy. 1134 pgs. Language. Language. 258 pgs. 111 pgs. Language. Linguistics. 1912. 86 pgs. Literature. 1933. Sanskrit. Literature.. Sanskrit. r.. Language.. valmiki. Sanskrit. Linguistics. sumadhvavijaya... Linguistics. Literature. Linguistics. 1916... 260 pgs.. Sanskrit.bapat. Technology. pandita nilakanta devarao deshpande. Sanskrit. Sanskrit. 999 pgs. 74 pgs. Philosophy.. subhaashhitaavalin.. Sanskrit. Linguistics. 1952. 350 pgs. statvaprakash. Language. subhaashita ratna bhaand'aagaara. Linguistics. 238 pgs. Sanskrit. Language.. 584 pgs. abhinava kalidasa... Sanskrit. Sanskrit.. Literature. Linguistics. sutravt'ati. Language. Theology. Language. Not Available. Pandith Laxmikanth Kanyaal. Literature. Linguistics. Not available. 0. Literature. Linguistics. Linguistics. 192 pgs. 1951. 142 pgs. Not available. saayand-a.. Literature. 170 pgs. subhashita niva. sushrutasan'hitaayaa. Language. Sanskrit. subhadraadhananj-jayamu. shriimaadhavabhat't'a... shriinigamaantamahaadeshikaa. Sanskrit. suuryyasidddhaanta... Psychology.. Philosophy. subod sanskrit vyakhan pradhama bhag. Linguistics.. chandrashekarana. Sanskrit. Literature.. Linguistics. Linguistics. shriisachchidaanadendrasarasvatii. shriimadullabhadeva. ti... sugamaa..

Linguistics. qs-emaraajaa. 1896. Language. Literature. pan'd'ita harishan'kara. Language. Linguistics. taitiriiya brahmand-a baashha part Ii.. Not Available. Linguistics. Sanskrit. Not available.. Linguistics. Theology. Literature.. Sanskrit. Literature. Sanskrit. mahadeiva saastri. Language. svaraprakriyaa.. Language. 0.ix.iii. Language. Sanskrit. Psychology. Sanskrit. svachchanda tantramu Vol. 478 pgs.. 89 pgs. Literature. t'ood'araanandamuu volume 1.org/…/SanskritIIIT. Sanskrit. 480 pgs.. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… suutrabhaashhyaarthatatvavivechani. A. 360 pgs. 1904.. Literature. 126 pgs. mahaadeiva saastri.. shivaraamakushhnd-ashaastri.v. taddhitaantaa kechanashabdaa. Religion. taitiriiya san'hitaa krishna yajurveida Vol.. Sanskrit. taittiriiya rand-yakan' bhat't'abhaaskara bhaashhyasahitan' Vol 3. Literature. 170 pgs... 1902.. Language. 0. Linguistics.. 221 pgs. 471 pgs. kaashiinaatha vaasudeivashaastrii. Linguistics. e. Sanskrit. Language. 1926. Literature. 0.… 156/167 . Literature. 1895. 1948. taaraanaayatarkavaachaspati jiivanacharitamu.. Language. Sri Ganapathi Sastri. Sanskrit. Literature... Philosophy. 1896. 1964. Linguistics. Sanskrit. sanskritdocuments.. shriiniilakand-t'haachaarya. Bhatta Kumarila. Linguistics. Language.iii. shriisambhavai jyothorupaaya. Literature. Sanskrit.. Language. 1956. Sanskrit.. Language. 224 pgs.. mahaadeiva saastri.. svaanubhavaadarsha. Literature. 346 pgs. Theology.. 34 pgs... Literature. 288 pgs. 1896. Sanskrit.. 470 pgs. ke maadhava krxshhnd-a sharma. Linguistics.. shriimadgrund-i shan'bhubhat't'a. taatparyachandrikaa dvitiiyasamput'amuu. d'aa maagiirathapraasaadatripaat'hii vaagiisha shaastrii. 1917. Language.. taitiriiya san'hitaa krishhnd-a yajurveida Vol. 0. Linguistics. Linguistics. Linguistics. Sanskrit. vyaasatiirtha. Sanskrit. 0.. Linguistics. Language. Literature. Sanskrit. svaraajyasiddhi qs-igagd'adharendra sarasvati virachitaa.. svasthavrxttasamuchchaya bhaashhat'iikaasahita.iv. Sanskrit. Literature. Linguistics. 540 pgs. Sanskrit. Mahadeva Sastri. taajika niilakand-t'hii t'ikayaa savisheshhopapatti sodaaharand-a bhaashhaabhaavaarthana. svayambhupuraand-amu. Literature. Linguistics. 1961.. 136 pgs.. mahaadeiva saastri. svarasiddaanta chandrikaa. Literature. 0. Sanskrit.. taitiriiya san'hitaa krishhnd-a yajurveida Vol. Psychology.. taatparyachandrikaa. Not available. Religion. taitiriiya san'hitaa krishna yajurveida Vol. 454 pgs.. 101 pgs. Language. 550 pgs. Linguistics.. 374 pgs. 454 pgs. Language... Literature... taajiiraatahinda.. Language.. 1927. Sanskrit. Sanskrit. 1898. 0. Sanskrit. svaravyaajjanamu. 0.. Literature. Sanskrit.. taitiriiya san'hitaa.. 0. svaanandavanavihaarakaavyamu. 362 pgs. aachaariyaraghuviirend-a. Literature. Language. 470 pgs. siitaaraama shaastri.. Literature. Philosophy. 306 pgs. ramanujacharya. Sanskrit. 1898. Linguistics. Sanskrit... e. Language. Language. 362 pgs. e. t'upuut'iikaa. Language. 570 pgs. 1983. shriisachchidaanadendrasarasvatii.. Not Available.. Linguistics. Linguistics. Literature.. Language. Linguistics.

Theology. Sanskrit. 1952. Religion. 1949. Religion.annanagarachari.. Sanskrit. tan'jaavuurupatanamu. Theology. Literature. taittiriyasan'hitaayaa padaanukramand-ii prathama khand-d'a.. Linguistics. 244 pgs. 333 pgs.. 230 pgs.. bhat't'abhaaskaramishra. tantralooka bhaaga 4. Literature. Psychology. Theology. 480 pgs... Madhusudhan Kaul Sastri. Religion. Sanskrit... tantralooka Volume Iii. 1930.. taittiriya upanishad. Sanskrit.. Linguistics. Philosophy.. 72 pgs. tantraadhikaaranirnd-aya... Sanskrit.. Language. Literature.. 1923. bhat't'abhaaskaramishraa. 558 pgs. 1934. Sanskrit.. tarkakutuuhalamu... Linguistics. 1918. 1971 512 pgs sanskritdocuments.. Language.. Sanskrit. Ramanujacharya.. 370 pgs. Sanskrit. Sanskrit. 1898. tantrashuddvaya prakarand-an' bhat't'aarakaqs-ivedottama prand-itan.... Philosophy. Philosophy.. tantrayeprasuunamaalikaa. 1930.. tantralooka bhaaga 2. Psychology. 1962.. Sanskrit. tarkabhaashhaa. Theology. 238 pgs. taittiriiyasan'hitaa bhaaga 2.. Religion.. Literature. 216 pgs. 1989. 1921. 1894. Religion. tantraprakaashikaasamete mimaaman'sa ar^thasan'graha. Sanskrit. Philosophy. tantralooka bhaaga 8. Not Available. Sanskrit.. 104 pgs.. Literature. Sanskrit. Language. Psychology. abhinavagupta. abhinavagupta.. tarka sangrah.b. Psychology. Theology. Psychology. Linguistics. Language.. Theology. 140 pgs. Religion. Psychology. 0. Language.. 66 pgs. 227 pgs. Theology. Sanskrit. 1953. Religion. Language. Sanskrit.. Sanskrit.. mallaadi vasun'dhara.. parvatiiya shriivishveshvarapaand-d'eya. Linguistics. Language. 0. Sanskrit. 1894.. Sanskrit. Religion. Sanskrit. 454 pgs. bhat't'abhaaskaramishra. 0. Theology.. tantralooka bhaaga 1. Linguistics.. 1918. Narayana Sastri. tarkai shaastra nirupand-amu. Linguistics. Theology. Sanskrit. Sanskrit. abhinava gupta.. Linguistics. Sanskrit. raghu vir. Language. abhinavagupta. Sanskrit. 206 pgs. 425 pgs. 1915. 271 pgs... 102 pgs.. -. 1921.. Sanskrit. 1952. 1897.. Theology. THEOLOGY. Religion. 102 pgs. Literature.. abhinavagupta. taittiriya upanishad anandavalli bhriguvalli. mahaamahopaadhyaaya parashuraamashaastrind-aa. taittiriiyasan'hitaa bhaaga 10. Literature.... Philosophy. Philosophy. Sanskrit. Psychology. Sanskrit. Ganapathi Sastri. taittiriiyabraah-hmrxnd-amam. Language. 512 pgs. 374 pgs. abhinavagupta. Sanskrit. taittiriiyabraahmand-amu prathamaashht'akamu. 0. mahadeva shaastri. P. Religion. 186 pgs. bhat't'abhaaskaramishraa.. 361 pgs.. taittiriiyasan'hitaa bhaaga 12. -. Theology. Linguistics.org/…/SanskritIIIT. Religion. 1922. tantrarahasyamn. 1924.. tark shastra terminology of logic part 1... 1911.2/14/2011 A list of scanned Sanskrit books at III… taittiriiya san'hitaa Vol II. 1882. 443 pgs. tantrasaara. bhat't'abhaaskaramishraa. RELIGION. taittiriiyabraahmand-amu trxtiiyaashht'ake prathamabhaaga 1 7 prashnaa. Sanskrit. Not available. 48 pgs.. taittiriyopanishhata. Sanskrit... tantrasaara. 98 pgs. Religion. Not available. Sanskrit. swami satchidaanandendra saraswathi. 239 pgs.. 280 pgs. Theology. Literature.… 157/167 . 1918. Philosophy. shrii sachchidaanadendrasarasvatii. Literature. Religion.. shriikeshavamishra. Sri Lowgakshi Bhaskara. T. 38 pgs. 1917. takra sangra.

512 pgs..… 158/167 . Linguistics.. Literature. Literature. LITERATURE.. 386 pgs. 360 pgs. 1938. tattvopaplavasin'ha. Language. Language. Linguistics. Language. 60 pgs. 278 pgs.. 1953. 0. llokaacharya. shriimachchitsuravaachaaryamunivara. Language. shrii vyaasatiirtha. 0. Language.. tarkataand-d'avamu trxtiiyan' san'put'amu. LINGUISTICS.. Linguistics. shriimadannan'bhat't'a.. 214 pgs. shriimadannabhat't'a. Linguistics. Sanskrit. 1003 pgs.. tarkakutuuhalamuu. aanandajnana... Linguistics.. Linguistics. Sanskrit. Sanskrit. Literature.. Sanskrit. Sanskrit.. pan' shriiaanandabhtaa nyaayachaarya. 612 pgs. sanskritdocuments. 315 pgs. Literature. Psychology. yativarashriignaanendrasarasvatii. 0. Sanskrit. 1888.. 192 pgs. tatva vichaar. sri vachaspati mishra... Sanskrit.org/…/SanskritIIIT. 0. kamalashiila. Philosophy. Language. 0. Sanskrit. Sanskrit. 2003. 1926. tarkataand-d'avamu prathamasamput'amu nyaayadiipaaravyaakhyaaya.. Sanskrit. Language. tarkasangraha. Language. 1944. 448 pgs. Language. Linguistics. tattvachintamand-i Part I.. Sanskrit. jayadayaala.. Language.. Linguistics. 1992. 401 pgs. 518 pgs. 552 pgs. s chandrasekhara sastrigal. LINGUISTICS. Sanskrit. 1974. jayadayaala. tattvasan'graha volume 1.. Literature. 1924. Literature... Literature. LANGUAGE.. 32 pgs. Gangesopadhayaya. Not available. Literature. Linguistics. Psychology. Sanskrit. 1916. Sanskrit. Literature. Linguistics. 1938.. 523 pgs. janaardanashaastrii paand-d'eya. Language. 830 pgs. Sanskrit. Not avilable. 116 pgs. tarkasangraha. Sanskrit. Sanskrit. Language. tattvachintaamand-e saamaanyalaqs-and-aprakarand-amu. tattvasaara samanugrxhita. tarkasan'graha nyaayabodhini vaakyavrxtti niruktti t'iippand-yaa. Language. Sanskrit. Sanskrit. jvaalaa prasaada kaanod'iya. 1969. Language. tattvapradiipikaa chitsuravi nayanaprasaadiniisamaakhyayaa vyaakhyaaya sahitaa. Philosophy. shriimadannambhat't'a. Literature. 1940. 1917. LANGUAGE. Language. tarkasang-grahasarvasvamu tarkasan'grahavyaakhyaa t'ippand-yaacha samalan'krxtamu. Language.. tatvabiidhinyaa uttaraardha subiidhinyaakhyan' svaravaidikaprakarand-an. Linguistics. Literature. tarkakutuuhalamuu.... 1932. tattvat'iikaa shataduushhand-ii. 200 pgs.... 398 pgs. Sanskrit. tattvabodhinii puurvaarddha viyaakarand-asiddhaantakaumudiivyaakhyaaruupan. Sanskrit. tarkasan'graha nyaayabodhinii siitaa padmaabhyaan' san'skrxta hindii vyaakhyaaya.. Linguistics. Literature. 1915. Linguistics.. LINGUISTICS. Sanskrit. 52 pgs..2/14/2011 A list of scanned Sanskrit books at III… 1971. Literature.. 364 pgs. shriimadvaradaachaarya. tattvabindu. Language... Linguistics.. tattva chintaamand-i bhaaga 7.. 520 pgs. Jayarasi Bhatta. 349 pgs. LITERATURE. Linguistics. tattvatrayamuu. tatvabodhanyaa uttaraardhda. mahaamahopaadhyaaya shrii ganggeshopaadhyaaya.. 1932. Language. Linguistics. Literature. 0. shriimadavedaantadeshika. janaardanashaastrii paand-d'eya. Linguistics. Linguistics. Linguistics. 216 pgs. Literature.. 1917. LITERATURE. Linguistics... tattva chintaamand-i bhaaga 6. Literature.... 456 pgs. Language.. tarkasan'graha diipikaa nyaayabodhiniisamalan'krxta.. Sanskrit. Literature. 0. Literature.. Literature. shriivyaasatiirtha. Language. Sanskrit. Literature. LANGUAGE. Sanskrit.

Sanskrit. Language.. Linguistics.suryanarayana Sastri. Sri Nigamantha Mahadesikar. 362 pgs. Sanskrit.. the saundarananda. Sanskrit. 29 pgs. kalidasa. Sanskrit. Sanskrit. the ashtadhyayi of panini vol .. 1937. Srinivasachar. 670 pgs. Literature. Literature. Literature. pandit durgaprasad.. Linguistics. Literature. Sanskrit. sambasiva sastry k. Iv. the jnanadipika tika mahabharata tatparya tika.. Suryanarayana Sastri. Sanskrit. Linguistics. Sanskrit. Philosophy. Psychology. tatvamukta kalaapa Vol.. Not available. krishhnd-amaachaarya. kasinath pandurang parab. Language. Literature. the meghaduta. ramaswami shastri...... Literature. narayana balakrishna godbole. 1955. 1928. 152 pgs... Literature.. S. D. veidaan'taachaarya. Sanskrit. Literature. 1933.. Sanskrit. Linguistics. t'i.. Literature. Linguistics. Psychology... vaman shivaram apte. 0. Sanskrit.i.. pg tatvakostubha Part 1..2/14/2011 y A list. Psychology.. Sanskrit. 542 pgs. Literature.. 60 pgs. 1989. 212 pgs. Philosophy. 1933. Sanskrit. 1900.. 356 pgs.. Sanskrit. Linguistics. the essential gaudapada. Sanskrit. Philosophy.. Philosophy. Theology. tatvamuktaakalaapa Vol 1. not avaliable. Unknown. 1925. 330 pgs. Sanskrit. Sanskrit. Linguistics. 830 pgs.. Linguistics... Linguistics. Sanskrit. di. Language.s. 1956. thakavarg Mahanibandh.. of scanned books at III… g g Sanskrit g . Linguistics. Literature. Language. the panchatantrika of vishnu raman. Literature. 0. Psychology. moreshwar ramachandra kale tr.. tatvamukta kalaapa Vol. Religion.iii.. tatvamuktakalaapa Vol. Sanskrit. Language.. t'i. Sanskrit. Linguistics. 448 pgs. Language. Psychology. Linguistics. the ranadipika of kumaraganaka. 254 pgs. 1917. Dr Suresh Chandra Mishra. 1941..s.. 428 pgs. Literature. Language.. Language.. Sanskrit. 106 pgs. Literature. Psychology. Sanskrit... 0. k. srisa chandra vasu... S. Philosophy. the raghuvamsa of kalidasa. the anargharaaghava of murari. Linguistics. 750 pgs. asvaghosa. Sanskrit. 0. 1975.ii.. 1945. Literature. Linguistics. Sanskrit. Philosophy... Language. 306 pgs. Philosophy. 466 pgs. devabodhacarya. tatvat'iikaa. 1941. Sri Bhattoji Dikshita. 100 pgs. Language. Language. 1954.. tatvatrayamuu. the students guide to sanskrit composition. 670 pgs. 1953 262 pgs sanskritdocuments. Language..… 159/167 . tatvasan'khyaanaraaghaven'dratiirthiiyat'ippand-ii..org/…/SanskritIIIT. Language. tatvashuddhijaanadhanapuujyapaadavirachitaa. 50 pgs. 1938. 1926.. the pratyabhijna hridaya.. 1997. Language.. the students sanskrit-english dictionary.. Linguistics. Language. 946 pgs. Linguistics. Sri Mallikacharya. 430 pgs. 746 pgs. Linguistics. 298 pgs.s.. 406 pgs. Sanskrit. shriinivaasagopaalaachaarya.. the dasakumaracharita of dandin. Psychology. Literature. swami satchidanandendra saraswati. tatvasan'graha. Literature. Language. the supreme epic of devotion. tatvashuddhi. 1944. Language. kshemaraja. 0. Sanskrit. shriinivaasaachaar. 1936.

shriibhaaskara. Literature.. unmattaraaghavamu. 178 pgs. Linguistics. 124 pgs.. Sanskrit. 1997.. upadeshasahasri Part I and Ii (prose and Poetry).. 73 pgs. Linguistics. hari raghunaath. swami satchidanandendra saraswati. kalidasa. Srimad Bhagawatpadacharya.… upanishhadaan' samuchchaya hari naaraayand a aapat'e RELIGION THEOLOGY Sanskrit 1895 160/167 . shriibhagavadramand-amaharshhi. Psychology. Not available. Language. bhava butta.. Psychology.. tisarii kitaaba. trin'shachchhulokii. A list of scanned Sanskrit books at III… the taittiriya upanishad. trikaakhaad'amakhad'ana. Language. Philosophy. Linguistics.v. Not Available. Sanskrit.. Language. Language. Sanskrit. 0.org/…/SanskritIIIT. Sanskrit.. Philosophy. Religion. Not available. Sanskrit.. Sanskrit. the vikramorvasiya of kalidasa. Srinivasachariar. Sanskrit. the vikramorvasiy. Linguistics.. 1930. 0.. Linguistics. Philosophy. Literature. 140 pgs. Psychology. Rangaswami Aiyangar. Literature.. 154 pgs. Badi Mudgara Kuthara Kumara Swami.. Psychology. Language... Literature. 135 pgs.. Literature. tithichintaamand-i. Narayana Bhatt. 394 pgs.2/14/2011 1953. Sanskrit.. Language. shriiharisin'hajii. Linguistics.. 194 pgs. Sanskrit. Sanskrit. 0. 1924. 443 pgs. 144 pgs. tristhaliisetu. Literature. Sri Rama Pisharoti And Subrahmanya Sastri. Sanskrit.. Bhrga Samhita. 389 pgs. I. vinaayaka gand-esha aapat'e. 382 pgs. Not Available. Sanskrit. 1915. Literature. upadeshasaara bhaashhyasahita. Sanskrit. upadeshasahastrii gadyaruupa sat'iikaa. Sanskrit. kalidasa.. 262 pgs.. K. 413 pgs... tripuradahanamu.. upanishhad'asa Vol. 1934.. trim'shaachchhalokii pat't'aabhiraamat'ikaasahitaa.. 1915. Sanskrit. Not available. Literature.. Language. Linguistics... Linguistics. Literature. udhaanapatrikaa. Literature. LINGUISTICS. 1942. Linguistics. Sanskrit. Literature. 1922.. Language. Sanskrit. 0. 262 pgs. 0. tithisaamaanyanirnd-aya.... 1942. Language.. veidaantaachaaryaa. Literature. Language. 360 pgs. the vikramorvasiyam of kalidasa. Sanskrit. 298 pgs. Language. tithaivivechanakaand-d'avishhayasuchikaa.. Not available. Language. Linguistics. the uttararamacharita of bhavabutta.. Linguistics. 1918.. 19 pgs.. Psychology. 0. 473 pgs. Social Sciences. 380 pgs.. 1899. naaraayand-abatta. 112 pgs. Linguistics. Language. 446 pgs. Literature. Language. tristhaliisetu tiirthendushekhara kaashiimoqs-avichaara. Psychology.. 1903. 1977. Literature. Sanskrit. Sanskrit. Linguistics.. Pandit A. 107 pgs. 1954.. 1949.. trin'shachchhlokii sat'iikaa. trishaati seituhu. Sanskrit. Literature. 63 pgs. suranada kunjan pillai. pand-d'ita shriishashinaatha bhkaa. Sanskrit. 346 pgs.. 52 pgs.. 1922.. Language. Language. tritalaavachchhedakataavaada. 1914. upakramaparaakrama. Literature.. Linguistics. Sanskrit.m.. bhat't'ojidiiqs-ita.. Linguistics.. Language.. LANGUAGE. Linguistics. Philosophy. 1962. Sanskrit. Literature. upadesasahasri. Linguistics. Sanskrit. upaakhyaanamaalaa. sanskritdocuments. 1937. 160 pgs. 20 pgs. 1936. 90 pgs.. Sanskrit. Linguistics. Philosophy.. 1947. kalidasa. Literature. 1957. Philosophy. LITERATURE... Theology. ung-ad'aamareshvaratantramu. Language. Sanskrit.. srimad ramatirtha. Sanskrit.

Literature. Literature. Literature.. LINGUISTICS. bhartrxhari. Language. 1903. upasamhara vijaya.. 500 pgs.. 62 pgs. Literature.… 161/167 . Psychology. Linguistics. shriibhavabhuti.. Literature.. Language. 392 pgs. 1835. vaadanaakshatramaalaa puurvoottaramiimaamsa...2/14/2011 A list of scanned Sanskrit books at III… upanishhadaan samuchchaya. vaadaavalii praaran'bhaha. 1823. uttararaamacharitamu t'iikayaa sametamu.. uttaragiitaa. vaakyapadiiyamu trxtiiyakand-d'amu vrxttisamuddesaatmakamu ambaakartriivyaakhyaaya samalangkrxtamu. Language.. Sanskrit. Linguistics.. Literature. 572 pgs. Sanskrit. Sanskrit.. Sanskrit.. Literature.. 1912. Literature. Language.. Literature. 1912. vaadaavalii. Sanskrit. uttararamacharitam. vaajaneyipraatishaakhyan' kaatyaayanaprand-iitan.. 374 pgs. Linguistics. Literature. uttararaamacharitamu naat'akamu. 84 pgs. Literature. uttaragitha.. 384 pgs. gi.. hari naaraayand-a aapat e. Literature. 618 pgs. Language. 475 pgs.. 1908. 1988... 212 pgs. 467 pgs. mahaakavi shrobhavabhuuti.. Sanskrit. 38 pgs. Language. Religion.. vaakyavrxtti. uttararaamacharitamu. shriimachchhan'karaachaarya.org/…/SanskritIIIT.. uttararaamacharitamu. LITERATURE.. Literature. Language. 82 pgs. vaadanaqs-atramaalaa. Linguistics. veimuuriraamagovindashaastrii. Sanskrit. 216 pgs. uttarapaqs-aavali. Literature.. 1934.. Language. Sanskrit. jagadguru vijendra trtha. jaakooba. 164 pgs. ushhaaparind-ayaprabandha. Linguistics. Literature. Language. vaakyapadiiyamuu brahmakaand-d'amuu. 1915. 1966.. 536 pgs. 1957. 0. Sanskrit.. Literature. 1895.. 56 pgs. Not available.. bhartrxhari.. Linguistics.. 366 pgs. Linguistics. Sanskrit.. 154 pgs. not availabe. Sri Madahobala Suri.. -. Language. Sanskrit. Language. Literature. Sanskrit.. Sanskrit... Linguistics. 1103 pgs. Psychology. Sanskrit.. Linguistics. Sanskrit.. Linguistics. appaya diiqs-itaa. Language. Sri Venkatarama Sharma. mahakavi bhavabhuti. Sanskrit. shriimadvedavyaasa. 0. RELIGION.e.. 0. Sanskrit. vaakyapadiiyamu dvitiiyobhaaga vaakyakaand-d'amu t'ikayaa ambaakartriivyaakhyayaa. 1937. Philosophy.. LANGUAGE. utsargapatrtramu. Sanskrit... Linguistics. Literature. Sanskrit. 1944. Linguistics. 128 pgs. Language.. suuyranaaraayand-aa. Linguistics. Literature.. Sanskrit... Language. ushhaaparind-ayaprabandha. 1891. Literature. 1956. Sanskrit. Theology. Sanskrit. 187 pgs. Linguistics. Linguistics.. vaakyaatharatnam. Literature.. Philosophy. Language. sanskritdocuments. upanishhadddakya koosha. aachaarya karapuut'ugala shrii dharmmashrii. Linguistics. 1926. Appaya Dikshita. 1956. 1980. Linguistics. shuuranaad'a krxjjanuu pilla. Linguistics. Linguistics. Sanskrit. 126 pgs. Sanskrit. shuuranaad'a krxjjanuu pilla.. 1943. 214 pgs. Language. Language. Linguistics. Linguistics. THEOLOGY. Sanskrit. 0. 182 pgs. vaamadeshvaratantraantargatanityaashhod'ashikaarnd-ava vyaakhyaaya. 0. pand-d'ita brahmashang-karamishra. Language. mahaakavishriibhavabhuuti. Language. shriibhaaskararaayonnitasetubandhaara. Language... Language. Sanskrit. 1977. shriimadgod'apaadachaarya. 491 pgs. uttaramiimaan'saa vidaantadarshanamu shaariirakanaamnaabhaashhyan' t'ippand-ii.

maadhava vaasudeiva. shriimadvaadhulamahaachaarya.. Linguistics. 375 pgs.. Theology. vallabhapushht'iprakaasha chaaroon' bhaaga. Language. Literature. Literature. a mahaadevashaastriind-a. vakrottkijiivitamu khopagn-avrxtti. Sanskrit. Literature. sanskritdocuments.. 380 pgs. Literature. Sanskrit. 270 pgs.. Sanskrit. 1958. Linguistics.. vaiseshika darsana. Linguistics. 270 pgs. Literature. Theology. vadavali. 1927.. Sanskrit. 407 pgs.. Sanskrit. 1953.. Linguistics. Sanskrit.. vachaspatya part 1. vararuchaniruktasamuchchaya. Linguistics. shriikaund-d'abhat't'a. vaiyaakarand-asiddhaantakaumuti paand-iniiyavyaakarand-asuutravrxtti. Linguistics. Sanskrit.. Sanskrit. Religion.. shriimatkaund-d'abhat't'a. Literature. 1926.. Sastri and K. Sanskrit. 1965. Language. Sanskrit. Mahamahopadhyaya. Language. Kunhan Raja. Linguistics. 1892.… 162/167 . vaishampaayananitipraashikaa.. Sanskrit.. gan'gaavishhnd-u shriikrxshhnd-adaasane... vaiyaakarand-asiddhaantakaumudii. 240 pgs. vararainugrxhiteshhu panj-chasuvijayeshhu. Language. 134 pgs. General.. Language. Sanskrit.. vajjaalaggan. 198 pgs. Literature. 374 pgs. Linguistics... vaidikamanoharaa. jayatirtha. V. Literature.. Language.. mahaakavi subandhu. Sanskrit. C. Language. vikhaanas. Theology.. Sanskrit.. Linguistics. Language. 1913. T. Language. 804 pgs. Literature. 1923. Religion. 1937.. Religion. Linguistics. Language. Sanskrit. 222 pgs.. vaatulanatha sutras vritti. 1961. 619 pgs. Literature. 406 pgs.... Sanskrit. Literature. Sanskrit. 1901.. Literature. Language. Sanskrit.. 65 pgs.. anantashaktipada.. P. 55 pgs. Sanskrit. Dr. taranatha tarkavachaspati... Literature. vallabhapushht'ipradkaasha chaaroon' bhaaga. 1943. Sanskrit. 704 pgs. P. vaikhaanasadharmaprasna. Theology. Linguistics. Religion. S. 1458 pgs... Sanskrit. 144 pgs. 105 pgs. Linguistics. Linguistics. shriimadraajaanakakuntaka. vaiyaakarand-asiddhaantakaarikaa vaiyaakarabhuushhand-asaaravyavyaakhyaaya. vaishhnd-ava upanishhada.. Linguistics. kalahasti kavi. 1933. Literature. Theology. Language. 1957. Language.. 1927. 75 pgs. bhaskararaya makhin. subramanya shastri p p. 476 pgs. Language. Linguistics... var^shhakrxdiipaka. Sanskrit. 1934. vaishhnd-avadharmaratnaakara. sri t viraraghavacharya. Language.2/14/2011 A list of scanned Sanskrit books at III… vaaraahagrxhyasuutramu. 1923. Literature. 1872. Social Sciences. 166 pgs.. 1828. 1961.... vaiyaakarand-abhuushhand-asaara abhinavasaralaa vyaakhyaaya t'ippand-ayaa samalang-krxtya. 1822. vaasavadattaa. bhat't'ojidiiqs-ita. bhat't'ojiidiiqs-ita. Literature. 1952. bhat't'ojidiiqs-itulu. 442 pgs.. Sastri. Religion.. Sanskrit. Chandrasekharan. Language. Theology. 1873. Religion. 1288 pgs. 65 pgs.. Language.. 1932.org/…/SanskritIIIT.. 0. Linguistics. Linguistics. vaidikakoshha prathamo bhaaga. Linguistics.. vaididasaahityacharitrama'm. 0. varivasya rahasya. Literature. Sanskrit. 122 pgs. vasu charitam. Linguistics... vaidik sahitya charitram. Literature.. 68 pgs. khemaraaja shriikrxshhnd-adaasa. hamsaraaja. vaiyaakarand-a bhuushhand-asaara. 1828. Language. Sanskrit. L. Not available. 568 pgs. Literature. khemaraaja shriikrxshhnd-adaasa. Sanskrit.. Sanskrit. Language. Sanskrit. pi bii annangarachaarya. Literature.. 1938.

vedhaantaraqs-aamand-ivimashe. Linguistics. 1965.. 1942. Theology. Linguistics. 1965. Sanskrit. 1902. Literature. Linguistics. 617 pgs. Linguistics... Linguistics. Sanskrit. Sanskrit.. Sanskrit. Literature. Language.2/14/2011 A list of scanned Sanskrit books at III… vasu charitram. Sanskrit.. Literature. 236 pgs. Language.. 1943. 1887..… 163/167 . Literature.. Literature. Dharmaradhwarindra. vasu charitram... veidaantaraqs-aamand-ivimarsha trxtiiyabhaaga. Linguistics. 0.. 580 pgs. 230 pgs.. Philosophy. Psychology. 0.. Language. Sanskrit. 1959. 0... 166 pgs.v. Sanskrit. Literature.. shrii baalaghanvi jaggu veng-kagaachaarya. Sanskrit.. 62 pgs. 314 pgs. Language.... 106 pgs. vedaartha bhuumikaa. Literature. sanskritdocuments. Language. Psychology. Language. 300 pgs. Psychology.. 0. Sanskrit.. Sri Satyajnananda Tirtha. svaamii vidhyaananda sarasvatii. 490 pgs.. vedadhammevyaakhyaanamn. 524 pgs. kalahasti kavi. Linguistics. Philosophy. Swami Govindasingh Sadhu. Linguistics. Sanskrit.. 0. Sanskrit. qs-emaraajashriikrxshhnd-adaasa.org/…/SanskritIIIT. 0. Sanskrit. 176 pgs. Language.. vedaantapan'chadashi. Linguistics. Language. Sanskrit.. harikrxshhnd-adaasa goyandakaa.. Sanskrit. 1985. shriividyarand-aya.. 1949. Sanskrit. 233 pgs. Not available. Sanskrit. Sanskrit. A... Sanskrit.. vedaantaparibhaashhaa. Philosophy. Literature.. Religion.. Language. Sanskrit. 416 pgs.. vedaantapan'chadashi. veidaantavijayamang-galadiipikaa. 463 pgs. vedaantaparibhaashhaa dhameraajaadhvarendrakruti. Literature. vedaanta darshana. Sanskrit. 1942. 620 pgs... shriimatsvaamidayaanandasarasvatii. Literature. 1992. Linguistics. shriimaddharmaraajaadhvariindra. shriibhagavatpaadaachaarya. vedaantaparibhaashhaasan'graha. veimabhuupaalacharitamuu. Literature. vedaantadeepa bhaagha 2. 1937... Sanskrit. 51 pgs. Literature. Language. Philosophy. Linguistics. vedaantaraqs-aamand-ivimarsha chaturthabhaaga. Language. Literature. Language. vedantapanchadashi. Language. 1942. Language. 1928. Raja Sri Sri Rama Varma. 1927.. vedaantaparibhaashhaa. Sanskrit.. Linguistics. Language.. veidaanta darshana brahmasuutra. Linguistics. 1833. Sanskrit... Literature. -. Lingannasomayaji. Language. Literature. Sri Madhusudan Prabhuji. Literature. Psychology. 142 pgs. goopaalaachaarya. Philosophy. Language. Sanskrit. 0.. vedaanta dharshana brahmasuutra sarala hin'dii vyaakhyamu. 1934. Literature.gopalacharya.. 145 pgs. 242 pgs.. 1969. 480 pgs.. Psychology. Linguistics. pan' bhat't'ashriigauragoopaalashamaa. Sanskrit. Sanskrit. shrii bhagavad raamaanuja.. Literature. Psychology.. veidaantabaalaboocdhini kramaan'ka 99. kalahasti kavi. 190 pgs. Language. Not available. vedaang-gaprakaasha navamobhaaga vyaakhyaaya. rayaprolu l somyaji... vedaantaparibhaashhaa. Linguistics. Linguistics. Philosophy. vedanta desika. shriimanmaharshhi vedavyaasa. Linguistics. 154 pgs. Linguistics. vedaantavichaaramaalaa. 614 pgs.. Literature. 0. Language. Not Available. vedaprakasa. Linguistics. 219 pgs. 370 pgs.

Religion. Language.. 147 pgs.. viiramitroodayei bhakti prakaasha Vol. Sanskrit. Sanskrit. Literature. 256 pgs. Religion. 1913. 1991. Sanskrit. 1959. vin'shashataabdikan' san'skrxta naat'akamu.. Literature. 614 pgs. Linguistics.. Sanskrit. 208 pgs. 394 pgs.. Religion. Literature. kalidasa. viduraniiti. Language. Sanskrit.. Sanskrit. 1916.. 292 pgs. viiramitrodaya tiir^thaprakaasha. Sanskrit. viiramitrodaya shraaddhaprakaasha. 1925. Social Sciences. 1972.. Language.. 1935. vikramorvasiyam. Language..… vishhnd ubhaktikalpalataa mahidharakrutayaa t'ikayaa Language Linguistics Literature Sanskrit 164/167 . 1932.. 1936. Sanskrit. Literature.. shrii veera raja charan gupta. Literature. shriikaalidaasa. Sanskrit. viind-aalaqs-and-amuu. Language. 674 pgs. Language. Linguistics.x. mitra mishra.. 1923. viiramitrodaya paribhaashhaaprakaasha.. Language. mitra mishra. 1916. venisamhara. viiramitroodaya Vol. Sanskrit. 1913. Sanskrit. 1917.. viiramitroodaya Vol. Literature.. 383 pgs.. 1070 pgs. bhatta narayana. Language. Sanskrit. Sanskrit. 158 pgs. 501 pgs. Sanskrit. vishatantram. mahaamahopaadhyaayashriimitramishra.. 266 pgs. Sanskrit. 1939.2/14/2011 A list of scanned Sanskrit books at III… vekramorvasiyamu. Language. vidhyaamaadhaviiyamu prathamasan'put'amu 1 5 adhyaaya.. vemana padyamulu. Sanskrit. vikramorvasiya.. Linguistics.. Mahamahopadhyaya Pandita Mitra Misra.. Sanskrit.k. Sanskrit.. Mahamahopadhaya Pandita Mitra Misra. viiramitrodaya Part Ii.org/…/SanskritIIIT.. 1917. Linguistics. Literature. 494 pgs. 1962... vikramoovrashiiyamuu. Literature. Sanskrit. Vishva Bandhu. Sanskrit. 50 pgs. 158 pgs. 577 pgs. 1913.. Linguistics. Social Sciences. 578 pgs. Linguistics. sanskritdocuments.. Literature. 1906. Literature. nyaayaacharya.. 228 pgs. viiramitrodaya Part Vii. Linguistics. 225 pgs. vishhnd-usharmaa. Language.ii. Literature. Linguistics. 1959. Language. Sanskrit. Literature... 1925.. viiramitrotayasya shraaddhaprakaasha. jagadgurukrutayaa t'ippapyaa. Literature. 161 pgs. kaalidaasa.. Social Sciences. 381 pgs. shriimahaamahopaadhyaayashriimitramishra. vidhyaamaadhava. Literature. vijaya vikrama vyayoga. kalidasa. 1903. 1897. Linguistics. Sanskrit. Theology.. 610 pgs.. srirama desikan siromani.. 1955.. mahaamahopaadhyaayashriimitramishra.s. Sanskrit. Linguistics. 0.. Xxi. 85 pgs. Literature... vish vekharaanandasan'sthaaniiya hastalekhasan'grahaparitaalikaa saacha khand-d'advayavatiisati. viiramitrodaya raajaniitiprakaasha bhaaga 6.. ramamurti. Linguistics. Linguistics.. viiramitrodaya puujaaprakaasha. Literature. Sanskrit. 166 pgs.. raamajii upaadhyaaya. parameishvara. Theology. Mahamahopadhaya Pandita Mitra Misra. 0. Linguistics. Language.. dr sir c p raamaswamy aiyar. Mahamahopadhaya Pandita Mitra Misra. vidyamaacdhaviiyamuu. Language. Mahamahopadhyaya Pandita Mitra Misra. Language. Social Sciences. Linguistics. 0. Linguistics.... Language.. vend-iisan'haaramu. Linguistics. Linguistics. 1914. Language. Social Sciences. Linguistics. 234 pgs.. Sanskrit. Language. Theology. Sanskrit.. Literature. viiramitrodaya laqs-and-aprakaasha. 382 pgs.. Sanskrit. Literature. 194 pgs... Literature. mahaamahopaadhyaayashriimitramishra. Language..

1909. Not available. Sanskrit. Literature.. 1814. 1957... Sanskrit. Language. 382 pgs. Linguistics. 120 pgs. lakqs-mii narasin'ha bhat't'aa.. 516 pgs. -. Sanskrit. Literature. Sanskrit.. Philosophy. T. 1956. 988 pgs. 1892. Sanskrit.. Literature... b j sandesara. vishhnd-usan'hitaa. Language. 244 pgs. vivarand-apajnikaa dashamo bhaagan.. Literature. 2001. vratakaand'amu chado bhaagan.. Sanskrit. 272 pgs. Linguistics. 0. 413 pgs. 0. 186 pgs. 354 pgs.. 1926. Literature. vyaakarand-a granthaa. Theology. Religion. Theology. Ramasastri Tailanga. 1961... Sanskrit. Sanskrit. Language. shriishn'karabhagavatpaada. 169 pgs. Sanskrit. Sanskrit. Linguistics.. Not available. vivarand-apajnikaa trutiyo bhaagan.. Linguistics. Language. Sanskrit. vishhnd-udharmoottara puraand-e trxtiiya khand-d'a. Language. 147 pgs.. Rangacharya. Language.. vistaarikaavyaakhyaaya san'valita kaavyaprakaasha dvitiiyobhaaga. M Rangacharya. shriisachchidaanan'dein'drasarasvati. 1893. 1965. Religion. gan'gaavishhnd-u shriikrxshhnd-adaasa. 1958. Linguistics. 298 pgs.. 376 pgs. 1895.. 440 pgs.... shriimadappayadiiqs-ita. shriimaduraadaasa.. Sanskrit. Sanskrit. Literature. Sanskrit. Literature.. Linguistics. vrxddhasuuryaaruund-akarmavipaaka.. Theology. Language.. Linguistics. Not available... Sanskrit. Sanskrit. vishhnd-udharmottaramahaapuuraand-a. Linguistics. 511 pgs. 482 pgs. Ganapathi Sastri.. Religion.. vivarand-apajnikaa saptamo bhaagan. 440 pgs. viveikachuud'aamand-i. Language. Not available.2/14/2011 A list of scanned Sanskrit books at III… vishhnd-ubhaktikalpalataa. 518 pgs. 676 pgs. vrxttamuktaavalii. Language.v.. 1940. 1953.. Sanskrit.. Religion. vrxttivaartikamu.... Sanskrit. 1972. bhaaratiitiirtha. not available. vishhvaksenasan'hitaa. M. 1982. 237 pgs. nijagund-ashiva yoogi. Literature. Rangaswamy Aiyangar.. 44 pgs. vivarand-apajnikaa ekaadasho bhaagan. Language.. Sanskrit. sanskritdocuments. 407 pgs. mahidharakrutayaa t ikayaa. Literature. Linguistics. Sanskrit. 1972. M. Literature. vivarand-apajnikaa dvitiyo khand-d'an. 146 pgs. 62 pgs. 1965. T P Upadhyaya.. Language.. M. Sanskrit. Religion. Sanskrit. 264 pgs. M. 0. K. shriikrxshhnd-aabhat't'a. vushhabhaanujaa. Language. Sanskrit... Linguistics. Sanskrit. Sanskrit. Bhrga Samhita. Linguistics. Religion. Literature.. vivarand-aprameyasan'graha. Linguistics. vivarand-aprameyasan'graha vidhaarand-ayamuniprand-ita Vol 5 Sanskrit Text. 1931.… 165/167 . Literature. Religion. Literature. Sanskrit.. Rangacharya.. Language.. 1964... 1962.. 1964. Language. Literature. Language. Religion... Linguistics. vuttamautkika.. vivaakachuud'aamand-i kramaan'ka 93.. Psychology. Literature.. Linguistics.. 1963. Sanskrit. 1942. Language. Philosophy.. vrxttaratnaakara. Linguistics. viveika chuud'aamand-i. paramaanandachakravarti. Sanskrit. vivarand-apajnikaa dvadasho bhaagan. Linguistics. Linguistics. 118 pgs. Sanskrit. 725 pgs. Sanskrit. 0. Literature. Kuberanath Shukla. 1879. visvasanskrit shatabdi granth yojnaaya. 286 pgs. vrxttaalang-kaararatnaadlii. Rangacharya. Theology. 327 pgs.. Literature.org/…/SanskritIIIT.. Religion. vivarand-apajnikaa ashht'amo bhaagan. Psychology. viveikachin'taamand-i paart' I.. Sri Kedara Bhatta. Swetharnia Narayana. 268 pgs. Religion.. 1925. vrajavilaasa. Rangacharya. Language.

Linguistics. 1964.. Linguistics. 1933. shriimitramishra.org/…/SanskritIIIT. Sanskrit. 0. shriiraajaanakamahimabhat't'a.. vyadhikarand-aprakarand-amuu. Language. 306 pgs. Sanskrit. 630 pgs. 722 pgs. Language. hari naaraayand-a aapat'e. 0. Literature. Linguistics.. Language. Literature. 430 pgs. Sanskrit. shriivedaantachaarya. yaagn-avalkyasmrxti viiramitrodaya mitaaqs-araa t'iikayaa. vyaasaadhikaarand-amaalaa. Language. 124 pgs. 1977. vyakaran pradip. 116 pgs. vyaasashiqs-aa.. 122 pgs. Sanskrit. Sanskrit. Language. vyaatpipanj-chakarahasyamu sin'havyaadhralaqs-and-arahasyan. 1937. 480 pgs. Sanskrit. Literature.. 90 pgs. Literature. Literature. Linguistics.k.2/14/2011 A list of scanned Sanskrit books at III… vyaakarand-a puurvapashnaavalii.. Linguistics. Literature... 0. 1892. vyavahaaranir^nd-aya. 190 pgs. 484 pgs. 0. vyaakarand-abaalabodha prathamobhaaga. LITERATURE. Language. 1942. Language. 98 pgs. vyaaktiviveka vyaakhyaaya madhusuudaniivivrxtyaa.. 114 pgs.. Sanskrit. Language.. Linguistics. shriimadagadaadharabhaat't'aachaarya... vyutpattivaada. -. vyakaran siddanta kaumadi. Sanskrit.. Literature. Linguistics. somaakarasudhaakara.. Linguistics. Sanskrit. vyaasasan'grahamu nov 1933. vyaktiviveka of rajanaka sri mahimabhatta.. 1950. Sanskrit. 1230 pgs.. 270 pgs. vyutpattivaada guud'haarthatattvaalokena samudbhaasita.. Linguistics. Sanskrit. Literature. Theology. Language. Language.. Sanskrit. Literature. 1927. Sanskrit... Linguistics. LANGUAGE. Sanskrit. 0. Literature.. Philosophy.. Sanskrit. Linguistics.. 568 pgs. Literature. Linguistics. Literature.. Social Sciences. Language. Linguistics. 1929. mahaamahopaadyaya kapistalama desikaachaariyara. 76 pgs.. Language. yaajnd-aavaalkyasmrithi.. Linguistics. 283 pgs.. Not available. J. Sanskrit. Not available. Literature. Sanskrit. vyutpattivaada guud'haarthatattvaaloka. vyavahaaramayuukha miimaan'sa. 0.. Linguistics. rewaprasada dwivedi.. Sri Varadaraja.. Literature. 166 pgs. 492 pgs. Literature. Religion.... 310 pgs.. 1908. 1931. LINGUISTICS. vidvadbhi ke vi subrahmand-yashaastrii. 1929. bapu shastri moghe. Language. Language. gopaalashaastrind-aa. 0. 1986. Linguistics.. 1150 pgs. vyaasashiddhaantamaataand-d'a. vyaasasiddaantamaartaand-d'a. Religion. Not available. 1993. Linguistics. Sanskrit. 886 pgs.. pand-d'ita veing-kat'araamashammrond-aa.. Sanskrit. 680 pgs. Literature.. sanskritdocuments. shriimadagadaadharabhat't'aachaarya. sircar mk..… 166/167 . yogiishvarend-a maharshhind-aa yaagn-avalkyena. 0. Theology. Language. yaajushha jyautishhan' bhaashhya aarcha jyautishhan. Literature. Balasubramanyam.. Language. Pandit Durgaprasad. Sri Maha Mahopadya Kapisthalamdesikacharya. Psychology. yaadavaabhyudaya. Literature. LITERATURE.. Sanskrit. yaagn-avalkyasmrxti trxtiiyaavrxtti. LINGUISTICS. Sanskrit.. Linguistics. Philosophy. 1942.. 556 pgs. Sanskrit... Language.. Language. Sanskrit... yajnj-avalkyasmuti Vol I. vyaasataatpayenind-eya. Sanskrit. Linguistics.. Literature.. shriiniilakand-t'habhat't'a. Psychology. 0. LANGUAGE. 1892. shriimathuraanaathatarkavaagiisha. vedavidhaalaya. Sanskrit. Language.. vyaaptipanj-chakamu.

0. 126 pgs. Linguistics.. Language. Literature.. Not available.. 597 pgs. Literature. yoogasandhyaa. Literature. Sanskrit.. Sanskrit. Religion. Literature. yojavaar^tikama~. vaajasaneyi madhyaandina shukla.. Literature. 246 pgs. Sanskrit. Sri Vijnana Bhikshu. Theology. Linguistics. shriivaasudeva.. yoogavaasishht'he. Sanskrit.. Literature.. shriishrutasaagarasurikutayaa. yudhishht'hiravijayamu vyaakhyaaya. 212 pgs. Psychology. Sanskrit. Linguistics. Literature. 1946. khemaraaja shriikrxshhnd-adaasane. yajurveda san'hitaa. Linguistics. mahaakavi shriivaasudeva. 1897. Literature. 0. Linguistics. yathiraja vijaya natakam.. yogavaasishht'a bhaashhaa bhaaga 2 6 t'haa nirvaand-aprakarand-a puurvaarddhottaraarddha. Not available. Language. Language.. 218 pgs. Linguistics.. Sanskrit.. 1903. Not available. Language. 252 pgs... Sanskrit. 1919.. ghatikasatam vatsya varadacharya. 802 pgs. Linguistics. Linguistics.. Religion.. 202 pgs. Sanskrit.. Sanskrit. Language. 802 pgs. Linguistics. 1857.. yuktimallikaayaan'gund-asaurabhan. 1983. Not available. 1834. Sanskrit. 1849.. 1884.. Search matched 4853 books with 1743368 pgs. Sanskrit.. khemaraaja shriikrxshhnd-adaasane.org/…/SanskritIIIT..2/14/2011 A list of scanned Sanskrit books at III… Sanskrit. 1 0-9 A-D E-H I-L M-P Q-T U-Z sanskritdocuments. 484 pgs. 616 pgs. yuktimallikaa. Sanskrit. yogaratnasamuchchaya dvitiyo bhaaga. yashasitalakamu.… 167/167 . 322 pgs. 493 pgs.. Sanskrit. Language. Literature. 969 pgs. Linguistics. 1903. hari naaraayand-a. 1909.. Linguistics. Language. yudhishthiravijayamu.. Literature. Language. 0. Language. Theology. 226 pgs. Philosophy... yatiindramata diipika. Language. yogaratnaakara vaidyakagran'tha dvitiiyaasrxti. Literature. 1949. navare ityupaabhidhakrxshhnd-asharmand-a. Language. Sanskrit.

Sign up to vote on this title
UsefulNot useful