2/14/2011

A list of scanned Sanskrit books at III…

12780 laghupaaraasharii... gagaavishhnd-a shriikruushhnd-adaasa, General. Sanskrit, 2005. 44 pgs. 127801 vrxddhayavanajaatakama... davis pingree, General. Sanskrit, 2005. 452 pgs. 12782 kaavyaadashar... acharya ramachandra mishra, General. Sanskrit, 2005. 332 pgs. 12783 muhhuurtachintaamand-i... narayana acharya, General. Sanskrit, 2005. 492 pgs. 12787 taajikaniilakand-t'hii... pandit srimadhukantagana jyotishacharya, General. Sanskrit, 2005. 478 pgs. 12789 liilaavatii... pt.shri lakhanlal jha, General. Sanskrit, 2005. 386 pgs. 12790 rupachandrikaa... ramachandrajhaa vyaakarand-aachaayra, Religion. Theology. Sanskrit, 0. 318 pgs. 12790 rupachandrikaa... ramachandrajhaa vyaakarand-aachaayra, Religion. Theology. Sanskrit, 0. 672 pgs. 12793 sachitra jyotishha - shiqs-aa... b.c thakur, General. Sanskrit, 2005. 270 pgs. 12794 jyotishha vdaaraa roga upacchara... prem kumer sarma, General. Sanskrit, 2005. 214 pgs. 12795 shatayoogaman'jari... madhurakrishnamurthy sastry, General. Sanskrit, 2005. 92 pgs. 12796 muhuurtadarpand-amu... vavilla rama swamy sastrylu and sons, General. Sanskrit, 2005. 180 pgs. 12798 vitti evan' vuutti prabandha... aacharya mukund devagna, General. Sanskrit, 2005. 254 pgs. 12802 Jyotishha ratnaakara... devakiinandana sih, General. Sanskrit, 2005. 1118 pgs. 12803 dasharsurpakamuu... keshavaraava musalagaavakara:, General. Sanskrit, 2005. 574 pgs. 12804 saahityadaprand-ama... aachaariya sheshharaajashamaa regmii, General. Sanskrit, 2005. 1146 pgs. 12805 chamatkaara chintaamand-i... malaviyadaivajna dharmesvara, General. Sanskrit, 2005. 556 pgs. 12807 bharatiiya jyotishha... nemichandra sastri, General. Sanskrit, 2005. 450 pgs. 12808 sachitra jyotishha shiqs-a... b.c thakur, General. Sanskrit, 2005. 904 pgs. 12809 shhad'avagar phalamuu... krishan kumer, General. Sanskrit, 2005. 450 pgs. 12810 ladhupaaraasharii madhyaparaasharii... kedaaradatta joshii, Religion. Theology. Sanskrit, 0. 128 pgs. 12811 vrxddhayavanajaaakamuu... davis pingree, General. Sanskrit, 2005. 414 pgs. 12812 vasan'taraajashaakuna... -, General. Sanskrit, 2005. 610 pgs. 12815 saaraavaali... -, General. Sanskrit, 2005. 400 pgs. 12816 sarvaarda chin'taamand-i... sri kambampati ramgopalamurthy, General. Sanskrit, 2005. 328 pgs. 12817 maanasagarii... Dr . ramachandra pandey, General. Sanskrit, 2005. 540 pgs. 12818 brxhatparaasharaherashaastramu... madhurakrishnamurthy sastry, General. Sanskrit, 2005. 408 pgs. 12819 sachitra jyotishha shiqs-a... bii . ela . t'hakura, General. Sanskrit, 2005. 286 pgs. 12821 jyothisyashhabdakoshha:... Pandit Sreemathru Prasadha Pandeya, General. Sanskrit, 2005. 440 pgs. 12822 sachitra jyotishha shiqs-a... b.c thakoor, General. Sanskrit, 2005. 252 pgs. 12823 jyautishha- san'hhitaa... aacharya baskaranand lohini, General. Sanskrit, 2005. 272 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 1/167

2/14/2011

A list of scanned Sanskrit books at III… 12824 bhuvanadiipaka... pandit kashiram, General. Sanskrit, 2005. 88 pgs. 12826 svapnavaasavadantamuu... gang-ga'saagararaaya:, General. Sanskrit, 2005. 278 pgs.

12828 jyotirveidan... gobboru venkatananda raghavarao, General. Sanskrit, 2005. 230 pgs. 12831 prashnachand-d'oshvara... pandit vishnu dutt, General. Sanskrit, 2005. 88 pgs. A Catalogue Of Sanskrit And Prakrit Manuscripts In The Rajasthan Oriental Research Institute Part Iii A... Muni Jinavijaya, Unknown. Sanskrit, 1967. 626 pgs. A Cattalouge Of The Sanskrit Manuscripts... Dr.aryendra Sharma, Unknown. Sanskrit, 1964. 338 pgs. A Critique Of The Brahmasutra Part 1... P M Modi, Unknown. Sanskrit, 0. 530 pgs. A Critique Of The Brahmasutra Part 2... P M Modi, Unknown. Sanskrit, 1956. 422 pgs. A Descriptive Catalogue Of Sanskrit Manuscripts Volume I Part Ii... T P Upadhyaya, Religion. Sanskrit, 1953. 266 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts... P P S Sastri, Unknown. Sanskrit, 1929. 530 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts... Vidya Sagara, Unknown. Sanskrit, 1934. 452 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts Vo Iii... P P S Sastri, Unknown. Sanskrit, 1929. 632 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts Vol 14... Tanjore Maharaja Serfoji S, Unknown. Sanskrit, 1932. 523 pgs. A Dictionary English And Sanskrit... sir monier monier williams, Unknown. Sanskrit, 1957. 666 pgs. A Dictionary Of Sanskrith Grammar... Kashinath Vasudev Abhyankar, Unknown. Sanskrit, 1961. 436 pgs. A Grammatical Dictonary Of Sanskrit Vedic... Surya Kanta Sastri, Unknown. Sanskrit, 1953. 308 pgs. A Grammatical Word Index To Atharvaveda... vishva bhandu, Unknown. Sanskrit, 1963. 734 pgs. A Grammatical Word Index To Rigveda... Vishva Bhandhu, Unknown. Sanskrit, 1963. 648 pgs. A Grammatical Word Index To Taittiriya Samhita... vishva bhandu, Unknown. Sanskrit, 1963. 376 pgs. A Grammatical Word Index To The Four Vedas... Vishva Bandhu, Unknown. Sanskrit, 1963. 506 pgs. A Grammatical Word Index To The Principle Upanisads... vishva bandhu, Unknown. Sanskrit, 1966. 579 pgs. A Handful of Popular Maxims... Dr.m.d.balasuramanyam, Unknown. Sanskrit, 1983. 336 pgs. A Short History Of Sanskrit Literarure... T K Ramachandra Iyer, Literature. Sanskrit, 2002. 220 pgs. A Study Of Bharatas Natyasasatra And Avaloka On Dhananjayas Dasarupaka... Dr Manjula Gupta, Unknown. Sanskrit, 1987. 342 pgs. A Vedic Word Concordance Vol 5 Part 2... Visva Bhandu, Religion. Sanskrit, 1965. 174 pgs. A Vedic Word Concordance Vol Ii Part Ii... Visva Bandhu Sastry, Religion. Sanskrit, 1936. 746 pgs. Aachaara Bhuushhand-ama~ Grantha 57... Paahatryambaka Oko, Religion. Theology. Sanskrit, 1908. 449 pgs. Aachaara~yaa Abhyudayaa... D'indi'ma Raajanaatha~, Language. Linguistics. Literature. Sanskrit, 1945. 130 pgs. Aachaarendu Grantha 58... Aapat'e Hari Naaraayand-a, Religion. Theology. Sanskrit, 1909. 415 pgs. Aadhaanapadhdati... Aapat'e Mahaadeva Chimand-aajii, Religion. Theology. Sanskrit, 1947. 145 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 2/167

2/14/2011

A list of scanned Sanskrit books at III… Aagaashe Ispupaahai Gran'tha 5... Aapat'e Hari Naaraayand-a, Philosophy. Psychology. Sanskrit, 1912. 103 pgs.

Aanandakandachampuu... Mishraa Mitra, Social Sciences. Sanskrit, 1931. 260 pgs. Aapastambashulbasutrama~... Aapastan'ba, Philosophy. Psychology. Sanskrit, 1931. 352 pgs. Aapastambiiyan' Shraotasuutrama~... Chaara~ya Narasin'haa, Religion. Theology. Sanskrit, 1944. 816 pgs. Aapracharya Yasak Ki Vedvyakhya Paddhati... Dr Gyan Prakash Shastry, Unknown. Sanskrit, 1985. 164 pgs. Aapradarshprastavmala Vol I... Pandit Sri Vishwanath Shastry, Unknown. Sanskrit, 1951. 147 pgs. Aaprayyorday Kavyam Poorvadharm... Pandit Ganga Prasad Upadhyay, Unknown. Sanskrit, 0. 250 pgs. Aapstamba Shulba Suutrama~... Chaara Shriinivaasa, Religion. Theology. Sanskrit, 1931. 352 pgs. Aara~tha Shaastra Padasuuchii Trxtiiyo Bhaaga... Shaastri Shamaa, Social Sciences. Sanskrit, 1925. 358 pgs. Aara~thavara~nd-a Jyotishhama~... Dattaa Bhagavata, Religion. Theology. Sanskrit, 1924. 45 pgs. Aara~yaasaptashatii Faskikyulasa~1,2 Cha... Shriivishveshvaraapand-d'ita, Religion. Theology. Sanskrit, 1925. 376 pgs. Aashvalaayana Shraota Suutrama~ Prathamo Bhaaga... Shaastri Man'gala Deva, Religion. Theology. Sanskrit, 1938. 187 pgs. Aath Shri Madrunu Bhasyam... Shri Vallabha Charya, Unknown. Sanskrit, 0. 792 pgs. Aath Shrimadbhagwatha Darshini Ekhadarshaskarandra Prarbhaythe... -, Unknown. Sanskrit, 0. 478 pgs. Aath Smrithisaarodhwarprarambh... -, Unknown. Sanskrit, 0. 102 pgs. Aath Vamanpuranam Prarabhyathe... -, Unknown. Sanskrit, 0. 420 pgs. Aatmadarshanam... Vedhanth Anjaneyakumara Swamy, Unknown. Sanskrit, 1987. 178 pgs. Aatyoug pradipika... Shemraj Shri Krishnadass, Unknown. Sanskrit, 1874. 236 pgs. Aayura~vedasutrama~... Yogaanandanaatha, Philosophy. Psychology. Sanskrit, 1922. 356 pgs. Abhidavimarsh... Yogeshwar Dutt Sharma, Unknown. Sanskrit, 1980. 150 pgs. Abhidhaana Ratnamaalaa... Aupharet'a, Language. Linguistics. Literature. Sanskrit, 1928. 419 pgs. Abhidhana Manjari Of Bhishagarya... Shankar Sharmana, Unknown. Sanskrit, 0. 530 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrit Vol I... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 1056 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrit Vol I I I... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 1378 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrith Vol I V... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 1297 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrithvol I I... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 728 pgs. Abhidhanarajendrah Prakriti Magadhi Sanskrit Vol 6... Vijayarajendra Suri, Unknown. Sanskrit, 1985. 1482 pgs. Abhidhanarajendrah Prakriti Magadhi Sanskrit Vol 7... Vijayarajendra Suri, Unknown. Sanskrit, 1985.
sanskritdocuments.org/…/SanskritIIIT.…

1217

3/167

E... 1982. 732 pgs.. Sanskrit. Ganesh Kashinath Kale.. Sanskrit. Psychology. 130 pgs. 326 pgs. Sanskrit. Abhidhanaratnamala. Aapat'e Hari Naaraayand-a.. Unknown. Abhidhara~maasamuchchayasya. Theology.obermiller...5. Abhidhanarajendrah Vol.. Literature. Adharsha Prasthav Rathnamala.. Mr. Psychology. Technology. Sanskrit. Acharya Jinabhadras Visesavasyakabhasya Part Iii. Narakand-t'hirava Shaastri Vat't'ipalli. Srimannarayana.4... 1992. 522 pgs. 0. Sanskrit. Sanskrit. Satavadhana Srinivascharya. Aasn'ga. Abhijnana Sakuntalam Of Kalidasa. Unknown. Abhidharmakocarikah. 648 pgs. Unknown. Abhinavam Prasutitantram First Edition.. Addaitasiddhi Dditiiyan' San'skarand-an.. Philosophy. Paand-d'uran'ga Oke Mahadevo..... 518 pgs.. Mahakavi Kalidasa. 1950. 1301 pgs. 364 pgs. Sanskrit. Abhilekha Sangraha Sixth Khandah. Abhidhara~masamuchchaya.. 1861. 1945. 1910. 1990. Religion. Abhidhara~maamrxtama~. Unknown. Sanskrit. Pandith Damodar Sharma Gaud. 1950. 1900. 1912. 532 pgs. 690 pgs.. Unknown.. Abhidharmamrta Of Ghosaka. 194 pgs. 1937.. Sanskrit. Adhyathyamramayana Vol Iii.2/14/2011 A list of scanned Sanskrit books at III… 1217 pgs. Vasubandhu. Unknown. 1940. Philosophy. 0. Advaitasiddhi Prathamasamput'ama~.. Sanskrit. Abhijnana Sakuntalam Naam Natakam. Sanskrit. 0. Agnipuraand-ama~ Grantha 41.kale.. Abhinavaratnamaala Davitiiya Bhaaga. 0. Sanskrit. Agnihotra Chandrikaa Grantha 87. 1933..org/…/SanskritIIIT. Abhijnana Sakuntala. Vijayarajenda Suri.. A N Krishna Aiyangar. Sarasvatii Madhusudhana.. Acharya Ddhruva Smaraka Grantha Vol 3. Abhijnana Sakuntalam. sanskritdocuments... Sri Viswanatha Shastri Prabhakar. Sanskrit. 1921. Bahadur Chand Chhabra. Sanskrit. Sri Guru Prasad Shastry. Abhidhanarajendrah Vol.. Shaastri Vaamana.. 1910. Asan'gaa... Unknown. 120 pgs. Sanskrit. Advaithdeepika.. Unknown. Sanskrit... Acyutarayabhyudaya Of Rajanatha Dindima. Language. 40 pgs. Theology. Philosophy. Unknown... Unknown. Unknown. Social Sciences. 1950. 0.. 1991. Parikh. Advaitasiddhi Trxtiiyasamput'ama~. 170 pgs.. Abhinava Vaasavadatta. Sanskrit. 1950. Sanskrit.... Unknown. Unknown. 284 pgs. Unknown.. Unknown. Abhisamayalankara Prajnaparamita Upadesa Sastra. 208 pgs. 1618 pgs... 210 pgs. 1922. Unknown. 1953. 1992. Unknown. Sarasvatii Madhusudhanaa. Sanskrit. Ghoshhaka. Sanskrit. Psychology.. 405 pgs. Sanskrit. 161 pgs. Shanti Bhikshu Sastri.. Rasiklal C. Theology. 134 pgs.. 1964. Sanskrit.. Religion. Religion. 879 pgs. 172 pgs. Pandit Ramachandra Sharman. Theology. Unknown. 1953.. Unknown. Dalshuk Malvania. Unknown. Srimath Paramhans Parivrajakachary. Unknown. 1946. 882 pgs. Sanskrit.… 4/167 . Sanskrit. Sanskrit... 152 pgs. Sarasvatii Madhusudhana. Religion. 993 pgs.. Linguistics. 0... Abhijnana Sakuntalam Of Kalidasa...... Sri Chelamcheral Rangacharya. 1968. 464 pgs. Sanskrit.. Sanskrit. Sanskrit. Adharva Vedha Samhitha. 620 pgs. 100 pgs. 260 pgs. Abhijnana Sakuntalam. 304 pgs. Vijayarajendra Suri. Sanskrit. Sanskrit. Sanskrit. Th Aufrecht.

... 98 pgs. Sanskrit. Amara Bharathi. 1951. Sanskrit... Language.. 520 pgs.. Shastrii Esa~ena~. Aldankar Sarvasvam. Surya Narayana Murty.. 1923. Alankarakaustubha Of Kavi Karnapura. 1986. 1984. Sanskrit.. Sanskrit..… 310 pgs 5/167 . Alankaramand-ihaara Trxtiiyo Bhaaga. 662 pgs. 46 pgs. Linguistics. Linguistics.. Sri Amaru Kavi. Language.. Literature.. 319 pgs.. 1987. 1931. Aitareyopanishhata~ Panj-jamii Khand-d'a Grantha 11. Sanskrit. Parakaalasvaamii Shrii Krxshhnd-abrahmatantra. Ajnanadhavanta Candabhaskarah. Sanskrit.sivadatta.. 252 pgs... Sanskrit. Alang-kaaramand-ihaara~ Chatura~tho Bhaaga. Sanskrit. 1982. Unknown.. Sanskrit. 182 pgs. Sanskrit. 1982.. Sanskrit. 449 pgs. 1917. 94 pgs. Suranad Kunjan Pillai. Geography. Linguistics. Sanskrit. 1957. Theology.. 1983. 441 pgs. 0. Biography. Literature. Anantakrisna Sastri. Language. R.. Akasmika Dana Laba Ke Yoga. 366 pgs.. 262 pgs. Parakaalasvamii Shriikrxshhnd-abrahmatantra. Alamkarasamgraha Of Amrtanamdayogin. 1927. Sri Bharateeya Yogi. Literature. Alphabetical index Of The Sanskrit Manuscripts Vol I. Alang-kaara Kaumudii. History. Language. 1964. Linguistics.. Literature.. Parakaalasvamii Shriikrxshnd-abrahmatantra. Parakaalasvaamina~ Shriikrxshhnd-abrahmatantra. 1929.. 1921. 138 pgs. Linguistics.. Sanskrit. Sanskrit. Mm. 368 pgs.v. Unknown. Alankaraustubha Of Visvesvara Pandita. 1950. Gaurinath Sharmana... Sanskrit... Sanskrit. Literature. k bhaskara rao. 334 pgs. Theology. Kondapudi Apparao. Subrahmanya Sharma. Sanskrit. 1923.... Parakaalasvamii Shriikrxshnd-abrahmatantra.2/14/2011 A list of scanned Sanskrit books at III… Aitareya Brahmana Of Sadgurusisya Vol I 1 To 15 Adhyayas.. Sanskrit. 1981. Jaggu Venkatachari. Religion. Linguistics. Unknown. Alang-kaaramand-haara Trxtiiyo Bhaaga. H L Jain. Sanskrit... Sanskrit.. 69 pgs. 339 pgs.. Unknown. Paand-d'eya Shriivishveshvara.. 1942.. Alankarathatvascha. Language. Enter Subject Of The Book. Unknown. Art. 134 pgs.s. All India Oriental Conference Thirteenth Session Nagapur University October 1946. 369 pgs. Biography. Religion.. Sanskrit.. Alang-kaaramand-ihaara Prathamo Bhaaga. Sanskrit. brahmananda tripathi. Unknown. Alamkaras In The Works Of Banabhatta. 139 pgs. Sanskrit. 1943. Amara Shatakamu. Alankara Sangraha Of Amrtananda Yogin. Alang-kaaramand-ihaara Da~tiiyo Bhaaga. Unknown.. Literature. Geography. Unknown. Unknown. Akaradhanukrmanika.. Sanskrit. Religion. Amarakosa Namalinganusasanam Of Amarasimha. v krishnamacharya.. Unknown. Alang-kaaramand-ihaara Chatura~tho Bhaaga.. Parakaalasvaamii Shriikrxshhnd-abrahmatantra. Language.. 100 pgs. Unknown. Aanandagiri. 1997. 242 pgs.. Theology. 1949.org/…/SanskritIIIT. Sanskrit.. Dr Raj Kumari Trikha. 0. History. 876 pgs. Theology. C. Amara Bharathi Astami Kaksha. Sanskrit. Unknown. 1929. Literature. Sanskrit. Alang-kaaramand-ihaara Trxtiiyo Bhaaga. 338 pgs. Religion. 1996. Misropahvedacharyapandithsrivamshidharshastriyna. Parakaalasvaamii Shriikrxshhnd-abrahmatantra.... 282 pgs.. Alang-kaaramuktaavalii.. 1923. sanskritdocuments. 559 pgs. Lokanatha Chakravarthin.

336 pgs. An Anthology Of The Epics And Puranas. 236 pgs...… 6/167 . 400 pgs. Sanskrit. Unknown. Literature. Sanskrit. 736 pgs. Dr. Amarakosah Dwithiya Khandah. Sanskrit. Kuttakarshiromani.... Ogale Gurunaathaprabhakara. 314 pgs. 1866. Haragovinda Sastri. 358 pgs. Sanskrit.. 168 pgs. Amrau Shatakam.. Amerika Bhaaga Pahilaa.. Sanskrit. 524 pgs.s. V Raghavan.. Language.. Unknown. 388 pgs. 1932. Sri G A V Ms Uppalacharyulu. Language. Sanskrit. Sanskrit.r. 571 pgs. Sanskrit. 709 pgs.aruna Gupta. Anekartha Tilaka Of Mahipa. Unknown. Unknown... Language. 136 pgs. 1984. 168 pgs. Mr.. Narayan Bhatt. 130 pgs. Amarkosha Of Amarsingh.kale. Amarkosh Pratham Kandam. Literature. Sanskrit.. Sanskrit. Sanskrit. Unknown. Unknown. Sanskrit. S K De.. 1939. M.. Religion. Biography. Shriimuraarimishra Mahaakavii. Anandh Samastha Granthavali. Theology.. 375 pgs.. 1864. 1952.. 1999. Anandashramasanskruthagranthavalihi. Sambu Prasad. V. Literature. Annamacharya And Surdas... 1940. Ttd. 239 pgs.. Sanskrit. Dr Ram Naresh Tripathi. 0. Sanskrit. Unknown. Anara~gharaaghavama~ Trxtiiyo San'skarand-ama~. 1998.s... 70 pgs. Nithyananda Parvathiya. pgs. 242 pgs. Prof.. Amelioration Genetique Des Arbres Forestiers Forets 20. sri amar singh. Andhra Bhagvthanuvad. 358 pgs. Amarzakosha Vigraha Comm. Unknown. Anandashram Sanskrith Granthavali Trishtlisethu. 1969. Sanskrit.. History. 300 pgs. Sanskrit.. Anandanandini. Anekaathara~tilaka. Sanskrit.. 1995. Anthya Karmadeepika. Unknown.. Sanskrit. 1979. Shriman Mahadev Chmanji Aftee. Ancient Indian Economic Thoughts.. Unknown. Literature. Sanskrit.. Amarakoshah.. Unknown. Sanskrit. Pandith Haragovinda Sastri. Literature... 0. Sanskrit. Sanskrit. Linguistics.tirupati. 138 pgs.. 1990. Literature. Sanskrit. Sanskrit.. Ananda Ramayana. Sanskrit. Sanskrit. Mahiipa. 1971.. . 194 pgs. 1983. Amhar Vani (sathvi Kaksha)...org/…/SanskritIIIT. 377 pgs. 1961. Linguistics. Anandasundari. 1947. Unknown. 1952. Amarakosa of Amarasimha. Jean Paul Lanly. Unknown. Anandasramsanskritgradhavali. 1993. 258 pgs. Unknown.2/14/2011 A list of scanned Sanskrit books at III… 310 pgs. Mamchala. 1985. Sanskrit. Viswanath Bhatt.. A N Upadhye. 328 pgs. Anekaara~thatilaka. General.. Linguistics... 468 pgs. Sanskrit. Unknown. 1947. 1986.. 1981... Jaganadha Rao.. Sanskrit. Unknown. Unknown. Sanskrit. 305 pgs. Madhukar Mangesh Patkar. Unknown. Arjunavarmadeva. Unknown. Mahiipa.. Amarkosh Namalingaanusasana. Annanda Sramasamskrutha Grandavali. 233 pgs.. 1970. Shiromani Sannidhanam Suryanarayanshastry. 1936. An Introdution To The Grammar Of The Sanskrith Language. Geography... 1955.. Unknown. 745 pgs. Sanskrit. 0. An Anthology Of Subhashitas Part Two. Unknown.. 268 pgs. Chandra Sekhara Sharma. 1947. -.. An Indian In Western Europe. An Anthology Of Poetry And Drama Part I.. 1984.snankarsastri marulkar. 66 pgs. Ramaswarupa Bholanath Pandit...... Anu Bhashya Vallabhacharya Art Sanskrit 1921 495 pgs sanskritdocuments... H H Wilson. Dr V Raghavan. 2000.. Sanskrit.. Unknown.

444 pgs.. Language. Theology. prasanna kumar acharya. Apastambasrautasutra Dhurtasvamibhasya. Unknown.. 0..t. Unknown. Apabhran'shakaavyatrayii. A Chinna Swami Shastrulu. 492 pgs. Unknown. Social Sciences.. Kunj-chanaraaja Chi Dakt'ara~.... Theology. Sanskrit. 1928. 469 pgs. Unknown. Sanskrit. Religion. 158 pgs... Vethanamanom.. Sanskrit.. 540 pgs. sanskritdocuments. Sanskrit. 1924. Unknown. Sanskrit. 1948. 458 pgs.. Sanskrit. 367 pgs. Apastambagrihya Sutra. 552 pgs.. Sanskrit. Anuvaada Kalaa Athavaa Vaga~vyavaharadara~sha. Sanskrit. 2000.... 1924.. Anusuchi.. 0.. 72 pgs. Pandith A Chinnaswami Sastri. History. Unknown... Unknown. Unknown. N Aiyaswami Sastri. 865 pgs.. Religion. Unknown. Sanskrit. Arthvaved Sanhita.. D Srinivasacharya. Asalayina Gruhasutram. 1950.. Sanskrit. Anustana Prakasaha Mahanibandhaha... 289 pgs. Sanskrit.. 1924...2/14/2011 A list of scanned Sanskrit books at III… Anumana Pramana... Anuvrath Vidhya Trishati. 1976. 0. Sanskrit. R Shama Sastry. Sanskrit. 1998. J Jolly. Unknown. Shaastrii Shriichaarudevashaastii. Unknown. Ganapati Sastri. Arthavedatdhasamhitha.. 247 pgs. Ramchandra Sharmane. Swamy Pramodgiri Vedanthkishore. Sanskrit.. 0. 588 pgs. Astadhyayisutrapatha. 1925.. -. 0.. Unknown. Sanskrit.. Unknown. Ardh srimadbagavathardha dharsan vol 1. 1927. Astadasasmrtayah. 346 pgs.. Ved Prakash Shastri.... Vidwan Shivasri. Sanskrit. Ashtadyayi Sutrapaat... Linguistics. Ramachandra Sharma. Popatbhai Ambashankar Mankad. 1955. 469 pgs. 472 pgs. 330 pgs. Ara~tha Shaastra Padasuuchii Dditiiyo Bhaaga. 1989. Shaastrii Shaamaa. Aryavidya Sudhakara. Sanskrit. Arthasastra Of Kautilya. Ashtanga Samgraha. Shaastri Shamaa..org/…/SanskritIIIT. Psychology.. 1955.. 0.. History. Sanskrit. 346 pgs.. Dr Bali Ram Shukla.. 762 pgs. Maharshi Panini. Aprakaashitaa Upanishhadah.. Unknown. 1940. 0. 122 pgs. Philosophy. 1950. Arya Salistambe Sotra. 1951. 262 pgs. 1064 pgs.. 1924. Literature. Ara~tha Shaastra Padasuuchii Prathamo Bhaaga.. Unknown. pgs. 986 pgs. 277 pgs. Ardh Srimadbagavathardha Dharsan. Shaastri Shamaa. Sanskrit.. 1924.. Sanskrit. 1955. Social Sciences. 1931. Sanskrit. 1923. Unknown. 459 pgs. Religion. . .. Sanskrit. Social Sciences... Yajneswara Cimana Bhatta. Aparajitaprccha Of Bhuvanadeva. Sanskrit. Sanskrit. Sripad Damodar Satvalekar. 896 pgs. Sanskrit. Artha Sastra Of Koutilya.. Ashvinao Devtaki Bhoomika. Somraj Krishna Das. Apasthamba Sulba Sutra. . Unknown.… 7/167 . 157 pgs. 0. 1950.. 248 pgs. 280 pgs. Architecture Of Manasara. Sanskrit. Unknown. Jindaattasuurii. Srinivasa Murti.. Sanskrit. Sanskrit.. Unknown. Unknown.. 1986. 720 pgs. 473 pgs. Arya Salistamba Sutra. Sanskrit. Theology. Arthasatra Of Kautilya Vol Ii. Dhamodar. Sanskrit. Ara~thashaastrapadasuuchii Prathamo Bhaaga. Apaharvarma Charita. Unknown. Sanskrit.. Sanskrit.. -..

0. Theology.. Unknown. Sanskrit. Athara~vedasan'hitaa Bhaaga 2. -. 100 pgs. 1895. Religion. Theology. Shri Anand Van Aagadi. 1928. 266 pgs. Atma Purana. Asya Vamasya Hymn. Nakula. 257 pgs. Saayand-aachara~yaa. 1955.. Sanskrit. Ath Sriskande Mahapuranm Vaisnavkhande Venkatachalammahatmay Vol I I. 0. -. 1996.Vivaram-vranam.. 0. 0.Puspam.. Asvasastram. Sanskrit. Bhagavadatta. Sanskrit. Religion.. 666 pgs... Religion.. P.org/…/SanskritIIIT. Theology. 1037 pgs. Pandith K P Aithal. 1644. Atma Praboda. 0.... Theology. saayand-aachara~ya. Literature.... Athavarvediiya Panj-chapat'aalikaa. Unknown. 0. Unknown. Sanskrit. Shri Anand Van Aagadi. Sanskrit. 180 pgs. Atharva Vedha Samhitha. Athara~va Pratishaakhyama~ Prathamogyan' Bhaaga. Ath Koormmahapuranam Prarabhyate.. . 1898. . 214 pgs. Ath Sriskande Mahapurane Shanst Nagar Khand I I I. Religion. Gulab Chand. Jacob G A. Shiva Sharma. Unknown. Religion. sanskritdocuments. Sanskrit. Athara~vavediiyaa brxhatsara~vaanukramand-ika. 1944. 0. Rama Chandra Sharma. 106 pgs. .. Baladevaprasaada.. Dr. 555 pgs. 1956. Unknown. Atharavaanaa Upanishhada Second Edition. -. Religion. Religion. Ath Sriskand Mahapurane Brahmkhande Sethumahatmay Vol I I I. pgs. Unknown. .. Astanu Hrudayam. 0.. Sanskrit. 363 pgs.. 1920. Tira~tha Svaami Ravi. Sanskrit. Ath Srimnmatsyamahapuranam Prarbhyate.. 547 pgs. 0. 0. .... Unknown. Unknown. Sanskrit. Sanskrit.. Ath Shuklayajurvedakavya Samhitha.. Sanskrit.. Linguistics Literature. Theology. 986 pgs. Sanskrit.. .. 288 pgs. 404 pgs... Sanskrit.. 0. Sanskrit. Asvalayaand-a Graha Suutraa Vol I.c.. Somraj Krishna Das. Sanskrit. Atha Tatpurusha Prakaranam. Atha Tatpurusha Prakaranam. 650 pgs. Atha Tatpurusha Prakaranam. Religion.vishnuteertha. 263 pgs.. 0. .. 474 pgs. Atha Gaayatrii Tantra..kunhan Raja. 310 pgs.. 0... Theology. Sri Venkatesho Vijaytetram. 340 pgs. Unknown. Ath Srimaddwaramahapuranam. 234 pgs. 362 pgs.2/14/2011 A list of scanned Sanskrit books at III… Astam. Sanskrit. -..v... .kumaraswamy. 1952. Dr. Ath Sriskanandmahapuranam.. -.. Theology. Unknown. Sanskrit.. Sanskrit. Sanskrit. Sanskrit.. Sanskrit. 0. Unknown.a. Unknown.. 1955.. Religion....… 8/167 . Literature. 520 pgs. Damodar Sathwalekar.. Atmadarsanam. Unknown. 436 pgs. Sanskrit. 130 pgs. Unknown. 594 pgs. 0. Asvalayanagrhyasutra Bhasyam Of Devasvamin. Sanskrit. 1922.. Sanskrit. 1955. 1824 pgs. 668 pgs. Sanskrit. 73 pgs. 1951. Athagreya Mahapuranam.. Atma Purana With Hindi Commentary. Atharva Vedha Samhita Mulya Mantra Sayaye Bhashya Kshiks Kandah. 696 pgs. Theology. Sanskrit. Shaastrii Raamagopaala. Sanskrit. Sanskrit.. Unknown. 562 pgs. 483 pgs. Religion. Ath Vishnudharmottar Mahapuranam. Sanskrit... Sanskrit. Unknown... Ityupaadhidhaarind-aa Ema O Ela. 1996. 867 pgs. Asthadhyayisutrapaath..... 1923.. 1987. Acharya Sri Sitaram Shastri. Literature. Athara~vavedasan'hitaa Trxtiiyobhaagaa. -. Sanskrit.. Theology. 1916. Sanskrit..

Psychology. 0.h. Ratna Ketamkavi.. Aunadikapadarnava.ganga Sagar Rai. 280 pgs.s. sri laxmiramaswami mahabhagavanamu. Sanskrit. Unknown... Sanskrit. Religion... 290 pgs. Sanskrit. Unknown. 1984. Aund-aadikapadaara~nd-avah. Sanskrit. Padhye. Mahaakavii.. Aya Srimadhnrumatrayam. Sri Durga Prasad Divyvedaen.. 442 pgs. Religion. 1922. The Greatness Of Badari Kshetram Or Holy Place. Speyer. 1983. K S Ramamurty. Unknown. J. Theology. Jaikrishndas. Sanskrit.. Chantaamand-i Ti Raa. Sanskrit. Unknown. S. Baktha Mandram.. 52 pgs. Vaachaspathimishraa. Dr.. 1924. 382 pgs. Literature. 1902. 1989. Ayodhyeche Nabaaba. Religion. 1983. Literature. Baapuu Gokhale Yaan'chen' Charitra. Sanskrit.. Sanskrit.bhatt. Sanskrit.. Biography. 1915. 1958. 327 pgs. Bhaaminiivilaasa.. Ayurvedabdhisara Part 1. Sanskrit. Avadanacataka A Century Of Edifying Tales Vol I. Sanskrit. Ayurved Vigyanasar. Language.. 1945. 132 pgs. 1982. Avachedakatvanirukti Of Sri Jagadisha Tarkalankara With Lakshmi Commentary. Sanskrit. Literature. -. 1939. Balaramayana. 1991. Bhaaratiistava Prathaman' Mudrand-ama~. Swami Sri Dharmananda.... Beauties From Kalidas.. 412 pgs. Sanskrit. Unknown.. 1941. Kapaaliishaastrii Ti Vi.. 1986. Unknown. Bhagavadajjukam.. kalluri ahobila rao. Unknown. 1933. G. Literature.. Unknown. 1956..k. Vaidhopahsriparushuramsharma. 51 pgs. Unknown.. 190 pgs. 193 pgs. 432 pgs.. Psychology. 1939. Beejganitham Vol I I I. Dr. Balabharatham Of Agastya Pandita.. Bhaat't'adiipikaa Niviitaanto Bhaaga 1. Theology. 206 pgs. Baismi Parinaya Champu. Chintaamand-ih Ti Raa. Unknown. Philosophy. 602 pgs.. 1939. Geography. Unknown.a. Bhaashhyaara~tha Ratnamaalaa Grantha 75... Shaaligraama Shan'karatukaaraama. Sanskrit.. 324 pgs. Bhaamatii Prathamo Bhaaga. Paarasaniisa Dattatrayabalavan'ta. 674 pgs. 1933.. Sanskrit.org/…/SanskritIIIT. Sanskrit.. Sanskrit. 1927.. 182 pgs.. Linguistics.. 1962... Sanskrit. Raramurthi. Literature.. 146 pgs. Sanskrit. Ayurvedhakandah. Geography.k. 294 pgs.. Sanskrit. 125 pgs.. 1889. Unknown. Unknown. History.. Baoudhagamarth Sangraha... Bhaaminiivilaasa.. Biography. Subrahmand-ya. Avantisundariikathaa. Linguistics... 1935. Pand-ashiikarasan'shodhitaa. Theology. Sri Sankaranarayana. Sanskrit. Theology. 346 pgs.. Sanskrit.. p sri ramachandrudu.. 401 pgs.kunhan Raja. Shriimadatkhand-d'adeva.. Sanskrit.. 1948. 1965. Sanskrit. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Atmarpanastutih. Bakthamala Ramramsikavali. Language. 1054 pgs. Veturi Prabhakara Shastry. Aund-aadikapadaand-ara~va Grantha 7. kaas'inaatha paanduranga paraba. Literature. 480 pgs. Sanskrit. Sanskrit. Bala Bharatam. History. sanskritdocuments. Sanskrit.. 772 pgs. 136 pgs... 1899... Unknown. Sanskrit. 126 pgs.. Religion. Language. C. Linguistics. Philosophy. 1964. 324 pgs. 191 pgs..… Bhagavadgaiitaa Bhaaratiiyadashara~naani Cha Shaastrii Ananta Krxshhnd-a Religion Theology 9/167 .

V S Venkata Ragavacharya. Unknown. Sanskrit. Sanskrit. Unknown. Dikshit.r. Sanskrit. Vacant. Sri Laxmana Sastry. Sanskrit. Theology. Bhattaldankartikaythu.. 0. pgs. Sanskrit. 306 pgs.. 112 pgs. Sanskrit.ramachandra Dikshitar..... sanskritdocuments.. 1968.. Unknown. Sanskrit. Sanskrit.. Sanskrit. 1945. Sanskrit. K Vasudeva Sastri. 1983. Literature... Sanskrit.. 1978. Dr. Bharata Kaumudi Part I. 1887.. Sanskrit. Unknown... Sanskrit. Sanskrit. 798 pgs.n. V. 240 pgs. Sanskrit.jd. M. 1951. 1938. Unknown.. 1952. 589 pgs. 1942. 1959. Unknown.. Dr Radha Kumud Mookherji. Unknown... 1985. Bhatti Kavyam Canto 10.. n gopalapanicker. 1952. Sanskrit. Unknown. Bhatruhari S Neetisataka.. Sanskrit. 1973.. Bhasa's Pratima Part Ii Natakam.. Unknown. Sanskrit. Ananta Deva. Literature.. Unknown. Saradaranjan Ray.. Bhatta Chintamani Tarkapada. 111 pgs.. Sanskrit. 1985. 0. Sanskrit. Venimadhav Sahastri Musalgonkar. Religion. Har Dutt Sharma. Bhasa Ki Sambhandi Thatha Natakiya Visheshathaye. Bhagavatham With Curmikatika Vijayadwaja Tirtha Padaratnavali 1892. Bhatta Dipika Uttarasatka Part I I. General. Bhattalankara Tikayuta. 954 pgs. 1933. Panditraja A Subramanya Sastri.... Kumudranjan Ray. . Sanskrit. Unknown. Unknown. 297 pgs... 442 pgs. 291 pgs.. Unknown.surya Narayana.. Shaastrii Ananta Krxshhnd-a. 0. 0 pgs. S Subramnya Sastri. .... 519 pgs. 1956.. Sanskrit. 510 pgs. Eeshwar Singh.. . Religion. 1921.. 174 pgs..2/14/2011 A list of scanned Sanskrit books at III… Bhagavadgaiitaa Bhaaratiiyadashara~naani Cha. Unknown. Bharatarnava Of Nandikeswara.. Bhatta Dipika(uttrasatka Part I) With The Prabhavali Of Sambhu Bhatta.org/…/SanskritIIIT. Venimadhav Sahastri Musalgonkar. Kumudranjan Ray. 304 pgs. Bharata Natya Darsanam. Sanskrit.r. Bhagavantabhaskara Of Sri Nilakantha Bhatta Vol I I. Bhagavantabhaskara Of Sri Nilakantha Bhatta Vol I. Sanskrit. . Unknown.. Janaswamy Subramanya Shasthri.. Bhas Kee Bhasa Sambandhee Tat(natakeeya Visheshtaem.dasgupta. Bhaismiparinayacampu. Bharatarnava Of Nandikeshwar. 1335 pgs. Dikshit Jd. 712 pgs. 1991.. 1936. . S R Sehgal.. Sanskrit. 1935. Manju. Unknown. Bhakti Chan'drikaa.. Unknown.. Bhagavata Tippani Chalari. Bhaminivilasa. 552 pgs. 252 pgs. Literature. Sanskrit. Matha. 0. 1985. Sanskrit. 512 pgs. 860 pgs. 1981.. 316 pgs. Bhartiya Darshan Ka Itihas. 172 pgs. Bhamti Ekk Adhyayan. S. S. 1942. Sanskrit. Theology. Sanskrit... Bharatiyam Vrttam.. 120 pgs. 383 pgs. Vachaspti Gairola. Unknown.. Bharathi Nirukth Vedh Swarup Darshan.. Unknown. Unknown. 340 pgs. 223 pgs... Art. Sanskrit.… Bhatti Kavyam Canto 11 12 Saradaranjan Ray Vidya Vinoda Unknown Sanskrit 0 280 pgs 10/167 . 165 pgs. Bhasa's Pratima Part Ii Natakam.. 1959. 1938.. Naaraayand-atiira~tha... Bharadvajasiksa. Swetaranyam Narayana Sastriar. Bhasas Balcharitam. 316 pgs. Sanskrit. Literature. Bhagavadgitha Anandatirtha.. Bharathiy Darshan Me Parivarthan Ka Swarup Vishestha Boudd Darshan Ke Sandarb Me... 1944. 518 pgs. 1921.

Sanskrit. sri ranga ramanujamuni. 1856. 212 pgs. Vacant. Sanskrit. Sri Girijadayalu Shukla. V. Bhramara Sandesa. Literature. 1903. Bibliotheca Buddhica Vol Vii Nyayabindu. Unknown. 1987. Unknown.. 1962... 1987. Bibliotheca Buddhica Vol Vi.. Sanskrit. 1991..rose.rajendralala. 388 pgs. Bhava Prakasika.. Sanskrit.. 0.. 108 pgs. Unknown. Bibliotheca Indica Volume 3.. 135 pgs..... Bhedojjeevanam. Unknown.rajendralala. 1959.. 1991.. -. 1951. M. 580 pgs. 120 pgs.. Sanskrit.. Sanskrit. Dwaita Philosophy.. Unknown.. 434 pgs.. Bhelsanhita. Philosophy. Sanskrit. -. 636 pgs. 2003. Bheda Vidya Vilasa. Vacant. 1987. Bibliotheca Indica Volume 31 1. Sanskrit. Geography. Language.. 580 pgs. Sanskrit. Sanskrit. Vijnana Bhikshu... Bhavprakashnidhantu. 185 pgs. Sanskrit. 320 pgs. Unknown. Geography. Sanskrit. Literature. 362 pgs. 1854. Bibliotheca Buddhica V. Vasudeva Sharman. Bhattikavya Of Bhatti. Sanskrit... Bheda Ratnam. Sanskrit. Bodhaikyasiddhi Prathamo Bhaaga. Bibliotheca Indica Volume 71 4. Sanskrit. 0.. 301 pgs. Unknown. Sanskrit.. Bibliotheca Indica Volume 45 1. Bhoja.. 0. Biblotheca Indica.. Bheddo Jevana Of Sri Vyasaraja.. Literature. Sanskrit. Sanskrit. M.. Tirumala Charya. 504 pgs. Sanskrit. 1959. Geography. Sanskrit. Literature. 1995.. Literature. Venkataramana Reddy. M. Bhavya Bharatham. Sanskrit. 1980. Geography. 1934.. 984 pgs. Linguistics.. Sanskrit. Bibliotheca Indica Volume 71 5.. C Lakshmi Kantaiah. 60 pgs. Sanskrit. Bibliotheca Indica Volume 27. 0. Prahladacharya. Sanskrit. Achyutaraaya. Sanskrit. 0. 576 pgs. Sanskrit. Geography. 722 pgs.rajendralal. 646 pgs....2/14/2011 A list of scanned Sanskrit books at III… Bhatti Kavyam Canto 11 12.... 220 pgs... pandit sri bhramha shankara misra.. Sanskrit. Bibliotheca Buddhica Vol Vvxx.. Sri Vyasaraja Tirtha. Sanskrit. 1983. Bhavaprakasa Of Bhavamisra...org/…/SanskritIIIT. 422 pgs. 1954... Vijnanabhikshu. 1945. E.. Unknown.… 11/167 . 280 pgs. Philosophy. Bhushanasara Samiksha Part Ii... Unknown.. 294 pgs.. 90 pgs. 968 pgs. Psychology. Sri Govind Das. Unknown..rajendralal. Bhoja Prabanda Of Ballala. Sanskrit. R Nagaraja Sarma. Bhoja s Samaarangana Suutradhaara Vol I. Narayana. Ramakrishnamacharya K. Geography. 1918. M. Geography.. 220 pgs. Maheshchandra. Unknown. 134 pgs.. 1987. 640 pgs.. Kavikarnapura.. Bibliotheca Indica Volume 71 1. 1998. 50 pgs. 122 pgs. 1980. Sanskrit. Bhuhgoghatharangani. M. 540 pgs. 1949. 1992. -. 1933. 1981. Saradaranjan Ray Vidya Vinoda.. 0. Unknown. Y Mahalinga Sastri. 134 pgs. -. Bhesajya Rathna Vathni. V. Geography.. Balvanth Singh.. Bhedojjivana Of Sri Vyasaraja. Bibliotheca Indica A Collection Of Oriental Works. Geography. 1980. Bibliotheca Indica Volume 71 2. Sanskrit.rajendralal. Unknown. Sanskrit.. Unknown.. Bibliotheca Indica Volume 4.rose. Unknown. Sanskrit... Bhupala Mandanam Of Devasri Narada. 0.. Gopinath Kaviraja. Sanskrit. sanskritdocuments. Late Vinayak Narayan Shastri Vasudev Laxman Shastri. E.. 830 pgs.. 557 pgs. 66 pgs.. Unknown. Sanskrit.

.. R. General. Sanskrit. Unknown. Unknown. Sanskrit. 336 pgs.ananthacharya. 286 pgs. Sanskrit.. 0. 1832.s. Sri Madra Dwapayamuni. 1941. 1992. Sanskrit. Brahma Sphuta Siddhanta Vol.. Ram Swapup Sharma. . Sanskrit. Unknown. 740 pgs.. Brahmasutra Bhasyamsahithayatham Thathvaprakasika. Philosophy. Sanskrit.. 95 pgs. Brahmasutrabhasya Vol 1. Brahmasutrabhashya. 1950.. Khemraj Sri Krishnadass... 890 pgs.. Religion. 586 pgs.. Brahmasutras And Dasasloki. ... Geography. sanskritdocuments.. Sanskrit. 708 pgs. Unknown. 1927. 1904... Unknown.. Sanskrit. Shankar Shastry Venegavakar. Sanskrit. Unknown. Language.. Unknown. Sanskrit. Sanskrit. 1980. Brahma Vaivartha Puranamu Vol 1. 1906. Unknown.. R. 584 pgs... 1982. Brahmasutra Bhashya Of Sri Madhvachrya. Sanskrit.. P L Vaidya..2. Pandurangatmaj Kashinath Sharma. Somraj Krishna Das. Brahmasutras. 644 pgs. 448 pgs. 402 pgs.. Sanskrit.. Bhaapat'ashastrii Vishhnd-uvaamana. Physical Fitness. 200 pgs.. Sanskrit. 334 pgs. Unknown. Sanskrit... 1937. Sanskrit.. 1966. Laxman Shastri Pansikar. Sanskrit..org/…/SanskritIIIT. Sanskrit. 762 pgs. Brahmanda Puranam. 0... 222 pgs. Not Available.. 1944.....tatvaprakashka1. Pandit V. Sanskrit. Brahmasutra Bhasyamsahithayatham Thathvaprakasika. 750 pgs. 88 pgs. Natural Sciences. R Antoine.rama Sastri. 1911. Sanskrit. Acharya Mandanmisra. Acharyavara Ram Swarup Sharma. Brahmasutra Bhashya. 505 pgs.s. Unknown..sampurnananad. Sanskrit.. Unknown. Brahaspatismrti. Sri Vijayeendra Tirtha.. 779 pgs. Book Of Exercises Part I. Sanskrit. 584 pgs. 1960. . Sri Narahari with a Commentary by the Author's Pupil Pandit Divakar. Bodhicharya Vatara Of Santideva. Bodhayana Grihya Sutram. Sanskrit. Sanskrit. 600 pgs.s. 0. 586 pgs. sathyanarayan tripati. 1979. 1915. 372 pgs. 0.panchamukhi... Brahma Sphuta Siddhanta Vol Ii.. 1966.. Unknown.. 661 pgs... Brahmachary Vishnu. Unknown. Brahdaranyakopanishath Vol-liv. 536 pgs. Archaryavara Rama Swarup Sharma.. 168 pgs. Brahmasutrashaariirabhashhyaara~tha Bhaaga tiisara. Unknown. Unknown. Brahatstotraratnavali Vol I.srinivasacharya. P. Literature.panchamukhi.. 0. Unknown.. Brahma Suutraand-i Grantha 67. 462 pgs. Brahma Vaivarth Eak Pradyayan.. 1953.. Brahama Sphuta Siddhanta Vol Iii. 1966.. 0.. Brahmanda Purana Of Sage Krsna Dvaipayana Vyasa. Religion. Unknown. Arka Somayaji. 0. K V Rangaswami Aiyangar... 329 pgs. Brahatkatha Manjari. Brahma Sutra Nyaya Sangraha. Theology. Unknown. Bodhicaryavatara. Unknown. Unknown. 18 pgs.s. L. 452 pgs. Sanskrit. 1925. Linguistics. Sanskrit. Sanskrit.… 12/167 . Sanskrit.. Brahmasiddhi.. Sanskrit. 758 pgs. Sanskrit. Brahma Sphuta Siddantha Vol I. 1966..tekct..nene.. 486 pgs.. Sanskrit. J L Shastri. Dr.2/14/2011 A list of scanned Sanskrit books at III… Bodhasara a treaties on Vedanta. G. Religion.. 1937. Brahmasutravrtti Mitaksara Of Annambhatta. 1973.2. Unknown. 0. Sanskrit. Theology... 1980.. I. Brahma Sphuta Siddhanta Vol 4. Brahma Sphuta Siddhanta Vol 3. 1965. Sanskrit. Brahma Sutra Dwithiya Bagamu. Brahmanjali Nam Parameswararpitha Slokamalika. 326 pgs. Ram Swarup Sharma. Unknown. shri bramha gupta.

Brahmavaivatar Puraand-ama~. 56 pgs. Sanskrit. 1935. Franklin Edgerton...books at III… Brahnni Ghantu Ratnakar Vol V I.. Prabhaakaramishra. Theology. Bruhaddevagnanaranganam... Stcherbatsky. Religion.. 600 pgs.. sanskritdocuments. Sri Krishnadas Aatmajain Ganga Vishnuna. Buddhist'a T'eksat'a Ashokaa. Religion. Bruhat Samudrika Sastramu.. 190 pgs.. Braj Bakthi Vilas.. Unknown. Max Walleser... Maraat'he Vaasudeva Shaastrii. 1935. 503 pgs. Sanskrit. Sanskrit.. 580 pgs. Brxhatii Prabhaakaramishraprand-iitama Da~tiiyo Bhaaga... Religion. 614 pgs. 86 pgs. .. 1986. 1992. Sanskrit. Brihadaranyakopanishad Bhasya Part 1. A list of scanned Sanskrit. Brahmavaivarta Puranam.. Brahmavaivara~tapurand-ama~ Dditiiyo Bhaaga Grantha 102. Sanskrit. Brahmavaivarta Maha Puranam.. General. Sanskrit. 334 pgs. Religion. Theology. Sanskrit. 0. 206 pgs.. Dr. 0. Vira Raghavachaya. Brxhadaarand-ya Kopanishhadabhaashhya Vaara~tikama~ Prathamo Bhaaga Grantha 16. Upanishads.. 0. Sanskrit. Theology.. 0.. Buddhist Hybrid Sanskrit Reader. Sanskrit. Theology. Sanskrit.. Sanskrit.. Buddhist Logic Vol 1. Sanskrit.org/…/SanskritIIIT. Sanskrit.. 0. Unknown.. Sanskrit. Aapat'e Vinaayaka Gand-esha..… 13/167 ... . Religion. Sri Krishnalal Thanaya Datt. Unknown. Sanskrit. Bruhajjyothi Sarnava (mirra Skandha) Hari Krishna. pg Brahmavaivara~tapuraand-ama~ Prathamo Bhaaga Grantha 102. 616 pgs. Religion. Buddhist Technical Terms... Unknown. 1867. Sri muralidhar. Sri Krishna Das Satmaj Gangavishnu. 753 pgs. 396 pgs. 268 pgs. Sanskrit. 216 pgs. 0... Unknown.. 0..... . Religion. 914 pgs. 437 pgs.. Sanskrit. 260 pgs. Sanskrit. Shaastrii Kashiinaatha. Sanskrit. Brahmavaivatara~purand-ama~ Ddvitiiyo Bhaaga Grantha 102. Brxhadaarand-yakopanishata~.. Religion.Bhashya. Theology. Philosophy. Bruhanigantu Rathnakara Panchama Bagh. -.. 880 pgs. Sanskrit.. Pandit Ramgopal Shastri. Psychology. . 1953.. Unknown.2/14/2011 .sharmistha Sharma. 1954. Brihat Sarvanukramnika Of The Atharva Veda. Brxhatii Prabhaakaramishraprand-iitaa Prathamo Bhaaga. 503 pgs. 1885. 463 pgs. 1886. Brhadaranyakopanishad Bhasyam.. 214 pgs. 926 pgs. Language..... 282 pgs. Unknown. Bhat't'achaara~yaa Vidhu Shekharaa. . 0. Brhadavanyaka Bhava Botha.. Gand-esha Vinaayaka. 1937. Brahnnighantu Ratnakar Vol I.t. 1954.. Literature. Sanskrit. 385 pgs. Somraj Krishna Das.. Bruhadh Hodachakra vivaranamulu. Sanskrit.. . 1994. . 1953. Unknown. Religion. 457 pgs. Sanskrit.. 1936. Theology. Sanskrit. Srilnarayana Bhatta Goswami. Sanskrit. . 225 pgs. Sanskrit. 1935. Theology. 0. 1934. Chaara~ya Matsureshvaraa. . Sanskrit. Theology. Buddhist Avadanas.. Philosophy. Brihadaranyakopanishad . 1922. 351 pgs. T Veeraraghavacharya. Brhajjatakam Bahotpala Tika. jyotirvdaya datta. 1980.. Sanskrit. Kenjiu Kasawara. 1992. Sanskrit. Unknown. Unknown.. 110 pgs. 457 pgs. Theology. Linguistics. Sanskrit. Theology. Aapat'e Vinayaka Gand-esha.. Unknown. 1935. Religion. Buddhapalita Mulamadhyamakavrtti. Prabhaakaramishra....

2/14/2011

A list of scanned Sanskrit books ,at III… y g

gy

,

1948. 73 pgs. Budhabhushhand-ama~... Shambhu Shriimada~, Philosophy. Psychology. Sanskrit, 1926. 132 pgs. Budhabhushhnd-ama~... Shriimachchhan'bhunrxpa, Philosophy. Psychology. Sanskrit, 1926. 132 pgs. Bugusamhita Mahashastra Palitha Kanda... , . Sanskrit, 0. 613 pgs. Bugusamhitargata Yogavali... Somraj Krishna Das, . Sanskrit, 0. 343 pgs. Calcutta Sanskrit Series... Pandit Amareswar Thakur, Unknown. Sanskrit, 1934. 830 pgs. Camatkarachandrika Of Visvesvarakavichandra... Dr P Sri Rama Murhy, Unknown. Sanskrit, 1969. 270 pgs. Canakya-caritam... Dr.thakur Prasad Mishra, Unknown. Sanskrit, 1981. 180 pgs. Candravyakarana Of Candragomi... K C Chatterji, Language. Linguistics. Literature. Sanskrit, 1953. 360 pgs. Carudattam Edition I I... C R Devadhar, Unknown. Sanskrit, 1943. 136 pgs. Catalogue Of Sanskrit Pali And Prakrit Books Vol-i... -, Unknown. Sanskrit, 1951. 354 pgs. Catalouge Of Sanskrit Parakrit Manuscripts Vol 3... Muniraja Sri Punyavijayajit, Unknown. Sanskrit, 1968. 368 pgs. Chaitanyachandroday Naam Natakam... Sri Rajendra Lal Mitrena, Unknown. Sanskrit, 0. 294 pgs. Chamatkaar... Dr Krishna Lal, Unknown. Sanskrit, 1985. 112 pgs. Chamatkara Chintamani... bhatta narayana, Unknown. Sanskrit, 1964. 550 pgs. Chanakyasuthram Part 1... Pandit Vijendermisra, Unknown. Sanskrit, 0. 48 pgs. Chandas Sastram... Sri Pingalacahrya, Unknown. Sanskrit, 2002. 321 pgs. Chandha Shastramu... Sri Pingali Nagh, Unknown. Sanskrit, 0. 326 pgs. Chandogya Panisad Bashyam Pradhama Bagamu... Sri Ranga Ramanuja Muni, Unknown. Sanskrit, 1952. 546 pgs. Chandogyopanishad... Sri Ranga Ramanuja Muni, Unknown. Sanskrit, 1952. 596 pgs. Chandologyopanishad... Venkata Subramanyam Sastri.m, Ayurveda. Sanskrit, 1924. 939 pgs. Chandrapeeda Katha... Pandit V Ananthacharya, Unknown. Sanskrit, 1946. 90 pgs. Chandraprabha Charithramu... P.amruthlal Jain, Unknown. Sanskrit, 1954. 34 pgs. Chandrika Sahitha Kuvalayananda... , Religion. Theology. Sanskrit, 0. 328 pgs. Charak Saheta Vol 3... Sri Narendrasen Gupt, Unknown. Sanskrit, 0. 664 pgs. Charaka 1... -, Unknown. Sanskrit, 0. 502 pgs. Charaka 5... -, Unknown. Sanskrit, 0. 626 pgs. Charaka Samhita 3... -, Unknown. Sanskrit, 0. 326 pgs. Charaka Samhita 6... -, Unknown. Sanskrit, 0. 534 pgs. Chaturdashalakshani With Didhiti,didhitiprakashka,vivarana... N.veejhinatha, Indian Logic. Sanskrit, 1997. 867 pgs. Chhaandogyopanishhata~... Upanishhata~, Religion. Theology. Sanskrit, 1952. 549 pgs. Chhaandogyopanishhata~ Grantha 14... Aapat'e Vinaayaka Gand-esha, Religion. Theology. Sanskrit, 1934. 539 pgs. Chhaandogyopanishhata~ Grantha 79... Nityaananda, Religion. Theology. Sanskrit, 1915. 223 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Chhanda Shaastrama~

Chaara~ya Pin'galaa Language Linguistics Literature Sanskrit 1950 272

14/167

2/14/2011

A list of scanned Sanskrit books at III… Chhanda Shaastrama ... Chaara ya Pin galaa, Language. Linguistics. Literature. Sanskrit, 1950. 272 pgs.

Chhatrapatisan'bhaajii Mahaaraaja... Rangand-ekara Keshavaman'gesha, Geography. Biography. History. Sanskrit, 1950. 86 pgs. Chidgagana Chandrika... Kalidas, Unknown. Sanskrit, 0. 208 pgs. Chitra Champu... sriram charan, Unknown. Sanskrit, 0. 146 pgs. Chitra Prabha... Bhagavata Hari Sastri, Unknown. Sanskrit, 1932. 480 pgs. Chitrasenapadmavati Charita... Mulraj Jain, Unknown. Sanskrit, 1942. 98 pgs. Chittavishuddiprakarand-a... Aara~yadeva~, Religion. Theology. Sanskrit, 1949. 147 pgs. Chrak Samhitha Part 2... -, Unknown. Sanskrit, 1950. 568 pgs. Chytanya Nandanam... Nistala Subramanyam, Unknown. Sanskrit, 1987. 170 pgs. Cikitsa Of Srinivasa... sri s venkatasubramanya sastri, Unknown. Sanskrit, 1953. 414 pgs. Cikshasamuccaya... Canti Deva, Unknown. Sanskrit, 1992. 494 pgs. Cola Campu Of Virupaksa... T Chandra Shekaran, Unknown. Sanskrit, 0. 90 pgs. Collected Papers Of Manavalli Ramakrishna Kavi... P S R Appa Rao, Unknown. Sanskrit, 1986. 340 pgs. Critical Study Of Vedarthasangraha... t v raghavacharyulu, Unknown. Sanskrit, 1989. 250 pgs. D'a Had'agevaara Charitra... Paalakara Naaraayand-ahari, Geography. Biography. History. Sanskrit, 1882. 538 pgs. Da Aara~ya Shatakama~... Shriimadappayyadiiqs-ita, Philosophy. Psychology. Sanskrit, 1944. 72 pgs. Da Ethimalojiisa~ Apha~ Yaska... Vara~maa Siddheshvara~vara~maa, Language. Linguistics. Literature. Sanskrit, 1953. 272 pgs. Da Jaataka Maalaa Prathama~ Bhaaga... Aara~ya Kuuraa, Philosophy. Psychology. Sanskrit, 1943. 279 pgs. Da Katuhsataka Dvitiya Bhaaga... Ara~yadeva~, Religion. Theology. Sanskrit, 1931. 344 pgs. Da Mahaabhaarata Sabhaapara~va... Vishhnd-u Esa~ Suktaankara~, Language. Linguistics. Literature. Sanskrit, 1943. 217 pgs. Da Saundarananda... Ashvaghosha, Philosophy. Psychology. Sanskrit, 1928. 200 pgs. Daa. Ketakara Vyaktti Aand-i Vichaara... Ketakara Shriidharavyan'kat'esh, Geography. Biography. History. Sanskrit, 1955. 216 pgs. Daivat Sanhita Vol-3... Sripad Damodar Saatvalekar, Unknown. Sanskrit, 1948. 284 pgs. Daivata San'hita Prathama Bhaaga... Shriipaada Daamodara Saatavad'ekara bhat't'aachara~ya, Religion. Theology. Sanskrit, 1941. 987 pgs. Daivata San'hitaa Bhaaga 2... Saatavalekara Sriipaada Vasan'ta, Religion. Theology. Sanskrit, 1943. 923 pgs. Dandanitiprakaranam... V S Bendrey, Unknown. Sanskrit, 1943. 144 pgs. Daqs-ind-achyaa Mdhyayugiina Itihaasachi sadhane Khan'd'a 2... khera~ Gand-eshaharii, Geography. Biography. History. Sanskrit, 1934. 119 pgs. Dara~sha Puura~nd-a Maasa Prakaasha Prathamo Bhaaga Grantha 93... Daad'ekaro Sarasvatii Bhushhand-a, Religion. Theology. Sanskrit, 1924. 652 pgs. Darsan Ka Prayojan... Bhagvan Das, The History Of Philosophy. Sanskrit, 1987. 312 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Das Gopatha Brahmana

Dieke Gaastra Unknown Sanskrit 1919 360 pgs

15/167

2/14/2011

A list of scanned Sanskrit books at III… Das Gopatha Brahmana... Dieke Gaastra, Unknown. Sanskrit, 1919. 360 pgs.

Das Purana Pancalaksana... Wllibald Kirfel, Unknown. Sanskrit, 1927. 664 pgs. Dasa Charitam... Sri Sailusuri, Unknown. Sanskrit, 1989. 232 pgs. Dasapadyunadivrtti No 81... Dr Mangal Deva Shastri, Unknown. Sanskrit, 1943. 578 pgs. Dashaa Kumaaraa Kathaa Saaraa... Appaayaamatya, General. Sanskrit, 1949. 39 pgs. Dashopanishhada Grantha 106... Maarulakara Shan'kara Shaastrii, Religion. Theology. Sanskrit, 1937. 227 pgs. Dasopanishadas Vol 1... C.kunhan Raja, Unknown. Sanskrit, 1935. 520 pgs. Dasopanishads Vol Ii... The Pandits Of The Adyar Library, Unknown. Sanskrit, 1936. 644 pgs. Dasopanishads Vol-1... C.kunhan Raja, Upanishads. Sanskrit, 1935. 519 pgs. Dasopanishads With The Commentary Of Sri Upanishad-brahma-yogin... C.kunham Raja, Upanishads. Sanskrit, 1936. 518 pgs. Dasopanishads With The Commentary Of Sri Upanishad-brahma-yogin... G. Achari, Art. Sanskrit, 1936. 518 pgs. Dathu Rathnakara... Sri Madwi Jayalavanya Soori, Unknown. Sanskrit, 0. 348 pgs. Dattakamiimaan'saa Grantha 116... Nanda Pand-d'ita, Religion. Theology. Sanskrit, 1954. 379 pgs. Dattapuranam... Swami Vasudevananda Saraswathi, Unknown. Sanskrit, 2004. 736 pgs. Descriptive Catalogue... K.s.ramamurthi, Upanishads. Sanskrit, 1993. 111 pgs. Descriptive Catalogue Of The Government Collections Of Manuscripts Jaina Literature And Philosophy Vol Xvii... Harilal Rasikdas Kapadia, Unknown. Sanskrit, 1954. 330 pgs. Descriptive Catalogue Vol I... Dr.k.s.ramamurthi, Religion. Sanskrit, 1993. 222 pgs. Deshabhakta Krxshhnd-aajii Prabhaakara Uura~pha Kaakaasaheba Khaad'ilakara Charitra... Khaad'ilakara Kaashinaathahari, Geography. Biography. History. Sanskrit, 1949. 428 pgs. Deshabhaktta Saahityasamraat'a Narasin'ha Chin'taamand-a Kelakara Yaan'chyaa Aat'havand-ii... Baapat'a Sa Vi, Geography. Biography. History. Sanskrit, 1945. 680 pgs. Deshii Naama Maalaa Dditiiya Khand-d'a... Hema Chandraa, Religion. Theology. Sanskrit, 1938. 523 pgs. Deshiinaamamaalaa... Hemaachandraa, Language. Linguistics. Literature. Sanskrit, 1938. 525 pgs. Devalaya Grama Mahatmyam... Balachandra Kavishvar, . Sanskrit, 1827. 277 pgs. Devanandamahakavya of Sri Meghavijayopadhyaya... Pandit Bechardas.j. Doshi, Unknown. Sanskrit, 1937. 102 pgs. Devatadhyaya Samhitipanisad Vamsa Brahmanas With Commentaries... Ballikoth Ramachandra Sharma, Unknown. Sanskrit, 1965. 270 pgs. Devatadhyaya Samhitopanisad Vamsa Brahmanas... B Ramachandra Sharma, Unknown. Sanskrit, 1965. 264 pgs. Devendra Mahakavyam... P.bhochardas Jeevraj Desi, Unknown. Sanskrit, 0. 114 pgs. Dhaara~mikavimara~shasamuchchaya... Bhaaratii Svaami Vidyashan'kara, Religion. Theology. Sanskrit, 1944. 237 pgs. Dhaatukoshaa... Shaastrii Baahuballabha, Language. Linguistics. Literature. Sanskrit, 1912. 288 pgs. Dhanyaalokaa... Chaara~ya Aanan'davaradhana, Language. Linguistics. Literature. Sanskrit, 1937. 149 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 16/167

1935... 86 pgs.. Sanskrit. Dharmakosa Vyavaharakhanda. Religion. Sanskrit. Dhaturoop Sangraha. Dharma Kosah Vyavaharakanda Vyavaharamatrka Vol 1 Part 1.. Dura~daivii Mohare. Sanskrit. Unknown. Dhatvarthavijnanam. Sanskrit. Unknown. Sanskrit. 1949. Dhathuratnakarah Shasthi Vibhagah. Sanskrit... Charandas Shastry. 56 pgs.... Theology. Aapat'e Gand-osha Vinaayaka.. Sanskrit. Unknown. 674 pgs. 211 pgs... Biography. 167 pgs.. Geography.. 0.v. Unknown.. Sanskrit.. Sanskrit. Dr. Docrichikitsarnava. Dutadangand. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Dhara~ma Bin'duu. Dhara~matattvanind-ara~ya Prathamaa Bhaaga 1. 424 pgs.. Religion. Dvadashan' Pushhpama~. Khemraj Shri Krishnadas. laxmanshastri joshi. Sanskrit. Sanskrit. Dura~gaa Pushhpaanj-jali Grantha 22. Dhwanyalok Rahasyam Prashnouttari. Sanskrit. Unknown. Dhavnalokha. Laxmansastri Joshi. Sanskrit. Sanskrit.. 552 pgs.. Theology. 1937. 1914..l. 117 pgs.. Dharmasindhu..bhagiratha Prasada Triputhi Vagisa Sastri.. Unknown.… 17/167 . History. 0.. Ddivedii Dura~ga Prasaada... 1980.. Unknown. 216 pgs... 166 pgs. pandit feroz phamaji.. Religion. Unknown. K. Sanskrit. laxman shastri joshi. Sanskrit.. History. Geography... Dhvani Vicara. 388 pgs. N G Kalelkar. 294 pgs... Unknown. Sanskrit. Sanskrit. 120 pgs.. 320 pgs. 1955. Theology.. 212 pgs. Laxmana Shastri Joshi. Sanskrit. 1940.. Unknown. 1942. Unknown. Lelegan'gadhara~ Vinaayaka~. 0.. Unknown.sastri. -. Sanskrit. Unknown... Shriivasudevaanan'da~. Vaidy Jadwaji Trikamaji Acharya. 146 pgs. Sanskrit. Sanskrit. Sanskrit. Biography. 214 pgs. Dilkush Untasdi Gayaki Prathama Bhag. Religion. Dr Nagendhra. Sanskrit.. Dhavnyaloksar. 1929. vadilal bapulal shah. 1872.... Sri Purshoutam Sharma Chaturvedi. Unknown. 156 pgs. Dvadasaranaya Chakra Of Sri Mallavadisuri Vol 1. 1950.. 1950.. 0. 1952. Religion.. 1977. sanskritdocuments. Dharmikvimarsamuchya Vol I I. Draahmaayand-a Grxhma Suutravrxtti Grantha 74. 1952. Unknown. Theology. Sanskrit. 1954. Gokhale. Dhara~matattvanind-ra~ya Parishishht'ama~ Bhaaga 2.. 109 pgs.. 528 pgs. 0. 352 pgs. Theology. Unknown. Sanskrit. Pandith Sri Shobhit Mishra.. Unknown. 1953. 2001. Hari Bhadraa. 0.org/…/SanskritIIIT. 415 pgs. 1941. Pandith Marulkaropahvanar Hari Shastry. 463 pgs. Unknown. Sanskrit. 1946.. Dravya Gun Vignan Purvardhamu. Sanskrit. Late Munichaturvijayaji. 76 pgs. M L Jacks. 544 pgs. Thakur Udaya Narayana Singh.. Educationas A School Social Factor. Sr Madananthram Shastry Vetalen. 1937. Aapat'e Gand-osha Vinaayaka. 232 pgs. 764 pgs. Dharmakosa Upanisatkanda Vol 2 Part 2.. Khem Raj Krishna Das. Sanskrit.. Dr C Kunhan Raja Presentation Volume. 1954.. Religion. Dhaturupa Manjari. 182 pgs. 145 pgs. Joshii Prahlaadanarahara. Unknown. 860 pgs. Unknown.. Sanskrit. Dharmakosa Upanisatkanda Volume 2 Part 4. 1950.. 1935. Theology. Dina Visheshha. Drahyana Grihya Sutra.. Unknown..

.. Unknown. Sanskrit. Linguistics. Sanskrit. 1801.org/…/SanskritIIIT. Srimath Paramhans Parivrajakar Chary Brahmanisht Loksangrahi.. Religion. Sanskrit. Unknown. Eeshopanishanthu. 2001.V I I I. Sanskrit. Unknown. Philosophy. 490 pgs.… 18/167 . Literature. 1950. Krishana Gi Parisharam Bide. Unknown.padmanabhachrya Chitaguppa.. Ganesa Purana. S..r.. 253 pgs.. Bhasara~vajnaa Aacharaya~.sreekrishna sarma. Sripati.... 1920.. Unknown. Sanskrit.. Ganatiya Kosh. Literature.. Language. Geography. Garuda Puranam. P L Vaidya. Religion. E.. 96 pgs. -. Sanskrit.. 1949.... Sanskrit. 1981.. Sanskrit.. 561 pgs. Gaadadhari Vol Ii. -. Sanskrit. 78 pgs. 470 pgs. Kelakara Chin' Na. Ganitatilaka. 1937.. Veeraragava Achariya. Sanskrit. Raamataarand-a. 1975. Sanskrit. Gaja saastram of paalakapya muni. Sternbach Ludwik. 152 pgs. Theology. 82 pgs.. Unknown. Unknown. Sanskrit. 542 pgs..j.. Sanskrit. Gandavyuhasutra.. Linguistics. Unknown. Unknown. 2000. 177 pgs. Sanskrit. mahadeva deshiah. 1933. Social Sciences. 214 pgs... 106 pgs.. Ganesh. Dr. Gand-adara~pand-a Shhashht'ha San'skarand-ama~. Sanskrit.... 1939. Psychology. Gangavaratana.. Sanskrit. T. Sanskrit. . Sanskrit.tadpatrikar. Language. 0.. Theology.. 383 pgs. Sanskrit. Somraj Krishna Das.. Unknown. First Lesson In Sanskrit. 0. 0. 1958. Unknown..r. Gajasiksa.. 670 pgs. 1920.. Linguistics. Dr P Sriram Chandrudu. subrahmanya sastri k s. Unknown. Sanskrit.. Unknown. Exercises in sanskrit translation. 94 pgs. Unknown. History. 360 pgs... Garuda Maha Puranam Of Sri Vedavyasa Mahamuni.r.. Gadhy Padhy Mala Chaturth Kusumam Vol I.. P. 1987. 418 pgs. Dr.k ramachandra aiyar.. 1954. Gaud'apaadoyama~ Aagamashaastrama~.n. 348 pgs. . Gatagoshha~t'i Arathata~ maajhii Jiivana Yaatraa... Unknown. 0...brej Mohan. 534 pgs. 206 pgs.. Unknown. -. 1968. Dr. Unknown... Sampurnanand.. Sanskrit. Eethi Sriskande Mahapuranam Prabhaskhand. Sanskrit. Gand-ikaa Vrxtta San'grah Khand-d'a 1 Grantha Maalaa 4. Sanskrit. 1975. 226 pgs.. 0. Gajasiksa. Unknown. 1953. Ekavali Of Vidhydahra. Sanskrit. naradamuni. Gajagrahana Prakasa. Sanskrit. 1916. 2004.. Gaekwad's Oriental Series..ramaji Malaviya..2/14/2011 A list of scanned Sanskrit books at III… Eeshavasya Upanishad I. Sanskrit. Biography. Pandit Kedaranatha Sastri. Sree Krishna Sarma E. Tantras. Gajasiksha. Bhattacharya. 1992. Gautamiyamahatantram. Sanskrit. 490 pgs. Narayana Dikshita. 1867. 140 pgs. Sanskrit. 1975. Gandhi Gita. 1960.. Sanskrit. Sanskrit. Unknown. Gand-akaarikaa.ballantyne. Literature.. Sanskrit. Unknown. Gananeshwari. 707 pgs.. 116 pgs. 96 pgs.. 1968. 90 pgs. Gaud'ayaada.. 702 pgs.. Language. sanskritdocuments. Unknown. 1084 pgs. 0. 100 pgs. Esevyopanishad Bhashyam. 130 pgs.

Gruha Vidhan.. Sharma.. Sanskrit.. 116 pgs.m.. Unknown. Gudhartha Dipika. Dr Nalinaksha Dutt. Sanskrit. 1985. 320 pgs. . Sanskrit.. 512 pgs. Religion. 186 pgs. Geetha Dharm Chandogyaupanishad Vol Ii. Dr. 256 pgs. Glimpses Of Buddhist Culture In India..... 1942. 1990. 1932. Dr. Aacharya baskaranand lohini.sampath Kumara Charya.r. 0..aryendra Sharma.. Nalinaksha Dutt. 507 pgs. 1908. Rajendra lal Mithra..s. Sanskrit... Unknown. 219 pgs. 1952.. 1939.Bhashya. 244 pgs..n.. Gopath Brahmana Of Atharva Veda. Gilgit Manuscripts Vol Iii Part Ii.. Krishna Yajurved. Unknown. 1969.. Sanskrit. Unknown.. 322 pgs. Unknown. Gopala Sahasranama Stotram. Unknown. Sanskrit. 174 pgs.. Sanskrit. Sanskrit. veerendrarai chandra shankar mehatha.l.. 184 pgs. 186 pgs.. Sanskrit. Sanskrit. Sanskrit.. Religion. Sanskrit.. Unknown..… Religion Theology Sanskrit 0 1049 pgs 19/167 . Guruparampara Charita With Comm sanskritdocuments. Gita Samiksa.. Sanskrit. 1934. 246 pgs. Goladyay Dwithiya Bagam. 338 pgs.. 1924. Gitagovinda Of Jayadeva With Commentary Of Laksmidara.. Sanskrit. Sanskrit. Graganithadyaya. Sri Math Paramhans Parivrajakarchary Brahmanisht Lok Sangrahi. 383 pgs. 1983. Religion... 1943. Unknown.. Sanskrit.. 1971. 1946.. 100 pgs. 322 pgs. Unknown. Dhanapati Suri. 532 pgs. Dattatrey Venkateshwar Kettar. 247 pgs. 1939.. Gitagovinda Of Jayadeva.. Sanskrit. Gilgit Manuscripts Vol Iii Part 3... Gilgit Manuscripts Vol I I I Part I I I. 0. 1990. Unknown. Subhramanyamvidhusha.. -. Narayan.. S B Valankar. Nalinaksha Dutt. Unknown. 1943. Sanskrit. Sanskrit. Sanskrit. Geetharthsangraharsha Geetabhashytathparyachandrikach. Unknown. Religion. Sanskrit. 1941. Gitagovinda Kavyam. Unknown. 1934.. Bhaaskaraachara~yaa Shrii... Gochar Aur Asthakavarga. 0. Sanskrit. Sanskrit. 1972. Gilgit Manuscripts Vol Iii. 1942. Grihya Sutras Of Varah. Sanskrit.. Geetageervanam. V Subramaniam. 66 pgs.. 100 pgs. k s ramamurty. Religion. Dr Nalinaksha Dutt.org/…/SanskritIIIT.. Giitaayogapradipaara~yyabhaashhya. 316 pgs. 1927.. Unknown.. Sanskrit. Nalinaksha Dutt. 1935.nalinaksha Dutt. 1972.. 0. Gudharthatattvaloka A Commemtary On Samanyanirukti Gadadiiari. Sanskrit... Mohan Lal.. 284 pgs. 126 pgs. Sanskrit. Religion. Gitagovinda Mahakavyam.. Unknown..tatacharya. Gangadar Bapurao Kale. Theology. K. 132 pgs. Pandit S'ri Lakshminatha Tha. Unknown... 360 pgs. Geethopadesa.. 338 pgs. 200 pgs. 1948.. Sanskrit. A. Gilgit Manuscripts Vol I. Unknown. 253 pgs... Gommatasara Karma Kandah. Anil Varan Roy. E R Sreekrishna Sarma. Golaadhyaaya Uttarara~dharupo Da~tiiyo Bhaaga. Sanskrit. 1941. Unknown. Unknown. Gomileeygruhakarmaprakashika. Unknown. Ramamurthi. Unknown.. 178 pgs. Gilgit Manuscripts Vol Ii. Sanskrit. Theology. Sanskrit. Goldavyaprashnavimarsh. Narayana Ram Acharya. Unknown. Theology. Religion.. Aara~muni Pand-d'ita~. Religion. Gramegeya Ganamatk.. Dr.2/14/2011 A list of scanned Sanskrit books at III… Geeta Vignana . Sanskrit. 890 pgs.s. Unknown. 452 pgs. 1941. 1952..

Bi h Hi t S k it 1939 500 sanskritdocuments. Geography.. 261 pgs.. 199 pgs.. Sanskrit. Philosophy. Hasya And Prahasana A Critical Study. 67 pgs. 1948. History. Halayudhkosh Abhidhanratnamala. 115 pgs. Unknown. Psychology. Unknown.. Sanskrit.... 0 pgs. Sanskrit. Sanskrit.. Sanskrit.. Literature.. Haricharita. Bodhendrasarasvati. Haricharita. History. Theology. Hari Charitra..k. Sanskrit. Sanskrit. Piit'ara~sana~ Piit'ara~.. Sanskrit.dhorasamaiah. 0. Sanskrit.. 1931. Geography. 0 pgs.. 0. Unknown. Krishnamacharya. Religion.. Jaya Shankar Joshi. Haribhadra Suri Grantha Sangrahah. 144 pgs. Sanskrit. Literature.. Hatopadesha. Haravijayam Of Rajanaka Ratnakara. 1999. Vaamanashaastriikhare Vasudeva... 1952. 1917. Sanskrit. Harshacharita Sara. Haasyaara~nd-avaprahasanama~. 419 pgs. 1917. Psychology. 1939.. Hara Naaraayand-a Aapat'e Yaan'chen' San'qsipta Charitra. Unknown... Ram Swaroop Sharma..sri. Philosophy. Theology.. 1049 pgs. Tryambaka Makhin. Sanskrit. Hemaadra Uura~pha Hemaad'apan'ta Yaachen' Charitra. Theology. Sanskrit. Durgaprasada amp Kasinath Pandurang Parab. Sanskrit. Harmakutam Sundarakanda. 764 pgs. Sanskrit... Theology. Paramesvara Bhatta. 153 pgs... Sanskrit. Unknown. Gyaariibaald'ii. Sanskrit. Sanskrit. 1982. 120 pgs. R.. Harivan'shaachii Bakhara.. 1948.. Unknown. Hashacharitha Sangraha. Sanskrit. 1954. .. 0.. Harsha Charitam. Shri Dhanya Kumari. 113 pgs.. Pandit V Ananthachary. 590 pgs.. Kelakara Narasin'hachin'taamand-a.. Religion. Religion... 743 pgs. 167 pgs. Harshacharita Ek Samskrutika Adhyayana. 1945. 238 pgs.. pgs. Haimsa phrama~ Da Rxgvedaa. 1948. Sanskrit..y. Aappaapaadydhye Keshava~. Sanskrit. 166 pgs. The Arts.. Vopadeva. Sanskrit. Jai Shankar Joshi.org/…/SanskritIIIT. Religion.. Hariharaaddaitabhuushhand-ama~.. Haricarita By Paramesvara Batta. Sanskrit. 1879. Paanase Venubaaii. Biography. 96 pgs. O. Theology. Sanskrit. Literature. 1896. Harshacharitha Sangraha. Unknown. Religion. .. Haridiiqs-itakrxtaa Brahmasutravrxtti. Unknown. 556 pgs. 1948.. Unknown. Theology. Parameswara Bhatta. Gulab Chand. 1922. Bal Govind Jha. Biography. Vasudevasaran Agarwal. Aan'bekara baapujiimaara~tan'd'a. 249 pgs.. C Sankara Rama Sastri. Haricharita. Sanskrit. Unknown. Sanskrit. 93 pgs. Religion. 139 pgs. Sanskrit. Dr Suram Srinivasulu. Sanskrit. 1951. 0. 1960. Religion.. Harshacharita The Fifth Ucchhvasa. 308 pgs. 1850. The Arts.v Krishnamachariar. 1909. Gurvarthadipika. Guruvamsha Mahakavyam... Sri vadiraja Tirtha. 98 pgs.. 1964.. 254 pgs. 1920. 104 pgs.. Religion. Hari Naaraayand-a Aapat'e Charitra Va Vaang-a~mayavivechana. Religion. Hariliilaa Nan' 3.. Harshacharitha Sangraha. 0. 383 pgs. Shriijagadiishhvarabhat't'aachaara~ya. Unknown.... 1994. Durgaprasada amp Kasinath Pandurang Parab. Mahadevaiah K. Theology.. Sanskrit... 1989. 763 pgs. Jaya Bharati. 1957.. Geography.m. Sanskrit. Subrahmanya Shastri.. Hanumannnatak.. 305 pgs.2/14/2011 A list of scanned Sanskrit books at III… Guruparampara Charita With Comm. 146 pgs. Unknown.. Sanskrit. Halayudh Kosha.p...… 20/167 .. 1948. Haridiiqs-ita. Sanskrit. 1958. Religion..

Religion.. Theology.hargovind Shastry. 454 pgs..… 21/167 . 457 pgs. 1924. Govinda Das. 1930. Introduction To The Devanagari Script. Sanskrit. R Shama Shastri. Sanskrit.. 632 pgs. Religion. 100 pgs. 466 pgs.... 192 pgs. 0. 1986. Unknown. 1925. Index Verborum Part 1. Iishvara Pratyabhinj-aa Prathamo Bhaaga Grantha 22... Sanskrit. C Dwarakanatha. Unknown. 1949. Introduction To The Study Of Mudra Raksasa. Sanskrit. Religion... Arthasasthra Visarada... Religion. 423 pgs.2/14/2011 A list of scanned Sanskrit books at III… Biography.. Introduction To Kayachikitsa. 360 pgs. 1949. Bhat't'a Aara~ya.. 1921. 1951. Hetubindutika Of Butta Arcata. Sanskrit. 78 pgs. P V Kale. Sanskrit. History Of The Duta Kavyas Of Bengal. Sanskrit. 354 pgs. Sanskrit. Sanskrit.. Unknown.. Sanskrit. Suniti Kumar Chatterji.. Sri Madhusudan Sharma... 1973.. Influence Of Kalidasa On Harshavardhana. 1938.. Gupta Abhinava.. Theology. Sanskrit. 1949. Sanskrit. Sanskrit.... 515 pgs. Theology. Hetubhindut'hiikaa. 1943... Sanskrit. 90 pgs. Unknown. 470 pgs. 530 pgs. 0... H M Lambert. 1938. 1918. 258 pgs. Unknown... 1925. 290 pgs. Religion. 1948. Index Verborum Part Iii. Dr R Shama Shastry. 105 pgs. Sanskrit.. Indian Scientific Nomenclature Of Birds Of India Burma And Ceylon Vol X X. Index Verborum Part Ii. Sanskrit... Unknown. Sanskrit. Shan'karaananda. 302 pgs... Unknown. Unknown. Introduction To The Study Of Mrcchakatika. Sanskrit.. Raghu Vira.. sanskritdocuments. Sanskrit. 176 pgs. 2002. Iishrvarapratyabhijnaavivrxtivimara~shini. Sanskrit. 354 pgs. Pt. Hitopdesh Mitrlabh.. Gupta Mada Abhinava.. Intermediat Patchabagh. 197 pgs.. Iishaavaasyopanishhata~ Grantha 5. Sanskrit. Hinduism. 120 pgs. Pandit Sukhlaji Sanghavi. Sanskrit. Unknown.. Theology. Psychology. N Padmavathy. Unknown. Indo Aryan And Hindi. Sri Krishnavallabha Charya. Iishaavaasyopanishhada~. Unknown. G V Devasthali. Unknown. 274 pgs. Religion. Kiranvalli. Unknown. Theology. Unknown. Theology.. Intermediate Sanskrith Selections. 1953. Sanskrit. History.. Unknown. Peterson Peter. Deva Utpala. 436 pgs. G V Devasthali. 0.. History Of Sanskrit Poetics. Ishvara Pratyabhijna Vimarshini Of Utpaladeva. Iishvara Pratyabhi Nj-aavivrxti Vimara~shinii Prathamo Bhaaga Grantha 60.. Religion. Sanskrit. Deva Utpala. 1941. 1953.. Unknown. Religion. Theology. Hitopdesh. 132 pgs. 520 pgs. Gupta Abhinava.. Sanskrit.. Hitopdesh Suharbudedh. Unknown.. Theology.. 1939. Intermediate Sanskrit First Year. Unknown. G V Devasthali. 1990. Unknown. Mukunda Rama Shastri.. Theology. Sanskrit. i srinivasa rao. 161 pgs.. Indravijay. 457 pgs.org/…/SanskritIIIT. Sanskrit.. Sanskrit. Hymns From The Rgveda.. 168 pgs. 323 pgs... Religion. Bhin'd'a Sadaashivashaastrii. 1953. Unknown. 1969. Iishvarapratyabhinj-aa Dditiiyo Bhaaga Grantha 33. Unknown. 500 pgs. 1930. 1942. Sanskrit. -. Sanskrit.. 1921. Philosophy... Dr Jatindra Bimal Chaudhuri. 134 pgs. Sanskrit.. 1934. 1986.. Sanskrit. Iishrvarapratyabhijnaavivrxtivimara~shinii Trxtiya Bhaaga.

V. Lokeshachandrend-a. 1934. Linguistics. gopesh kumar ahoja.. Unknown.. Jathakat'a~t'hakathaa Prathama Bhaaga. Jambhavati Parinayam.. Subramanya Sastri. V. Jaisinhakalpadrumah Dharmashstragranth 1. 81 pgs.. 1980. Literature. 1950. Language.2/14/2011 A list of scanned Sanskrit books at III… Isvasyopanished Asyam.. Unknown. 1922. Jainadara~shanasaara. Unknown. Geography... Jatakatthakatha Vol I. sanskritdocuments. History. 0. 1984.. 145 pgs. Itihasah Shaastra Va Tattvajnj-aana.. Sharma. Unknown. Sri Vallabhacharya. Jatakattha Katha.. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Daivajana Vaidyanatha. Bhiqs-u Dhara~maraqs-ita.. Mahopadesaka S Rajavallabha Sastrigal. 536 pgs.. 1904.... Jaiminigrxhmasuutrama~. Ramakrisha Kavi. Jaiminiiya Braahmand-an' Dditiiye Kaand-d'e. Sanskrit. 342 pgs. 0. Javaahara~lala~ Neharu Aatmacharitra. Literature. Religion. 0. Sanskrit. Sanskrit. 442 pgs. Unknown. Sanskrit. 0. Bellikoth Ramchandra Sharma.. Jaminiya Arseya jaiminiya Upanishad Brahmanas. Bhikshu Dharm Rakshit. Sanskrit. Sanskrit... Unknown. 538 pgs.. Theology. Gandesha~gore Naaraayand-a.. 446 pgs. Jathaka Baranamu.. 408 pgs. Religion. Jaipur Ki Saskrith Sahitya Ko Daen. 406 pgs. 1982. 296 pgs.. 1947. Unknown. 344 pgs. 1950. 105 pgs. 248 pgs. 170 pgs. Unknown. Sanskrit. Jaiminiya Brahmana of the Samaveda.m. Geography. Jathaka Baranamu. Gupte Ke Esa~. Language. Unknown. Kalaan'da Vi. Jataka Parijata Adhyayas 11-15. brahmachari sarveswaranand. Theology. Sanskrit. Vacant.... Sanskrit. 1937. Theology. 1950. Language. 414 pgs. 76 pgs. Jaiminiya Brahmana Of The Samaveda.… 22/167 . Unknown.... 1956. Sanskrit. Unknown. 1951. Literature.... 455 pgs. Sanskrit. Jaatakapaarijaata. Pullagummi Venkatacharyulu. . 350 pgs.. Jaiminiya Arseya Jaiminiya Upanishad Brahmanas. Unknown.. Raghuvira. Sanskrit. Unknown. Jainendravyaakarand-ama~. Sanskrit. Sanskrit. Sanskrit.... Achyatananda. 1984. Jainendra Mahavritti Of Shri Abhayanandi. Dr B Ramaraju. Astrology. 146 pgs.. 524 pgs. Sanskrit. Acahrya Jinvijay Muni. Biography.. Sanskrit... 305 pgs.. Theology... Theology. Sanskrit. 1954. 1951. 171 pgs. Sanskrit. 333 pgs. 1952. 582 pgs. Jaathakadesha Margaha Chandrika. 175 pgs. 0. 1969. Sanskrit. Dr Prabhakar Shastry. 1944. 1920. Unknown. Unknown....... Acharya. Unknown. Jalabheda... Devanandimunii..org/…/SanskritIIIT. Linguistics. Jathaka Bharanam. Linguistics. Jagadruru Sri Sacchidananda Sivabhinava Nrisimhabarathi Vijayakavya. Jambu Chariyam Number Xxxxiv. Biography. Jagadish Anumitha Grandhah.. Tripitakacharya Bhikshu Dharma Rakshit... 0.. 568 pgs. Religion. Theology. Religion. Raghu Veera. ... 0. Muura~tii Vijaya. Sanskrit. 1951. B.r. Panditharinarayansharmami. Linguistics Literature. Linguistics Literature. 178 pgs. Religion. Jainashiilaa Lekha San'grah Dditiiyo Bhaaga. Janasrayi. 247 pgs. Sanskrit.. 940 pgs. 1933. Sanskrit. Jaimani Sutra Vritti Subhodini Namika. shambhunath tripathi. Sanskrit. Religion.. Sanskrit.. Sanskrit.. Mallinathana Si Esa. 0. 714 pgs.r.

. Linguistics. Sanskrit. 1976... Linguistics. 1975. Language. 56 pgs. Language. Chaara~ya Maadhava. 188 pgs. Kaadambariikalyaand-an' Naat'akama~. Psychology. 304 pgs. 264 pgs. 694 pgs. Literature. Religion.. 88 pgs. Unknown.… 23/167 . Kaat'hakopanishhata~. 1919. Jinaratnakosa Vol I.. Sanskrit.. Sanskrit. Jnaanaara~nd-avatantrama~. 1076 pgs. Religion. 714 pgs. Kaasyapagnaanakandaha. 216 pgs. Sanskrit. Biography.. 1948. Buddhi Jinendra. Jyothishshamasangraha Jaathakbhag. Unknown. 1131 pgs.. Miraashii Vaasudevavishhnd-u... Literature. Linguistics. Kaalidaasiiyama~ Rxtusan'haarand-ama~ Da~vitiiyo Granthaa. Sanskrit. Ram Chandra Narayan Velingkar... 1954. 217 pgs. Philosophy. Aashaadhara Pand-d'ita. Philosophy. -. Sanskrit. Sanskrit. Unknown. Vilomakaaland-d'a Shriidakt'ara~. 643 pgs. Sanskrit. 1925. Theology. Sanskrit. Pandit dayashanleareupadhyaya. Sanskrit.... Jnaneshwari.org/…/SanskritIIIT. Linguistics. Jeevandhara Champuh. K t'h k i hh t Ch t thi k tti V d Phil h P h l sanskritdocuments.. Jayasri Grandhavali. 1947. 142 pgs.. Religion.. Kaashi Kaa Vivarand-a Panj-jikaa Vol Ii Part I. Literature.. Sanskrit. 1925. Theology.. Jivanandanam. Shriidhashaastrii Pan'd'ita. 1944. Unknown. Pandit Pannalal Jain Sahitya Charya.. Literature..duraiswami Aiyangar.. Theology. Kavii Narasin'ha.. Unknown. Kaarikaavalii Mukttaavaliida~vitiiyan' San'skarand-ama~. Literature.. 1954. Pandit Narayan Datta Vaidy. Sanskrit. Linguistics. Theology. Hari Damodar Velankar. 736 pgs. 1913. 141 pgs... Sanskrit. Unknown.. Theology.. 349 pgs. Jigyansadhikarnpoorvapaksh. Parthasarathy Battacharya. Unknown. Journal Of Sri Venkateswara Orintal Institute Tiruoathi Vol 2. 1952. Unknown... 264 pgs. Sanskrit.. Sarasvatihrdayalankara. 0. Language. 134 pgs. Jitante Stotram. Kaadambarii Shhashht'a Vrxtti. Sanskrit. 0. Kaalidaasa.. Rajanadh Sarma. Jyaneswarinche Shabda Bhandar. Sanskrit. Language. Sanskrit. Sanskrit.. 416 pgs... Language.. 1934. Sanskrit. 408 pgs.. Religion. 1909. 64 pgs. Shriibaand-abhaat't'aa Mahaakavii. Religion. -. Geography.. 1959. Kaalidaasa. 576 pgs. Jeevanandanamu. shyam lal.... Ramchandra Kesava Bhagwat. 1921. Jayadevacharitram. Sanskrit. 623 pgs. 545 pgs. Linguistics. History.. Sanskrit. 0..2/14/2011 A list of scanned Sanskrit books at III… History.. 0. 1867. Literature.. Jinasahasranaama. Language. Linguistics.. 563 pgs. Literature. Jayapoorva Bhavamu. Sanskrit. 0. Unknown. Kaashikaavivarand-apanj-jikaa Prathama Bhaaga. 1936. Sanskrit. Sanskrit. G Laxmi Kantaiah. 0. Religion. Sanskrit. Sanskrit. Kaat'hakagrxhyasutrama~ Bhaashhyatrayasarasutama~. Unknown. 1995. Chakravara~tii Chan'draa. Literature. Balasharma. 1947.b. 772 pgs. Language.. Kaashi Kaa Vivarand-a Panj-jikaa Khand-d'a 3... Jotisha prasna phala ganana. Bhat't'aachaara~ya.. Unknown. R. 314 pgs. M. 1951. 1944.. Kaalamaadhava.. 1929. Buddhi Jinendra. Sanskrit. Iishvara~ Proktama~. Sanskrit. 488 pgs... 247 pgs.. Sanskrit.

Technology. 1992. Literature. 376 pgs. 156 pgs. 1935. Linguistics Literature. 1935. Ara~hadhaasii.. Sanskrit.. Kaavyamaalaa Saptamo Guchchhaka.. 412 pgs. Sanskrit. 1955. Unknown. Sanskrit. Unknown. 240 pgs. Linguistics. 389 pgs. 1939. Sanskrit. Sanskrit.... Biography. Psychology.. Kaavyamaalaa Shashht'ho Guchchhaka. Unknown. 290 pgs. Kaavyaprakaashakhand-d'ana.. Literature. Parushuraamachin'chaalakara Dattatraya. 0. 0. 1932. Kaavyamiimaan'saa Aalochanaa Nibandha.. -. Sri Paramanandaji.2/14/2011 A list of scanned Sanskrit books at III… Kaat'hakopanishhata~ Chatura~thiyamang-kanaavrxtti.. Sanskrit. 1937. 1931. Kalpa Kalkika. kapila vatsyayan... Philosophy. Sanskrit. 212 pgs. 1954... Literature.. Shaastrii Shriivasudeva. Sanskrit. Kainkaryaratnavali. Linguistics. Linguistics. 715 pgs.r.Purva Bagha. 254 pgs. Literature. Sanskrit. Sanskrit.. Literature. Unknown. Durgaprasada~ Pandita~. 300 pgs. 0.. Sanskrit.. Sanskrit. 1394 pgs. Raajashekhara Kaviraajaa. History. Literature. 1938. Kalpadrukosa Of Kesava Vol I Ramavatara Sarma Unknown Sanskrit 1928 564 pgs sanskritdocuments. Language. Unknown.. 207 pgs. Literature. 1930. Literature. 1934. Kalatattvakosa. Vyasadevena. 1955. Language. 126 pgs.. Language. Kakolutikeeyamu.. Linguistics. 108 pgs. 1993... Dr Sushma Kulshreshtha. Theology. Kaavya Prakaasha 15. Sanskrit.. Language.org/…/SanskritIIIT. Social Sciences. Siddhichandragand-i. Psychology. K S Rama Swami Sastri. 1914. Raajashekhara Kaviraaja.. Kadhambari Purvabaga Part 2. 1993. 352 pgs. 1926. Madhava Charya. Kalaamruthamu. Geography. 1954. Kaavyamaalaa Da~tiiyao Guchchhaka. 1986... Sanskrit. Sanskrit. Harihara Kripala Dwivedi. Technology. Sanskrit. Kaat'hakopanishhata~ Grantha 7. Sanskrit..... Raajashekhara Kaviraajaa. S Suryanarayan Shastry. -. 606 pgs.. 140 pgs. Philosophy.. Kaavyamaalaa Dvadasho Guchchhaka. Kaayaparishuddhi. 377 pgs. Sanskrit. 363 pgs. Kala Madhav. Unknown.. 1953.... 1972. S. Shriimaanatung-gaachaaraya. 114 pgs. 282 pgs.. Language. Unknown.. Kainkaryaratnavali Of Paravastu Krsnamacaharya. Kaavyamiimaan'saa Prathama San'skarand-ama~. Biography. Linguistics. 147 pgs. Sin'h Satyavrata. 1952. History... Sri Vishnu Sharma.. Unknown.. History.... 160 pgs. Sanskrit. Sanskrit.… 24/167 . Linguistics Literature. Kabeer Manshur... Kalidasa Sahitya Evam Vadana Kala. Kai Govin'dasuta Ura~fa Parushuraama Govin'da Chin'chaalakara. 172 pgs.. Sanskrit. Biography.. Dura~gaaprasada~ Pand-d'ita. 280 pgs. Dand-d'i Aachaara~yaa. Kasinatha Panduranga Parab.sehgal. 1959. Sanskrit. Language. 1936.. Kalidasa Vol Ii.. Kaavyaratnan. Sanskrit. Geography. 510 pgs.. Sreemannarayanamurthy. Geography. Kalapoornoday. Kalidasa's Kumarasambhavam (cantos I-vii). Kaavyamiimaan'saa. Unknown. Dr M Srimannarayana Murti. Kadambari . 1958. Sanskrit. Religion. 176 pgs. Linguistics. 175 pgs.. Sanskrit. 0. Unknown.. 143 pgs. Kaavyaadara~sha. Sanskrit. Sanskrit. Sanskrit.... Durgaprasada~ Pandita~. Sanskrit. Aapat'e Mahaadeva Chimand-a.

Unknown. Unknown. Theology. Unknown. Sanskrit. Literature. 216 pgs. Sanskrit.. Sanskrit.b. Unknown. Linguistics. Unknown. Motilal Joshi. Kashyapajnana Khandah. Sri Kalanath Jha. Ramavatara Sarma. 2001. Kalyan Markandeya Puranam... Narayana Kavi.. Sanskrit. 234 pgs.. Kanva Sanhita.. The Arts. Unknown. Unknown. Sanskrit. Unknown... 307 pgs. 674 pgs. Sanskrit. 1926. R. 0. Sanskrit. Brahmadeva. Sanskrit.. 90 pgs... -. Unknown. 1960. 192 pgs. Kartika Masa Mahatmyam. Kalyan Ank. Sri Somashambhu. 1175 pgs. 0. Panditraj Dhunddhiraja Sastri. Unknown. Sanskrit. Kashyagnanakandah. Dr.. Kalyaanamaalla Mahaakavi. 412 pgs. Unknown. Sanskrit. Karanaprakasa. Kalpadrukosha Da~vitiiya Bhaaga.. Sanskrit. Literature. 900 pgs. 1934. Sanskrit.. Kesava. Indian Astrology. 302 pgs. 1860. Sanskrit. Unknown. Unknown. Linguistics... Sanskrit. Kalyan Sankhya-i. Sanskrit... 100 pgs. 1899.. Kashyapashilpama~... 1971. Language. 240 pgs. 564 pgs. 0. Kanya Sanhitha Of The Shukla Yajurveda.. Sanskrit. 231 pgs. Kamalavilasabhana. Kasaya Pahudam Iii Thidi Vihatti. Parthasaradhi Bhattarcharya. 0. Unknown. Sanskrit. Indian Astrology. 1932. Sanskrit. Kanva Sanhitha. 313 pgs. 1991. .. Kashyapgyaankanda. Gauri Shankar. Kanakaamara Munii. Sanskrit. 148 pgs. Biography. Sanskrit. 0.. 112 pgs. 906 pgs.. 140 pgs... -. Sanskrit. 0. 0. 1960. 240 pgs.. Karmakanda Karmavali. 30 pgs. Karakan'd'achariu. Sanskrit. Kalyan Sanshikpt Skand Puranam. Krishna Das Gupta. 176 pgs. Unknown. Gunabhadracharya. 395 pgs.. Madhava Shastri. Pardha Saradhi Battacharya.. 462 pgs. Unknown. Bhattacharyen Sripad Sharmana Damodar Bhattsununa. Unknown. Kalpasutra(subhodhika Vyakya). Karak Darshanamu. Karaka Mimamsa. Sanskrit.. 0. 0. Language. Kapphinabhyudaya. 1915.. Hanuman Prasad.. Sanskrit. 782 pgs.. 1915. 1937. History. 1976... Sanskrit. Religion. Karmakanda Kramavali No Lxxiii... Sanskrit.. 294 pgs. Sanskrit. Sanskrit.. Kashyapa Mahaara~shhi. Unknown. Hanuman Prasad Pothar. 1967. Sanskrit... Kaniviya Anthyashti Padhathi. Kalyaanamaalla Anan'garan'gama~.. Linguistics Literature. Somasnambhu.. 1932.. Sanskrit. Kamakunjalata.. sanskritdocuments... 1947.. Kashika Part 3. 528 pgs.org/…/SanskritIIIT.. Hanumanprasad Pohar. 1958. Technology. Unknown. 1927.. Sanskrit. Ghorapad'e Ekanatha Keshavarava.. 760 pgs... 0. Kalpadrukosa Of Kesava Vol I I. Sanskrit. Sanskrit.. 306 pgs. 370 pgs. Unknown. Bapuharshet Devalekar. 0. 1947.satyendra Mishra.. Vamana. Kalyan. 558 pgs.2/14/2011 A list of scanned Sanskrit books at III… Kalpadrukosa Of Kesava Vol I. Unknown. 1948. 268 pgs.. Kalpalataviveka By An Anonymous Author. 1969.. Kara~maviira Bhaauuraava Paat'iila Charitra Va Kara~ya. -. 1928. Kalyana Sancheka. Unknown.. 207 pgs. Srikanth Sharma.. Karupuramanjari Edition Ii. 212 pgs.. Murari Lal Nagar.… 25/167 . Badlikar Sriyeag Raghavrisurisununa.. Sanskrit. Manomohan Ghosh.. Geography. Unknown. 234 pgs.. Karana Kutuhalam Of Sri Bhaskaracharya. Sanskrit.patrusarthi Bhatta Charya. Linguistics Literature...... Unknown. 1942. Unknown..

. Sanskrit. 240 pgs. Jollii Je.. Kathakagrhyasutram..r. 164 pgs. Dr. 1938.. 62 pgs. Sanskrit. 1924. 1904.. 1954.. R Ananta Krishna Sastry. Kavyakotukadarsh.. Unknown. 338 pgs. Kat'hopaanishhada~ Aavrxtti Pahilii. Theology. Jolli Je. Kaumudi Mahotsava.Jnan kanda. Unknown. Unknown.. Vamana And Jayaditya. Sanskrit.. 1969. 1904. 1944. Kasyapa Gnanakandaha. Sanskrit. Jolli Je.. 92 pgs. Sanskrit. Sanskrit.. 1948. Kavikalapadruma Of Vopadeva. Unknown. 0. Unknown. 1923. F Keilhorn. 486 pgs.org/…/SanskritIIIT. Kavyadeepika. Sanskrit. Unknown... Sanskrit. Literature. Sanskrit. 1948. Literature.vedeshiya Teeka.. Parthasarathy Battacharya. Sanskrit. Chintaamand-i Ti Ra. Unknown. 348 pgs. Theology.... 1987. Kaut'iliiyan' Ara~tha Shaastrama~. Kavya Prakash.. Religion. 1965.... Shaastrii Ra Shamaa. 330 pgs.nitya Nanda Parvatiya.. 1930. T.. Unknown. Sanskrit... 260 pgs. Sanskrit. Sanskrit. Sanskrit. 222 pgs. Language. Pt. Sanskrit.. 1921. 378 pgs. Unknown. 502 pgs. Katha Kagruha Suthra. 266 pgs.. Kavya Parisha.. S V Shastri. Rambalak Shastri. Unknown. Religion. 142 pgs. Gajanan Balkrishna Pa sule. Kavindracharya List.. Kaut'iliiyama~ Ara~tha Shaastrama~ Dditiiya Khand-d'a. Sanskrit.. Linguistics Literature... Kavikalpadruma Prathama San'skarand-ama~.. Unknown.. Shriivopadevagosvaamii. Kaut'iliiyama~ Ara~tha Shaastrama~ Khand-d'a 1.. 624 pgs. Kaushhiitakagrxhyasutraand-i. 0. Social Sciences. Sanskrit. Unknown. Pandith Rangacharya Raddi Shastry. Rarthasarathi Bhattachar.. Unknown. Kasyapa Samhita.. Dr Gaya Charan Tripathi..srinivasa Tirtheeya Etc.. 1952.. Sanskrit. 1924. 236 pgs. 122 pgs.b.… 26/167 .. R. 344 pgs. 1919. Kasyapa Jnanakanda.manduka Vyasatirtheeya. 1925. K C Varadachari. Sanskrit. Social Sciences. Kasyapa Maharshi... 211 pgs. 210 pgs. Linguistics. Unknown. Kavindracandrodaya. Sanskrit. Katyayana And Patanjali Edition Ii.willem Caland... sanskritdocuments. M. Sanskrit. 1979. 1963. Somadeva.. Religion.. Unknown. Language.. Kathaka Vyasatirtheeya Teeka. Literature. 1934. Unknown. Kautilya Vol I. Kasyapa . 1951. Rajachudamani Dikshita. Har Dutt Sharma.p.. 1960.. Sanskrit. Kavyadarpana Volume 1. 0. 1924. 58 pgs. Social Sciences. Katha Sarithsagara..r. 220 pgs.. 1923. 142 pgs.m. Unknown.. Sanskrit. 423 pgs. Kaut'iliiyama~ Ara~tha Shaastrama~ Dditiiyo Bhaaga. 1939. 172 pgs. 202 pgs.. Unknown. Linguistics. 1925. William Caland.. Sanskrit. Rarthasarathi Bhattachar R. 1998. Unknown. Unknown. 84 pgs.. Katiyeshti Dipaka. Kathasaritsagara Part 2. Sanskrit.2/14/2011 y pgy p A list of scanned y Sanskrit books at III… pg Kasika Part 1. Sanskrit.krishnacharya. Sanskrit.girdhar Sharma. Social Sciences... 342 pgs.. Sanskrit... Sri Parushuram Sharmana. Kavyadarsh. Sanskrit. Pandith Sri Ram Govind Shukla. Kathopanisad Bhasya. 338 pgs. Dr Ram Gopal Mishra. 1984. Sanskrit. Katakarajavamsavali Vol I.. -. Sanskrit. 114 pgs.. 339 pgs. Sanskrit.. Sakuntal Rao Sastri.. Unknown. Kathamruthamu.. Sanskrit. Bhin'de Sadaashivashaastrii. 466 pgs. Unknown. 1959. 230 pgs.

646 pgs. 123 pgs. Kiratharjuniyam. Kavyasamudaya. 2003. Pandit Durgaprasad.. Unknown.. 1889. Kenopanishhata~ Shhashht'hiiya Khand-d'a Grantha 6. ananthalal thakur.. 0.. 203 pgs. Pandit Sivadatta. 1944. Kishkindhakandah Of Srimad Ramayanam. Sri Harishankara Sarama. Sanskrit. Kenopanishhata~... Kavyasangraha 3. The Arts. 1981.. Unknown.. Sridhar Shastri. Poems. Philosophy.. Kavyalankarasutrani Vol I V. Krishna Charitam. 1952. Sanskrit. 1997..b. Language. 1934. Sanskrit. 1937. Sanskrit. Sanskrit. 1929. Kavyanusasana.. Machchhakad'araachaara~ya. Kavyalankara Sara Sangraha. Unknown.… 27/167 . Sanskrit. Unknown. Sri Venkataramanarya. Religion. Unknown.. 449 pgs. Sanskrit. 124 pgs. Krishna Charitramu Peri Venkateswara Shastri Unknown Sanskrit 0 74 pgs sanskritdocuments. Srigowrinatha Shastri.. K. Sanskrit. 334 pgs.. 582 pgs. 587 pgs.. 1927.. Sanskrit. Rajvaidya Jivaram Kalidas Shastri. Unknown. Unknown. Sanskrit. 359 pgs. Sanskrit. Theology. 0. Sanskrit. 1959. Kavyamrtam. Kramadiipikaa.. Sanskrit.. Kavyalankara. Sanskrit. Kavyamala Part I X. Sanskrit. N.. 176 pgs. 140 pgs.. 114 pgs. Sanskrit. 1956.. Unknown.. Sanskrit. Kavyanusasana Vol I. 112 pgs.. 1934.pathrusarthi Bhatta Charya. Sudhakar malaviya. Unknown. 1992. Mahamahopadhyaya Pandith Shivadatta... Literature. 166 pgs.. 2002. 1925. Pandit. Kavyaprakasa of Acharya Mammata.. 1919. 232 pgs. 1166 pgs.. Ganeshopadhyay. Khilandhikara. Kiichakavadhama~. 1951. 327 pgs... 1951. pg Kavyalaksana Of Dandin. Unknown. Sanskrit.. 224 pgs. Unknown. 0. Kiirasandeshah. Sanskrit. Poems. Durgaprasad. Sreeramamurthy. 1962. -... 1917. 1957. Sanskrit.. Kavyamala Part 5. 1992. Narayan Nathaji Kaulkarni. 57 pgs. Unknown. Kemopanished.. Kasinath Panduranga Parab.. Unknown.. Pardha Saradhi Battacharya. 1938..n. 1916. Kiranavalirahasyam Of Mathuranatha Tarkavagisha. 117 pgs. Nitiivara~ma Mahaakavi. Kevalanavyiprakarnaam. Hari Narayan Aapte. Laqs-mikaantasyaa jii. Unknown. Khiladikara. Sanskrit. 174 pgs.. Kavyalamkarasutravritti Of Vamana.. Keralodaya (a Historical Poem). 190 pgs.. 191 pgs.2/14/2011 y p A list. 1919. Unknown..ezhuthachan.. Sanskrit. Banhatti.. Unknown.. Linguistics. 626 pgs.. . 356 pgs. Sanskrit. 1938. Unknown.madladevi Shastri. Keinchuifantsan. Unknown. -. 510 pgs. Theology.. Theology. Psychology. 70 pgs. Narayan Ram Acharya.. 576 pgs. 1938. Arka Somayaji.. of scanned Sanskrit books at III… .. Koushetika Brahmanam Achara Vichara. Sanskrit. Kavyaprakash.. Naaraayand-a. Sanskrit.. Sanskrit. Jivananda vidyasagar Bhattacharya. Sanskrit. Narayana Daso Banahatti.. Kavyamala. 1929. Unknown.. Sanskrit. Khanda Kadya Sahastrika. Indian Logic. 1961.. 180 pgs.... 538 pgs. Kiratarjuniya 1889.. Religion. Sanskrit... Pandit Durga Prasad. Kavyalankara. Sanskrit. Acharya Hemachandra. Bhat't'a Keshava.. 108 pgs. Sanskrit.. Pandit R. Dr.. 1916. Unknown.. Dr.. Kavyamala Part 1.. Unknown..org/…/SanskritIIIT. Kavyamala Part 13. Kavyalankara. Sanskrit. 43 pgs. 275 pgs. Religion.d. Sanskrit. Sanskrit. 332 pgs.

Dr Surya Kanta. 180 pgs..sudhakar Malaviya. Rangaswami Aiyangar.2/14/2011 A list of scanned Sanskrit books at III… Krishna Charitramu. 592 pgs. Kumparnapuranam.moksakanda. Religion.. Dr. Unknown. Sanskrit. Dr..... 1976.. 1946.xiv..v. Shriimatsaayand-achaara~yaa. Krxshhnd-ayajura~vediiya Taittiriiyasan'hitaa Prathamo Bhaaga. 1950. Sanskrit. k v rangaswami aiyangar. 1929. Sanskrit. k. 1950. Theology. K... 178 pgs. K V Ranga Swami Aiyangar. Language. Religion. 1976. Sanskrit. 234 pgs. 1941. Unknown. Pandith Sripad Damodar Sathvalekar. Unknown... 424 pgs.. Unknown. Sanskrit. Religion. Krxshhnd-a Yajura~vediiya Taittiriiya San'hitaa. Krxshhnd-ayajura~vediiya Taittiriiyaarand-yakama~ Prathamo Bhaaga. Krtya Kalpataru Of Bhatta Laksmidhara Danakanda Vol 5. 644 pgs. Sanskrit.. Unknown. 1954.. sanskritdocuments.v. Sanskrit. Unknown. Unknown. Peri Venkateswara Shastri. 446 pgs. 1967. Sanskrit. Religion.. Sanskrit. K. Ksemendra Ladrukhayasangra. Krxshhnd-a Yajura~vedii.org/…/SanskritIIIT. Krtyakalpataru Of Bhatta Lakshmidhara Vol Iv. 681 pgs.v. Religion. 1948. 322 pgs. 1890. 372 pgs. Shriimatsaayand-aachaara~yaa. Sanskrit.. 74 pgs. Unknown. Krithya Kalpataru.. 290 pgs. 0. Sri Neelamanimukhopadhya.. Krishna Vilasa Of Punyakoti With Commentary..ayendra Sharma. Sanskrit. 413 pgs. Shriiding-a~naaga Mahaakavii. Sanskrit. 490 pgs. Theology. Krtyakalpataru Of Bhatta Laksmidhara Vol 3 Niyatakala Kanda. 1940. Unknown. Ksemendra Studies. 436 pgs. Shivaa Chara~yaa Niilakan't'ha. Thakkura. Kumarasambhavam Mahakavyam. Sanskrit. 1983. 1997. Linguistics.s.. Kriyaasaara Vol I.. Krtyakalapataru Of Bhatta Laksmidhara Vol.. Unknown.. Theology. K V Rangaswami Aiyangar. 1925. Krishnajuvirdeeya Taitireeysanhitha.. 1945. Religion. 1950.. 349 pgs. 478 pgs..… 28/167 .... Krtyakalpataru Of Bhatta Lakshmidhara Vol X. Sanskrit. Theology... Sanskrit... Sanskrit. 414 pgs. 1929. Krtyaratnakara.. Sanskrit. Dr.. Rangaswami Aiyangar. Kurmapuranam. 401 pgs. Rangaswami Aiyangar. 1848. Theology..s.. Theology.k.. 1983.ramshankara Bhattacharya. Sanskrit.. Kriya Svara Laksanam Or Yohi Bhasyam. Krxshhnd-ayajura~vediiyataittiriiyasan'hitaa Da~viitiiyo Bhaaga. 462 pgs.. C. Unknown. 230 pgs. Sanskrit. 373 pgs. Literature. Sanskrit. 777 pgs.. Unknown.... Sanskrit. Religion. Dr. 658 pgs. 1940.. Unknown. k. Rangaswami Aiyangar.... 1954.. Religion.. 1945. Krtyakalapataru Of Bhatta Laksmidhara Vol 1. Rangaswami Aiyangar. Unknown. 580 pgs. Sanskrit. 446 pgs. Sanskrit. Sanskrit. Rama Murti. k.. Unknown. Shriimatsaayand-aachaara~yaa. Sanskrit. Suru Bhatta. 1950. Shriimatsaayand-aachaarayaa. Vaamanashastrii Pand-d'ita. Sanskrit. Krsnavilasa Of Punyakoti. Religion. Kundamaalaa. 1961. 1942. Krxshhnd-ayajura~vediiya Taittiriiyopanishhata~ Pnj-chamiiyamang-kanaavrxtti.v. 258 pgs.. Unknown.ramamurti. Krtyakalapataru Of Bhatta Laksmidhara. Sanskrit. Krxshhnd-a Yajura~vediiya Taittiriiya San'hitaa Panj-chamo Bhaaga.. Theology. Religion.

Literature...… 29/167 . 1917. Sanskrit. 34 pgs. Laghu Sabdendu Sekhara Vol I. 34 pgs. shri achyuthananda jha. History. 70 pgs. Sanskrit. Biography.. Sri Girishkumar Tagore.. 496 pgs. Shara~mand-aa Vaasudeva. alfred lord tennyson. Unknown. Laghu Siddanta Kaumudi. Prakash.. Lakshmi Tantra A Pancaratra Agama. Literature.. 342 pgs.. 1280 pgs. Unknown.. Unknown.. 257 pgs. Geography... Sanskrit. 1944. 1952..org/…/SanskritIIIT. Sanskrit. Unknown. Laghubhaaskariiyama~.. Lalitha Madhavam Gareth And Lynette. P S Subramanya Sastri... 174 pgs.. 130 pgs. 0. Sanskrit. 220 pgs. 296 pgs. Sanskrit. 133 pgs.. Raghunathaharya N c. 1974. Unknown. Laghu Kashika 1. Unknown. Sanskrit... 1938. Tata Subbaraya Sastri. 298 pgs. 152 pgs. Laghumaanasama~. 46 pgs. 1999. 1978. 372 pgs. Linguistics. Krishnamacharya. Laalaa Lajapatharaaya Yan'chen' Aatmacharitra Va Charitra. Sri Govindnath Guha. Sanskrit. Pandith Sri Narayana Dutt Shastrina. -. Kutuuhalavrxtti Prathamodhyaaya. Sanskrit. 1977. 124 pgs. 162 pgs. Sanskrit... Laghuparashari Madhyaparashari. 1946. Sanskrit... Sanskrit. Munj-jalaachaara~ya. Unknown. 514 pgs. Shriinaageshabhat't'a Mahamahopaadhyaaya. 608 pgs. Unknown.. Ladhu Ramayanam. 1941.. Sanskrit.. Kuttanirmatam Kavyam... 277 pgs. Sanskrit. Sanskrit. 0.... 684 pgs. Lavangee. Lagusidhantkomudhi. Sanskrit. Sanskrit.. Kuvalayaananda. Theology. Unknown. J P George. Laghushabdendushekhara Napadaantasuutraanto Bhaaga. Sanskrit. Lalleshwari Vyakyani. Laghu Parasari And Madhya Parasari.2/14/2011 A list of scanned Sanskrit books at III… Kut't'aakaarishiromand-i. 1941. Le Role Des Forets Dans Le Developpement Des Collectivites Locales Forets7. Laghusidhantakoumudhi. 1993. Sanskrit. Pandith Nandkishore Shastri Ayurvedacharya.. Lectures On Patanjali S Mahabhasya Vol 2 Ahnikas 4 6. Natural Sciences.. Laghu Siddhanta Kaumudii Pura~vaara~dharuupa Prathamo Bhaaga.. 65 pgs.... Unknown. Lagusidhanthkoumudhi.. 394 pgs. Religion.. 1951 314 sanskritdocuments. 1651. 314 pgs.. Sanskrit. 1936. Kulakara~nii.. Saktisrm. 466 pgs. 1993. 290 pgs.. Sanskrit. 858 pgs. Unknown. Unknown. Unknown. 1904. Language. Unknown. Ladhunibandha. Sanskrit. Sanskrit. 1959. Suryakanta.. Sanskrit. Sanskrit. Varadharajacharyapranith. 310 pgs. Sanskrit.. Unknown. 1998. Unknown.. Shriibhaaskaraachaara~ya. Lakshmi Sahasram Part 1. Peri Venkateswara Sastri. Theology. N C S Venkatacharya... Laghusiddhantkaumudi. Natural Sciences. Prakash.. Unknown. 1950. 134 pgs.. 1944. Pandit Sri Achyutananda Jha. Sanskrit. Sri Varadharajacharya. 456 pgs. 1867. Sanskrit. Varadaraajaachaara~yaa... Lakshmisahara. Religion.. Sanskrit. Sanskrit. Unknown. 2000. Sudarshanacharya Tripathi. Natural Sciences... Shriidevaraaja. Theology.. 328 pgs. Venkatadhvari. Pandith V. Linguistics. 0. Unknown.. Unknown.. Linguistics Literature. Religion. Language.. Madhusudan Kaul. 1954. 1931. 1988.. Sanskrit.. 1983. Laghu Shabdendu Shekar. Sanskrit.. Sanskrit. Unknown. Latkamelakamu. Laghurkatantrasamgraha And Samasaptalaksana. Laghu Sabdendu Sekhara. Theology. 1962.. Diiqs-ita Vaasudeva. Religion. Acharya Krishan Mohan Shastry. Dasharadhi.. Lakshmisahasra Vol Iv.. 0. 1940..

vinayak ganesh apte. 187 pgs. Maan'nd-d'ukyopanishhada~ Taittiriiyapanishhada~ Aavrxtti Pahilii. Sanskrit. Madanamaharnava. 182 pgs.. 266 pgs.. P S Subrahmanya Sastri. Sanskrit. Sanskrit. Shriinivasaachaara~ya Laqs-miipurama~. Literature. sanskritdocuments.. Aapat'e. Geography.. Sanskrit. Korat'akara Vit't'alakeshavaraava. Ma.. Sanskrit. Unknown. 1812. Shriinivaasaachara~yaa Laqs-miipurama~.... Geography. 146 pgs.. 491 pgs.. Sanskrit. 1947. Unknown.. Bid'e Sadhaashivashaastrii. Unknown.. Unknown. Linguistics. 501 pgs. Natural Sciences.. Sanskrit. Kulakara~nd--ii Ran'ganaatha.. Maalatiimaadhavama~. Sanskrit. Geography. History. 1953. Leelavathi.. 1928. Pandith Ravi Dutt. Literature. Sanskrit. Lectures On Patanjalis Mahabhasya Vol I I I.. Religion.. Sanskrit. Liilaavatii Pura~vara~dharupam Prathamo Bhaaga. 0.… Madhavanidan Vijayarakshita And Shri kanthadatta Unknown Sanskrit 1932 792 pgs 30/167 . Madanpalnidhantu. 1926. Linganusasana Of Durgasimha. Biography. Literary Circle Of Mahamatya Vastupala And Its Contribution To Sanskrit Literatute.2/14/2011 A list of scanned Sanskrit books at III… 1951. Tekumalla Achyuta Rao. Sanskrit. 1913. 104 pgs. 1924. 268 pgs..org/…/SanskritIIIT. Sanskrit.. 327 pgs. Chaara~yaa Vyaakarand-a. Literature.. 1937. 326 pgs.. 178 pgs. Language. Maadhaviyaadhatuvarittii. bhogilal. Unknown... 1925. Sanskrit. Maanavii San'skrxtiicha Itiihaasa.. Sanskrit. 491 pgs.. Theology. Biography. 1952. Linguistics. Maanavaa Grxhayasuutraa.. Psychology. Psychology. 677 pgs. Biography. 194 pgs. Maanameyarahasyashlokavara~tikama~. Sanskrit. Linguistics. Gaan'dhii dara~shana~. Harsavardhana. Sanskrit.. Maajhaa Sn'giita Vyaasan'ga. Unknown. Life of Pingali Suuranaarya. Maanameyaarahasyashlokavara~tikama~ Sakalashaastrasaarasan'graharupama~.. Shriibhavabhuutii Mahaakavii. Maalati Maadhava Sekand'a~ Ed'iishana~.. 1934. Vinayak Ganesh Aapte... Religion. Linguistics. Shriimadbhaskaraachaara~yaa. Maalatiimaadhavan' Naamaprakarand-ama~. Natural Sciences. 277 pgs. Language.. Geography. 1955. Unknown.. Philosophy. 314 pgs. Sanskrit. Philosophy.. Maajhii vilaayatachii Saphara~.. 115 pgs. Liilaavatii Uttarara~dharupo Da~vitiiyo Bhaaga. Theology. Biography. 685 pgs.. sri visvesvara bhatta. 0. Kara~ve Chintaamand-agand-esha. Sanskrit. 1937. Geography. Literature. Unknown. 314 pgs.. Sanskrit.. Sanskrit. Sanskrit. History. Sanskrit. Lokaprakasha Of Kshemendra. 1953. Literature. 1931... Unknown. Sanskrit.. 1944. 0. 1951. 150 pgs. Devadhara. Language. Language. Linganusasana.. History. Pandit Jagaddhar Zadoo Shastri. History. Shriimadbhaskaraachaaryaa. Maara~ka T'a~vena... 474 pgs. 448 pgs. 270 pgs. 86 pgs.. 374 pgs. Shaastrii Raamaakrxshhnd-a Hara~shaajii. Language. Leelavathi Uttarshorupo Dwithiyo Bhagah. 1930.. Biography.. Sanskrit. History. Linguistics. 1931. T'en'be Govin'da. 1948. Dattatrey Gangadhar Koparkar. 1935. Bhavabhuuti.. 120 pgs.. Sanskrit. 1946..

Biography. 1969. 1940. 1924. Pand'e Siitaaraama Vasudeva. P.2/14/2011 A list of scanned Sanskrit books at III… Madhavanidan. Literature... 710 pgs.. Linguistics.. 1912. Shriimanniilakand-t'ha. Vipushhpadantaa Mahaakavi. Unknown. Unknown.. Madhyakaumudini Rahasyam Prashnottari. 0.. Mahaaraaja Shivaajii. 104 pgs. 1954... Madhavnindanam.. 1984. Gaddangadevi. 1086 pgs. Unknown. Language.. Sanskrit. 456 pgs. Sanskrit.. Linguistics. Sanskrit. Vijayarakshita And Shri kanthadatta.. Mahaapurand-ama~ Da~tiiya Khand-d'a. Sanskrit. Sanskrit. 198 pgs. Madhyanta Vibhanga.... Sanskrit. Language. 590 pgs. Sanskrit... Psychology. sri madhuvakar. Sanskrit. Unknown. Sanskrit.... Biography. Religion.. Sanskrit.. Linguistics. Bhagavan'ta Bhad'aaraya Bhuudabali. 84 pgs. 385 pgs. 832 pgs. Vasubhandu And Sthiramati. Language.. Literature. 162 pgs. Keshani Prasad Chaurashiya. Sanskrit. Mahaaban'dho Bhaaga 2. Phool Chand Siddhanth Shastry. 1919. khemraj Shri krishnadas. Sanskrit. Mahaanaarayand-a. 1992..... 444 pgs. Sanskrit. Sanskrit. Sanskrit. Linguistics. 70 pgs. Language. 1930. Sanskrit. 1835. 1931. 406 pgs.org/…/SanskritIIIT... 0. 792 pgs. History. 503 pgs.. Mahaapuraand-ama~ Uttarapurand-aada~vitiiyaara~dhabhuutah Trxtiiya Khand-d'a. Geography.. Literature. Mahaabhaarata 13 Anushaakanapara~va. 176 pgs. 741 pgs. 454 pgs. Theology. Unknown.. Madvanidhan.. Mahaabhaaratama~ Prathama Bhaaga Viraat'apara~vama~. 520 pgs.. Sanskrit. Madhavanidana.. Pandith Sri Ramchandra Bhatt. 172 pgs. 180 pgs.. 170 pgs. Madhyakalin Hindi Sant Vichar Aur Sadhana. 1953. 601 pgs.. 1888. 408 pgs. Language. Religion. Mahaanaarayand-a Upanishhada. Psychology. Philosophy. Raghuviiraa. Sanskrit. 1953. Sanskrit.. Unknown. Sanskrit. madhakara. Philosophy. 0. Unknown.. Geography. 1965. 1983. Maha Bhashyam... Dr Hari Narayan Dixit. Madhavanidhan. 1986.. Sanskrit. Mahaabhaaratapraveshikaa. 0.. History.. 448 pgs. Saradaranjan Ray Vidyavinodha. Mahaabhaashhyama~ Prathama Grantha. Ganga Devi. Maghas Sisupalavadham Canto I I Edition V I. Shriimadappayyadiiqs-ita.. Theology. Mahaaban'dho Pustaka~ 3. 589 pgs. Maenkavishwamithram. 1951. 92 pgs. Unknown. -..chaudika prasad sharma. Pushhpadantaa Mahaakavii. 1992. 1956. Madvanidhanamu. Literature. Sanskrit. Unknown. Sanskrit. 1936.. Sanskrit. Maha Bandho Vol Iii Book Iv. Madhura Vijaya Or Virakamparaya Charita. Sanskrit.. Bhuda~bali Bhagavan'ta~. Madhyama Kavatara Par Candrakirti. Madhvatantramukhamara~danama~. Sanskrit. Saatalekara Daamodara. The Arts. 1932. Literature.… 31/167 . 1931. 596 pgs.. Unknown. Unknown. Mahaabhaaratama~ Sat'iikama~ Chatura~to Bhaaga Drond-apara~va. sanskritdocuments.. Kaand-e Pii Vii. Sanskrit... Unknown. Unknown.. 1941. Unknown... Valle poussin. Linguistics.. Manmukundamuni. Madhura Vijayam. Literature. Sanskrit. Social Sciences. Sri Vrajwallabh Sharmana.

. 1986.. Sri Sheshraja Sharma Shastri. 0... Mahaarashhatra Itihaasaman'jarii. Unknown... Unknown. History. Mahabhasya Praskash. Geography. Biography. 556 pgs. 1989. -. Sanskrit. Sanskrit. Unknown. 1931. 280 pgs. Sanskrit. 1998. Malavikagnimitram. 153 pgs. -. 274 pgs. Sanskrit. The Arts. History. Sanskrit. Sanskrit. Swami Dwarikadas Shastri. Anundoram Borooah. Sanskrit. Sri Anjani Nandan Sharan. Maharaja Bhojarajas Sringar Prakasha.... History. Aapat'e Dattaatrayavishhnd-u.. 744 pgs. Sanskrit. 1926. Unknown. Mahaviracharita Of Bhavabhuti. 486 pgs. Sri Ramachandra Mishra. 1969. Mahartha Majari. Unknown. Spiritual Experience And Mysticism. Unknown.. 0.. 670 pgs. Unknown. 360 pgs. -. Unknown. Unknown. Mahakavi Bhasas Swapna Vasavdatta Natak. 502 pgs. Acharya Sri Ramachandra Mishra. 354 pgs. Sanskrit. Unknown. 0.. Sanskrit..... 1990. Mahapurana Vol Ii Uttar Purana. 1845. Biography.. 290 pgs. M. 232 pgs.. Sanskrit. Madhukanth. ramkumar rai. Unknown. Sanskrit. Unknown. Mahabhasyam. Sanskrit. 537 pgs. Shri Yogendra. 315 pgs.. 1929. Malatimadhava. Majjhi Manikaya Vol 2. Sanskrit. Sanskrit. 1941... Satavalekar. 285 pgs. Sanskrit. Mahavira Charita Of Mahakavi Sri Bhavabhuti. 1993. Bhuutabalibattaraka Bhagavan'ta~.. Mahabharata Tatparya Nirnaya With Comm Anandha Thirtha. Unknown. Sanskrit... Mahaban'dho Prathama Bhaaga. Sanskrit. 1968. Mahaviirachacharitaa.. Sanskrit. -.. Pandit Guru Prasad Shastri. Sanskrit.. 750 pgs. Unknown. 1951. Sanskrit. 709 pgs. Mahabharatha Kosha.. 334 pgs. 166 pgs. Mahabharathmarmagya Varnasi Subhramya Shastry.. Mahaveera Charithramu. . Mahabharathvachanamruthm. Religion.... Maharajas Sanskrit College Magzine. Religion. Unknown. Sanskrit. 420 pgs. H Mhpohobs.. Unknown. P.... Mahavyutpatti. Gaan'dhiijii Mohana~daasa~karama~chanda~.. Biography. G R Josyer. 370 pgs. Maitrayani Samhita. Sanskrit...… M h t Of Th M it i S kh R ki h H h ji S ti U k S k it 32/167 . Majjhi Manikaya Vol 1. Sanskrit. Sanskrit. 790 pgs.2/14/2011 A list of scanned Sanskrit books at III… Mahaaraashht'a San'ta Kavayitri. 378 pgs.. Unknown. Sanskrit. 1954.. 1911. Mahaatmaajiin'che Satyaache Prayoga Athavaa Aatmakathaa. Theology.. Mahanirvana Tantra Vol Xiii with The Commentary Of Hariharananda Bharati. 1982. Sanskrit. 1947... Shastri. 269 pgs. 0. 0. Aajagaan'vakara Jagannatha Raghunaatha. 164 pgs. Unknown. 0. 0.. 765 pgs. 1949.. 284 pgs. Unknown.. Bhaavabhuuti. Unknown. Malavikagnimitram A Play In Five Acts.. Sanskrit. . Sanskrit. Malavikagnimitram. 1955..org/…/SanskritIIIT. Swami Dwarikadas Shastri. Unknown.. Mahabharathtatvadeep. sanskritdocuments. Sanskrit.. Geography. Theology... 77 pgs. Sanskrit. 1951... Mahabharathamu. 0. 1918. Manasa Piyush Sundara Khanda. 597 pgs.. 422 pgs.. Geography. Pandith Sri Ramchandra Mishra.. Pannalal Jain. Mahabhashyam.r. Sri Charudevshastryna. 503 pgs.. Unknown. 1951. -. Vayu Purana.. 1918. ..

Unknown. Literature. 1962.. Sri Harish Shankar Sharmana. Manormaratnavivek Vol Iv.. Language. 2002. Raajaa Kun'haana.. 302 pgs.... Literature. Unknown. Mruschakatika. 274 pgs... Hira Lal Jain. Miimaan'saadara~shanama~. 114 pgs.. -. Literature. Sanskrit. Medhdutam. Unknown.… 33/167 .. Mudraraksasa First Edition. Mrxgaang-kalekhaa Naatikaa.. 0. Sanskrit.. Language... Unknown. 1969. Meghaduta of Kalidasa Text With English Translation amp Notes. Dr Ramashankar Tripathi. 1929. 1911. 335 pgs.nandargikar. 1937.. Sanskrit... Unknown. G. Mimamsabalaprakasha Of Sri Bhatta Shankara. 49 pgs. Philosophy. 1970. 0.. Muhoorta Depika.. Sanskrit. 0. 0... Mayurasandesa. Mudrarakshasam.. 632 pgs. Linguistics.. 1902. Mayadprajaichariu. Unknown. 1961. Sanskrit. Deva~ Shriivishvanaatha.. 220 pgs... Sanskrit.. Unknown. Unknown. 1948. Unknown. Philosophy. 174 pgs. 690 pgs. 540 pgs. 1918. Sanskrit. Mayuura Sandesha. 2002. -. Dr C Kunhan Raja. Sanskrit... Sanskrit. Meghadutam. Unknown. 308 pgs. Unknown.raghavacharya. Meghavijayopadhyayas Digvijaya Mahakavya. Sanskrit. 374 pgs. Sanskrit. Unknown.. Literature.v. Minorworks Of Ksemendra. Sri Mukunda Shastri. Mimamsa Shastram.. 185 pgs.. Vishaakhadatta. 760 pgs. 1879. God'abole Krxshhndaajiiballaala... Sanskrit. Sri vidyanth Jha. 203 pgs.. 1926. Sanskrit. Psychology. Mandukya Upanished. 94 pgs. Shalaram Dwivedi. Mishra bandhu vinod. 1982. Literature. Sanskrit. 1944... Muhatri Chintamani. Maunt'ast'uara~t'a Elfinst'ana Saaheba Yaan'chen' chariitra Pura~vaara~dha. khemraj Shri krishnadas. Sanskrit.. 306 pgs. E.. Manusmruthi. 0.. Mudraraaqs-asa Prathama San'skarand-ama~. Unknown. Manthrardha Deepika. 2001. History. -. Shukadev Bihari Mishra. Kavi Shriikrxshhnd-aa. Unknown. Biography. -. 318 pgs. Mudrarakshasa Or The Signet Ring A Sanskrit Drama In Seven Acts... Sanskrit.. 333 pgs. Sanskrit. Shyam bihari Mishra. Upanishads. 0. 178 pgs. Sanskrit. Markandeya Samhita. 195 pgs. Sanskrit. 372 pgs. 0. 235 pgs. Sanskrit.. 1915. Sanskrit. Sanskrit.. Apte. Jaimini.. Jaya Shankar Lal Tripathi.g.. Linguistics. Geography. 1944. Unknown.. Sanskrit... Sanskrit. gagaavishhnd-a shriikruushhnd-adaasa.. V.. Linguistics. Unknown.. Psychology. Linguistics. Unknown. 230 pgs. Sanskrit.. 702 pgs..r. Kashmorey Dwij Sri Prannath Pandith.. Language. Literature. 200 pgs. Sanskrit. 0. Visakhadatta. 583 pgs. Sanskrit.. Unknown.v. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Manavagrhyasutra Of The Maitrayaniya Sakha. Sanskrit.. 330 pgs. Religion. 1984. Sanskrit. 1923. Ganesh Bihari Mishra. Ramakrishna Harshaji Sastri. sanskritdocuments. 1921. 1924. Theology. Mudra Rakshasam. Marcandeya Purana. Saradaranjanray Vidyavinode. Language. 184 pgs. 128 pgs. Megh Dootam... 62 pgs. Mandaaramarandachampuh. Sanskrit. -.org/…/SanskritIIIT.. Mrcchakatika of Sudraka. Sri Shathragna Mishra. Sri Haridas Siddhanta Vagosha Bhatta Charya. Sanskrit..

Literature. 1987. Literature. Unknown. Chand baradai... C. 0.. 4-6.devarshi Sandhya Shastry. Mysticism And Symbolism In Aitareya And Taittiriya Aranyakas. Nagari Pracharini Granthamala Series No. 162 pgs. Literature.. Sanskrit. 168 pgs. Linguistics..org/…/SanskritIIIT.. 358 pgs. Sanskrit.. 1950. 1992. 790 pgs. Sanskrit.. Natural Sciences. Naagakumaaracharita. Baalakrxshhnd-akulakara~nd-ii Purushhottama~.. 194 pgs.. Unknown.. History. 1934. Sanskrit.. 1906. Unknown. Sanskrit.. 4-10. 1331 pgs. 0.d. Mund-d'akopanishhata~ Grantha 9. Mulamadhya Makakarikas... Sanskrit. Sanskrit. Linguistics. Linguistics... 1937. Chintaamand-i Ti Raa. 452 pgs. Geography.. 1907. Literature. Biography. Naagapura praan'taacha Itihaasa. Philosophy..chakraberti. Sanskrit. Sanskrit. 1906. Sanskrit. Unknown. 210 pgs. Chand baradai... 1929. Unknown. Technology. Pandith Sri Guru Prasad Shastry.2/14/2011 p g g A list of scanned Sanskrit books at III…gy g pg Muhurtha Chintamaani. Nagari Pracharini Granthamala Series No. 135 pgs. Chintaamand-i. 680 pgs.. Sanskrit. 170 pgs. Language. Nagananda Edition I I. Sanskrit. 492 pgs.… 34/167 . 384 pgs. Sanskrit. Language.. 4-9.. Psychology. Dr. Unknown.. 0. Maadhavakaale Yaadava. 178 pgs. 0.. 1988. Pada~mashrii. -.. Sanskrit. 1985..b. 1933. Sanskrit. 1927. Pushhpadanta Mahaakavii. 1962. 111 pgs. Unknown. Linguistics. 567 pgs. Naat'a~yadara~pand-ama~ Prathamo Bhaaga. Sanskrit.. 1927. Unknown.. Sanskrit. S k it 1984 554 sanskritdocuments.. 131 pgs. Unknown. 290 pgs. Unknown. Sanskrit. Language... Theology. 1933. Sanskrit... 206 pgs. Sanskrit.. Naaraayand-aguro. jyeshtarama mukandaji.. Myths And Races Of The World. 1937. Kaviatan Pandit Shiv Dutta. 0.. m m pandit sivadatta dadhimatha. Naanaathara~ San'grah.. Sanskrit.. 92 pgs.. Namalinganusasana Alias Amarakosa Of Amarasimha. 276 pgs. Unknown.. P V Ramanuja Swami. 67 pgs. Sanskrit. Sanskrit. 0.... Naisadhiyacaritam Of Mahakkavi Sriharsa. Naishaddhiya Charita. 1469 pgs. 173 pgs. 4-8. Literature. Biography. 4-8. Nalopakhyanam.dhawan.... Chand baradai. Nagari Pracharini Granthamala Series No. 1941. Sanskrit. Sanskrit. Naamalid'agaanushaasanama~.. Religion. Literature. Unknown. Linguistics. Valle Poussin. 1953.. Language. Dhanj-jaya Mahaakavi. 132 pgs. Geography.. Naathamaadhava Trot'aka Charitra va Aat'havand-ii. Sanskrit. Literature.. Naaraayand-aguro San'skrxtakrxtayaa. Sanskrit.3. Sanskrit. Unknown. 1934. 1926. Nalopakyanam Dwithiya Khandah. Nagari Pracharini Granthamala Series No. Naanaara~tha San'grah Grantha 10. Bhat't'a Qs-irasvaami. Literature. 674 pgs. Jagdamba Prasad Sinha. Gunasaan'dra and Raamachandra. Literature. Chand baradai. Dr.. 236 pgs. Literature.. My Prayers Vol. History.. Naagarasara~vasva Kaamashaastrakaa Apuura~va Gran'thaa. Naamamaalaa. Naisadhiyacharitham Canto12 22 Uttarardha. Dr Jagdamba Prasad Sinha.. Aapat'e Hari Naarayand-a. 78 pgs. Language.. 1906. Nagananda Natakam. Chand baradai. Dr Devarshi Sanadhya Shastri.. Nagari Pracharini Granthamala Series No.

. Literature. 64 pgs..s. Ramakantha. Sanskrit. 1924. 1983. Sri Daivagyadunichandratmajapandit. Sanskrit. 1984. 1926. Naradh Puraye...org/…/SanskritIIIT. 772 pgs. 420 pgs. Unknown. Theology.. 218 pgs.. Unknown. 1994.. Unknown. Sanskrit. Sanskrit. 1961. Nispannayogavali.. 471 pgs.. Natya Sastra Sangraha Vol I.. 422 pgs. Nanarthasangraha Of Ajayapala. Unknown. 392 pgs. Bhattacharya.. 1928. Unknown. Narayankruthvruthisametamashrav Layan Shauthsutram. 1917...abhinavabharati 1.. Language. Dr.. Niruktan' Dditiiyo Bhaaga. m ramakrishna kavi. 367 pgs. Sanskrit. Sri K Vasudeva Sastri. 1953..ravishankar Nagar. 748 pgs. Makara Bhad'aka.sankara Ramashastri. Unknown. 506 pgs. 446 pgs. 144 pgs. sanskritdocuments. Sanskrit. Unknown... 0.. 219 pgs... Natyasastra With The Commentary Of Abhinavagupta Vol 3.. Sanskrit. 1930. 1949. Dr.. Linguistics. 1926.. Natya Sastra Of Bharatamuni 3.. Narasinha Puranam. Nirakttama Da~vitiiyo Bhaaga.. Sanskrit. Bhat't'a Kamalaakara.. Kulakara~nd-ii Ekanaatha Dattaatreya. Unknown..r. Nanartha Samgraha. Nira~nd-aya Sindhu. Sanskrit. Nilakanthavijaya. Hari Narayan Aapte. 1969. Nareshvarapariksha. Natyashasrta Of Bharathamuni Vol Iii. Unknown. Sanskrit. Unknown.. Pandith Shivduttsharma. Natyasastra Of Baratamuni. Sanskrit. 562 pgs. Unknown. 222 pgs. Sanskrit. Unknown. 560 pgs. Sanskrit. Sanskrit. 0.. K Sambhasiva Sastri. 366 pgs. Sanskrit.r. Social Sciences.. Literature. 0. Sanskrit. 1994. C. Nighantusesa. Niruktam. 129 pgs. Sanskrit. 474 pgs. Namamalikaa Bhojaa. Unknown. Religion.. Nirnaysindhu Vol Ii. 230 pgs.saini. Literature. Abhinava Gupta Charya. Sanskrit. K Vasudeva Sastri. Abhinavaguptacarya. Literature. Sri Kamalakar Bhatt... Navaratnavidhapadhathi. Unknown.. Nitidvishashtika... Sanskrit.. Niilamatapurand-ama~. Unknown. 1941.. Unknown..s. Unknown.. 300 pgs.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit.. Unknown... 1942. Natyashasrta Of Bharathamuni Vol I I. embar krishnamacharya...... 764 pgs. Language. 1934. -. Sanskrit. Sanskrit. Abhinava Gupta Charya. 1949. 1954. Linguistics. Sanskrit... Nishkarma Siddhi. Sanskrit. Unknown. Rama~lala~ Kanjilala~ Yama~ Hecha~. 1986. acharya hemachandrasuri s. Sanskrit.. Literature. 972 pgs. Narayaniya Of Narayana Bhatta.. Sri Prem Vallbh Tripatisha Thran. Sanskrit. 1984. Unknown. Sanskrit.. 340 pgs. 420 pgs.. Linguistics. Shriimadhyaaskaachaaraya. 344 pgs. Language.. Unknown. Sanskrit.. 146 pgs.. 1968. Nanjarajayasobhusana Of Abhinava Kalidasa. Unknown. T R Chintamani.. Natya Sastra Sangraha Vol Ii. Sanskrit. Sanskrit. Natyasastra Of Bharatamuni Vol Iv. Language. Unknown. Sri Madanthram Shastry. 204 pgs. 1937. Sundara Pandya.… Nitiprakashika Vaisampayana Unknown Sanskrit 1953 135 pgs 35/167 . 1986. 1955. 0. 554 pgs.. Anundoram Borooah. 0. Linguistics.nagar. 556 pgs. 162 pgs. Sanskrit. Dr. Niteshatakam. 1984.

Language.. 0. Nitya Kamya Karma Mimamsaa. Nyaayasudhaa Faskikyulasa~9... Literature.. Nyayabhindu. Sanskrit.. Nyayabhindu Of Dharmakirti. Nyayamritakulya. vallabhacharya.... 119 pgs. Sanskrit. 249 pgs. Sanskrit. Sanskrit. Linguistics. Vyallabhacharyya. Language. Sanskrit. E. 849 pgs. Unknown. Shriimadudayaanaachaara~yaa. Shriidhara~mottaraa Chaara~ya. Sanskrit.. Sanskrit. 1932. Philosophy.. 1909. 1938. 1936. vallabhacharya.. 135 pgs. Vishwanathvritti. -. Religion.. Sanskrit.8.. Literature. 2000. Unknown.. -. Nitiprakasika. 1990. 102 pgs. Sanskrit. 58 pgs.. Linguistics. 1916. Unknown. vallabhacharya. Mahadeva Sastri.. Theology. Shastrii Raamasubramand-yama~. 1938. 184 pgs. Sanskrit. Sanskrit. Nyaayakusumaan'nj-jali. Nyaya Lilavati Vi 6. 666 pgs... Kumaara Nyaayaachaara~ya Mahendra. 1948. Sanskrit. Sanskrit.. 112 pgs. Nyayadarshanamu. 1919. Unknown. Unknown. Unknown.. 118 pgs. 1933. 41 pgs. Philosophy.. 1927.... Nyaya Lilavati Ii 2. 1907. Sanskrit.. Sanskrit. 1953. 1954. 1985. 243 pgs. 1927. Unknown. Philosophy... Nyayabhindutikatippani... Unknown.. Sanskrit. 216 pgs. 106 pgs. 1992. Sanskrit. 1990. 216 pgs.. Unknown. Shukla Sri Raja Narayan Sastry. Indian Logic. Philosophy. Sanskrit. Sanskrit. Nyaayabhaaskarakhand-d'anama~. Sanskrit. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Nitiprakashika.. 96 pgs.. 1929. 36/167 . 1909. Sanskrit. Nyaya Lilavati Viii . Vaisampayana. Nityotsava Vol Iii.. Goswamy Damodar Shastry. 1932. Unknown. Literature. Sanskrit....org/…/SanskritIIIT. Remella Suryaprakasa Shastri. Bhat't'asomeshvara. Unknown.. Gopinath Kaviraj. Psychology. 155 pgs. Sanskrit. .. Nrsimhtyasya Prayoga Parijatasya Sodasa Samskara Kandam Pakasamstha kanda Samksepasla. Unknown. 186 pgs. Unknown.. Remella Suryaprakasa Sastri. Sri Ananda Bodha Battaraka Charya. Unknown. Sanskrit. vallabhacharya. . Nyaya Makarandaha. 236 pgs. Nyaaya Kumuda Chandra Dditiiyo Bhaaga. Literature.… Nyayamrtatarangini 686 16383. Nitya Kamya Karma Mimamsa. 1941.. 355 pgs.obermiller. 134 pgs. Sanskrit. vallabhacharya. 971 pgs. 1904.. E.. Religion...obermiller. Psychology.. Nyaya Kumud Chandra Vol-i. Mahendra Kumar Nyaya Shastry. 872 pgs. 1992. . Sanskrit. Nyayadarsana.. Nrisinha Prasada Tritha Sara. 388 pgs. Nyaya Lilavati V 5.. 332 pgs. Sanskrit. Sanskrit. 1940. Aapat'e Gand-osha Vinaayaka.. Unknown. 1955. 608 pgs. Nyasakalpalata.. Nyaayasudhaa.. Sanskrit. Nyaya Lilavati Vii 7. 1902.. Psychology. 102 pgs. Unknown. Psychology. 115 pgs.... Sanskrit. Sanskrit. Gustav Oppert.. Tukaram Javaji. Unknown. 1932... Someshvara Bhat't'a. 1992. 153 pgs.. Sanskrit. 110 pgs.. Unknown. Philosophy.. Psychology. Dwaita Philosophy. Nrxsin'hapuuvauttarataa Paniiyopanishhata~. 110 pgs. Padamunnur Sri Narayanacharya. Nyaya Lilavati I 1. 328 pgs. Unknown... 1929. sanskritdocuments. Nyaayabindu. Theology. Nyayamrithaha Sudha chandrika.. 108 pgs. vallabhacharya.. Nyayabhindu Of Dharmakirti And The Nyayabindutika Of Dharmottara. 0. Nyay Lalavati..

Religion. Paashhara~dasuutrama~.. Sanskrit. 134 pgs. Sanskrit. Pan'chasan'graha. 660 pgs. Shaunakamahaamuninaa Bhagavataa. 1953. Religion. 422 pgs. Religion. Padakavya Ratnakara. Sanskrit... Padya Mala.2/14/2011 A list ofLinguistics. Panchampushpam V. Unknown.. Padhamanjari Pradhama Bhagamu.... 1981. 230 pgs. Language. 380 pgs. 157 pgs. gandanatha jha. Sri P P Vasudevanand Saraswathi Tembeswami. Shriimadamitagatyaachaara~ya. 1922. Unknown. 1971. Anantha Charyar. Literature. Nyayasiddantamuktavali Of Viswanathapancanana Bhattacarya... scanned Sanskrit booksSanskrit.... Pandit S. 252 pgs. Sanskrit. Unknown. Sri Haridatta Misra. 1984.org/…/SanskritIIIT. 1937. 132 pgs..s.. Haribhaskara. P i ht k Utt dh P dith S i Y t d tt t ibhi U k S k it 0 380 sanskritdocuments. Literature.. 1952.... C R Devadhar. Psychology. 554 pgs. Nyayaratnamala Of Parthasarathimisra. Sanskrit. Linguistics. Sanskrit. Sanskrit. Sri Jaya Tirtha. Sanskrit. .. 1973. Sanskrit. Pandit Ramgopala Shastri. Unknown. Dr. Unknown. Padhyapushhpaanj-jali. Unknown. Padit Raj Jagannath Mahakavi. Sanskrit. Padhamanjari Dwithiya Bagamu.. 1939. Viiraraaghavaachaara~ya Mund-aluura~. 1984... Padyamrta Tarangini. 152 pgs. 1953. Sanskrit. Sanskrit.. 757 pgs. 254 pgs. Sanskrit. 83 pgs. 1904.. Sri Haridatta Misra. Unknown. Maniantha Misra. Sanskrit.. Sanskrit. 1951.. Unknown. 0.. Unknown. 1983.r.. 434 pgs. 311 pgs.. Dr. Sanskrit. Sanskrit. Padukapattabhisekam Of Narayanakavi. Biography. 258 pgs. Dr K S Rama Murthy. 386 pgs. K Surya Narayanashastri.. 283 pgs. 1940. Pancaratram. Unknown. Sanskrit.ramaswami Sastri Siromani. 210 pgs. Geography. Unknown... 1954.… 37/167 .b. 534 pgs. . 249 pgs. Panditaraaja Jagannatha. Nyayasutra Of Goutama. Unknown. Sanskrit. History.krishna Murthy. 392 pgs. Sanskrit... 777 pgs. 274 pgs. Sarasvatii Vaasudevaananda.. Khaad'ilakara Shrii Krxshhnd-aajii Prabhaakara..gajanana Shastri Musalagaonkar. 68 pgs. Language. Sanskrit... 1990. Unknown. Sanskrit. 1941. Nyayasastra With The Commentary Of Abhinavagupta. 392 pgs. Sanskrit. 1953... Pan'chamapushhpama~ Kaavyadvayama~.. 1957. Nyayaratna. Unknown. Literature. Palkuriki Somanatha. Philosophy... at III… 0... m ramakrishna kavi.. 667 pgs. 702 pgs. Theology.. 1953. Nyayasiddhanta Muktavali. Unknown. Panchatantram Vol Ii. 0. Theology.. Language.. Sanskrit. Paand-inisutravyaakhyaa... 1981. Unknown. Pandit Bhanu Dattshastri.. Aara~yend-a Subrahmand-ya.. Sanskrit.. Linguistics Literature... 1927. Pandith Devdutt Sharmana. Pahile Mahaayudhda Bhaaga Tisaraa. Dr Smt Mudigonda Uma Devi. Sanskrit. Gajanana Shastri Musalagaonkar. 1934. P. Nyayarakshsmani Of Srimad Appayya Deekshithendra. Om Brihat Sarvanukramnika Of The Atharva Veda. 1941. Panditaraaja Kaavyasangraha Complete Works of Panditaraja Jagannatha. Nyaysutravaidikvruthi. Nyayamrtatarangini 686 16383. Theology. Linguistics. Unknown. 89 pgs. Sanskrit. Unknown. Sanskrit. . Unknown. Nyayasudha Sesavakyartha Chandrika Chapter 1 Subunit 4. 1958... K.

497 pgs. S Krishnaswami Aiyangar. 1940. 1923.. Pingala Acharya. Sri Pindagala Charya. 175 pgs. 200 pgs. 1972.. 97 pgs... 442 pgs. 1874. 252 pgs. Paribhashendushekar. Unknown. Unknown. Viraraghavacharya. Jinavijaya Muni. Bhat't'a Naagojii. Pashvaalambhamiimaan'saa.. Theology. Language. 1938. Sanskrit. Sanskrit.. Sanskrit. Sanskrit.. Sanskrit. 1938. 1931. 164 sanskritdocuments. 1990. Paramartha Prakasika. pandit bapudeva sastri. Aan'bekara Vishhnd-ubaapujii. Sanskrit.. S D Joshi. 1980.. Language. -. Pandita Viswanatha Shastri.... 1952. Unknown.. Unknown. Pandith Nityananda Panta Parvatiya. Valmiiki. Parama Laghu Manjuaha Of Nagesh Bhatt. Sanskrit. 694 pgs.. Unknown.. 624 pgs. Unknown. Sanskrit.. Unknown. Linguistics. Sanskrit. Ganesh Shankar Shukla. k r joshi s m ayachit. 454 pgs. Sanskrit. Prabandaha Cintamani Of Merutungacharya Part I. Sanskrit. Sanskrit.. Parijaat. Philosophy Of Poetry. Linguistics. Language.. Grammer. Sanskrit. Sanskrit.. 188 pgs. Shaastri Vaamana.. 1913. 0. 1957. Parameshwarpitha Slokamalika. 70 pgs.. Poona Akhbars Vol Ii. Sanskrit. srinatha pandita.org/…/SanskritIIIT. Linguistics. 322 pgs... Sanskrit. 252 pgs.. C Kunhan Raja... Literature. Pindagalachand Suthram. Unknown. Sanskrit. Post Independence Sanskrit Literature. 1935.. Philosophy. 0. Unknown. 323 pgs. Sri Nagesh Bhatt. Panj-chavin'shatisaahastrikaa Pranj-aapaaramitaa... Sanskrit. Sanskrit. Persian Sanskrit Grammer.. Literature.2/14/2011 A list of scanned Sanskrit books at III… Panineeyashtakam Uttaradharm. Tadnujen Sri Manmadhusudansharma. Paramaananda~. Pandith Sri Kapileswar Shastrina.. 132 pgs. 134 pgs. Narendra Nath Choudari. Paribhashedendushekar.. 436 pgs. 1959.. Pandith Sri Yutagnaduttasastribhi. 181 pgs.. 531 pgs. Paraamara~sha Khan'd'a 1. 1934... Natural Sciences. Panineeyasthakam Poorvadharm. Linguistics.. 380 pgs. Unknown. 334 pgs. Unknown.. 1940. Paninisutra Vyakhya Vol 1 Purvardhamu. Language. Literature. Unknown. D. 173 pgs. 112 pgs. 1946. Datta Nalinaaqs-a.. Paqs-chimottarashaakhiiyan' Vaalmikiiya Raamaayand-ama~ Kishhkindha Kaand-d'ama~. Religion. Unknown. Paqs-chimottarashaakhiiyan' Vaalmikiiya Raamaayand-ama~ Yuddha Kaand-d'ama~. 172 pgs.. Sanskrit. Ghosha Manamohana. Sanskrit. 1947.arkasomayaji. Pandith Sri Yutagnadutt Sastry. Unknown. Sanskrit. Sanskrit.. 1954. Literature. T. Literature... Unknown. Valmiiki.. Sanskrit. Parama Samhitha. Paqs-chimottarashaakhiiyama~ Vaalmiikiiya Raamaayand-ama~ Uttara kaand-d'ama~. Linguistics. 247 pgs.....… 38/167 . Sanskrit. Panini As A Variationist. Paramaanandakaavyama~. Religion... Viraraghavacharya siromani. 1944.. Sanskrit. Unknown... 1947. 0. Praakrxtashabdapradiipikaa. Pilibhit ka Sahitiyik Itihaas. Paniniya Shiqs-aa.. 334 pgs. 582 pgs. Sanskrit. 506 pgs.. 0.. Plane Trigonometry. Sanskrit. Theology. Praayashrvittendushekharah. Unknown. Sanskrit.. 1954.... Theology. 1936. Nrxsin'hashaastrii... Paribashendu Sekhara. 0. Parahita Samhita. 0. Harinarayna Apte. 172 pgs. 0. Sanskrit. 1916. Language. Natural Sciences. Literature. Sanskrit. Unknown.. 374 pgs. 245 pgs. Religion. Unknown.. Vaalmiikii. 1933. Sanskrit.

1951.. 128 pgs.. Prameyakamal Martand. Unknown.. Religion.. Shriimadabhinavachaarukiira~tipand-itaachaara~ya. Mishra Krxshhnd-a. 0. Linguistics. Philosophy. Sanskrit. Prakrta Prakasa. Prasadamandanam. Language. Prameyaratnaalang-kaara. Sanskrit. 1943. Prakrxtamand-idiipa Prathamao Bhaaga. P. Sanskrit. Sanskrit.. 346 pgs. 77 pgs... Unknown. 1936. 20 pgs.. Sanskrit. Psychology. 924 pgs. Unknown. sanskritdocuments. 441 pgs.. 1941..c. Sanskrit. 0. Sanskrit. Sanskrit. 652 pgs.shantiraja Sastri. Sanskrit.. 1948.. 176 pgs..org/…/SanskritIIIT. Sanskrit. 1978. Unknown. Prabandhakosha Prathama Bhaaga. Literature... Sanskrit. Pratima Natakam. Pramaand-avaara~ttikama~ Svaara~thaanumaanaparichchheda. Shriinaaraayand-a Bhat't'aprand-iitan.. 94 pgs. Prasaada Mand-d'anama~.. Sanskrit... 1935. 1931. 1992. E.… 39/167 . 142 pgs. Prameyaratnalankara. 265 pgs.. Sanskrit. Sanskrit. -..... 70 pgs. Unknown. Pandit... Mallikarjuna Shastri.. 107 pgs. Unknown.. Prakrutananda.Edition. Psychology. 164 pgs.obermiller. Sanskrit. 1955. 1932.. 1947. Religion. Sri Ramachandra Mishra. Sanskrit. Sanskrit. 1940.. 252 pgs. Dr P L Vaidhya. Prabhodhanaachandrodayama~. Literature. Unknown. Shriiprabhaachandraachara~yaa.. Sanskrit.. Jinavijaya Muni. Tallapally Muralidhara Gowd. 186 pgs. 152 pgs. Prakriyasarvasva Taddhita... Raghunatha Kavi. 1935. Narayana Bhatta. Haribhadraa. Sri Harishanker Mishra. Prashnopanishhata~ Grantha 8. Religion. Prasnopanisad Bhasya I I.. Mahendrakumar Shastriyna. 134 pgs. Literature. 262 pgs. Sanskrit.. Sanskrit. Theology. Unknown. 484 pgs. Linguistics. 186 pgs. Panditaratnam A. Theology. 1975. 1947. 676 pgs. Prameykamlamartand Vol Ii. Atalananda Sarasvati. Language. 922 pgs..... 1948.varadhachari. 1941. Prakriyaasavara~svama~. Religion. Aanandagiri. 0. Unknown. Prasnopanishad Bhasya. Unknown. 1953. Sutra Dharamandana.. 160 pgs. Unknown. Prabhu Lingaleela. Religion. 1981. Shriigovindaamrxbhagavaana~. Shri Prabha Chandra. Prashanamka choodamani. Technology. 1926. Sanskrit. Prapancha Sara Tantra Of Sankaracharya. 261 pgs. Prajna Paramitha Ratnaguna Samcaya Gatha.. 1932. 1954.. Appayya Diiqs-ita. Unknown. Theology. Sutradhaaramand-d'ana. Unknown.. Pradhama Padyamala.. Vijaya Jina.. Sanskrit. Unknown. Sanskrit. Ramaji Upadyaiah.. Prataha Smranmala. Prabhanda Chinthamani Of Merutungacharya Part 1. Theology. Language. Sanskrit.. 239 pgs. Prachina Sanskrit Natak. Literature.. Prabodhachandrodayama~. Prabhaavakacharita Prathama Bhaaga Muula grantha. Tantras.. Sanskrit. Unknown. Unknown. The Arts. Sanskrit. 722 pgs. Sanskrit.. Philosophy.. K. Punnasseri Nambi Neelakndha Sarma. 272 pgs. 252 pgs.. 1941.. Prajnaparamitasa~ Prathama Bhaaga Abhisamayaalad'a~kaaralokah. Sanskrit.. Sanskrit. 1994. Language. Sanskrit. Theology. gomi kara~nd-aka. 394 pgs. Linguistics. Pandit sri seetaramanga Jotishaclarya.. 1933..2/14/2011 A list of scanned Sanskrit books at III… pgs. 0. Prasnamarga... Linguistics..

Religion. Theology. Unknown. 1920.. Theology. 1929... 1989. Unknown. Prayodhya Kavyam. 1922. Sanskrit. Sanskrit.. Sanskrit. at III… pg Pratimaa Mana Laqs-and-ama~. 82 pgs. 1952. 0.shrikrishnamani Tripathi.. Ragavibodha. Unknown. Prem Pathanam. Proceedings And Transactions Of The First Oriental Confirence Poona... Ragatarangini.. Raamaayand-ama~ prathama khand-d'a.. 0.. Sanskrit. Bhagavad Datta.. 1908. Sanskrit. Unknown. Sanskrit. S... Raghuvamsam. 1931. Proceedings And Transactions Of The First Oriental Conference Poona Vol 1. 0. Unknown. Sanskrit. 1935. Sanskrit.. Biography. Unknown. A. Saradaranjay Ray. Da~vivedii Kapiladeva. 1930. a s altekar. Sanskrit. Sanskrit. 1945. Unknown. Literature. 936 pgs. History. Vaalmiiki. -. Language. Purascaryarnava.. Linguistics. 1999.gangaprasad... 0. 536 pgs.. Bosa Phanin'draa Naatha.. 1926.. Lakshminarasimha. Sanskrit.. 0. 118 pgs. Unknown. 154 pgs. A. sanskritdocuments.. Sanskrit.. 611 pgs.. 302 pgs. Unknown.. Sanskrit. Visvanatha Pandita. 226 pgs.. Purusharth Chintamani. Suryakanth Shastri. Purvakhandatmika Bhaktiyogaparisha. Purana Vishya Samnukramayaka. Sanskrit. Unknown.a.. Linguistics.. 163 pgs.... Sanskrit.. 1947. 348 pgs. Raghava Naishadhiya. Raghuvamsam Canto V. Late. Pt.2/14/2011 A list of .. 286 pgs. Muralidhar jha.. 451 pgs. Dr... scanned Sanskrit books .… Raghuvamsham. Proceeding And Transactions Of The Fifth Indian Oriental Conforence Vol I.. 730 pgs. Religion... 1985. Sanskrit.. 112 pgs. Pratyakruttatvachintamani Vol I. Proceedings And Transactions Of The All India Oriental Conference. Sanskrit.. Saradaranjanray Vidyavinode. -.. Sanskrit. Vasudev Sharma. Purva Mimansa Darsana.. Sanskrit. Sri Krishnaiah Panth Sastriye. Purva Kalaamrutamu..subrahmanya Sastri. Unknown. 369 pgs. Unknown. Unknown. History. 1935.. Sanskrit Religion. 40/167 . 1952. 1950... Theology. Raghuvamsam (canto vi). Unknown. 480 pgs... Unknown. Sanskrit. Purva Mimamsa. Literature.. 176 pgs. 1985. 0. 98 pgs. G. Sanskrit. Religion. 1979. Unknown. Unknown. 1927.. Dr. Sanskrit. Purushparthchintamani. Language.. Unknown. Kara~mara~kara~ Epi.org/…/SanskritIIIT. 1928. 1323 pgs. Geography.. Yashpal Tandon's. Sanskrit. Pandit Sivadatta. 626 pgs. G D Thukral. Unknown. Purana Panchalaksana. 246 pgs. 310 pgs. Qs-iira Ratagd'ind-ii... 826 pgs. Sanskrit. Miimaan'saka Yudhishht'hira. Sanskrit... Unknown. 490 pgs. Sri P. Raasabihaarii Basuun'che Kraan'tijiivana. Ranjit Sitaram Pandit. Sanskrit. Sanskrit. Raashht'a~ra Giitaanj-jali. 1875. 1945. 330 pgs. 492 pgs. Sanskrit. Unknown. 1993. Unknown.. 308 pgs. Sanskrit. Yagna Ramulu.shastry. 828 pgs... 242 pgs. Haradaasa Baalashaastrii Saahityaachaara~ya. Sanskrit. Mahadeva Sastry. Sri Madramkrishnabhattsunuvishnubhatt. Sanskrit. Raamaayana Of Vaalmiki Bala Kanda. Sri Sadanand Vidvadwirichith. 370 pgs. Social Sciences. 0. Premarasayana.. Puranika~ En'thalojy Puraand-a Kaavya Stotra Sudha. Bharatwaj. 82 pgs..

Unknown. 0. Satkari Mukhopadhyaya. Ram Swayamvaram. Unknown.Vaarasree. Ramayana With Three Commentry Tika.. 369 pgs. Satkari Mukhopadhyaya. Ramayana Of Valmiki Yudda Kanda. 795 pgs. 2001.. Ramayana Of Valmiki Vol Viii Index Of Verses. Sanskrit. 2002. Sanskrit. Sanskrit. Satkari Mukhopadhyaya. Psychology. Unknown. 0. 1983. 1983. Unknown.. Satkari Mukhopadhyaya. Sanskrit.c. Sanskrit. Ram Rasayan Ayodhyakand. Ramayana Of Valmiki Vol Vii Yuddhakanda. 317 pgs. Satkari Mukhopadhyaya. 0.. 2001. Unknown. 192 pgs. Sanskrit.. Rasa-jala-nidhi. Raghu Vira.. sanskritdocuments.. Sanskrit. pgs.. Philosophy. Mishra Brahmashan'kara. 0. 1955.. . 234 pgs. Temples. 1944. 1983... 845 pgs... Unknown.. Ramayana Of Valmiki Vol Ii Ayodyakanda.. 1983. 638 pgs. 1917. 168 pgs..ganapati Sastri. Unknown.. Sri P Ramachandraghna Vyakaranacharyah.. Ras Gangadhara. 164 pgs. Sanskrit.. 1983. 164 pgs. 2002.org/…/SanskritIIIT... 0. Ramayan Valmikiye Aadikand..shrikrishnamani Tripathi. 1915.. Raghuviracharata.… Rasagadagdar Rahasyam Sri madanmohan Jha Unknown Sanskrit 0 60 pgs 41/167 .. Sanskrit. 523 pgs. Unknown. Literature.. . 1983.. Unknown. Sanskrit.. 1935.. Unknown. Sanskrit.. Unknown. 1983. Sanskrit.. 481 pgs. Unknown. . Sanskrit. Unknown.. Satkari Mukhopadhyaya.. Temples. Sanskrit. 193 pgs. Unknown. Ramayana Of Valmiki Vol Iv Kishkindhakanda. 1895. Ramalashiktha Jyothish. 1992. Durgesh Singhal. 681 pgs. 354 pgs. . 0. 1965. 700 pgs. Kalhana.. Sanskrit. 706 pgs. -. . 112 pgs... Bhudeb Mookerjee. Rangaayana.. Ramayana Of Valmiki Vol V Sundarakanda... 1983... Sanskrit. 1902. Rangayan Vol 34 Jan-june 2001. 426 pgs. Jagannath Prasad Kayath. Sanskrit. Di Valmici. Religion. Sanskrit. at 730 pgs. Ramayana Of Valmiki Vol I Balakanda... Religion. 588 pgs. Sanskrit. 1260 pgs. Pandit Sri Bhadarinath Jha. Ramayana Of Valmiki India S National Epic. Kavignar ... 330 pgs. Ramayana Of Valmiki The Aranya Kanda. Sanskrit. Peeyush Darya. Unknown. 1950. Bhagavad Datta.. Rajagopalachari. Unknown. Sanskrit. Vishva Bhndhu Shastri.. Unknown. Ramayana. 612 pgs. Sanskrit. Rangayan Vol 34 Jan-june 2001. 1985... Sanskrit. Shripad Krishna Belvalkar.. Unknown. Sanskrit.m. Ramayana Ramabirama. Raja Tarangini.. .. Dr. Raghuvan'shamahaakaavyama~. Satkari Mukhopadhyaya. Sanskrit. 605 pgs... 1938. Unknown. 427 pgs.. Sanskrit.. Unknown. Rangayan Vol 34. 350 pgs. T.. Ramayana Of Valmiki Vol Iii Aranyakanda. 1934.2/14/2011 A list of scanned Sanskrit books III… Raghuvamsham. -. 164 pgs.. Sanskrit. Sanskrit. Sanskrit. 454 pgs. Bagaiah . Unknown. Raghuvamshamahakavyam. Satkari Mukhopadhyaya.. Ramas Later History Vol X X I. Sanskrit. Sanskrit. Unknown.. Ramayana Vol 3.. Ramayana Of Valmiki Vol Vii Uttarakanda. 460 pgs...

. Unknown.. Rgvedasamhita. Art.. 266 pgs. Literature.p. 94 pgs. Budhdabhat't'a Chand-deshvara~ cha. 82 pgs. 1955.. Religion.. V S Venkata Raghavacharya. Rasamanjari Of Bhanudatta. Sanskrit. 500 pgs. Sanskrit. Sanskrit. Unknown.lakshman Sarup. 220 pgs.. Unknown. 75 pgs. Sanskrit.kapali Sastry. Theology.. Rigveda Samhita..n. 0. Reader Ii.v.l... L Finot. 0. Unknown.s.sastri..k. Unknown. Unknown. Language.. Rigveda Samhita. Unknown. 1945. Vedas. Aryendra Sharma.....v. Ravi-vichaar. Philosarhy.. History.. Biography. Sanskrit. Ramgovind Trivedi Vedanthshastry... Ram Suresh Tripathi. 100 pgs. Sanskrit. Linguistics. Vidhydhar Johrapoorkar. 1941. Sanskrit....… 42/167 . 1314 pgs.. Haughton G. 1074 pgs. Language. Unknown. 332 pgs. 1204 pgs. Linguistics. Literature. Rg Bhasya Sangraha. Unknown. Reader I. Sanskrit. 1997. Unknown.. Dinakara Bhatta.. Sanskrit. Sri Rama Sharma. Srinarayan Misra. Ramasastri. Sanskrit.. Unknown. Unknown. Sanskrit. 116 pgs. N R Bhatt. Dr.. Unknown. 100 pgs. Allaraaja. Sri madanmohan Jha. K. Rauravagama Volume I.. K. Rasaviveka of Kavya Darsa. Remarks On The Sanskrit Passive. 0. 152 pgs. 241 pgs. 1946. Literature. Srit.. 231 pgs. 128 pgs. Sanskrit. Rgvedi Purva Proyoga..v. K. Sanskrit. Dev Raj Chanana. Linguistics. 1951. 552 pgs. Ratna Dipika And Ratna Satram... Rasendra sarsangra... 1152 pgs.. Rastrapala Pariprccha Sutra Du Mahayana. Unknown. 1951. 1974.. 1996. 1956..org/…/SanskritIIIT.v. Sanskrit. Rasagangadhara. Reader Iii. Rasamanj-jari faskikyuulasa~ 3. 1108 pgs. 1959. Unknown. Shriigovindabhagavatpaada..l. Rasahrxdayatantrama.v. 1951. Sri Mathsainacharyavirchitbhasyasameta.. 146 pgs. Sayanas Comentary. Unknown. Ravanarjuniyamu. 403 pgs.. J Gonda. 60 pgs. -. 1949. 1988. P. 129 pgs.. 206 pgs. Geography.. 134 pgs. Sanskrit. 354 pgs. sri bhattabeem. 0.. Religion. Sayanacharya. 133 pgs. Ratnadiipikaa Ratnashaastrama~cha. Sanskrit.. 1961.. Sanskrit.. Rediscovering India Manav Dharma Shastra Vol 30 I. Sanskrit. 0. Sanskrit. Rgveda Samhita Vol 4. Literature. Sanskrit. 964 pgs... Unknown. Bhaanubhat't'aa Shrii. Sayanacharya. 1965. Sanskrit.... Unknown. Rigveda Samhita Vol Iv Ix X Mandalas. 1961. Unknown.. 2001... 1927. Rigveda Samhita Vol Iii 6 8 Mandalas. Remarks Of Similes In Sanskrit Literature. 1987... 1951. Language. Rigved. Rasaratnapradiipikaa Gran'thang-ka 8. -. Late Dr.l. Narayana Sharma. 1868.. Rashtriya Panchang. 594 pgs. Sanskrit.. 84 pgs.. Sanskrit. sanskritdocuments. Rgarthasara Of Dinakara Bhatta Vol 1. Sanskrit. Sanskrit. Sanskrit. Sanskrit.. Theology. Unknown. 2001. 82 pgs. Unknown.. Sanskrit. Rgveda Samhita Vol-i.. 0. Sanskrit. Sanskrit.. Sudarsanacharya. Sanskrit. Sanskrit. Unknown.sastri. Rgarthasara Vol I. T. 148 pgs. Unknown..2/14/2011 A list of scanned Sanskrit books at III… Rasagadagdar Rahasyam.. 1904.. 1981.I. 1986. 1959.c. Gonda.sastri. Technology. 188 pgs. Regved Sanhita Vol. 1992. Sanskrit. Sanskrit..

. 429 pgs. Literature.. sanskritdocuments.. Sanskrit. Rxgvedaanukramand-ii Prathamo Bhaaga Grantha 2.. Rxgveda San'hitaa Trxtiiyo Bhaaga. Rxgvedaa Vyakhyaa Maadhavakara~ta. 0. 0. 352 pgs. Sanskrit. Ritriratna Prakash. Rxgaratna Bhaand-d'aara. 1219 pgs. . Language. 1939. Religion. 736 pgs.. Shriimadhavaa. Language. Theology. Sri Balayajnavedesvara. . Rxgveda San'hitaa Prathamo Bhaaga. Pramodhini Panda. 102 pgs. 1058 pgs. 770 pgs. 158 pgs. Theology. 1932. Rigvedasya Prathamamanadalasya Sayana Venkatamadhava Bhasyayos... Sanskrit. Sayanacharya.r. 1966. Rubaiyat Of Omar Khaiyam. Riksan'graah Trxtiiya Khand-d'a. Sanskrit.t. Rigveda. Sanskrit. Raajaa Kunahaana. Language. 1929. Sanskrit. 641 pgs.. Sanskrit. 2000. Religion. Rudradasas Chandralekha. Rxgara~thadipika Bhaaga 2. Sanskrit. Sanskrit. Unknown. 374 pgs. Dr A N Upadhye... 0.. Religion. Sanskrit. Religion. Sanskrit. .r.. Unknown. Shriimaadhavena Shriiven'kat'aara~yaatanudbhavena. Sanskrit. 1940. Sanskrit.. 176 pgs. Religion. Sayanacharya.. 1936. 1208 pgs. Aapat'e Hari Naarayand-a.. Rxgara~thadiipika Chatura~tho Bhaaga.. Rudrasthadhyayi. Unknown. Religion. Sanskrit. Santavalekara~ Shriipaada Daamodara~. Theology. Rxgveda San'hitaa Bhaaga 2. 450 pgs. 0. Shriimaadhavena Shriiven'kat'aara~yaatanudbhavena.. Theology. 1955.. Sri Pandith Jwalaprasad. Ramanand Divvedina. Vilsana~ Hecha~ Hecha~. Rxgara~thadiipikaa chatura~tho bhaaga. Krishnacharya. 1058 pgs. 1931. 362 pgs. Sanskrit.. Theology. Theology. Theology. Sanskrit.. Religion. Sanskrit. 1950. 1945.. Sanskrit. Rxgveda San'hiita Shashht'o Bhaagaa. Rukminikalyana Mahakavya. Sanskrit.. 1823. Theology. A Narayanadas. Sanskrit.. Religion. Literature.2/14/2011 A list of scanned Sanskrit books at III… Rigveda Samhita Vol-ii 2-5 Mandalas... . Rksamhita.… 43/167 . 1929. Sanskrit.... 249 pgs. Sanskrit.t.org/…/SanskritIIIT. . Sanskrit. 1929.. Shaastri T'i Vi Kapaali. Sri Rama Sharma. . Linguistics. Unknown... Rukminishavijayahaha. Shriipaadashara!~mand-aa Bhat't'aachayaind-a. Sanskrit. Rxgveda Sn'hitaa. Bhat't'ena Maadhava. Religion. Rudraadhyaaya Grantha 2. 1951. Roopdeepika. Literature. 502 pgs. 1955.. 1986. 170 pgs. 1823.. 32 pgs.. Rkbhasyam Chalari.. 283 pgs.. Krishnacharya.. 1950. Sanskrit. Rigveda Samhita Vol-v Indices. Journals.. Sanskrit. 242 pgs.... 200 pgs. Kolan'gad'e Raamachan'dragovin'da.. Bijapurakara Vishnd-u Govinda. Kamakshi. Rukminikalyana Mahakavya Of Rajacudamani Diksita.. Religion. Shriimatsaayand-aachara~ya.... Unknown. Sanskrit. 1062 pgs. 1940. Unknown. Religion. Dharmasthala.. Sanskrit.. P.. Literature. 1140 pgs. 914 pgs. 1951.. Linguistics.. 1986.. Linguistics. Theology. Religion.. 298 pgs.... 1242 pgs. Theology. Rksamhita. Rkbhasyam Tika. 454 pgs. Theology. 1928. 1935. Theology.

.. pg A list of scanned Sanskrit books at III… Rxgvedasan'hitaa Pdaadisuuchyaatmakah Panj-chamo Bhaaga.. Sanskrit. 1961. Bhaagavata Hari Radhunaatha.2/14/2011 . Language.. Rxgvedasan'hitaa Prathamaashht akama~ Prathamo Bhaagaa.. Saamaanya Bhaashhaavijnj-aana.a. Sanskrit. 1935. Sanskrit. 160 pgs. 197 pgs.. Rxgvedavyaakhyaaya Bhaaga 2 Ast'aka 1 Adhyaayaasa~ 5 Se 8.. Sanskrit. 1990. Sanskrit. 208 pgs. shriimatsaayand-achaara~yaa. Theology.. Religion.. 1950. 1957.. Theology. Sanskrit..l. 168 pgs.. Saamavediiya Chandogyopanishhata~. Religion. Raghuviira~ Achaara~ya. 1940. Saksenaa Baaburaama.. Theology. 2002. Sanskrit. 702 pgs. Saamavediiya Jaiminiiya San'hitaa Bhaaga 3. Matsaayand-aachaara~ya. Sanskrit. Theology. Theology. Religion.. Religion. sanskritdocuments. Unknown..2. Saamavediiya Taand-d'yamahaabraahmand-ama~ Da~vitiiya Bhaaga. Sanskrit. Sayanaachaara~yaa Shrii. Language. 359 pgs. 1922. Shara~maa Raamasvaruupa.. Sanskrit. Sanskrit. 1951. Raamaanuja Jaiyasaragomat'han. 547 pgs. 1913. Theology. Rxgvedavyaakyaa.. Literature. Purushottam. 602 pgs.. Sabda Manjari. 1939. 1917. Religion. 1936.. Unknown. 1938. Rxgvedasan'hitaapadapaat'hah. 949 pgs. Theology. Sabda Sakti Prakasika. 370 pgs. 238 pgs.. Sanskrit. Religion.u.. 1922. Unknown. Pandit Dhundhiraj Sastri. Religion. Sanskrit. Saarasvata Vyaakarand-ama~ Uttaraaddhara~ma~. S. 492 pgs. Religion.. Shriikapaalishaastri. Religion.org/…/SanskritIIIT..… Sabdakalpadruma Kanda Ii Radhakanthadev Religion Theology Sanskrit 1976 944 pgs 44/167 .. K.. Maadhavakara~ta. Theology. Saayand-aachaara~yaa. Saamavediiyataand-jyamahaabrahmand-ama~ prathama bhaaga. Linguistics. 353 pgs.t.. Literature. Theology.. Language... 77 pgs.. Sanskrit. 500 pgs. Rxgvedasan'hitaa Trxtiiyobhaaga.. 1951. Sanskrit.oriental Journal Vol-4 Part 1 . Religion.. Svaruupaachaara~ya Anuubhuuti. Religion.. Theology... 126 pgs. Theology.. Madhavaka~ra~ta.. Rxgvedasan'hitaa Prathamashht'akama~ Prathamo Bhaaga.. Sanskrit. L Laxminarayan. Sanskrit. Saathar Upanishhatsn'grah 4 Bhaaga. Theology. Saaraswatham (vyakaranam)... Sanskrit. Natural Sciences. Theology. Theology. Chaara~ya Saayand-a. 353 pgs. Sont'ake Esa~ena~. 189 pgs. Theology. Sabda Manjari. 1941.sastry. 1072 pgs. 1934. Bhaagavata Hariraghunaatha. 1142 pgs.. Linguistics.. 1151 pgs. Saamaveda San'hitaa. 1984.. Rxgvedasan'hitaa Trxtiiyo Bhaaga. Religion.. Shriikapaalishaastrii. 285 pgs. Sterling Publishers Private Limited New Delhi. Religion. Tippayya Parishkrit. Indology. Religion. Sanskrit. Literature. Saadaashivabhaashhyama~. Shriikapaalishaastrii.v. 1947. Linguistics. 1936. 543 pgs. Saara~tha Upanishhatsan'graha Bhaaga Sahaava. Sanskrit... Sanskrit.v. Sanskrit. Rxgvedasan'hitaa Prathamaashht'akama~. 387 pgs.. 1943. Virachita Nanj-jund-d'aaraadhya. Religion.. 1934. Sanskrit. 1947. Sanskrit.

Unknown. Unknown.ramanatha Deekshithar.. Sabdartha Ratnamu. 1994.. Monier Williams. 1982. 188 pgs... Biography. Unknown. 1979. Religion.. Sahithya Rathna Kosah Thruthiya Khandamu. Sanskrit. 0. Aomesvara Sharma.. . Nalinaksha Dutt. 1974. Unknown.. 494 pgs. Sanskrit.. Sagaud'a Paadiiya Kaarikaathara~va Vediiya Shhashht'hiya Khand-d'a Grantha 10. Shriibhojadeva Mahaaraajaadhiraaja. Sanskrit. 623 pgs... 412 pgs. Sanskrit.. Sanskrit. Pushpa Srivatsan. Sabhashyatatvarthadhigamsuthrah. Sanskrit. 1962. shivnath khanna. Sacitra Prasuti Tantra. 1924. Linguistics. Stotras.. 272 pgs. Saddarsanasamuchchaya. 1913. Religion. Mayuram Sri M. Sanskrit. Linguistics. Literature. 420 pgs.. 1936. Theology. 639 pgs. 88 pgs. 498 pgs. 188 pgs. 450 pgs. Sahitya Darpan. Unknown.. 558 pgs.. Sahitya Darpan (vimla).. 1976. Sanskrit. Sanskrit.. 101 pgs... 408 pgs. Sadguru sri Tyaga Brahma Pushpanjali. Hari Damoder Velankar.. 485 pgs.bhatt. Sanskrit. .. Salihotra Of Bhoja. 1957.org/…/SanskritIIIT. Unknown. Pandit Bhatta Yogi Dikshit.radloff. Kaloori Hanumanthrao. Sabdartna With Bhairavi. 394 pgs. Chaturveda Shastry. 944 pgs.. 1987. Sanskrit. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Sabdakalpadruma Kanda Ii... W. 249 pgs. 1967.. Sanskrit Grammer.. M.. 1802. Saddharmapundarika. Sahityaratnakara Of Dharmasuri Part I I. -.r.… Samanya Vedanta Upanishad Mahadevshatrin Religion Theology Sanskrit 1921 556 pgs 45/167 .. Literature. Sanskrit. Sanskrit.. ekanath dattatraya kulkarni. 0. 1973.... 1911.. 634 pgs. Sanskrit. 292 pgs.. Sahasra Yogaha. Unknown. Sanskrit. Theology. 94 pgs. Bhuskut'e Vi Bha. Religion. Samaarang-gand-asuutradhaara Prathama Bhaaga. Sanskrit. 764 pgs. 1953. Unknown. Sabdapasabdavivekahaccn0 946. Sahithya Darpan Of Vishvanatha Paricchedas I Ii X. Sanskrit. 142 pgs. Dr B R Shastry.. Unknown. Sanskrit.. Sanskrit. Unknown. 1945. Sanskrit... Sanskrit. 1932. Sabdanusasana. Sanskrit. Unknown. 1939. Unknown... -. Sanskrit. The Arts. P V Kane. Unknown. Literature. Sanskrit. Dr P Sri Ramachandrudu.. Sahitya Vimarsa.. 1981. Rama Krishana Misra... 348 pgs. Radhakanthadev. Sahitya Darpanam. Sanskrit. Sri Haribhadrasiri. 0. 388 pgs. Sanskrit. 84 pgs. Geography. Language... Khubchandraji Siddhanthashasthri. Sadaashivaraavabhaauu.. Language. Not Available.. Sachurnika Srimad Bhagavatam... 1981.. 174 pgs..a. Sri Durga Prasad Divyedaen.. Sama Veda Rahasya Ganam. Sanskrit.. Sakuntala.. 1951. . Sanskrit. Sahityasara. Sanskrit. Unknown. 1949. 0. Sahitya Sudhalehari. Bhagavata Shan'karaanan'da. Unknown. 1886 pgs. Sahiti Jagathi.narasimha Charya.. Sanskrit. sanskritdocuments. Sanskrit. 0. Sabhashya Rathna Manjusha.. 1956.. 1961. T. Srotaranay Tarakavachaspati abhattacharya. Sanskrit. Theology. 498 pgs. Unknown. Unknown. Unknown.. 1906. Sabhasha Arthavedika Vishaysoochi... 1917. Sahstra Deepika Of Partha Sarathi Misra.. 1982.. Literature. Unknown. 266 pgs.. 110 pgs. Sabdha Koustubha. Unknown.. Pandith Bechardas J Doshi. 814 pgs. 151 pgs. Sri Madachutaraya. Sanskrit. Sahityaratnakara Of Dharmasuri Part I I I.. History.

. Sanskrit. .. 1965. 266 pgs. 364 pgs. 95 pgs. Samarangara Sutradara Vasthu Sastram Mulamatram. V. 1961. 1925. 615 pgs. 1983.. 233 pgs... 407 pgs. Theology. Yudishtar Mimasak. Linguistics. Sanskrit. Samkhyayogadarsanam.. Samskaranrusimhaha... Sanskrit. Sanskrit. Samskrit Baladarsa. 0. Sanskrit. 98 pgs. 226 pgs. 1948. -.. Art. Satyavarata Samasarami Bhattacharyyaa. 1937. 104 pgs. Narayana Swamy.. Sanskrit.. Literature. Religion. Samskruta Vyakarana Sastra Ka Ithihas Part . 454 pgs. 0. Samsara Chakram.. Unknown. sanskritdocuments. Samsara Chakram. Sanskrit. Samskruth Natakome Athi Prakruth Thatv. Sanskrit. 557 pgs. 136 pgs... Samgitaratnakara Vol I V Ashyaya 7. 1965.. Unknown. Sanskrit.1. 166 pgs. Unknown. Pandit V. Jithendranath Shukla. 0. Linguistics Literature. Samskrita Akshara Siksha. 490 pgs. Sanskrit.. . 0.. Sanskrit. C. Samskritha Prathibha Vol I. Linguistics. Literature. Samkalpa Suryodaya Of Venkatanatha Part 1. 323 pgs... 422 pgs.. Krishnamacharya. Samskruth Chittah Trutiya Bagh. Literature. R... Theology. 384 pgs. 436 pgs. . Trutiya Kanda....... Sanskrit. Unknown. 0. Sanskrit. 424 pgs. Sanskrit. Samkalpasuryadaya. Ramji Upadhyaya.v. 1982. Samarad'gand-asutradhaara Bhaaga 2. Unknown. 0. V. Sanskrit. Satya Srinivasa Ayyangar. Samavedasamhita. 568 pgs. Unknown. 1948.. Literature. Gosvami Damodara Sastri. 288 pgs. 556 pgs. 452 pgs. Religion. 1921. Literature... 0.... 103 pgs.. Samkalpasuryodaya Of Sri Venkatanatha. pandit s subramanya sastri... 1948. Shriibhojadeva.. Language.krishnamacharya. Subbrayudu.. 1983. Sanskrit. Sri Gowrishankar Sastri. 84 pgs. Samaveda Samhita Volume Iv. Dr... Samaskrit Basha Vibushanam. Language. Sanskrit. Bhavavibhuti Bhattachary. Sanskrit. Sanskrit...2/14/2011 A list of scanned Sanskrit books at III… Samanya Vedanta Upanishad. Unknown.org/…/SanskritIIIT. Samskara Prakasika.. Pandit M Suryanarayana Shastry. 1990. 634 pgs. Shrikrishanamani. Linguistics Literature. 0. 263 pgs. Samaveda Samhita.. Sriramdeen Cheturrvedi. 0. Literature.. Language..… Samskrutha Sikshamajyarayaha Bhattacharya Sanskrit 1934 143 pgs 46/167 . Sanskrit. 0.. Unknown. Theology. Sanskrit. Sanskrit. Sanskrit. 1992. Sanskrit. Unknown. . 0. Mahadevshatrin. Linguistics Literature.. Samskruth Sukthi Sagar. 1943. . Pandith S Subrahmanya Sastri. Unknown.. V.. Sanskrit. Sridhar Bhaskar. -. 2000. Literature. Literature. Samgita Rathnakara Vol 1. Sanskrit. Unknown. 144 pgs. . 0... 226 pgs.. Samarrngara Sutradara Vasthu Sastram Mulamatram.. Sanskrit. Linguistics. . Sanskrit. 1935. Samskruta Vanmaye Chandrah.balasubramanyam. 1963. 0.. Sanskrit.. 0000. . Sanskrit. Linguistics......krishnamacharya. Unknown. Samskruta Sukthi Sagar. Language. Samskrta Kavi Jivitam Part Ii. Religion. 587 pgs.. Samskrtu Vadumaya Kosa.. Sanskrit. 0. Sanskrit. Sanskrit. Unknown. 440 pgs. Linguistics Literature. -. Samskrutha Bhakthamala. Samskrita Swayam Sikshak Praba. Mulchandr Patak. 736 pgs.. 102 pgs. Samskruta Sahitya Silanam.. Sambapuranam (upapuranam). 0. Vidyasagar k L V Sastri..

. Mathura Prasad. 1992. Sanskrit. Sandesh Rasak. Sangeetanjali.. 237 pgs. Sanskrit. San'skrxtapadyavali. Geography. San'qs-epashaariirakama~ prathamaadhyaayarupa Prathamo Bhaga. 560 pgs. Gopinathadiiqs-ita Bhat't'a. Poonam Niraula.. 331 pgs. Shaastri Bhaaskara. 1917.. History. Gand-eshaa Shaastrii Laqs-mand-a. . Aalatekara Maadhava daamodara. 1934. 267 pgs. 1982.. Sandhi Samasa Manjusha. Others . 143 pgs.. Sanskrit. Sanskrit. Unknown. sanskritdocuments. 1918. Art. Unknown. Sang-game Shrvarakrod'ama~. 0. Samveda Vachaspathi. Sangitaratnakara Of Sarngadeva Vol I. Sanskrit. Language. 1899. Philosophy. 406 pgs. Sanadaapatraan'tiila Maahitii.. 80 pgs. Sangitaratnakara Of Sarngadeva Vol 4 Adhyaya 7. Geography.. 244 pgs.. 270 pgs. San'skaara Paddhati Grantha 94. Sanatsu Jatiya.. Linguistics. Theology. 82 pgs. San'skaararatnamalaa Prathamo Bhaaga. Linguistics.. 1933. Natural Sciences. Samtanantarasiddhi Vol Xix. Natural Sciences. 0. 439 pgs. Sara~jnj-aatmamuni. Psychology. Sara~vajnj-aatmamuni. Sanskrit. Sanskrit... 1899... Unknown. Psychology. Sri Ramachandra Jha Vyakarnacharya. Samtanantarasiddhitika.. Language. 405 pgs. Sri Kunda Kunda. Religion.33.krishnamacharya. Sangita Chandra. Unknown. 1950. Sanghameswara Krodam. Sanskrit. Sanskrit. Philosophy. 212 pgs. 0000. 462 pgs. 86 pgs. San'pura~nd-a Aagarakara Bhaaga 2....... Sanathakumara Samhita. 298 pgs.subrahmanya Sastri. Rigveda Samhita. Sanskrit. Sanskrit. 1943.. Sanskrit.. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Samskrutha Sikshamajyarayaha. Sangita Chandra (a Trearise On Indian Dance). Sanskrit. 176 pgs. Sanskrit. Bhaand-d'aarakara~ Raamakrxshhnd-agopala. Sanskrit.. V.33. 1918. 455 pgs.. 1982. Pandit Omkarnath Thakur. Theology. Atri Samhita... Atri Maharshi.. 1987. 1934. Samyasara Of The Nature Of The Self. Sanskrit. Sanskrit. Atri Samhita. 1955. 1913. Sri Kunda Kunda.. Sandhi Chandrika.. Sanskrit.… Sangitopanisat Saroddhara vacanacharya sudhakalasa Unknown Sanskrit 1961 198 pgs 47/167 . 1960. Unknown. Sanskrit.. Sanskrit... 1924.org/…/SanskritIIIT.. 603 pgs. 1928. Sanskrit. Pandit S. Bhattacharya.. Religion. Sanskrit. 230 pgs.. History.. Others . 1931.. 72 pgs.. 822 pgs.. Sanskrit.. Biography. 386 pgs. Gummaluura~yupanaamaka Sang-game Shrvarashaastrind-a. 180 pgs. Literature. San'skrxtamandiraantah Praveshikaa. 1947.. Samyasara Of The Nature Of The Self... Samurtar Chanadhikarana: Atri Samhita. Unknown. Sanskrit.. 1953. pandit s subramanya shastri. Biography. Literature. Samvedika Sri Subhodini Paddhati. Social Sciences. Suklapandita.. Sanskrit. Sanskrit.. 638 pgs. Sanskrit. 173 pgs. 1941. 406 pgs.. San'skaararatnamaalaa Uttaraara~dama~ Bhaaga 2. San'qs-ipta Vaalmikii Raamaayand-a Trxtiiyo Khand-d'a. Theology. Chimnaajii Gand-esha... Religion. 312 pgs... Unknown. San'skrxtavaachanapaat'hamaalaa Dvitiiya Khand-d'a. 1921. 1677. Unknown... Vaidaya Si Vi. Hajari Prasad Divyedi. Sanskrit. Suklapandita. Vaamana Kaane Paan'd'uran'ga.. Unknown. Bhat'a~t'agopiinaathadiiqs-ita.. Art. San'qs-epashaariirakama~ Da~vitiiyo Bhaaga. 1953. 1950.. 154 pgs.

.. 667 pgs.. 1958. Unknown. 302 pgs. 1959. Sanskrit Sopanam Vol Iv. 1945... 68 pgs. Sanskrit Bhashamahe. 1994. Unknown. 456 pgs. 1976. Sanskrit. 1994.p.. 1956. Unknown. Sanskrit. 146 pgs. Unknown.sriram Sharma Acharya. 266 pgs... Sanskrit.. 260 pgs. . Pandit Krishnama Charya.. Sangrahartha sangraha. Kurt F. Sankya Darshan. 1948. 0. 243 pgs..upadhaya. Sankara Bhashyalochanam. Pt. Sanskrit. Sanskrit. Sanskrit Text Book For Detailed Study 1960.. Sanskrit. Unknown. Shri Brihaspati Shastri.. Sanskrit. Language..... 0.. Unknown.. Sanskrit Journal Sahrudaya Part 8. 684 pgs. Sanskrit.. 0. 146 pgs. Unknown.. Linguistics. Sanskrit Text Book For Detailed Study 1962. Unknown. 1963. Sanskrit. Not available.org/…/SanskritIIIT. 435 pgs. Sanskrit. 758 pgs. Sanskrit. 1886.... 207 pgs.. 131 pgs. Sanskrit Syntax And The Grammar Of Case. Sri Brahaspati Shastry. sanskritdocuments. -.. 1976. . Sree Purushottam Lal Srivastav. 110 pgs. 1930. Sanskrit Essentials of Grammar and Language... ... Sankskrutha Gantha Suchi. Unknown.. Sanskrit Saiva Kavyas Vol I. Sankhyadarsana.. 650 pgs. Sanskrit Manuscripts Vol. 2002.. Unknown.. 1961. Sanskrit. Sanskrit... Linguistics Literature. 1987. Sanskrit Gadhy Padhy Sangraha Vol I. 254 pgs.hansraj Aggarwal.... Ramashankara Bhattacharya.. Sansar Sagar Manthanam Vol Ii. 118 pgs. 0. Sanskrit. 1985. 377 pgs. Sri Vijnana Bhikshu. 50 pgs. Unknown.. Thibaut. Sastri. 2002. -. Sanskrit. 588 pgs. Sanskrit.. Literature.. 1960. Linguistics. Hari Narayan Dikshit.. vacanacharya sudhakalasa. Pandith Rajesh Dixit. Brahmachari Surendra Kumar. Sanskrit. Sanskrit Journal on Sahrudaya.. Unknown. Sankhyayana Grihya Sangraha. Sanskrit. Unknown.ix..p. I Shekhar. Unknown. Unknown. G. Sanskrit.. Sanskrit Ratnakarmay Shigyandank.1. Sanskrit Drama Its Origin And Decline. Gopala Bhatta. 102 pgs. 352 pgs. Unknown. Sanskrit. 0. Unknown. Pro. Unknown. Sanskrit..krishnamachariar. Leidecker. Sankshepa Sarirakasya Adhyaya I. Sankalp Suryoday Vol I. 70 pgs. 1976. Sanskrit. Sanskrit. Sankhya Darshan Pravachan Bhashya...venkataramanan... Surendra Kumar Gambhir. Sanskrit English Dictionary Vol 2. Sanskrit... 107 pgs. 0.. G. 62 pgs. 1953. 1954. Unknown. Unknown. Sri T K Tiruvenkatacharya. 0.. 644 pgs. Sanskrit Text Book For Detailed Study.2/14/2011 A list of scanned Sanskrit books at III… Sangitopanisat Saroddhara. Kanta Gupta.. Unknown. 198 pgs. Sanskrit. Narayanacharya. Unknown. Language.s.. Geography. Literature. Language. 150 pgs. 467 pgs. 164 pgs. Sanskrit. 0. -. Sankaravijaya. Acharya Udhayveer Shastri. Sanhit. Literature. Sanskrit. Sanskrit. Sanskrit. 1980. Unknown. Unknown. 1947. Sanskrit. Religion. Sanskrit Gadya Padya Samgraha. Sanskrit Bhasha Bhodhini Vol I I. Sankhya Darshan Ka Ethihas. Sanskrit Nibandhavali. Sanskrit. Vyasacala.. 523 pgs.. Unknown.. Sanskrit Sahithyothihas Vol. Pandit Vruddhi Chandra Sharma Shastri. 1947. 1940. History. Theology.. Sanskrit Manuscripts 2. -.. Sanskrit. Sanskrit. Sanskrit. Linguistics. K.... S.. 0.. P K Gode. Krishnamachari. P.… 48/167 . Biography. 284 pgs. Unknown. 435 pgs.

302 pgs. Jagdish Kumar. 2002. sanskritdocuments. 1950. Sanskrit.. 1930. Sanskrit. Sarasangrahah... Unknown. Pandith Sripad Damodar Saatvalekar. Sanskrite Panchadevastotrani. Unknown. Sanskrit. Sarasvatibhavana Granthamala Volume X. Sanskrit. Sanskrit. .. 1927. 0. Linguistics Literature..kapildev Devedi Acharya. Sri Rurthar M Mikanal.. Sanskrita Sahitya Itihasa Khunjka. 42 pgs. Dr.. Unknown. 0. Biography.... Unknown. Sanskrit. Sanskrit. Saralaayurved Shiksha. 1942. 40 pgs. 57 pgs. 70 pgs. 1990. Sanskrit. Sanskrit. Santi Prakasa. Sanskrith Grammar. Literature.. 1949. Unknown. Sarasvata Home Of Kalidasa. 0. History. Sanskrit. 0..… 49/167 . Sanskrith Paath Mala Vol I V. Sanskrit. 0.. Sanskrit. 1928..org/…/SanskritIIIT. Pandith Jeevaram Upadhyay. Sanskrit Vyakaranam.... V.. 1843. Sanskrit.. 0. Sanskrit Text Book For Detailed Study 1964. Unknown. Unknown. Unknown.. Sanskrxtavaachanapaat'hamaalaa Da~tiiya Khand-d'a. Unknown. 60 pgs. Language.. Sanskrit Text Book For Detailed Study 1967. 110 pgs.. Unknown. 300 pgs. Acharya Paramanand Shastry. Sanskrit. 72 pgs. 84 pgs. Sanskrith Paath Mala Vol Ii... Sarasvata Vyakaranam. Sri Naraharishastry. Sanskrit. Sanskrit. Religion.. Geography. Sanskrit.. -. 62 pgs. Sanskrita Shiksha 3. 133 pgs.. Pandith Sripad Damodar Sathvalekar.. Unknown. Sanskrit. Surendra Narayana Tripathi. Sanskrita Kavya Kanthah.. Sanskrita Shiksha 2. Unknown. Unknown.. Unknown. Sanskrith Paath Mala Vol Ix.. Sarasvanth Vyakaranam Poorvadharma. Sanskrit. Sarasabharati Vilasa.. 0.. 1950. Janardana Pandeya... 336 pgs.. Sanskritkavicharcha. Dr.. Unknown.. Sanskrith Siksha Vol Ii. Garikapati Laxmikanthaiah. 0. Sanskrit. Sanskrit.. Unknown.. 0. Religion. Sanskrit. 1955. Unknown.. 132 pgs. Sanskrita Shiksha 1. 1976...2/14/2011 A list of scanned Sanskrit books at III… Sanskrit Text Book For Detailed Study 1963. 116 pgs. 70 pgs. Philosophy. 1868. Mangesh Patkar.. 1956.. Surendra Kumar Gambhir.kapildev Devedi Acharya. Sri Vadirajathirtha. 366 pgs. 1996. Sanskrith Siksha Vatika Vol Iv. Unknown. 100 pgs. -.. Sanskrit... Babu Ayodhya Prasad. Lele Laqs-mand-agand-eshaastii... Sanskrit. 475 pgs.kapildev Devedi Acharya. Pandith Sripad Damodar Sathvalekar. 1927. Sanskrit... Unknown. 122 pgs. 166 pgs. Unknown. Unknown. Sanskrith Paath Mala Vol X I I. 58 pgs. 324 pgs.. 404 pgs. Unknown.. Sanskrit Vyakaran Praveshika A Sanskrit Grammar For Students. Sanskrith Kathasagar. Sanskrit... Sanskrit. 1973. Unknown. Sapindya Kalpalatika. Sanskrit. 1951. Sanskrit. Sarasabharathi Vilasa.... Sanskrit. Sanskrit. Pandit Ram chandra Jha. Saradiyakhya-namamala of Harsakirti. Sri Guru Prasad Shastry. 146 pgs. -... Dr.m. Sanskrit. Sanskrit. Literature. 418 pgs. 44 pgs. 174 pgs.. 0.. 0.. Pandith Rahul Sanskruthanen. 214 pgs. Krishnagopal Goswami Sastri. -. 1985. 1981.. Santati Shastra.. Unknown. Unknown. Unknown. -.prabhanjanacharya. 315 pgs. 1982. 410 pgs.. Sanskrit. Gopinatha Kaviraja. 48 pgs. Benfey T H. Linguistics.. 420 pgs. 1990. 133 pgs. Ramchandra Sharma. -. Chaturya Lal.. 1982. Sanskrith Sopanam Vol Ii.

Sanskrit. 1952. Unknown... Sanskrit. . Philosophy. Sanskrit. Sastra Darpana. Theology... Sanskrit. Srimadvijayeendrateertha. Pandit Sri Vishveswara Jha. pgs.. Unknown. 166 pgs. Unknown. 1915. . Literature. 162 pgs. 1986... Vaidya Shivacharan Dhyani. 1967. Sathyaashhaad'ha. Unknown. Dr. Sanskrit.. Unknown. Sanskrit... . Chinnaswamy Sastri. 1927.. Sanskrit. Ramchandr Savath. Philosophy. Vedanta Desika. 340 pgs. Sarvedic Prasnothari. 1983... Religion. Sanskrit. 0. Shri Nanamaharaja Joshi Sakhre. 0. 1964. Sanskrit. Saraswari Kanthabharana. Geography.shama Sastry. pgs. 1986. Mangesh Patkar. 212 pgs. 544 pgs. Biography.. Sarva Darsana Sangraha Of Madhavacarya. 1957. Sastra Siddhantha Lesa Sangraha.. 185 pgs..shama Sastry.. Unknown. Satapada Brahmanam.. 226 pgs. Unknown.. Sanskrit.. Linguistics. Geography. Sastra Dipika. Sanskrit. Unknown.m. E. Sanskrit. Sarvadarshana Sangraha.r.… Satikathraya Sri Valmiki Ramayanam Utthara Kandam Sanskrit 0 2090 pgs 50/167 . Sanskrit. 1913... 402 pgs. Dr. 431 pgs.... Saraswathi Sushama Vol 37 (1-4). 241 pgs. 182 pgs.. 241 pgs. 405 pgs. Saraswathi Suhama Vol 53 Mar Dec 1998-99. Sanskrit. Sanskrit.. P. 0. Unknown. 880 pgs. Pandit Rama Krishna Kishra. Sri Nanamaharaja Sakhare. 1950. Sathyaashhaad'havirachitamn' Shraotasutrama~ Shhashht'o Bhaaga. Sanskrit. Chin'taamand-i Ti raa. Gopi Natha Kaviraja. 456 pgs..sastri. Sastri Dipika. 1935.. 431 pgs. 214 pgs.. 164 pgs. Sanskrit. Unknown. Saraswati Sushma Vol 37 1 4. 1951. 1940. 0.shama Sastry. Sanskrit. Unknown. History.p. 1937.... Unknown. Sri Pradhacharya Vidwanandi. 1969. 206 pgs. Theology.cowell. Religion. Sasthramuktavali. Language. Literature.. Sanskrit. Sanskrit. Unknown. Linguistics. 401 pgs.. 1927.r.. 233 pgs.. History. 1916. Vageesha Sastry.. Sarva Siddhanta Sourabham. Sanskrit. 0.. Sanskrit. Sastra Siddhantalesasangraha Volume I. Sanskrit. bhatta vasudeva. Geography. Biography.. Biography. Sanskrit. Biography. Philosophy. Sarkara Srinivasavirachita Tatvaprakasika. 1935. Pandit Rama Krishna Misra.. 1927.. Saraswati Vilasa (vyavahara).. Unknown. Vedas. Dr. Sanskrit. Sardh Jnaneshwari. Sri Amalananda. Mangesh Patkar.b.. 80 pgs. Religion.m.. Sarth Jnaneswari.. 120 pgs. Sanskrit... Philosophy... 158 pgs. Sanskrit.. Sanskrit.. Literature. Anubhavananda Swamy.2/14/2011 A list of scanned Sanskrit books at III… Sarasvatii Kand-t'haabharand-ama~ Bhojaadevaa. 1973. Sanskrit. Saraswati Bhavana Texts Part Ii. Philosophy. 562 pgs.. Sarvavednta Siddhantasarasangraha. Anundoram Barooah. . 400 pgs. 1901. Sathya Shasan Pariksha. 1927. Sanskrit. Saraswatha Vyakaranamu Purvardhamu. 382 pgs. 0. Sri Sankaracharya. S R Krishna Murthy Shastry. 539 pgs. Unknown. Saraswathi Suhama Vol 53 Mar Dec 1998-99. Sanskrit... Unknown.org/…/SanskritIIIT. Satha Dushini. sanskritdocuments. .s. Raobahadur Gangadhar Bapuraj Kate. Satha Dushini.. Sathavarthmala Sampoorna. pgs. Sarvasiddanthasara Vivechanam. History. 357 pgs... Sanskrit. Sanskrit.. 694 pgs. Sarira Kriya Vijnaniyam. Satha Dushini.. History.r... 1912.. 1951. 1935. Saraswathi Sushama Vol 37 (1-4). 1995. Language.... Geography.

Satyaashhad'ha Shraotasutrama~ Chatuura~to Bhaaga. .. Sanskrit.. Satyaashhad'ha. Sanskrit.. 1930. Prof. Religion. Shaan'karapaadabhushand-ama~ Da~vitiiyo Bhaaga. Unknown. 221 pgs. Satyaashhaad'a Shraotasutrama~ Trxtiiyo Bhaaga... 140 pgs. Sanskrit.. Sanskrit. Linguistics. Theology. Philosophy. 1929... sanskritdocuments.. Gaadi. Satyaashhad'ha. 138 pgs.. Satyaashhad'havirachitaman' Shraotasuutrama~ Dashamo Bhaaga. Sanskrit. Raghunaathasuuri... Aapat'e Vinaayaka Gand-esha. Theology. 350 pgs. Sanskrit. Vedas. 165 pgs. V. Theology. Sanskrit.. Theology...n.. Mario E Carelli. 1922. Satyaashhaad'havirachitan' Shraotasuutrama~. 1933. Sanskrit.. 0. 1908. 51/167 . 1907. Shriiraghunaathasuri. 455 pgs. Haraprasad Shastri. 0. 1941. Unknown.. 1908.. 1932. 331 pgs. Kalluri Hanumanth Rao. 1939. 1927. Satyagrahodaya. Satyaashhad'havirachitaman' Shraotasuutrama~ Ashht'amo Bhaaga..org/…/SanskritIIIT. Saudaryalahari. Unknown. Religion. Religion. Satyashhad'ha Virachitaman' Shraotasuutrama~ Navamo Bhaaga. W. Satyaashhad'ha.2/14/2011 A list of scanned Sanskrit books at III… Satikathraya Sri Valmiki Ramayanam Utthara Kandam. 1975... Swamy Ghanapathi. 1975. Sanskrit. 1969. Sanskrit. Theology.. 71 pgs. Sanskrit. Satyaashhad'havirachitan' Shraotasuutrama~ Saptamo Bhaaga.. 406 pgs.. Sanskrit. Dr B R Sastry. N... Aapat'e Vinaayaka Gand-esha. Sanskrit. Psychology. Religion. 73 pgs.. Religion. Sanskrit. Religion. Seleqs-ansa~ Phrama~ San'skrxta~ Insa~kripshhansa~ Para~t'a~ 1 Tekst'a~. Sattotravalivibhag.. Literature. Satyaashhad'havirachitan' Shraotasuutrama~ Navamo Bhaaga. 1987. 1953. 212 pgs. 2090 pgs. Sanskrit. 144 pgs. Satyaashhad'ha. 367 pgs. 359 pgs. Unknown...shri Krishnamacharyswamy. Philosophy.. Satyaashhad'ha.. Saundara~yalaharii Third Edition. Theology.. 455 pgs. 1932. Shaad'a~khaayanaarand-yakama~ Grantha 90. Karambelkar. Religion. 400 pgs. Religion. Saundarananda Kavya Of Arya Bhadanta Asvaghosa.... 368 pgs.. Aapat'e Vinaayaka Gand-esha. Satprati Pancha Grandhaha. Sanskrit. Satyaashhad'ha Shraotasutrama~ Da~tiiyo Bhaaga. Theology. Theology... Theology. Sanskrit. Psychology. Religion. Satyaashhad'ha. Satyaashhad'ha. 1907. Unknown.. . Sanskrit. Theology.… Shaan'karapaadabhushhand-ama~ Prathamo Bhaaga. Language. Satyaashhaad'a. Religion. Sanskrit.. 158 pgs. Dr. Satyaashhad'ha Shraotasuutrama Trxtiiyaa Bhaaga. Theology. Language. Seethaharanam. 166 pgs. 370 pgs. Satyashhad'ha. Jwalaprasad Goud. Theology.. Theology.. 1925. Satyaashhad'ha. 1908. Saurapuraand-an' Vyaasakrxtama~ Grantha 18. Literature. Sanskrit. 1921. Religion... Sanskrit... Sanskrit.. Linguistics. Religion. Theology. Religion. 125 pgs. Sanskrit.. Religion. Sanskrit. 310 pgs. 1930. Sekoddesatika Of Nadapada Naropa. 1940. Diskaalkara~ Di Bii. Select Sanskrit Inscriptions. Shan'karaa Chaara~yaa. 328 pgs. Satyaashhad'ha Shraotasutrama~ Da~tiiya Bhaaga. 169 pgs. Vedas... Sanskrit.

Sanskrit. 1822.. 0. Shaiva Paribhaashha.. Sir Raja Radha Kanth Dev Bahadur.. 790 pgs. Language.. Religion. Literature.. 0... Linguistics. Literature. 247 pgs. Sir Raja Radha Kanth Dev Bahadur. Shakttivaada. Sanskrit. 170 pgs. Shabdakalpadruma Volume I. Sanskrit. .. 324 pgs.r. 340 pgs.. Pandit Ramprasad Rajvaidy Patiyal. 558 pgs. 0. . 194 pgs. Diiqs-ita Bhat't'o. Shabdashattkiprakaashika. 0.. 1950.. 430 pgs. Sanskrit. Sharushan-sar-patrika. Shaastratattvavinira~nd-aya. 340 pgs. Linguistics. Shamakosh sabhayanuvadh. 278 pgs. Shabdhakapadrumaha Thruthiyakandaha. Language... Tara~kalan'kaaraa Shriijagadiisha.... 0. 1934. Shadgadhara Samhitha. raja radha kanta deva. 1984.. Unknown. Sanskrit.. Shabda Kalpadrum Part I I I. Vedas.. Shabda Nirnaya Dipikahsampadanamu. Bhat't'ojiidiiqs-ita..... 802 pgs.. .. Shabdh Deepika. Psychology.. Sanskrit. Shang-karavijaya. Literature. Raja Radha Kanta Deva. Literature. Unknown.. Sanskrit. Sanskrit. Theology. 1961. -. 1997. 519 pgs. 485 pgs. Sanskrit.. 818 pgs. Shang Dhara Samhata.... Theology. Literature.. 1822. Shareerak Vignanamu Dwithiya Bagamu. Unknown. Sanskrit.. Sharirkvigyanam Vol I. 1949. 8798... Literature. Sanskrit.. 557 pgs.. Sanskrit. Shabda Kaustubha Prathamo Bhaaga. Linguistics. Sanskrit. Prabhakara Prasad. Raja Radhakanta Deva. Sanskrit. -... Language. . Ramswaroop Sharma.org/…/SanskritIIIT. Kaatare Sadaashiva Laqs-midhaaraa.. 2003. Theology.2/14/2011 A list ofBhaaga. Shriibhara~trxhara Mahaakavii. Shabdhakapadrumaha Panchamakandaha.. 1929. Shambhohara Prakasha. Unknown. Pandith Madhusudhansharamamaithila.. 244 pgs. Sanskrit.. Sanskrit. Sri Madhusudhan. Shaan karapaadabhushhand ama Prathamo Shriiraghunaathasuri. Unknown. 524 pgs... Shatakatratama~ Bhaaga 9. Psychology. Sanskrit.. 147 pgs. 1954.. 294 pgs.. Language.… 52/167 . Linguistics.. Sanskrit... Unknown. Language. Psychology. 1961. Theology. Unknown. 1909. Shadkar Vijay. Unknown. Literature. Shabdakaustubhah Da~vitiiyo Bhaaga. Vyaasaachala. Sanskrit. Shabdhakapadrumaha Chaturthakanda. Sanskrit. 1951. Shanker Vedanta Ek Annusheelan. Unknown.... Literature. Linguistics. 0. 573 pgs. 0. Babu Zalim Shing. 569 pgs. Anandagiri. Religion. 1949. Chara~yaa Shiva. sanskritdocuments. 1933. Sanskrit. 245 pgs. Sanskrit. Language. scanned Sanskrit books at III… Philosophy.. 0.. -. 345 pgs. 438 pgs. . 652 pgs. Philosophy.. 1961. Shabda Kalpadrum Part 5. Unknown.. Sanskrit. Unknown. Linguistics. Unknown. Sanskrit.. mahidhara sharma. Sanskrit.. Sanskrit. 592 pgs.. Shastavakru Geeta. Raja Radha Kanta Deva. Kantha Dev. Sanskrit. 344 pgs. 1946. Sanskrit. 1979. 1961. Dr B R Shastry. Bhat't'aachaara~ya Gadhaadara. Shankara Bhashya Sametha. . Linguistics. Philosophy. Shabda Kalpadrum Dwithiya Bagam. Shabd Kalpa Druma Chaturthi Kandam. Unknown. Language. Unknown.. Unknown. Sanskrit. 1988. 289 pgs. Religion. Ramakanta Angiras. 265 pgs. Religion. 1932. 945 pgs. Sanskrit.. Shabdakalpadruma Volume V... 1927. Shabd Kalpa Druma Padama Kanda. Sanskrit. Sanskrit. Sanskrit. 0. Shabda Kalpadrum Part I V. 116 pgs. 494 pgs..

Theology. Shri Hari Swami. Sanskrit. Theology. Sanskrit. Sri Guruprasad Shasrti.. Unknown.. Religion. Shradhamanjari.. 400 pgs. 1907. Religion. Shivacharitra Pradiipika... Sanskrit. 52 pgs. Sanskrit. Theology.. Shriimachchhan'kaarachaara~ya. 1927. Sanskrit. 1908. Joshii Shankara~naaraayand-a..... 404 pgs.. Sanskrit. Shraotasuutrama~ Saptamabhaaga. Satyaashhad'ha. Shiva Samhita. Shraotasutrama~ Chatura~tho Bhaaga. 893 pgs. Sanskrit. History.. 105 pgs. Shivacharitra Saahitya Khan'da 3 Ra.. Unknown.. 209 pgs. 1854. Sanskrit.. Srimathi Urmila Devi Sharma.. Shrautapadarthanirvachanam. 1957. Unknown. 84 pgs. Satyaashhaad'ha. Sanskrit.. Theology. 1927..madannatkrishnshastrikrut.Brahmanam Part Ii. Social Sciences. Sanskrit.. Religion. 127 pgs. Religion.. Shatapatha Braahmand-ama~ Dditiiyo Bhaaga. Shatgidhara Samhitha.. 1930. 1908. Religion.... 0. Shraotasuutrama~ Panj-chamo Bhaaga... Sri Narendraprasadji Maharaja Sri Ni. Sanskrit. Shatashlokii Aavrxtti tiisarii. Sanskrit. 1927. Theology. 315 pgs. 1940. Shishupalvandh. Unknown.. 337 pgs.. 1909. 1935. 62 pgs. Theology. 1847. Shri Anka Kavya. 1940. Religion... 160 pgs. Religion. Sanskrit. 1940. 1939. Sanskrit. 1997... Shraota Suutran' Dditiiyo Bhaaga Grantha 53. Religion. Religion. Unknown. 404 pgs. Sanskrit... Shilpa Shaastrama~. Shri Ramacharanpurikruth... 221 pgs. Theology. Satyaashhaad'ha. Bosa~ Phaniin'dranaatha~. 200 pgs.. Sanskrit. 1972. Theology. Theology. Sanskrit.. 0. sanskritdocuments. History. Unknown. Narayana Ram Acharya. Shatpath ... Religion. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… 212 pgs. Aapat'e Hari Naaraayand-a. 225 pgs. Biography. 310 pgs. Sanskrit. Sanskrit. 936 pgs. Shatpath Brahman. 152 pgs. Shivajataka. Viiraa Raghu.. Sanskrit. Vedas. 168 pgs. Unknown. Sanskrit. Unknown. Sri.. Theology. 254 pgs. 1868. 438 pgs. Religion. Theology. Sanskrit. 317 pgs. 360 pgs. Shraadhdamanj-jarii... Religion. Sanskrit. Aapaat'e Da Vii.. Shiksha Patri.. 909 pgs. Shrimat Trayibhashyakar Sayanacharya. Shatpath Brahmanamu Part Iii. Satyaashhaad'ha. 302 pgs. Sanskrit. Theology... Unknown. 1929. 1951.. Shraotasutrama~ Prathama Bhaagah. Krishna Kaura Mishra. Biography. Sanskrit.. Satyaashhad'ha.. Shiqs-aatrayama~. Unknown. Shivaraj Vijay.. Shatpath Brahmanam.. Satyaashhaad'ha. Theology. 135 pgs. Geography. 816 pgs. Sanskrit. 1928.. Sanskrit.. P. 1907. Satyaashhaada. Satyaashhaada. Shraotasuutrama~ Ashht'ama Bhaaga.. Shraota Suutrama~ Shhashht'ho Bhaaga Grantha 53.. Shraotasuutrama~ Panj-chamo Bhaaga.. Sanskrit. Shatpath Brahmanam Part V. 288 pgs. Vaasudevananda Pa Pa. Geography. 0. Aagesh Ithyupavedattatreyashastry. 1919. Sanskrit. Pandit Sreemathru Prasadha Pandeya. Religion. Religion.… Shri Madbhagvadgeeta Vijay Chandra Varmanujya Unknown Sanskrit 0 340 pgs 53/167 . Vedas. 1982. Sanskrit. 360 pgs. Shatbhushni Vol-1. Satyaashhaad'ha. Unknown. 1928... Unknown.. 608 pgs.. 0. 1893. Theology. Srimat Travibhashyakar Sayanacharya. Vishwanath Shastri. Sri Vasudeva Brahma Bhagwat.jetendriya Charya. Shraotasutrama Bhaaga 2.org/…/SanskritIIIT.

1947. Theology. -. Shrii Manmahaabhaartama~ Shhashht'hobhaaga Anushhsanapara~va. 167 pgs. Philosophy.. 1851. Sanskrit.. Religion. Linguistics. Sanskrit.. 1934. Unknown... Theology. Linguistics. 612 pgs. Sanskrit. 1932. Sanskrit. 1922. Shrii Madabhgavadagiitaa Grantha 44. Chaara~yand-a Shrii Krxshhnd-a Priyaa. Shrii Alang-kaarakaustubha Da~vitiiyo Bhaaga.. Sanskrit.. Sri Narayana Charya.. Paramadiishvaraa. 219 pgs. 680 pgs... Sanskrit. Unknown. 378 pgs.. Literature. Religion.. Linguistics. Psychology. Language. Sanskrit. Literature. Theology. 1978. 642 pgs. Shriishang-khadhara. 0. Shriibhaasa Mahaakavi. Shriimadramaanujaachara~yaa. 82 pgs. Sanskrit. 2001. 1644. Unknown. Philosophy. Social Sciences.. 1916. 458 pgs. 1933.... Shriinivaasaachaara~ya Laqs-miipuran. Sanskrit... Sanskrit.. Sanskrit. Shriimanniilakand-t'haa. Sanskrit. 1903. Language. 239 pgs.. Bhat't'a Shriinaagesha. Shrii Puraand-a San'hitaa Grantha 89. Sanskrit. Shrii Giitaamrxtataran'gind-ii. Theology.… 54/167 . Language... Philosophy. Maarulakara Shan'kara Shaastri... Sanskrit. Vishvabandhu Shaastrind-a. Shrii Chitraprabhaa. Shrii Madabhagavadagiitaayaa Prathama Dditiiyaadhyaayau. Psychology... Sanskrit. Unknown... Sanskrit. 1933. Sanskrit. 1918. Kara~nd-apura Kavii. Linguistics. Sanskrit. 131 pgs. Unknown.org/…/SanskritIIIT. 1958. Language. Language.. Sanskrit. Religion. Mumbayyaan. Sanskrit.. Shrii Dara~shanodaya. Vijay Chandra Varmanujya.. Sanskrit.... 112 pgs. 373 pgs.. Linguistics.. Shri Ram Charit Manas. Sanskrit 1933 89 pgs sanskritdocuments. Shrii Lat'akamelakama Trxtiiyo Bhaaga. Shrii Madaara~yabhat'iiyama~. Gautamamunii. 1237 pgs. Shrii Paribhaashhendushekhara.. Language. Sanskrit. Theology. Shrii Dayaananda Mahaavidhaalaya Vol 25. 1951... Religion. Literature. Sanskrit. Theology.. Psychology.. 357 pgs. 808 pgs. 1846. 50 pgs. Sanskrit.. Shri Vidrananya Muni. Literature. 340 pgs. Shriihariishaastrii Pand-d'itavara. Natural Sciences. 0. Shrii Paraatrin'shikaa Grantha 18. 294 pgs. 1923. Shri Raghavendra Vijayah.. 1927. Goswami Tulasidas. Shri Pacchadashi Pitambhari Bhashya. Sanskrit. Literature. Raghunaathaprasaada~ Pand-d'ita~. 1874. 278 pgs. Shrii Sang-gameshvarakrod'ama~. Shaastri Mukundaraama. Jayakrishna Misra. Religion... Shrii Bhaashyama~ Da~vitiiyo Bhaago Vivrxtyaatmaka.. Linguistics. 1917. 1938. Social Sciences. Religion. Aapat'e Hari Naaraayand-a. 384 pgs. Mahaakavii Shriishaktiibhadraa. Psychology. Philosophy. 1933. Sang-gameshvarashaastrii Gummaluurii. Shrii Panj-charaatran. 326 pgs. 611 pgs.. 517 pgs. Social Sciences.. Literature. Shriddisarah.2/14/2011 A list of scanned Sanskrit books at III… Shri Madbhagvadgeeta. Shrii Gautamamuniiprand-iitanyayasutrani.. Shrii Ashht'adashasmrxtayaa. Shri Manmahabharathamu Vol 3. Shrii Aashchara~yachud'aamand-i. Aapat'e Vinayaka Gand-esha. 161 pgs... Literature. Shrii Mada~ddaipaayanaprand-iita Brahmasuutraand-i Grantha 21.. 473 pgs. 1933.

Shriimadabhagavadagiitaa Grantha 64. Psychology... 1921.. Sanskrit.. Sanskrit. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… Sanskrit. Sanskrit. Shriimadand-ubhaashhyama Faskiikyulasa~ 8.. Religion. Sanskrit. 94 pgs. Shriimadand-ubhaashhyama~ Faskiikyulasa~ 9. Chaara~ya Madraamaanujaa. 1952. Sanskrit.. Shriishriivallabhaachaara~yaa. 264 pgs. Shrii Sara~vadara~shanasan'graha. Religion. Sanskrit.. Sanskrit. Biography. Shriimanmadhvaachaara~yaa. Sanskrit. Theology. Theology. Sanskrit. 1927. 1948... 1921. Theology.. 1906. Sanskrit. Philosophy. Shriikrxshhnd-ayajura~vediiyataittiriyasan'hitaa Trxtiiyo Bhaagah. Theology. 393 pgs. Theology.. History. 110 pgs. Theology. Vallabhaachaara~yaa Shriishrii. Shriikhachchhandatantrama~ Panj-chamo Bhaaga Grantha 53. Natural Sciences. Shriishriivallabhaachaara~yaa. Psychology. Sanskrit. Shriimadaachaara~yadand-d'i.... Religion. Shrii Svachchhaandatantrama~ Grantha 52. Theology. 1939. Theology.... Shriimadabhagavadagiitaa Grantha 92. Qs-emaraaja. 1954.... Sanskrit. Religion. Raamaanujaachaara~yaa Shrii. 1930.. 1919. Shriivaasudevaanandasarasvatii Pa Pa. Kand-t'ha Raajaanakaraama. Theology. Shrii Madabhinavaguptachaara~ya. 288 pgs.. Qs-emaraaja. Shriimadabhagavadagiitaa Dditiiya Khand-d'a Grantha 34. Theology. Religion. 219 pgs. Shrii Tantraaloka Bhaaga 7. Religion. Religion.. Religion.. Vaamanashaastrii Pand-d'ita. Qs-emaraaja.. Psychology. Shriimadand-ubhaashhyama~ Faskiikyulasa~ 13. Philosophy. Shriimadabhagavadagiitaa Grantha 112. Religion. 1947.. Sanskrit...… Shriimadand-ubhaashhyama~ Faskiikyuulasa~ 8 Shriishriivallabhaachara~yaa Philosophy 55/167 . Shrii Shaakttivaadah.org/…/SanskritIIIT. 1945. Theology. 291 pgs.. Shriimatsaayand-aachaara~ya. Religion. Shriikrxshhnd-ayajuravediiyataittiriiyasan'hitaa Panj-chamakaand-d'arupa Saptamo Bhaaga. 299 pgs... Religion.. Theology. 443 pgs. 168 pgs. 89 pgs.. Shaastri Kaashiinaatha. 1951.. Sanskrit. 1906. 326 pgs. 344 pgs. 619 pgs. Sanskrit. 42 pgs. Shriimadaachaara~yadand-d'ivirachita Kaavyaadara~sha. 330 pgs.. Sanskrit. Abhinavaguptaa. Theology. Religion. Shrii Tantraaloka Shhashht'ho Bhaaga. Sanskrit.. 215 pgs. 215 pgs. 1924. Theology.. 761 pgs. 111 pgs. 374 pgs. Sanskrit. Theology. 1924. Shriimatsaayand-aachaara~yaa. 1933. Bhat't'aachaara~ya Gadaaghara. 112 pgs. Shriimadagand-eshagiitaa Grantha 52. Taad'apatriikara Shriinivaasa Naaraayand-a. sanskritdocuments. Sanskrit. 1923.. Psychology. Shriigurucharitama~ Da~visaahastrii. Shriimatsaayand-aachaara~yaa. Shrii Vedaara~thasan'graha. Sanskrit.. Philosophy. Religion. 1929. Philosophy.. Kaula Madhusuudana. Shrii Svachchhandatantrama~ Chatura~tha Bhaaga Grantha 47.. Shriigand-eshaathara~vashiira~ra~shha Sabhaashhyama~.. Sanskrit. 1906. 1924. Theology. 1927. Sanskrit. Shrii Svachchhandatantrama~ Grantha 31. Niilakand-t'ha. 348 pgs.. Shriikrxshhnd-ayajura~vediiyataittiriyasan'hitaa Ashht'am Bhaagah. 297 pgs. Geography. 1943.. 1933. Religion. Theology. Religion. Religion. Religion..

. Sanskrit. Philosophy. History.. Shriimanmahaabhaaratama~ Prathamo Bhaaga.. Sanskrit. Shriishriivallabhaachara yaa. Language. 483 pgs. 626 pgs. 1953. 874 pgs.. 1933. Sanskrit. Sanskrit. Shriimadand-ubhaashhyama~ Faskikyulasa~ 12.org/…/SanskritIIIT. 1905. Sanskrit. 1952. Shriimaddevii Bhaagavatama~ Mahaapuraand-ama~... 297 pgs. 112 pgs. Paramaananda.. Language. Sanskrit. Shriishriivallabhaachaara~yaa. 1905. 324 pgs. 1936. Linguistics.. 110 pgs. Biography. Theology. Philosophy. Paramaananda Kaviindra. 377 pgs. Philosophy. 1906. Social Sciences.. Psychology. Shriishuklayajura~vede Shatapathabraahmand-ama~ Bhaaga 2. Shriimadbhagavadagiitaa Trxtiiye Khand-d'a Grantha 34. Religion. Kalanda~ Viillemena~. Sanskrit. Shriisvachchhandatantrama~ Dditiiyo Bhaaga Grantha 38. 700 pgs. 1935. Psychology.. Shriimadgand-oshagiita. Linguistics. Theology. 1849... Theology. Philosophy.... Psychology. Sanskrit. Shriisayaajiigauravagran'tha. Psychology. 1923.. Religion. Religion.. Shriishan'karabhagavatpaadaachaara~yaa.. Aapat'e Vinaayaka Gand-esha. Shriimadand-ubhashhyama~ Da~tiiyo Bhaaga Baalabodhinii. 1906. Shriisvachchhandatantrama~ Bhaaga 5. Sanskrit. 517 pgs. 1930.. Sanskrit. Literature. Sanskrit. Shaastrii Pi Pi Subrahmand-ya. Sanskrit. Sanskrit. 1368 pgs. Shriiraamaayand-ama~ Prathama Khand-d'a Baalakaand-d'ama~. 1926. 639 pgs.. Psychology. 1926.. Sanskrit. Psychology. Sanskrit. sanskritdocuments. Qs-emaraaja. Theology. 165 pgs. Shriishivabhaarayama~. Philosophy.. Vallabhaachaara~yaa Shriishrii. 1921.. 350 pgs. 110 pgs.. Theology. Sanskrit. Philosophy. 112 pgs. 395 pgs. Religion. Govindaachaara~ya. Shriipurshhasukttama~. 1906.2/14/2011 A list of scanned Sanskrit books at III… Shriimadand ubhaashhyama Faskiikyuulasa 8. Theology.. Sanskrit. Shriiqs-emaraaja.. Shriimadand-ubhaashhyama~ Faskikyulasa~ 6.. 1939. Psychology. Shriishriivallabhaachaara~ya. Shriisvachchhandatantrama~. Shriimadand-ubhaashhyama~ Faskikyulasa~ 10. Sanskrit... Religion. 1963. Paand-d'eyena Raamateja.. Religion. Sanskrit.. Shriishivabhaarata. 1933. Philosophy. 1906. Shriimadand-ubhaashhyama~ Faskikyulasa~ 14. Shriivaalmiikimahaamuni Aadikavi. Aapat'e Hari Naaraayand-a. Geography.. Shriishang-karaachara~yaa. Sanskrit. Psychology. Shriimadbhagavadgiitaabhaashhyaara~tha. Literature. Religion. 1906. Vallabhaachaara~yaa Shriishrii. 110 pgs. Shriishriivallabhaachaara~yaa.. Shriimadbhagavadadgiitaa. Qs-emaraaja~. 1875. Shriipaarameshrvarasan'hitaa.. Sanskrit. 110 pgs. Religion.. Sanskrit. Psychology... Shriimadand-ubhaashhyama~ faskikyulasa~ 4. Theology. Theology. Religion.. Shriimatsaayand-aachaara~yaa.. 1953. Shriimadand-ubhaashhyama~ faskikyulasa~ 5. Upaadhyaaya Shrii Baladeva. Philosophy. Theology. Theology. 1906. Baapat'ashaastrii Vishhnd-uvaamana.... Theology. Sanskrit.. Vaad'hdivasa. Religion.… Sh ii h hh d t t G th 31 A h M h h h R li i Th l 56/167 . Sanskrit.. Sanskrit.. Theology. Religion. Shriishriivallabhaachaara~yaa. 851 pgs. 110 pgs.... 138 pgs.. Religion. Philosophy. 212 pgs. 29 pgs. 1931.. Shriimada~vallabhaachaara~yaa. 102 pgs.

Religion.. 1930. Theology. Shriitantralokah Navamo Bhaaga. 1922. Shriitantraalokah Ashht'amo Bhaaga. 351 pgs. 300 pgs. Unknown. Shrxng-gaaratilakama~ Da~vitiiya Vrxtti. Shriitantraloka Saptamo Bhaaga.. Aloiisa~ Ant'ona~ fuha~rera~. Theology. Shrimad Bhagvad Geeta. Shriitantraalokah Bhaaga 2. Shriitantraalokah Chatura~tho Bhaaga. 232 pgs.... 262 pgs.. Shastri.… Shukla Yajura~vediiya Kaand-va San'hitaa Saantabalekara Vasantashriipaada Religion Theology 57/167 . 1927.. Religion. Srimadvaman Pandith Virchita. 1931. 93 pgs. Literature.org/…/SanskritIIIT. Gupta Abhinava. 237 pgs. Dr Abhaya Nath Mishra. Shriitantraloka Dvadasho Bhaaga. sanskritdocuments.. Unknown. Theology. 594 pgs. 844 pgs. Ram Prasad. 1921.. 1930. Sanskrit.. Shriitantraaloka Ashht'amo Bhaaga Grantha 47. Sanskrit. Linguistics. Gupta Abhinava.... 1946.. Sanskrit. 342 pgs. Jeevanrama Lallurama. 287 pgs. Theology. Theology. Ant'ona~fuha~rera~. Chara~yaa Tot'akaa. 1924. 1921. Sanskrit. Gupta Abhinava.. Religion. 1930. Gupta Abhinava. Religion. 301 pgs. Sanskrit..... 1938. Religion... Sanskrit.. 161 pgs. Religion.. 279 pgs. Philosophy. Sanskrit. 548 pgs.. Guptaa Abhinava. 1936.. Unknown.. Shriivaasishht'hadhara~mashaastrama~. 1912. Gupta Abhinava. Unknown.. Unknown. Theology. 1940. 1935. Sanskrit.. Gupta Abhinava. Shriitantraaloka Navamo Bhaaga. 1921. 105 pgs. Religion. Sanskrit.. Theology.. Religion.. Shriisvachchhandatantrama~ Grantha 48. 1975. Religion. Sanskrit.. 1922. Shrutikalpalata. K. 1922. 1938.. 1984. Sanskrit. Religion. Sanskrit.. 78 pgs. Sanskrit. Religion. Shriisvachchhandatantrama~ Shhashht'ho Bhaaga. 340 pgs. Sanskrit. Shriman Mahabharatam Part 4 7 Dronaparvan. Sanskrit. Theology... Shrii Mumbayyaam. 280 pgs. Sanskrit. Theology. Theology. Shriivaasishht'adhara~mashaastrama~. Theology. Religion.. 1926.. Sanskrit. Religion. Qs-emaaraaja Shrii. Sanskrit.. Shriiraamabhadradiiqs-itaa. History. Religion. Theology. Sanskrit.. Theology.. 93 pgs. 111 pgs.. Theology. Abhinavaaguptaa. 1936. Philosophy. Sanskrit.. Gupta Abhinava. 304 pgs.. Sanskrit.. Unknown. Sanskrit. 1926. Shriramanageetha. 1922. Shrimad Bhagawatam. Philosophy. Aachara~ya Maaheshvaraa. 1910. Sanskrit.. Religion. Mulkaraj Sharma. Shrxn'gaaraa Prakaasha Prathamo Bhaaga Grantha 1. Theology... Pandit Ramachandra Shastri Kinjawadekar.. Sanskrit. Shubh Santhathi Yogaprakasha. Geography. Theology... Shriitantraaloka. Religion. Religion. Theology.... Raaghavana Vi. Religion. 262 pgs.. 287 pgs. Shrotriyas Of Mithila. 1956. Aachara~ya Mahaamaaheshvara. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Shriisvachchhandatantrama~ Grantha 31. Sanskrit. Niranjananda Swamy.. Shriitantralokah Panj-chamo Bhaaga. 370 pgs. Psychology. Shriisvachchhandatantrama~ Trxtiiyo Bhaaga Grantha 44. Aachara~ya Maaheshvara. 185 pgs. Shukasaptati. Theology. Biography. Shriitantraaloka Chatura~tha Bhaaga. Sanskrit.. Shrutisaarasamuddharand-ama~. Chaara~ya Madaabhinava. 290 pgs. 321 pgs. 1926.. Gupta Abhinava. Shriitantraalokah Shhashht'ho Bhaaga. 177 pgs. Sanskrit. 2001. Sanskrit. 282 pgs. Language.

Pan'chaananabhat't'aachaara~ya Shriivishvanaatha. Sanskrit.. Literature. . sanskritdocuments. Sanskrit. 932 pgs. 1937.... kumudranjan ray. 0. Siddhaantalesha San'graha Bhaaga 2. Language. Sanskrit. Sidhanthkalpavalli.. Sanskrit. Unknown. Siddhaantakaumudii. 1916.. 2002.. 565 pgs. Linguistics.. Sanskrit. 0.. Sanskrit.kesavarao Musalgaonkara. Sanskrit. Shukraachaara~yaa Shriimada~.. Language. Sanskrit. Sidhdaantamuktaavalii. Sanskrit... Pt. 1929... Shukraniiti. . wasudev laxman sastri pansikar. -. 1921. Unknown. Sanskrit.sri Sudhakara Dvivedi. 679 pgs.. 112 pgs. 1990.. Sanskrit.... Philosophy. . 942 pgs.. Sanskrit. Philosophy. 1916.. Sinjiniyam. Sanskrit.venkata Rao. Saantabalekara Vasantashriipaada.. Sri Chandiprasadshuklashastrina. Literature. Siddhanta Kaumudi Or Bhattoji Dikshit S Vritti On Paninis Vyakarana Sutras. Sanskrit. Linguistics. 142 pgs.. 0. T.… 58/167 . Language. . Diqs-ita Appayya. 1877. Siddanta Muktavali Dinakari Ramarudra. Diiqs-ita Shriibhat't'oji.. Philosophy. Siddantakaumadyam. Sanskrit.. Vedanta. Sibrasutra Nrubhatrayam. Sanskrit.. 474 pgs.. Siddanta Siromani Of Bhaskaracharya. 1906.. M...bhatt. Sidghnithryam. Diiqs-ita Bhat't'o... Unknown. 1998. 0. Jagannatha Shastri.... 40 pgs. 1219 pgs. Geography. Siddhanta Tatva Viveka Of Sri Kamalakara Bhatta.. Sanskrit. 96 pgs. Siddantha Sidda Gnanam... 1960. Unknown. 434 pgs. Sindhi Jaina Granthamala. 1962. 1938. 1991. Philosophy. Sanskrit Grammer. Siddhaanta Kaumudii Trxtiiyo Bhaaga Grantha Maalaa 136. 534 pgs. 317 pgs.. Theology. 1910.... 360 pgs. Msk Shasthri. Sanskrit. Religion. 142 pgs. Unknown.. 235 pgs. 1980. 1997. History. 155 pgs. 1959. Linguistics.. Bahadur Simhaji Sindi. Sanskrit. 0. Jagannatha Shastri. Anantha Charya. 1862. Sisupalavadham. Biography.. Siddhivinishchayatika. 1937.. 325 pgs. Dr.. Yudishtara Mimamsak. Siddhanth Kaumudhi.. 249 pgs. Sanskrit. Linguistics. Indian Astrology. Shulkayaju Praatishaakhyama~ Dditiiya San'skarand-a. Dr D Arkasomayaji. Sri Anantaviryacharya. Theology. 1005 pgs. Sanskrit. Sanskrit. Siksha Sutrani.. Siddhanta Rahasyam. 1949. 166 pgs.. 234 pgs. 1925. Literature . Sanskrit.s. Siddhanta Kaumudii Bhaaga 2. 1942. Religion. Language. Sanskrit.shastri... Unknown. 416 pgs.. 235 pgs. Technology.. Psychology. Sanskrit. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Shukla Yajura vediiya Kaand va San hitaa.. Unknown.. Sanskrit. Siddhanta Siddhanjana.. Siddhanta Kaumudi Vol 3 Part 1.. 134 pgs. 215 pgs. Literature. Bhat't'aachaara~yaa Jiivaananda Vidhaasaagara. Sanskrit.5. Literature. 690 pgs. Siddhanta Kaumudi. Unknown. 1893.g. Linguistics. Shukla Ysjuhu Shskeysksrams kanda Pradeepa.. Philosophy...h. Siddhitrayi And Prthyabhijna Karika Vritti. Sanskrit. 130 pgs. 580 pgs. Sanskrit. Chandra Sekhara. G.. 1929. Sanskrit. 1499 pgs. Sri Vallabhacharya. Unknown. Literature.org/…/SanskritIIIT. 2002. Siddanta Chandrika. 404 pgs. Shvetashvataropanishad. Language. Bhat't'oji Diksita. Sri Ramasram. M. A C Subbukrishna Srowthy. Sanskrit. Philosophy.

.. Art. Bhat't'aa Devaanaa. sanskritdocuments. Linguistics. Language. krishna Das. Dharaachaara~ya.. .. Literature.. 1916. Pandith Sri Ramchandra Jha. L. Skanda Mahapuranam Vaishnava Khanda. 1959. Sotara Siddhanth Kaumudi Prayogsoochi Vol Iii. Srimadananda Theertha.. Smriti Chandrika Sraddhakanda. 170 pgs.2/14/2011 A list of scanned Sanskrit books at III… Sita Ravana Samvada Jhare. Language. Smrutyartha Sagara.k. Sanskrit. 1918. . A B L Awasthi.. 1949. Gand-apatin' Naathaadigurutrayan. 470 pgs. Unknown... Sanskrit..padhya. Linguistics. devana bhatta.. 144 pgs. Religion. Smrxti Chandrikaa Khand-d'a 3 Dditiiyaa Bhaaga. 423 pgs.. 301 pgs. 1875.. 252 pgs. Religion. . Sanskrit.. Smrxtichandrikaa Samskaarakaand-d'ah Prathamah. Smrxtiinaan' Samychchaya Grantha 48. Sanskrit.. Theology. 1965. Religion. devana bhatta. 1921. Skanda Purana. 1914.. 474 pgs. 156 pgs. Smruthi Chandrika. 661 pgs.. 1952. Sanskrit. Smrxti Sandara~bha Trxtiiyo Bhaaga. 410 pgs. Unknown. Unknown. Unknown.. Theology. Somraj Krishna Das.. .. Narasimhachar. 944 pgs. Skanda Mahapuranam Vol Iii. 379 pgs.. Hari Narayana. 1966. 1978. Philosophy. 673 pgs. Sanskrit. A Ramachandra Ratnaparakhi. Sanskrit. Smavadamala.. Literature. Bhat't'aa Devaanaa.org/…/SanskritIIIT.. 375 pgs. . ... Philosophy. Sanskrit. Sivadvaita Nirnaya. Smrxtyara~thasaara Grantha 70. 412 pgs. Bhat't'opaadyayaa Shriiyaajnikadevand-a~. L. Theology. Sanskrit.. Sanskrit.. 1914. Sanskrit. Bhat't'aa Devand-a. 486 pgs. Smrityartha Sarah. Sanskrit. Sanskrit. Linguistics.srinivasacharya.. . L. 437 pgs.. Sanskrit. 478 pgs. Sanskrit... 1912. Religion. 480 pgs. Skanda Mahapuranam Nagara Kanda. Sanskrit. Sanskrit. 119 pgs. Sanskrit. R. Theology. Literature.. Religion. 262 pgs. Sanskrit. Smrxti Chandrikaa. 1914. Skanda Purana Avantya Kanda Vol7. Sanskrit. 0. Sanskrit.. Smritichandrika. 502 pgs. 179 pgs. krishna Das. Theology.. Devana Bhatta.. Smritichandrika Part Ii. Sreenivasacharya. Sanskrit. Literature. . 1982. 1918. Unknown. Language.. Skanda Purana Volume 1 Index.... 787 pgs. 122 pgs. Sanskrit... D. 102 pgs. 334 pgs. Religion. Unknown.k. Philosophy.. Sanskrit. Sanskrit. 1914.. Unknown. 328 pgs. Language. 0.. 1965. Theology. Appayya Diksita. 1899.. 1916.. Social Sciences.. 1962. Philosophy. Somraj Krishna Das. 232 pgs.. 1912.… 59/167 . Smritichandrika... Sanskrit.. Theology. Smrxti Chandrikaa Prathama Bhaaga..g. Sanskrit.. . Smritichandrika Ahnika Kanda. 1929. 198 pgs. Bhat't'a Devand-a. Skanda Purana Part Ii.... Sanskrit. Religion.. Skanda Purana Kasi Kanda. 0. 1905.. 336 pgs. Religion. Sanskrit. 1916... Aapat'e Hari Naaraayand-a. Nag Sharan Singh. 1914. Sitaramaviharakavyam Of Orient Laksmanadhvari. 0. Sanskrit. Smrxti Chandrikaa Shraaddha Kaand-d'a. Unknown.. Sanskrit. Sreenivasacharya. Smritichandrika Iii Vyavahara Kanda Part I. 1966. Linguistics. Skanda Puranam Brahma Khanda..

Sanskrit. Pandith Sri Ramchandra Jha. Unknown. Unknown.. 0. 0. 1907. 0... Sr Madradbagavathgeetha. . Unknown. Unknown. Unknown. Linguistics Literature. Sphot'avaada.org/…/SanskritIIIT. 1933. Govindacharya.. 1956. Language. Linguistics.. 188 pgs. 1989.. Unknown. Sanskrit.. Sanskrit. . 1065 pgs. Sanskrit. Sri Anubhashyam.. 0.. Sanskrit. 0. Sri Acaranga Sutram Part3. Sri Bashya Vimarsana Pariksha. Vedanta.. 0. 1992..... Unknown.. Sradha Martanda. 439 pgs. 1948. Unknown.. Sanskrit.. Sanskrit. 1949. . Spanda Sandoha Of Kshemaraja. Sanskrit. Sakthism. 374 pgs. Literature. 214 pgs. Linguistics. 130 pgs. 136 pgs.. 126 pgs.. Sree Mrgendra Tantram.. Spota Darsana. 1956. .. 1956. 110 pgs.. Sphutartha Abhidarmakovyakhya. sanskritdocuments.. -.. -. Sanskrit.. 416 pgs. Sri Bagavathgeetha. Sanskrit. 598 pgs. . Sanskrit..... Sphotavada Of Nagesa Bhatta. . Sanskrit.. 682 pgs. Sree Lakshminarayan Samhitha. Sri Sundaracharya.. 1946.. Swamy Sri Krishnavallabha Charya. 1997.. 194 pgs. Sanskrit.. Unknown. 341 pgs. Madhusudanacharya. pgs.. Unknown. 1946. Unknown. Sree Skande Mahapurane Panchama Avanthyakhandye. Sri Ath Madhvanidaanvishayanukramnika..2/14/2011 A list of scanned Sanskrit books at III… Sothara Prashnavali Dwithiya Kandamu.. Mishra Aachara~ya Mand-d'ana.. Sanskrit. Sanskrit. Swamy Vishnu Thirdha. Sri Ramachandr Jha. Literature. Sotthara Prashnavali Vol I. Philosophy. Unknown. 1931. 110 pgs. Krishnananda Natha. 1927. 234 pgs. 1946. Srauta Prayascitta Vidhi.. 0. Ramdin. Krishna Datta Shastrin. Southara Pradhama Prasnavali. Sramana Bhagavan Mahavira Vol 1 Part 1. 46 pgs. 1930. Literature. 270 pgs. Sanskrit. Sree Subhodhini. Sanskrit. g somayaji. Sanskrit.. Sanskrit.… 60/167 . Unknown.. 580 pgs. 163 pgs. Sphot'asiddhi Grantha 6.. Unknown. 108 pgs. 0. Sri Ascharyachudamani. Linguistics.. Raghunatha Patak. Sanskrit. Vallabhacharya.. Linguistics Literature. Unknown. Sri Bashya Vimarsana Pariksha. Sri Bashya Vartikam.. Unknown. Sraddha Marthandam.... 392 pgs. Literature. Sphotavada. Unknown. 490 pgs. V. Sri Krishna Das.. Linguistics Literature.. Sanskrit. Mahamahopadhyaya Pandit Mukunda Rama Shastri. 701 pgs... Sanskrit.. Unknown. Unknown. 0. 1887. S Levi.. Sanskrit. Language. 220 pgs. 166 pgs.. Sree Madbhagavathgeetha. V Krishnamacharya.. Naageshabhat't'a. Sanskrit. Sradda Viveka. Language.. 1917. Sanskrit. Soundarya Lahari. Unknown. Sril Narayan Bhattagoswami. S Kuppuswami Sastri.... 0. Sanskrit. 258 pgs. 0.. Sri Bashya Vimarsana Pariksha. Sanskrit. Sanskrit Mimansa.. Psychology. Sanskrit. Ramayanam. 244 pgs. Sanskrit. Unknown. 158 pgs. Sri Bajothsav Chandrika. 1919. Unknown. Sri Bashyam. 225 pgs. 0. 0... Sanskrit. Madhusudan Kaul. A Ramulu. Sanskrit. Sanskrit.. 142 pgs. 1927. Soundarnand Mahakavy.. Sanskrit.. 40 pgs.. 0. 1927.. Muni Ratna Prabha Vijaya. Sri Ramachandra Jha. Southara Prasnavali.. 46 pgs. Sanskrit. 372 pgs. Sanskrit. Krishnamacharya. Unknown. 1952.

Srivasudevanandsaraswathikruthm. Sri Durga Saptasati. Sanskrit.. 128 pgs.. 1240 pgs... Sanskrit. 2000... 1950. Sanskrit. Sri Bhasya Or Bhramasutrabhasya Vol 3. Sri Brahmasutrani. 1917.. 408 pgs. History. Sri Geetha Jnanmarg... Sri Brahma Sutriya Vedanta Vrtti.ananthchary. Pandith Sri Sudama Mishra... Unknown.... Sanskrit. 506 pgs. Sri Gurusanhita. V. 1867.ranganadhacharya. Sanskrit. 128 pgs. 0. Sanskrit. Acharya V R... Unknown. 1938. Khem Raj Krishnadas ... Sri Dommraj Narsinghraj. Sri Gurugovind Singh Bhagvat Padh Jeevnetivratham.. Sanskrit. Pandith Duttram. Sri Daandeepika.. Sri Chaitanayalilamratsar. Unknown. Sanskrit. Swami Jagadisvarananda.. 334 pgs. -. 580 pgs. 1935. Sri Devipuja Kalpa. 1953.. Sri Geethardha Prabodh. 1237 pgs. 616 pgs. Sanskrit. Sri Bhrthurisubhashitam Vairagya Shatak.. Sri Yashodanandanayen. Sanskrit. Sanskrit.… 61/167 . Srikanth Sharma... 1954. Sanskrit. 569 pgs. Khem Raj Krishna das. Sri Bhasya Mahapuranam. Unknown. Sanskrit. Sri Bhattikavyam... 886 pgs. Sanskrit. Sanskrit. Sanskrit. . 202 pgs. Badhiri Das. 569 pgs.. Chakravarthy Acharya Swamy U V P M. Geography.. Philosophy. sanskritdocuments. Bhavamisra. Sanskrit. Biography. 228 pgs. 694 pgs. Unknown. Unknown. 243 pgs. Unknown. Sri Mahadev. Sanskrit. Theology. 312 pgs. Vasudeva Vidyabhushan.. 0.. 0. Unknown. Sri Jathi Bhaskar. Sanskrit. Unknown. Sri Harithsanhita. Sri Brajotsava Chandrika.. Sanskrit. 242 pgs... Sri Ranga Ramanuja Charya. Literature. Shes Raj Sharma. Sanskrit. Unknown. 1941. 538 pgs. 1954. Linguistics Literature.. Sanskrit. 70 pgs.. 290 pgs.. 1939. M. Pandit V. Unknown... Sri Fakkikartanmanjusha Vol I.. Unknown.. .. Unknown. 2000. Sri Gurucharitam Vol 2. Unknown. 1938. 473 pgs. Unknown. 362 pgs. 268 pgs. Sanskrit. 1955.. Sri Jayapura Raja Vamsyavali. 1993. 504 pgs. 1962.. Swami Sri Raghuvaracharya. Sri Vasudevanandsarawathiswamikrutha.2/14/2011 A list of scanned Sanskrit books at III… Sri Bashyam. Unknown. Sanskrit.. Sanskrit. 1910. Sanskrit. Unknown.. Sri Hikmath Prakasha. Sri Bhava Prakasa. Grammer. Somraj Krishna Das. Sri Devi Poojakalp.... 1960. 1942. Sri Bhasya Vol I.. Narayana Bhatta Goswamy. Sanskrit. 1970. 252 pgs. 1966. Ramanatha Nanda Sarma.. Sanskrit. Sanskrit. Unknown. Sri Bhasya Sariraka Mimamsa Bhasya Vol I. 532 pgs. Language. 1958.. Unknown. Sri Bhagavata Dashamaskandha part. 588 pgs. Sri Datta Puranamu. 1935. Unknown. Sri Brahnidhanturatnakar Vol Iv. Sanskrit. 0. 1943.. 294 pgs... 536 pgs. Sri Bhavaprakasa Of Bhavamisra...ananthacharya. sribhavamisra. Sanskrit. Sri Brahtstotraratnakar.. Pandith Sri Kankalalasharma Thakur.. Unknown. 0. 1947. 1930. Sanskrit.. Sri Ramanuja. Sanskrit.. Sri Vasudeva Nandasaraswathi Tembeswami.. Linguistics Literature.. Philosophy. Sri Bhasya Or Brahmasutrabhasya Vol Ii. 22 pgs. Sri Bhavishya Mahapurana. 1954. Pandith Jwala Prasadji Mishra. .org/…/SanskritIIIT. Unknown.. 624 pgs. Linguistics. 1953.. Religion.ityanen.. 154 pgs. Venkat Rao Raysam. Unknown.

Unknown. Dr.. 0. 854 pgs.. Unknown. 0.. Sanskrit. Sri Mad Bhagavatam.... 262 pgs. Language. Unknown.. 384 pgs. Sanskrit. Sanskrit. Sri Kavyardash. Theology. Sri Mad Bhagavatam Ashtamaskanda. Sri Laghushabdendulkala. 1985. S Vshwanathan.. Pandit Ramtejpandeyan. 1956. Sanskrit. Language... 1957. Sanskrit. Sanskrit. Unknown.. 1976. Ganga Vishnu Sri Krishna das. 0. Sri Kavyadarsa Of Dandin Edition Iii. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Sri Kanta Charitam Of Munkhaka. Unknown. . 246 pgs. Unknown.. Sanskrit.. 784 pgs..… 62/167 . 515 pgs. Unknown. 1567 pgs. 746 pgs. Sri Mad Bhagavad Gita. Unknown.. -. Sanskrit... Sri Krishna Janmaskanda. Sri Raghunath.. 145 pgs... Unknown. Sri Laxminarayana Samhitha Of Sri Svetayana Vyasa Vol 1 Part 2. 0. Literature.. Dr.. Sanskrit.. 1976. Sanskrit.. sanskritdocuments. Swami Srikrsnavalla Bhacarya Shastri. 0.. Sri Madhandra Maha Bhagawatakathah.. Sri Madbhagavathy Thiruthiya Skandhaha. Sanskrit. 1956. Sanskrit. 1956. ... 845 pgs. 306 pgs. Literature.. . 393 pgs.. Sri Madbhagavathe Prathamaskandhaha. 578 pgs. Sri Ramanujbhasyen.. Sri Madbhagavatam Pradama To Dvadasakandaha Full With Sanskrit.. G Laxmikanthaiah. 122 pgs. Sanskrit. Sri Laghu Bhasyamu. . Abhinava Gupta. Sanskrit... . Sri Madbhagvathgeethaya Vigyanbhashyam. 0.. . Language.raghunathacharya. Unknown. Sri Mad Bagavadgeeta Sri Mahabharath Antargath. 192 pgs... Swami Vireshwarananda.. Literature. Sanskrit. 0... Sri Madbhagavadgita Gitarthasangraha Of Abhinava Gupta. Unknown. Linguistics. 0. Sri Madbhagavathe Akadhasaskandhaha. 1921. Unknown.. Unknown. Srimannarayanramanujjeeyswamini. Sanskrit. 412 pgs. Unknown. Sri Laghu Bhasyam. Religion.. 1963.. 1957.I V. 352 pgs. Swami Srikrisna Vallabhacharya Shastri. Sri Chidirematiyeveerchandrasharma. Literature. .. .. Language. Sri Madbhagavathy Panchama Scanda. . 353 pgs. Sanskrit. 0. Sanskrit.. Mahakavi Sridhara Acharya Virchit. Sri Madhusudhan Sharma Maithli. 362 pgs. 0. 792 pgs. Sanskrit. Sri Karbhashyam Vol. Unknown.b. Jona Raja.. Linguistics. 855 pgs. 1971. Sanskrit. Sanskrit.. 415 pgs. 151 pgs. Linguistics.org/…/SanskritIIIT. Sri Madbagavath Sridaritika. 278 pgs. 802 pgs... 1957. Sri Laghu Siddhanth Kaumudi. 1953. 252 pgs. 0. 0.... Sanskrit. Somraj Krishna Das. 283 pgs. Sri Mad Bhagvadgeeta. Sri Mad Bhagavatam Trutiya Kandam. 422 pgs. Literature. Linguistics... .. . . Sanskrit.. Sanskrit. Shivnarayan Shastrina. . 1976. Unknown. 1972..sankaranarayanan. Sri Madbhagavad Gita Sri Mahabharathantargath. Sanskrit. 468 pgs. 546 pgs. Unknown. 1976. Sri Ramanuj Bhasyen.. Sri Laksminarayanasamhita Vol. 0. Sanskrit. 1985.. Unknown. 1164 pgs. Sri Maaliniivijaya Varttikam.. Unknown.1. Chintamani Gangadhar Bhanu. Sri Madbhagvadgeeta. Sanskrit..s. Sri Madbhagavatham Vol 5. 0. Sanskrit. . Khemraj Krishnadas. Sanskrit. Pandith Sri Shobhakanth Jha... 383 pgs. Sanskrit. . 0. Sanskrit. Sri Madbhagavatham Vol 7.. Sri Lalthasahasranama. .. 466 pgs. 1971. Unknown. Sri Madhevibhagavatam Mahapuranam. Sanskrit.

. 0. Unknown. 1935. Sanskrit.. .krishnacharya. Sanskrit. 259 pgs. .. Sanskrit. 240 pgs.. 1366 pgs.. Sri Madvalmikiramayaname Sundharakandam. 939 pgs. C Sankara Rama Sastri.. Sri Natakatha Sangraha Abridge Stories Of Sanskrit Dramas. Sri Maha Bhagavatam. 540 pgs. Unknown.. 368 pgs. Sanskrit. Sri Madvalmiki Ramayan Vol I. Religion.. .. Unknown. Jai Krishna Das Haridas Gupt. 1921. 1922. Nalachakravarthy K.... 1992.. Sri Madvalmiki Ramayanam Vol. Religion. Language. Sri Thulasi Das. 0. Yoganarasimha. 1950. 130 pgs. 94 pgs. 43 pgs. Sanskrit... 572 pgs. 1987. 0. 1322 pgs. Theology. Sri Manmanas Namavandana. Unknown. Sanskrit.. Sanskrit. Unknown. 1867... 0. Religion. Sanskrit. 0. Ganga Vishnu Sri Krishna Das. Sanskrit. . Sri Manoramashabdaratn Prashnouttarwali Vol I. Sri Mahabharatham Shanthi Parvan. Unknown.. Unknown.. Sanskrit. Religion Theology. Sri Manoramashshabdartan Prashnouttarvali Part I I. Pandit Madhusudan Kaul Shastri.. Linguistics. Sri Madhvacharya Brahmasutra Bhasya Vol Iii. 459 pgs. Ganaga Vishnu Sri Krishnadas. .. Literature. Sri Mani Charithamruth. Pandit V Ananta Charya. Unknown. 82 pgs. 956 pgs. 98 pgs.. 402 pgs. Sanskrit. 334 pgs. Sanskrit. 1948. Ganagavishnu Sri Krishnadas. Language. Sanskrit. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Sri Madhragra Sanhitha.I. Sanskrit. 288 pgs. 1995. Sanskrit. 816 pgs. Sri Mahabharatha Tathparyyanirnaya Satikas. Sanskrit. Sri Malinivijayottara Tantram Vol Xxxvii. Sanskrit. 148 pgs.. 498 pgs. Sanskrit. 226 pgs.. Pandith Shivdutten. . Sri Madramayanmimamsa. Sri Malavikagnimitra Of Kalidasa. Sri Madhvas Tattva Vada. 1922. Sri Man Mahabharatam.. Unknown. Linguistics. Sri Rajnarayan Shastry. 1907.. Language. 0. Sanskrit.. Dr Malladi Gopal Krishna Sharma. 1994. Sri Nilakanta Bashyam. T Srinivasacharya. 0. 0. Unknown.. 1944. Sri Nimbarkvrathnirnay. Literature. Sanskrit. Sanskrit. Sri Mahabharatham Ashravmedhikparv Vol X V I I I. Unknown. Vedavyasachar........... P P S Sastri. Sanskrit. 0. Unknown.. sanskritdocuments.org/…/SanskritIIIT. 665 pgs...… 63/167 . T R Krishnacharaya. 0.I I I. Anandtheertha Bhagavatpadacharya. Linguistics.. Sanskrit. Religion. Sri Markandeyapuranam. Hariprasad Bhagirathi Ityesham. Language. Sri Nirnaysindhu. Sri Nyayamrutha Kaladharaha.. 1968. Dattavathari Sri Manik Prabhu Yanche. 1940. 900 pgs... Sri Malinivijaya Varttikam. Sanskrit. K Ramachandra Shastri. 1043 pgs. 1985. Literature. 0... 780 pgs.. . 328 pgs. Sanskrit.. Sri Madhwa Mantrartha Manjari Of Vaishwanathi Narayanacharya. Religion. 1955. Sri Manmaharaj Sanskrit Mahapatashala Patrika. Pandut Madhusudan Kaul Shastri.. T.. Unknown. Sanskrit. Sanskrit. Sri Madwasiddantasarasangraha.r. Sri Madvalmiki Ramayanam Vol.. 1948... Unknown. . Sanskrit. 215 pgs.. 1992. Unknown. Unknown. 370 pgs. Sri Nilakanta Bagavathpada. Unknown.. Unknown. Sanskrit.. Sri Mannyayasudha Prarambha. Linguistics. 534 pgs.. Literature..

Sri Paninivyakarne Vadartanam Vol I.. Theology... Unknown..org/…/SanskritIIIT... Sri Shabdharthchintamani Kosh I Vol I I I. Unknown.. M.. 242 pgs. Sanskrit. 0. Not Available. Linguistics. 1954. Krishnamacharya V. 70 pgs. 160 pgs.. Sri Sankara Vijaya Makaranda.. Sanskrit. K... 235 pgs. Sri Sanatana Dharma Lokaha Part Iv. Subramania Sastri. 88 pgs. Religion.. 656 pgs. Sri Ramanuja Campu. Sanskrit. Sri Ramayan Valmikiye Ayodhyakand. Sri Sanskrithalok Vol I I. Sri Nyayasudhatipani Srinivasathirthavirachita Prarambyathe.. 128 pgs. Pandit Sri Mayaram Sangrahit.. Sri Raghuvamsam Pakyanam... Sanskrit. Unknown. 533 pgs. Sri Paramahamsah. Sri Sarvamoola Granthah Of Sri Anandatirtha Bhagavatpadacharya I. Sanskrit.. Unknown... 0.varadachari... Unknown. Sanskrit. Sri Satika Threemuthrrasagara Nam. Sanskrit. 1920... Unknown. Sanskrit. 500 pgs. Literature. . 210 pgs.. 1978. 818 pgs. Sanskrit.. -. .. 0. Sri Raga Ratnakar Tatha. Sri Paribhashendu Shekar. Sanskrit. 1976.Vol 2. Sri Sankara Grandhavali . Dvaita Philosophy. 1661.. Unknown. Literature. Unknown. Tirumazisai Alwar. 1999.. 605 pgs. 0. Sanskrit.. Literature. 378 pgs. Sanskrit. 47 pgs. 1965. 382 pgs.. Sanskrit. sanskritdocuments. . Sanskrit. P Srirama Chandrudu. 100 pgs. 600 pgs. Unknown.. 1998. Language. Linguistics. Madhvacharya Gangur. 2001. 0. Unknown. Prabhakara Rao M. V. 1987.. Sri Sareeraka Meemansa Bashya.. Unknown. -. Sanskrit.. Vijayeendrateertha. Sri. 52 pgs. 1933. 230 pgs. Sanskrit. Sanskrit. Language. Sri Rasayoga Satakam Part Ii. Sri Sukhanandnathen. Sri Sankara Grandhavali Upanishadvani.. 1949. Acharya Pandit Sri Sotharam Chaturvedhi. Sri Sathpurush Charitra Prakash. Sanskrit.. Sri Pithrakarm Nirnay. Pandith Surya Narayan Shukla... 0.. Sanskrit. 81 pgs. 1958. K Srikrishna Das. 1956. Unknown. Theology..Upanishadvani. Sanskrit. Sri Sandhichandrika. Sanskrit. Sri Parasara Bhatta's Sri Ranagarajasta . Literature. 1988. Language. Literature. Sanskrit. Pandith Sri Ramchandra Jha. 394 pgs.. Sri Ramanujas Theory Of Knowledge. .c. 635 pgs. Unknown. 2000. History. Unknown.. 1942... Sanskrit. 724 pgs.… 64/167 . Literature. Sri Sanskruthalok Vol I I I. Sanskrit. Vedanta.. 232 pgs. Linguistics.. 0. 592 pgs.. Sri Valmiki Mahamuni. Teekadutt Dhikal. Sanskrit.. Sanskrit. 1661.. Dhinanathasharma. 0. Biography. 1952. Sanskrit. Unknown. Rambalashastri. Unknown..... Sanskrit. Sri Ramayanamu Pradhama Khandamu Balakhandamu.2/14/2011 A list of scanned Sanskrit books at III… Sri Nyayasudhatipani. Literature. Sanskrit. Narasimha Charya A. Religion. 558 pgs.. Pandith Sri Ramchandrabhakt. 1980.. Sharma V A. Philosophy. Unknown. Sri Rama Sahasra Namastotram Sri Tyagaraja Nama Stotram And Namavali. 1954. Sri Sahityanushasanam. Sri Sarvasiddhantasarasara Vivechanam.. Sanskrit. 1054 pgs.. P Sri Rama Chandrudu. 0. Unknown.... 86 pgs. pgs. 0. Sri Saaraswatham. Sanskrit. 416 pgs.. Ram Balak Shastri. Sri Madnubhutiswarupacharyapranitham. 570 pgs. Geography. Sri Paribhasendushekhara.

. Sri Sivagitabhashyam. 1973. 374 pgs. Sri Veerkrishnavijay Mahakavyam. 1953. Bellankondopnamkaramaraykavindren. Sanskrit. Sanskrit. Dr Palle Poorna Pragnya Charya. 0. Unknown. Sri Shankatrashdarbhashyvimarsh. Sri Valmiki Ramayanam Ramabiramatikayitham.. Sanskrit.. Sri Sri Vishnu Purana. 355 pgs... Sanskrit. 1940. Sanskrit.. Unknown. Ganga Vishnu Sri Krishna das.. Sanskrit. Sanskrit... Religion.. Maheshwar Shastry. Sri Sudarshana Shathakam. 1889. 673 pgs. Sanskrit. 218 pgs. Sri Siva Samhita.. 1830 pgs. 402 pgs. Sanskrit. 610 pgs. Sri Vaikhansagruhasutram Vol Ii. Sri Suryacharit Mahakavyam. 1998. Sri Svathsvrutham Vol I. Sanskrit. Unknown.. Sri Valmiki Ramayanam Sundara Kandam. 184 pgs. Sanskrit..org/…/SanskritIIIT.. Sanskrit.. Philosophy. 672 pgs. Sri Vallabhacharya And His Doctrines. Unknown. Religion. Sri Shaligramoshdhshabdh Sagar.. Sanskrit.. A S Mahaskar. Sanskrit... Sri Shivamahapuranam Vol Ii. 216 pgs. Shri Madhava Charya.. G H Bhatt. Pandith Ramchandra Sharma. 108 pgs. Unknown.. Unknown. 1985.. Sri Vaikhansagruhasutram. 1979. 1867. 1980.. Unknown. 418 pgs. Sri Tantraloka Vi... Haridas Shastri..2/14/2011 A list of scanned Sanskrit books at III… Sri Shagdhara Pragadvitha. Laxman Ranchandra Pangarkar.. 1947. .. Sanskrit. Sanskrit.. 1966. Lanka Sita Ramanshastrin. 112 pgs. Sri Munilal Gupta. Late Prof. 804 pgs. Unknown. 148 pgs. 1939. Nrusimha Bharathi. Sri Srinivas Makhi Vedanth Deshike.. 1960.. Linguistics. 406 pgs. Sri Sita Ramayanam. Literature.... 696 pgs. Unknown. Unknown. Sri Sri Chantayan Chandramurthy. Pandit Taradatta Panth. Sanskrit... . Sanskrit. Literature. Sri Subodhini. 1889. 1116 pgs. 0.. Khem Raj Krishna Dasane... 1064 pgs. 423 pgs. Sri Vayustuti. 210 pgs. Sanskrit. Sanskrit. . 0.. 236 pgs. Dr Parama Hamsa Mishra.. Sri Sri Gandhi Katha. Sri Skandamahapuranam Saptmaprabasakandam Prarambyathe. Sri Srishukadooth Mahakavyam.. Language. Unknown. G Sri Yadunathaji Maharaj. Sreemuralidhar. Sanskrit. Unknown. Linguistics. 1959. Theology. Sri Siddhhemchandrashabdanushasanam. 0.. 545 pgs. Sanskrit. Unknown. Sanskrit.... Vedas.. 0. 728 pgs. Literature. Sri Srimad Alankara Koasthubha Accn0 589. Sanskrit. Sanskrit. 192 pgs. Tantras. Tiruvenkatacharyana. 660 pgs.… 65/167 .. Garikpati Laxmikanth.... Chilukuri Ramabhadra Shastri. Sanskrit.... 255 pgs. Sri Tukaram Charitra.. Sanskrit... 0. 108 pgs. -. Unknown. 0. Sri Vallabhadigvijaya. Sri Valmiki Ramayanam Mahabyas. 262 pgs. 78 pgs. Sanskrit. Acharya D V N. Sanskrit.. Unknown. 1952. 1985. 72 pgs.. Goswamy Sri Krishnaiah Chautan. Sanskrit.. Sri Srinivas Vilas Samskruth Kavyam.. Sri Srinivasamkhivedanth Deshike.. Unknown. Language. Unknown. Literature. K Krishna Das. sanskritdocuments. Chandraji Goswami Mahodayan. 1993. Unknown. Sanskrit. Sri Vaikhanasa Paitrumedhika Prayogaha. 0. Unknown.. 82 pgs. 0. 0. Sri Srigandgiri Sri Jagadgur Charitra Sangraha.. Sanskrit. .. 0. 1996. Kulkarni G V. Dvaita Philosophy. 0. Unknown. 1963.

510 pgs. Unknown. Srikhaudar Khanda Granth. Sanskrit. Srimath Srinivasay Parasmay Brahmaney. Religion. Sri Krishna Das Sathmaj Gangavishnu. Sanskrit. Sanskrit. Srimad Bhagavad Gita. Sri Vidvadwibhooti. Sanskrit..... 1953. 714 pgs. Sanskrit... 1963. Sanskrit. Unknown. Sanskrit. Sri Vyasa Panini Bhavanirnaya. Sri Venkatachalamahatyam. 416 pgs.. 500 pgs.. 584 pgs. Sri Venkatachalam Mahatmay Vol Ii.. Dinker Vishnu Gokhale. Literature.. 340 pgs. Sri Venakatachala Mahatyam.. 1973. 1959. 1982. 1974. 578 pgs. 606 pgs... 1959. Sri Vishnu Dharmottara Mahapuranam. Unknown. 1961.. Somraj Krishna Das. Religion.. 1960. 280 pgs. P. 0. 582 pgs. Sri Vichara Dipika. 0. 1944. 1959. Tippal Samalad. Sri Venkatachala Mahathyam Dwithiya Bagam. 0. Srimath Srinivasay Parasmay Brahman. Sanskrit... Philosophy. 584 pgs. 1244 pgs. Sanskrit. Unknown.. Sanskrit. Unknown. 1926. Religion. 1987. 441 pgs. Someswara Sharma Y. 1943. 846 pgs. Sanskrit. 0. Unknown. 559 pgs.. Unknown. Gandham Sri Rama Murthy. 498 pgs. Sri Venkatachalammahatmayam Vol-i...org/…/SanskritIIIT. S Sethumadhavacharya. Sanskrit.vargranth Bhattacharya.I I.. Shri Math Srinivasa Parasmay Brahman. Sri Venkatachalam Mahatyam Vol.. 105 pgs. -. 202 pgs. Bhagavadgita. Sanskrit. 1959. Sanskrit. Sri Yogvashista Bhasha Vol I I. Sri Venkatachalam Mahatyam Vol I. Sri Yogtarangini... . Sanskrit..... Unknown. Sanskrit. Sanskrit. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Sri Vemageeta Prathama Sahasram Part Ii.. 1993. 1930... Sanskrit. Swami Bramahananda. Unknown.. Sri Vrindaranya Kshetramahatyam. 1867. 1959. Unknown. Sanskrit.. Sri Venkatachalam Mahatmay Vol I. Sanskrit. 208 pgs. Sri Viswanatha Shamran.. sanskritdocuments. Sriharshas Naishadha Darshanaparamsha. Unknown. Unknown. Madhusudhanacharya. Srikrsnavallabhacarya Sastri.. Sanskrit.. Srimad Bagavathgeetha.. Sanskrit. Sanskrit. 250 pgs. -. M Ranganadhacharya. Sri Venkatachala Mahathyamu. 460 pgs. Unknown. 349 pgs. 1000 pgs. Sri Vishnu Puranamu. Dr. Sanskrit. -. Srimath Srinivasay Parasmay.. Sanskrit..… 66/167 . Unknown. 360 pgs. Sanskrit.. 1915. Srimath Srinivasay Parasmay Brahmane. 1960.. Srimad Almiki Ramayanamu Thruthiya Bagamu. Sri Venkatachala Mahathyam Pradhama Bagam. Unknown... Sanskrit.. 276 pgs... Belvalkar S K. Sanskrit. 1960. Sri Vrath Raja. Sanskrit. 448 pgs. Srima Brahmasutra Bashyam Part 3 2 Pada.m... -. Unknown. 1941. -. Unknown.. 130 pgs. Ramlagna Pandey. 552 pgs. Sri Ram Chandra Jha. 1959. 1954... 123 pgs... Srimadvallabhacharya. Sri Vimanacharya Kalpaha. 294 pgs.jayaseeta Rama Sastry. Srimad Bagavad Geetha. Unknown... Srilakshminaryanasamhita Of Sri Svetayana Vyasa Vol Iii. Unknown. Unknown. Unknown. 0... Sri Venkatachalam Mahatmayam Vol I. Sri Prayoga Dasji. Sri Venkatesa Kavya Kalpaha... Sanskrit. Unknown. Unknown. Sanskrit. Sri Parashar Rammaharshi.. Tatacharya D T.. 584 pgs. 1972.

.. 1997. Theology. Sanskrit. Ramayanam.. Religion. 1961.. 1006 pgs... 1989. Brahucharya. 1913. 1911. Srimadvallabhacharya. 292 pgs. 956 pgs. Sanskrit.. 341 pgs. 242 pgs. Religion.. .. Sanskrit.. . Jwalaprasad Misra. Anandtheertha Bhagavatpadacharya. Dr N C V Narasimhacharya... 744 pgs. Srimadbhagavatam Navamaskanda. Srimad Valmiki Ramayanam Balakandam Ayodhya kandam. Mahadeva Gangadhar Bakre. Sanskrit... Srimad Valmiki Ramayanam. Srimad Brahmasutra Bashyam Part 3 1 Pada... 355 pgs. Srimad Brahmasutranubhasya Of Srimad Vallabhacharya. 1875. Brahucharya. Religion. K Hanumanth Rao. 327 pgs. Sanskrit. .. Unknown. Srimad Brahmasutra Bashyam Part 3 4 Pada. 1987. Sanskrit. 276 pgs. 1969. Religion. Srimadbhagavatam Pradamaskanda. Srimad Bhagavadgita. Sanskrit. Maganlal Ganpatiram Shastri.… Srimadbhivishgarvgadadhartanyavadgnasen Vidhusha Virchitaha Khemraj Sri Krishna Das Srehthina 67/167 . Bhagavad Gita. 126 pgs. Sanskrit.. -. Brahucharya. 75 pgs. Srimad Valmiki Ramayanam Saralagadyatmakam. Unknown. Religion. Prof. Sanskrit. Sanskrit.. Sanskrit. Srimad Vijayindratirtha. Srimadvallabhacharya. Sanskrit. 291 pgs. Religion. Maganlal Ganapatiram Shastri. 291 pgs. 1982.. 92 pgs. Srimad Brahmasutra Bashyam Part 1 1 Pada.... Srimadbhagavatam Astamaskanda. Srimad Valmiki Ramayanam Part 2.. 1983. 308 pgs.. Srimad Valmiki Ramayana Part 2. Srimad Vallabhacharya.2/14/2011 g A list of Sanskrit books at III… g scanned g pg Srimad Bhagavadgeeta.. 1954. 1997. 428 pgs. Sanskrit.... -.. 1997.. 1982. Sanskrit. Srimad Bhagavath Dashamaskanda Subhodini. P Radha Krishna Sarma. Unknown. Unknown. Sanskrit... 370 pgs. Srimadvallabhacharya. Srimad Jayatirthas Tattvasankhyanatika. Srimad Brahmasutra Bashyam Part 2 2 Pada. Religion. . K Hanumantha Rao. Sanskrit. 1961. Theology. Sanskrit. 1984. Srimadvallabhacharya. Sanskrit. Wasudev Laxman Shastri Pansikar. A V N Acharya. 1980. Sanskrit. Srimadbhagvata Aur Tulsi Sahitya Tulnatmaka Anushilana. Bhagavadgeeta. ... Sanskrit. sanskritdocuments. Unknown... 0. Unknown. 212 pgs. 426 pgs. 1961... 0.. Srimadbhagavatam Ekadasaskanda.. Srimad Valmiki Ramayanam: Aranyakandamu Kishkinda Kandamu. . Bhagavadgita. Religion. Srimad Bhagvad Geetha. Srimad Brahmasutra Bhashyam Vol I Part Iii. 1980.. Srimad Bhagavata Mahapuranam Of Maharsi Vedavyasa Vol 1 Skanda 1. Bhagavadgeeta. 1985.. 1992.. Hanumantha Rao K. Srimad Brahmasutranu Bhasya Of Srimad Vallabhacharya. Srimad Brahmasutrani Part Ii.org/…/SanskritIIIT.. Art. 1998. Srimad Bhagavata Mahapuranam Vol I. D Harishankar Mishra. Sanskrit. 148 pgs. Srimadbhagavatam Shashtamaskanda. 650 pgs. Sanskrit. Sanskrit.. 1997. Religion. 286 pgs. ... Sanskrit.. Sanskrit.. 358 pgs. Unknown. 720 pgs. Sanskrit.. 1936. 605 pgs.. Hanumantha Rao K.. 0. Sanskrit.. 120 pgs. 1270 pgs.

Philosophy. Sriman Nyadudha Vol .9. 1156 pgs. Philosophy. 160 pgs. 1982.. .. Philosophy. Philosophy....10. Sanskrit. Sriman Nyaya Sudha Vol I. 1983. 171 pgs.. 384 pgs. Dr. Unknown...9.. Sriman Nyadudha Vol Ii. Philosophy.. Jayatheertha. Khemraj Sri Krishna Das Srehthina. Sriman Nyaya Sudha Vol .2..... 171 pgs. Philosophy... Sanskrit. .. Sriman Nyaya Sudha Vol . 1983. 1982. 1983.. Sanskrit. Philosophy.. Sanskrit. Sanskrit. Sanskrit. 842 pgs.8... . Sriman Nyaya Sudha Vol .9.. Sriman Nyaya Sudha Vol Viii. Sanskrit. Sanskrit. Sriman Nyaya Sudha Vol Ii. 1918. Sriman Nyaya Sudha Vol .org/…/SanskritIIIT. 1061 pgs. . Sriman Nyaya Sudha Vol .. Sanskrit. Sanskrit. 1982. Philosophy. Sri Kanchi P B Annangaradharyar. 1983.. 1981. Sanskrit. .8. Philosophy.. Philosophy.... 164 pgs. Sanskrit.. 164 pgs.1. Srimat Sitaramajaneyam. Srimath Vedantadesika Granthamala. Philosophy. 1983. . . 163 pgs... Philosophy. 266 pgs. Sanskrit. 1982. Sriman Nyayasudha part 1. Srimat Tatparya Chandrika Volume Iii. Sriman Nyaya Sudha Vol .. .2. 130 pgs. Sriman Nyadudha Vol Iii.. Sanskrit. 1998.. 166 pgs. . G Laxmikanthaiah. Philosophy.8. pgs. Venkata Reddy K. Sanskrit. 1983.. pgs. Philosophy. Sriman Nyaya Sudha Vol . 336 pgs. Srimadhandra Mahabharatha Kathah. Srimadhya Mahapuranam. Sanskrit..1. Philosophy. . Venkata Reddy K.. 166 pgs. pgs.. 1983. Sanskrit.. . Sriman Mahabharathamu Aranyaparvan. 186 pgs. Unknown. Sriman Nyaya Sudha Vol X. 1981.. Sanskrit. 1982. Venkata Reddy K. Linguistics. Philosophy. Sanskrit. 186 pgs. Philosophy. Philosophy. 1982. Philosophy. Sanskrit. Sanskrit. 1983. pgs.. Sanskrit. B N K Sharma.. Ramayanam. Linguistics Literature. Sanskrit. . 1982. Unknown. Philosophy. pgs. 1981.10. 1981. Sriman Nyayasudha part Ii. Jayatheertha.5. Unknown. 316 pgs.2. Sanskrit.. . 1868. 184 pgs. 1983.. 1941. Sanskrit.. Jayatheertha.. Sanskrit. G.… 68/167 . 160 pgs. Unknown. Sriman Nyaya Sudha Vol .. 163 pgs. Sanskrit.. Philosophy. Philosophy..3. Sriman Nyadudha Vol . 183 pgs. 0.. Sriman Nyaya Sudha Vol . 1983. . Sanskrit... Gadi Srikrishnmacharyaswami.guru Venkatacharya. Sriman Nyadudha Vol .. .. 167 pgs. 167 pgs. 1980.. Sriman Nyaya Sudha Vol Ix. . Literature. 160 pgs. .d. Sanskrit. Sriman Nyaya Sudha Vol . P P S Shastri.... pgs..1. 1997. 1983...arka Somayaji. Vayu Purana.. 171 pgs.2/14/2011 A list of scanned Sanskrit books at III… Srimadbhivishgarvgadadhartanyavadgnasen Vidhusha Virchitaha. Sanskrit. Philosophy.. 198 pgs.. Sriman Nyaya Sudha Vol . 1983. Language. Sanskrit. Sriman Nyadudha Vol V. Sriman Nyaya Sudha Vol ... 1981.. 1983. sanskritdocuments. Sanskrit. 723 pgs. Sanskrit. . Linguistics Literature. Sriman Nyadudha Vol I. 1984. Sanskrit. 1982. 1933. . 1110 pgs. .. Sanskrit. Sriman Nyadudha Vol .. Philosophy.. Philosophy. . Srimahedantdesika Grantha Malaya.

2/14/2011

A list of scanned Sanskrit books at III…

Sriramakirti Mahakavyam... satya vrat shastri, Unknown. Sanskrit, 1990. 582 pgs. Sriramyansar Kanya Tilakam... B.ramraj, Unknown. Sanskrit, 1972. 243 pgs. Sritattvacintamani... Chintamani Bhattacharya, Tantras. Sanskrit, 1937. 123 pgs. Srngara Sekhra Bhana... Dr B Rama Raju, Unknown. Sanskrit, 1969. 76 pgs. Srngaraprakasa... P P Subrahmanya Sastri, Language. Linguistics. Literature. Sanskrit, 1939. 100 pgs. Srngaraprakasa Part I... Maharajadhiraja Sri Bhoja Deva, Art. Sanskrit, 1939. 101 pgs. Stava Chintamani... Bhatt Narayana, Art. Sanskrit, 1918. 165 pgs. Sthotramala... K Prathivaadi Bhayankar, Art. Sanskrit, 1942. 112 pgs. Stotraadisan'grah... T'embe Shriivaasudevaa Nanda Sarasvatii, Religion. Theology. Sanskrit, 1952. 474 pgs. Stotrasamuccaya... Dr.v.raghavan, Unknown. Sanskrit, 1969. 332 pgs. Studies In Buddhism And Sikhism... Harcharan Singh Sobti, Unknown. Sanskrit, 1986. 116 pgs. Studies In Skanda Purana Part 3 Vol 1... A B L Awasthi, Unknown. Sanskrit, 1983. 182 pgs. Subhaashhitaratnabhand-d'aagaarama~ Parivara~dhitamashhtaman' San'skarand-ama~... Raama Naaraayand-a, Language. Linguistics. Literature. Sanskrit, 1952. 528 pgs. Subhashitasudha Ratna Bhandagaram Or Treasures Of Sanskrit Poetry... pandit shivadatta kavirathna, Unknown. Sanskrit, 0. 876 pgs. Subhasita Ratna Bhandagara... Narayan Ram Acharya, Kavyas. Sanskrit, 1952. 525 pgs. Suddhadvaitamartanda... Ratna Gopala Bhatta, Kavyas. Sanskrit, 1954. 116 pgs. Suddhadwita Pushtimaargiya Samskut Vagnmaya Part I... Prof Kantamani Sastry, Religion. Theology. Sanskrit, 0. 268 pgs. Sudhasharachhandhramu... Chilakamurthy Laxmi Narasimham, . Sanskrit, 1927. 180 pgs. Suklyajurveda Samhitha... Wasudev Laxman Sastri Pansikar, Unknown. Sanskrit, 1929. 658 pgs. Sulabasutram... P Venkataramaiah, Kavyas. Sanskrit, 1984. 74 pgs. Sulabasutram... Niccolao Manucci, Kavyas. Sanskrit, 1984. pgs. Sulabasutram Katyana... P Venkataramaiah, Kavyas. Sanskrit, 1984. 70 pgs. Sulabasutram Katyana... Niccolao Manucci, Kavyas. Sanskrit, 1984. pgs. Sulbhavykaranamu Part I... kambamupathi gopalakrishnamurthy, Unknown. Sanskrit, 1959. 46 pgs. Sundari Meghasamdesa Or Dakshinatya Meghasandesa... Veluri Subbarao, Unknown. Sanskrit, 1999. 122 pgs. Sundarkandam... Dr.chandra Prabha, Unknown. Sanskrit, 1981. 284 pgs. Supplement To Purana Vol Ii No 2... Dr Ganga Sagar Rai, Religion. Theology. Sanskrit, 1963. 40 pgs. Surjan Charita Mahakavyam... Sri Chandrashekhar, Unknown. Sanskrit, 1952. 264 pgs. Surya Dandaka... Mayura Kavi, Unknown. Sanskrit, 1989. 46 pgs. Surya Siddhanth... -, Religion. Theology. Sanskrit, 0. 358 pgs. Sushruta San'hitaa Muulamaatraa... Sushruta, The Arts. Sanskrit, 1945. 1261 pgs. Sushrutasamhita Of Sushruta... Jadavi Trikumji Acharya, Unknown. Sanskrit, 1915. 778 pgs. Sutrarthamrta Lahari... Dr. R. Nagaraja Sarma, Unknown. Sanskrit, 1951. 112 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Sutrutham

Sri Jovanand Vidhyasagar Bhattacharya Unknown Sanskrit 1983 908 pgs

69/167

2/14/2011

A list of scanned Sanskrit books at III… Sutrutham... Sri Jovanand Vidhyasagar Bhattacharya, Unknown. Sanskrit, 1983. 908 pgs.

Suuktimuktaavalii... Harihara~, Technology. Sanskrit, 1949. 186 pgs. Suuta San'hitaa Dditiiya Khand-d'a Grantha 25... Chaara~ya Maadhava, Religion. Theology. Sanskrit, 1950. 441 pgs. Suutasan'hitaa Grantha 25... Aapat'e Vinayaka Gand-esha, Religion. Theology. Sanskrit, 1924. 374 pgs. Suutasan'hitaa Trxtiiya Khand-d'a... Aapat'e Hari Naaraayand-a, Religion. Theology. Sanskrit, 1929. 380 pgs. Suutasn'hitaa Bhaaga 3... Aapat'e Gand-osha Vinaayaka, Religion. Theology. Sanskrit, 1929. 390 pgs. Suvarnaprabhasa... C.e.marobz, Unknown. Sanskrit, 1992. 758 pgs. Suvarnaprabhasa Das Goldglanz Sutra... W Redloff, Unknown. Sanskrit, 1992. 270 pgs. Svabhaava Chitren' Prathamaavrxtti... Divekara Dinakaravaasudeva, Philosophy. Psychology. Sanskrit, 1934. 180 pgs. Svacchanda Tantram... Kshema Raja, Literature. Sanskrit, 1923. 345 pgs. Svachchhan'da Tan'trama~ Vol V... Shaastrii Madhusudhana Kaula, Religion. Theology. Sanskrit, 1930. 297 pgs. Svachchhandatantrama Bhaaga 2... Qs-emaraaja, Religion. Theology. Sanskrit, 1923. 348 pgs. Svapnavasavadattam... C R Devadhar, Language. Linguistics. Literature. Sanskrit, 1946. 169 pgs. Svara~nd-a Kirana~... Shrii Sumitraanan'dana Pan'ta, Philosophy. Psychology. Sanskrit, 1947. 197 pgs. Svetasvaradyupanishad Purushasuktha Bashya Part 1... Veera Raghavacharya T, Upanishad. Sanskrit, 1955. 445 pgs. Svetasvataradyu Panishad Purushasukta Bhasya Part 1... T Veeraraghavacharya, Unknown. Sanskrit, 1955. 448 pgs. Svetasvataradyupanishad Purushasukta Bhasya... T Veera Raghavacharya, Unknown. Sanskrit, 1955. 446 pgs. Swapravasavadatta... Haradayalu Singh, Art. Sanskrit, 2003. 47 pgs. Swetha Swatharaghupanishatpurushasukthabhashyam Prathama Bhagah... Sri ranga rananuja murthy, Unknown. Sanskrit, 1944. 448 pgs. Taan'trika T'eksat'a Khand-d'a 11... Raavaa Bhaaskara, Religion. Theology. Sanskrit, 1922. 117 pgs. Taittiriiya Praatishaakhyama~ Grantha 10... Maahishheya, Religion. Theology. Sanskrit, 1930. 262 pgs. Taittiriiyaarand-yakama~ Bhaaga 2... Krxshhnd-ayajura~vediiyan, Religion. Theology. Sanskrit, 1927. 471 pgs. Taittiriiyaarand-yakama~ Dditiiyo Bhaaga Grantha 36... Aapat'e Vinaayaka Gand-esha, Religion. Theology. Sanskrit, 1927. 479 pgs. Taittiriiyabraahmand-ama~ Dditiiye Khand-d'a Grantha 37... Krxshhnd-ayajara~vediiye, Religion. Theology. Sanskrit, 1937. 570 pgs. Tajika Neelakanti... , Language. Linguistics. Literature. Sanskrit, 0. 280 pgs. Tamara Parinayam... , . Sanskrit, 0. 448 pgs. Tandyamahabrahmana... Pandit A Chinnaswami sstri, Unknown. Sanskrit, 1935. 510 pgs. Tantra Sara Sangraha... M Duraiswamy Aiyangar, Indology. Sanskrit, 1950. 566 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Tantra Trutiya Samputam

Sri bhagavad ramanuj Unknown Sanskrit 1951 380 pgs

70/167

2/14/2011

A list of scanned Sanskrit books at III… Tantra Trutiya Samputam... Sri bhagavad ramanuj, Unknown. Sanskrit, 1951. 380 pgs.

Tantraaloka 57... Abhinavagupta, Religion. Theology. Sanskrit, 1936. 374 pgs. Tantraaloka Dashamo Bhaaga Grantha 52... Gupta Madabhinava, Religion. Theology. Sanskrit, 1933. 400 pgs. Tantraaloka Ekaadasho Bhaaga Grantha 57... Gupta Madabhinava, Religion. Theology. Sanskrit, 1936. 377 pgs. Tantraaloka Grantha 30... Madhusudana, Religion. Theology. Sanskrit, 1921. 314 pgs. Tantrasara... , . Sanskrit, 0. 495 pgs. Tantrik Tests... Swamy Trivikrama Tirtha, The Four Vedas. Sanskrit, 1937. 132 pgs. Tarad'aga... Saagarikaa, Philosophy. Psychology. Sanskrit, 1940. 132 pgs. Taranatha's... Albert Grunwedel, Unknown. Sanskrit, 1914. 222 pgs. Tara~kataand-d'avama~ Chatura~tho San'put'ama~... Vyaasathiira~tha Shrii, Philosophy. Psychology. Sanskrit, 1943. 409 pgs. Tara~kataand-d'avama~ Da~vitiiyan' San'put'ama~... Vyaasatiira~tha Shrii, Philosophy. Psychology. Sanskrit, 1935. 417 pgs. Tara~kataand-d'avama~ Prathamasamput'ama... Shriivyaasatiira~ta, Philosophy. Psychology. Sanskrit, 1932. 564 pgs. Tarka Tandavam Vol I... D.srinivasacharya, Indology. Sanskrit, 1932. 557 pgs. Tarka sangraha... Acharya kedharnadh tripati, Religion. Theology. Sanskrit, 1974. 204 pgs. Tarkabhasa Of Moksakara Gupta... Embar Krishnamacharya, Unknown. Sanskrit, 1942. 140 pgs. Tarkabhasha And Vedasthana Of Mokshakaragupta And Jitaripada... H.r. Rangaswami Iyengar, Religion. Theology. Sanskrit, 1944. 144 pgs. Tarkasamgrahah... Shri Guru prasada shasthri, Unknown. Sanskrit, 1939. 308 pgs. Tarkasan'graha... Annambhat't'a, Philosophy. Psychology. Sanskrit, 1930. 225 pgs. Tarkatandava... , . Sanskrit, 0. 331 pgs. Tarkatandavam Of Sri vyasa Tirtha Ii... V Madahvachar, Dvaita Philosophy. Sanskrit, 1935. 407 pgs. Tarkatandavam Of Sri vyasa Tirtha Iv... V Madahvachar, Dvaita Philosophy. Sanskrit, 1943. 402 pgs. Tarkatandavam Of Sri vyasa Tirtha,3... V Madahvachar, Dvaita Philosophy. Sanskrit, 1938. 373 pgs. Tathava Teeka... Mahadesika, Geography. Biography. History. Sanskrit, 1934. 538 pgs. Tathvaprakasika Chapter1... , Language. Linguistics. Literature. Sanskrit, 0. 451 pgs. Tatparya Chandrika Part 2... Krishnacharya,t.r, . Sanskrit, 1913. 2011 pgs. Tatparya Chandrika Vol Ii Part Ii Iii Iv... Sri Vyasateertha, . Sanskrit, 1982. 213 pgs. Tatparya Chandrika Volume I... Sri Vyasateertha, Unknown. Sanskrit, 1981. 182 pgs. Tatparya Chandrika Volume Ii... Vyasateertha, Geography Biography History. Sanskrit, 1981. 211 pgs. Tatra Pratham Samputam Vedratha Geetabhasya Gadyatrey... Sri Mannarayanramanujayteendranamagya, Unknown. Sanskrit, 1980. 292 pgs. Tattva Pradipika With Citsukha Commentry... , . Sanskrit, 0. 294 pgs. Tattva Samkhyanam... Ramamurthy Sharma R, Philosophy. Sanskrit, 1980. 77 pgs. Tattva-kaustubha-kulisa... Dr.rnaga Raja Sarma, Unknown. Sanskrit, 1956. 324 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Tattvaara~thasuutrama~

Svamii Umaa Religion Theology Sanskrit 1944 324 pgs

71/167

Unknown. Unknown. The Abhidhana Sangraha. Religion. Unknown. Linguistic. bhattamalla.r. Sanskrit. Sanskrit. Theology. 1953. Sanskrit. Sanskrit... Tattvatika. Unknown. Sanskrit. 289 pgs. R S Panchamukhi. 324 pgs. Tatva Prakasika Bhavadipa Volume I to Ii. Geography Biography History. 538 pgs. Svamii Umaa. 554 pgs.. Tattvatika. Tattvasankhyanam. 1940. Sanskrit. 0... 117 pgs. Wasudev Laxman Sastri Pansikar. Mahadesika. Vdaantaachaara~yaa.. Sanskrit. Sanskrit.. 528 pgs. 0.. 748 pgs. Sanskrit. Psychology. The Amarakosha.. Thaithariya Brahmanamu Dwithiya Bagamu. 461 pgs.. Tatuabodhini Uttaraidha Gnanendra Saraswathi.. Sanskrit. Sanskrit. . Sanskrit. Unknown. Sanskrit. 0.. Sanskrit.. Tattvamukttaakalaapa Da~vitiiyasan'put'ama~. 1933. 1953. Unknown.. Technical Terms And Technique Of Sanskrit Grammer Part 1. Raghava Bhatta. Tattvarthavartik Of Shri Akalank Deva.. Veng-kat'anaatha. 329 pgs. Sanskrit.. Tattvasamkhyanam. 1938. Sanskrit. History. -.. 375 pgs. Tharkasangraha.. Sanskrit. Sanskrit... 1927... 602 pgs. Mahendra Kumar Jain. Tattvaara~thavaara~tika Bhaaga 1... 554 pgs. Biography. Sanskrit. 198 pgs. 1980.. Sanskrit. 106 pgs. 0. . Philosophy. 152 pgs. A B Gajendragadkar. The Alankaramasekhara. Unknown. 314 pgs. Sanskrit. 1954. Prof. Religion. 347 pgs. Tattvamukttakalaapa Da~vitiiya San'put'ama~.... 0. 551 pgs. 811 pgs. Tatvaprakasika Bhavdiya. Sanskrit.. The Akhyata Chandrika. Nigamaantadeshika~. 382 pgs.. 1981. Unknown.… 72/167 . Krishnacharya.. 1938.. -. Tatvapradipika Nyaya Prasakdika Vyakyanamu. Psychology.. 1940. Linguistics. Sanskrit. Anantarama Sastri Vetal... Literature. Sri Jayatirtha. Psychology.. Thathvaprakasika Kavyankya Sharkara. 1953. The Alanka Asa Vasva Of Rajanaka Ruyyaka. Tattvaraya Rahasyam. 1964. Sanskrit. D Sreenivasachar.. Tatvodyota. Philosophy. Unknown. Sanskrit. Philosophy. 0. 72 pgs..t. 1980. Linguistics Literature. 1939.. . Philosophy. Telugu-savara Dictionary. Geography Biography History. sanskritdocuments. Tattvamuktakalpa. Language. 1943. 1999.. Language.. Geography. G V Ramamurti.. 1948. Sri Madhvacarya.2/14/2011 A list of scanned Sanskrit books at III… Tattvaara thasuutrama . 1944. 367 pgs. Linguistics Literature. Tatva Marchand Vimarja. 1914.org/…/SanskritIIIT. Sanskrit. Sanskrit.. . Literature... 1936.... . Pandit Girijaprasad Dvivedi.. ludwik sternbach. Sanskrit.. Vidya Manyatirth Swami. . 1936... The Abhijnana Sakuntala Of Kalidasa.. 1940. Theology... Literature. kshitish chandra chatterji. 99 pgs. 110 pgs. Vedaantaachaara~ya Shrii. 22 pgs. The Abhijnana Sakuntala of Kalidasa. Philosophy. Unknown. 1954.. 406 pgs. 692 pgs. Tatvamukttaakalaapa Prathamasanput'ama~. Sanskrit. Unknown. Veeraraghavacharya.. Sanskrit. . Unknown. Ramanuja. Tattvamukttakalaapa Trxtiiyasamput'ama~.. . 1934. 0. Linguistics.. Sanskrit. 1303 pgs.. 157 pgs. Sanskrit. kalan'kadeva Bhat't'aa.. . 754 pgs.. Texts On Courtezans In Classical Sanskrit. 342 pgs... 462 pgs.

. 1940. Harihara Sastri.. Unknown. 1984.. 1960. 538 pgs. 1930. Sanskrit.. Sanskrit. 400 pgs.. The Andhra Pradesh Pension Code 1960... The Bhrngasandesa Of Vasudeva. Unknown. 1922.. Sanskrit. 433 pgs.. The Bijaganita Elements Of Algebra Of Bhaskrachrya. Unknown. Sanskrit. The Bhagavad Geeta Vol Lxiv.2/14/2011 A list of scanned Sanskrit books at III… The Amarakosha. Sanskrit. Literature. 216 pgs. Sambasiva Shastri K. Philosophy. 1938. Unknown.. The Bhaminivilasa Of Jagannath Pandit. The Brahmasutra Bhashya Volume Iv..... 1961. Abhay Mithra. The Antagonist In Sanskrit Drama. The Asokavadhana. 1963... Linguistics Literature.. 560 pgs. Sanskrit. Ramakantha R. The Boudhayana Dharmasutra. Indology. Sanskrit. Sanskrit. The Bhakti Candrika. 674 pgs. 1942.. Unknown. 183 pgs. 350 pgs. Pandit Durga Prasad.. 1920. 162 pgs. Sanskrit. Sujitkumar Mukhopadhyaya. Bhagavadgita. P.. 423 pgs. The Arthasastra Of Kautilya. The Anargharaghava Of Murari Edition V. The Brahmavada Sangraha. 1963. The Brahmasutra Bhashya Volume Iv.. Unknown. Unknown. K. Language. T Ganapati Sastry.. Sanskrit. 1949. Unknown. 648 pgs.. 396 pgs. 1943. Diavanji. Raghavendracharya.. Sanskrit.... Sri Madhwacharya. The Bhaskarodhyam The Rising Sun. 550 pgs. Dhundiraja Sastry.. 1967.. pgs. The Bhagavadgita.. Ramakantha. Sanskrit. Sanskrit.. The Aranyakanda Vol. 521 pgs. The Brahmasutra Bhashya Volume I. Unknown. The Brahmasutra Bhashya Vol-3. 260 pgs. Rajanaka Ramakantha.. The Brahmavada Sangraha And Suddhadvaitapariskara. Unknown.anant Shastri Phandke Vyakaranacharya. Bhagavadgita. Dr Jatindra Bimal Chaudhri. K Smba Siva Sastry. Charudeva Shastri. Unknown. Ramakantha.. 440 pgs.. 1931.. The Bhattikavyam Of Bhatti. 1922.. 534 pgs. . 1928. Sambasiva Shastri.. Kasinath Pandurang Parab. Sanskrit. Sanskrit. 1934.. Sanskrit.. Bhagavadgita Sanskrit 1928 140 pgs sanskritdocuments.. 96 pgs..… 73/167 . Vishnu S Sukthankar. Sanskrit. Sanskrit.. Wasudev Laxman Sastri Pansikar. Religion. 1933. 644 pgs. Sanskrit. 243 pgs.. 494 pgs. Sanskrit.. 0. 1940... k m vaidya. Sanskrit. Sanskrit. Linguistics Literature. Govinda Shankara Shastri Bapata. 1937.. Unknown. Sanskrit. 1984... Unknown. The Bhagavadgita. G Rghavendracharya... The Balamartandavijaya. Sanskrit... Pandit Harisankara Sastru Vedabta Visarada. 1936. Literature. Unknown. The Aranyaparvan Part 2. 162 pgs. Unknown. 1943.I I I. Sanskrit.. 1940. Sri Narayancharya Atreya. 1887. Sanskrit. 160 pgs. The Balamartandavijaya. 1956.org/…/SanskritIIIT. Govinda Swami. The Bhagavadgita.. Linguistics. Literature. Literature. Sanskrit. Sanskrit. Pt. Brahmasutras. Sanskrit. Theology. 1943. The Atmatattvaviveka Of Sri Udayanacharya. 1930. 630 pgs.. 466 pgs. The Atmatattv Aviveka.c.. 394 pgs. Jiva Natha Jhi... 139 pgs. 76 pgs. pgs. The Art Of Sanskrit Translation Or A Mirror To Sanskrit Usage. Sanskrit. The Arthsastra Of Kautilyavol I.. T Ganapathi Sastri.. Sanskrit. 290 pgs. Sanskrit.. Unknown.. 1937. Unknown.. Unknown. Aryabhatacharya. 442 pgs. G Raghavendracharya. Unknown.. Unknown. R. 1943. The Aryabhatiya. The Ashtanga Hridaya Kosha With The Hridaya Prakasha..

… The Harasastra Sastri K S Unknown Sanskrit 4008 394 pgs 74/167 . 1942. 1942. Sanskrit. Sanskrit. The Harasastra.. suryakanta. The Dasarupaka Of Dhananjaya.. Sanskrit.rocher.. The Dipakalika. The Ganapatha Ascribed To Panini.. The Dhatupatha Of Panini. Sanskrit. Sanskrit. Sanskrit... 1939.. Unknown. The Ganita Kaumudi Part 1. 340 pgs. 1987. Dr M Jaya Seetha Rama Sastry. Unknown. Unknown. Ganapati Sastri. The Dasrupaka of Dhanamjaya. 264 pgs.. Literature. 1942. Unknown. 170 pgs. The Charaka Samhita Volume 4. Sanskrit. The Gospel Of Advaita. The Commentaries On The Prajnaparamitas Vol 1. Pt. 1908. The Elements Of Darsanas Of Shriharshas Naishadha. 1936. Narayana Pandita. 1942. 400 pgs. Sanskrit... Manmatha Nath Dutt. 1890. 1986. Sanskrit. The Elements Of Darsanas Of Sriharshas Naishadha. 252 pgs.. 56 pgs. 1953.. Sanskrit. Social Sciences. 426 pgs.. 68 pgs. Literature. sage agnivesa.... Sanskrit. 1928.. Unknown. 1938. Duncan Greenless. The Catapatha-brahmana. 436 pgs... 394 pgs. The Dhatuvritti Vol I Part I. L. Sanskrit. 184 pgs.org/…/SanskritIIIT. 0.. The Dharmasindhu By Kasinath Upadhyaya. The Dharma Sastra Vol I. 283 pgs. Unknown. Sastri. A Mahadeva Sastri.. Sanskrit. Unknown.. Unknown.. The Danadipika With Tha Bhavabodhini Hindi Commentary. M M Sri Mukunda Jha Bakshi.. 296 pgs.. 1112 pgs. Sanskrit.jayaseeta Rama Shasthry.. Sri Gagabhatta. 1176 pgs. 430 pgs. Unknown.. 1969. 1519 pgs. sulapani. Sanskrit. Sanskrit. The Chandraloka Of Shri Jayadeva. The Gobhilagrhyasutra. 1936... Unknown. Sanskrit.. Sastri... Sanskrit. 516 pgs. Unknown. Unknown.k. 1934. Unknown. Duncan Greenless. The Charaka Samhita Volume 5. The Devinamavilasa. The Charanavyuha Sutra Of Saunaka.. Unknown. pgs.2/14/2011 A list of scanned Sanskrit books at III… Bhagavadgita. 1924.. pgs. Pandit Sri Sudama Misra. Sanskrit. 332 pgs.. Sanskrit. 1987. 140 pgs... Yugalakishora Vyasa.. Pandit... Sanskrit... Pandit Sri Sudama Misra. Upanishads.. 126 pgs. Unknown. The Ganitha Kaumudi. 1941. T... The Harasastra.. 4008. Unknown. Sanskrit. 1949. The Grihaya Sutras Of Gobhil. Sanskrit. 1889. 1969. Unknown. Pandit Anantaram Dogara Sastri.. Ganganath Jha. Sanskrit... 1936.. 1900. 1932. Unknown. Sanskrit. Sanskrit. 680 pgs.. Unknown. Sanskrit... Literature. T. sage agnivesa. Mangal Deva Shastri. 4008. 668 pgs. The Danadipika. Unknown. Dr. The Durghatavrtti Of Saranadeva. 1949.. Sanskrit. The Charaka Samhita Volume 1. Sanskrit.venkata Charya.. The Gospel Of Advaita.. The Ganitha Koumudi Part Ii.. Unknown. 296 pgs. 344 pgs. sage agnivesa. Unknown. 426 pgs.. Sanskrit.s.. P Sathyavrata Samashrami.. Unknown. 1949.s. Kasinath Panduranga Parab. Sanskrit. 30 pgs. Sanskrit. Sahib Kaul. 140 pgs. Giuseppe Tucci.k. Unknown. 1953. 1000 pgs. 1936. sanskritdocuments. M. 661 pgs.kanakalal Sarma. The Collection of Sikshas by Yagna Valkya and Others. Unknown. Religion... Unknown.. 160 pgs. Albrecht Weber. Sanskrit. 1938. padmakara dvivedi jyautishacharya. The Chhandogya Upanishad Vol Iii..

The Isvarapratyabhijna Vivritivimartni. The Kadambari Kathasara Abhinanda. Sanskrit. 1933. 64 pgs. 1943. 178 pgs... 539 pgs.. 446 pgs. Abhinavagupta. 1943. 626 pgs. The Harsha Charita First Uchhvasa.. Pandit Madhusudan Kaul Shastri. Unknown. Sanskrit. 1935. Gudharthatattvaioka.. K Dakshina Murthy. The Harasastra. Sanskrit... Pandit Sri Nanda Kishore Sharma. 195 pgs. 307 pgs. 538 pgs. The Isvarapratyabhijna Vivritvimarsini Vol Iii.. Sanskrit.. The Kalatattvavivechana. Unknown.. 281 pgs. B. Mahamahopadhyaya. 394 pgs.k.. 1907. Dr Hendrik Kern.. 1867.... The Kasika Vivarana Paniyaka. 4008.. 396 pgs. 422 pgs. The Ishvara Pratvabhijna Vimarshini Vol I. 94 pgs.. Sanskrit. The Kama Kala Vilas Of Punya Nanda.. Vrdddha Jivaka.. 280 pgs. Sanskrit. The Janakiharanam Of Kumaradasa I X. 413 pgs.j. Unknown.. Pandit.. Sanskrit. The Isvarapratyabhijna Vivriti Vimarsini By Abhinava Gupta. Sanskrit. 1933.. Unknown.. 4008. Sanskrit. Sanskrit. Unknown. 1941. 1023 pgs. The Journal Of Vedic Studies Volume 1 No 1.. 349 pgs. 0. Dakshina Murthy K. Sanskrit... Pandit Durga Prasada. The Kasyapa Samhita. 1918. Benerjee. 195 pgs. Sanskrit. 446 pgs. Unknown. Abinava Gupta. Sanskrit. Sanskrit.… 75/167 . Sanskrit. The Jataka Mala. Sanskrit... pgs. The Kalatattvavivechana. Spiritual Experience And Uysticism. 70 pgs... 1918. The Karna Sundari Of Bilhana. The Ishvarra Pratyabhijna Vimarshini of Utpaladeva.. Unknown.. Sanskrit. 1921. Pandit Durgaprasada. Sanskrit. vrddha jivaka. Gopal Raghunath Nandargikar. 1943.. Sanskrit. 1940. Literature. Unknown.. 1902. The Kasyapa Samhita. The Kadambarikathasara Of Trivikrama. Sanskrit.. Unknown. 1944. The Isvarapratyabhijna Vivritivimarsini.. Sanskrit.... Unknown. Sanskrit. 186 pgs.. Abhinavagupta. Madhusudhan Kaul Shastri. Sanskrit. 394 pgs. 1938. Rama Deva. Unknown. General.. 1933. Unknown.. Unknown.. 90 pgs. Raghu Vira. Sanskrit. pandit bhavadatta shastri.. 1941. B C Benerjee.2/14/2011 A list of scanned Sanskrit books at III… The Harasastra.. Spiritual Experience And Uysticism. 1925.. 638 pgs. 446 pgs.. Unknown.. Spiritual Experience And Uysticism.. Unknown. Upanishad. The Holi Gita. Sanskrit. The Jaiminiya Or Talavakara Upanishad Brahmana. 1957. Srish Chandra Chakravarti. Mukunda Rama Shastri. Sastri K S. General. 130 pgs. Sanskrit. 1934.. The Kashi Sanskrit Series. Sanskrit. The Kamsavadha Of Sesakrisna Edition I I I. 1925. The Kadambari Kathasara Of Trivikrama. Not Available. 1932.. .. The Harililamrtam. Unknown. 1957. The Isvarapratyabijna Vivritivimarshini. Unknown... Unknown. Pandit Durga Prasad. The Jayantavijaya Of Abhayadeva.. Abhinava Gupta.pandya.. Unknown. Sastri.. sanskritdocuments.. Sanskrit. Sanskrit. 1953. Unknown. 312 pgs. 190 pgs.. Unknown. Upanishad. 1918. 1941. The Isvarapratyabhijna Vivritivimarstni Vol Ii. 349 pgs.. The Journal Of Oriental Research Madras. Sanskrit. Sanskrit.org/…/SanskritIIIT. Unknown. 1930.. Abhinava Gupta..s. J.c. Sri Bopadeva. 160 pgs.

1917. P. K Sambasiva Sastri. The Kausitaki Brahmana Upanisad. 96 pgs. The Celebrated Vedavyasa Rishi. The Mahabharata An Epic Poem Vol 4. Unknown. 587 pgs.. 1939. 728 pgs.. The Kavyakalpalata Vrtti.. Mangesh Ramakrishna Telang. 1935.org/…/SanskritIIIT. The Mahabharata Vol 10 Drona Parvan Part 2. Sanskrit. Sri Gangadhara Misra.. 318 pgs.. 1944. Unknown. The Kavyarathna Of Arhaddasa.. The Malatimadhava Of Bhavabhuti. P P S Shastri. The Mahabharata Vol 9 Salya Sauptika And Stri Parvans. Sanskrit. The Celebrated Vedavyasa Rishi. 444 pgs. 268 pgs. The Mahabharata Vol Viii Bhisma Parvan. Unknown. 676 pgs.. 1934. Unknown. Sanskrit. Unknown. Sanskrit.. 1940. 1936. 1936. 0. Vidhyasagara Vidhyavachaspati.. The Mahabharata An Epic Poem Vol 3. 106 pgs. The Kavyalankara Sangraha Of Udaha Bhatta.. 0. Unknown. Literature. Sanskrit.. The Mahapurana of Puspadanta Vol. 210 pgs. 0. The Krityasaravol 1. 974 pgs. 1934... Sanskrit. Pratap Singh. 184 pgs. Unknown. 1915. Sanskrit.. Pandit Mukunda Rama Shastri. 362 pgs. 1954. Sanskrit.mahadeva Sastri. Unknown. Literature.. The Mahabharatha Santi Parvan Vol X V Part I I I.. Pandurga Parad .. Sanskrit. 822 pgs. Pandit Mukunda Rama Shastri. Sanskrit.. The Kavya Mimamsa. Unknown... The Mahanaya Prakasha Of Rajanaka Shiti Kantha. The Kautiliya Arthasastra Part 1.s. Unknown. T R Chintamani. 114 pgs. The Krityasara Samuchchaya Of M M Pandit Sri Amritanatha Jha.. 1918. 152 pgs.. Unknown. 557 pgs...l. 1961. Sanskrit. 1935. Sanskrit.. 1968.. The Mahanaya Pkasha O Rajanaka Shiti Kanta. P P S Sastri. 1935. 486 pgs. Rajashekhara.. Sanskrit. The Malavikagnimitra Of Kalidasa Edition V I I I. Vidan N.. 1918. 1935.. 1931. Sanskrit. Sanskrit. 390 pgs. 298 pgs. Sanskrit. Unknown. Unknown. Unknown. 1918.. Unknown.. Sanskrit. 154 pgs.. The Celebrated Vedavyasa Rishi.. Mangesh Ramakrishna Telang. P P S Sastri. Unknown.. Sanskrit.. Amara Chandra Yati.. Sanskrit. The Madhaviyadhatuvritti Of Sayanacharya. Sanskrit. 1934.. E B Cowell. 154 pgs. 442 pgs. Vaidya..ramashastri.. 186 pgs.. 1953. Sanskrit.. Gopal Sastri Nane. The Laws And Practice Of Sanskrit Drama Vol X I V Vol I.. Unknown. Sanskrit. Sanskrit. sanskritdocuments. Sanskrit. Sanskrit.. Sanskrit. The Kausitaka Grhyasutras. 609 pgs.. Sanskrit. r p kangle. 640 pgs. A. Unknown. 1936. Literature. Unknown. The Mahanaya Prakasha Of Rajanaka Shiti Kantha. Misra V. The Mahabharata An Epic Poems.. 1913.… 76/167 . 676 pgs. Sanskrit. The Khadira Grihyasutra. Kashinath Pandurang Parab. Sanskrit. The Mahabharata Vol 9 Drona Parvan Part 1... Unknown.. 1931.2/14/2011 A list of scanned Sanskrit books at III… The Katyayan Srauta Sutra Part Ii. Surendra Nath Shastri. Unknown.. The Kirtatarjuniya of Bharavi. 1100 pgs.. 154 pgs.-2. Unknown.Revised By T Srinivas Venkatarama. Unknown.. The Mahabharata Santi Parvan Vol Xviii Part I. Literature.. Pandit Ananta Sastri.... Unknown.. 388 pgs. P P S Shastri. P P S Shastri.. Sanskrit. Unknown. 1935. The Madhvamukhalankara.... Unknown. 1960. 696 pgs.

Sanskrit. Unknown.. 1981. -.. The Nirsinha Prasada Tirtha Sara. Sanskrit. Unknown. 380 pgs. 780 pgs. 0. The Nirnaya Sindhu. sri kamalakar bhatta. M Ranga Acharya. Unknown. 1903. sanskritdocuments. 297 pgs. Pandit Kedarnatha. Unknown. 1966. 138 pgs. Unknown... Unknown.. Unknown. 1934. The Mimamsa Slokavartika. Language. Sanskrit. Unknown.. 1921.. Sanskrit.... Sanskrit. 297 pgs. Linguistics. 906 pgs. 1953. 1898.. Unknown. 1926. T Ganapati Sastri. G A Jacob. Dalapati Raja. 1912. Literature.. 1930. The Megha Duta Of Kalidasa. The Megha Duta Of Kalidasa Edition I I. Literature.. 542 pgs.... Kamalakar Bhatt. 1936.. 1984. The Nareshvaraperiksha. Language.. Sanskrit. The Memorial Verses Of Appaya Dikshita's Kuvalayananda. 80 pgs. 142 pgs. Sanskrit. Sanskrit. Sanskrit.. 1933. Unknown. Sanskrit. Sanskrit.. Johannes Hertel.. Sanskrit.. Sushil Kumar De. Unknown. Sanskrit. Unknown. 416 pgs.. Unknown.. Franklin Edgerton. 1957.. Sanskrit. Literature. krishnaji govind oka. Sambasiva Sastri. The Pancharatra Of Bhasa. 126 pgs. Unknown. Pandit Harihara Sastry. P R Subrhmanya Sarma. .. The Nidhipradipa Of Sri Siddha Srikanthasambhu. Sanskrit. Unknown. 1930. Sanskrit. The Mathuri Panchalakshani. The Padyacudamani Of Buddhaghosacarya... Sanskrit. Sanskrit. Unknown. 158 pgs. The Panchatantra 1 To 5. The Nareshvaraperiksha. The Nyayaa Lilavati. The Namalinganusasana Amarakosa Of Amarasimha. 1925. 471 pgs. 310 pgs. Sanskrit.. 52 pgs.… The Parama Laghu Manjusha Pandith Nityananda Panta Parvatiya Unknown Sanskrit 1946 133 77/167 . 342 pgs. Sanskrit. 1017 pgs. 60 pgs. The Naiskarmya Siddhi. 484 pgs.. 1916. 331 pgs. The Paippalada Samhita Of The Atharvaveda.. Ramakantha.. 1982. narayana ram charya. Ramakantha. 0.. The Orient Pearls Indian Folklore.. Sanskrit. The Nirnayasindhu... 475 pgs... Unknown.. Mukund Jha Bakshi. Unknown. A. Unknown. Sanskrit.. The Manidarpana. Dipak Bhattarcharya. Language.. 212 pgs. 1925. Unknown. 194 pgs. Literature. The Panchatantra Text Of Purnabhadra.. Sanskrit. Mahamahopadhyaya Gangdhare Sasatri Tailanga. 1924. 1942. Pandit Sri Hariram Shukla. Sanskrit. 1926. 1957. The Niruktam Of Yaska Muni. Unknown.. The Minimum Wages Central Rules 1950.. 195 pgs.. Unknown... The Muhurtachintamani.org/…/SanskritIIIT. Gopi Natha Kaviraja. K Sambasiva Sastri. Late M R Kale.2/14/2011 A list of scanned Sanskrit books at III… The Mandaramaranda Champu Of Sri Krishna Kavi.. 1913. 135 pgs. 200 pgs.. Religion Theology. The Mimasa Kaustubha.. The Nirukta Of Yaska Part Ii. Jaimini Sutras. 529 pgs. . Sanskrit. The Mirichchhakatika Of Sudraka. Ambadas Sastry. Literature. 1917. R G Bhadkamkar.. 134 pgs.. 66 pgs.. 1924. Shovona Devi. Sanskrit. Linguistics. Dr V Raghavan. 1954. Chinnaswamy Sastri.. The Nyaya Darsana.. Sanskrit. 1940. Sanskrit. Sanskrit. Sanskrit. Linguistics. 128 pgs. The Nirsinha Prasada. 676 pgs. Sanskrit... 0. Pandit..... T Ganapat Sastri. The Nyayavarttikat Paryatika Of Vachaspati Misra Vol Xiii..

Unknown. Unknown. Sanskrit. Sanskrit. A Mahadeva Sastri. 1934. 1946. The Ramayana Of Valmiki Ayodya Khanda. The Pratyabhijna Hridaya. Unknown. The Queset Of Enlightenment. 1911. Unknown. Unknown.. 1931. Sanskrit. Unknown. Kavi Ratna Pandith Shiv Dutta. 1928. Unknown. Sanskrit. 122 pgs. 1926.. Unknown. The Rajaniti Ratnakara. Sanskrit. Unknown. Sesha Srikrishna. Sanskrit. 64 pgs. E. 660 pgs. Sanskrit. Unknown..… 78/167 .. The Rasopanisat. Vasudeva Laxman Shastri Paniskar. Bhattoji Dikshit. 72 pgs. Unknown. Pandit Ram Labhaya. Sanskrit. T Venkatacharya. Sanskrit. The Parvati Parinaya. The Rekhaganita Or Geometry Sanskrit. Kunhan Raja C. 1929. vaman shivaram apte.. Unknown. 1986. 1889... E B Cowell.. 1926. The Patanjali Charita Of Rambhadra Dikshit. The Rasarnavasudhakara Of Simhabhupala. 855 pgs. K Sambha Shiva Shastri. 133 pgs.. Sanskrit..... E. 1928. 1936... The Prasannaraghava Of Jayadeva Edition I I I.. Dr Juan Miguel De Mora.. Sanskrit. Sanskrit. Sanskrit. 259 pgs.. 553 pgs.. Sanskrit. Pandit Shiva Datta.. 1979. 321 pgs. Sanskrit. Sanskrit. The Ram Charitha Of Bhatti.j.. 1982. Thomas. Pandith Nityananda Panta Parvatiya. 1902. The Prakrta Prakasa Or The Prakrt Grammar Of Vararuchi.. 136 pgs.. 150 pgs... Linguistics Literature. The Practical Sanskrit English Dictionary Volume First. The Rupavatara Of Dharmakirti Part I I.... The Rig Veda. The Prakriya Prayoga Suchi. Philosophy.. Literature.. 560 pgs. The Philosophy Of Vallabha.. The Sabda Kaustubha. Kamalashankar Prana Sankhar Trivedi. 1950.... 1950. The Queset Of Enlightenment... Unknown. 1935. Rao Bahadur M.. Sanskrit. Unknown. Sanskrit. Sanskrit. 1962. The Pranjnaparijata Kavyam. Unknown. 94 pgs. 54 pgs. 1980. 108 pgs. 1936. Unknown. Sanskrit... sanskritdocuments... 580 pgs. Unknown. Unknown. 1928. The Principle Of Opposites In Sanskrit Texts. 100 pgs. 395 pgs. Sanskrit. Sanskrit... Dharmasthala.2/14/2011 A list of scanned Sanskrit books at III… The Parama Laghu Manjusha.rasik Vihari Joshi.. 1923. 150 pgs.. Kamalasankara Pranasankara Trivedi.. Dr. 518 pgs... 100 pgs. Mahamahopadhyaya Pandit durgaprasada. Unknown.. The Parijataharanachampu Of Sesha Srisrishna. 154 pgs. Unknown. 260 pgs. Biography. Unknown. 1960. The Phakkika Saralartha. 118 pgs.. Radharani Sukhawal. 1911. Chandeswara. Geography. Unknown.. 1935. Sanskrit. Sanskrit. 565 pgs... Bhana Bhatta.. Unknown. The Parijataharana Champu. Unknown. The Rgvedabhasya Of Skandavamin. The Ratnagotravibhaga Mahayanottaratantrasastra.. 1950. Sanskrit. The Prakriya Kaumudhi of Ramachandra Vol iii. Sanskrit. Sanskrit.h. The Phakkikaratna Manjusa... E J Thomas. 1922. 274 pgs. Pandith Ramacharitra Tripathi. The Purvamimamsa Darsana With Khandevas Bhatta Dipika Vol I I. 264 pgs. Sanskrit. 1950. Kshemaraja. History... Johnston D Litt. 1938. Sanskrit.org/…/SanskritIIIT. maithil pandit sri kanakalal sarma. Philosophy.. Vishva Bandhu Shastri. 545 pgs. 94 pgs. sri nagendra narayana misra. Sanskrit. pgs.

Durgaprasa. Sanskrit. Sanskrit. 1935.r.. 64 pgs. The Sarasvata Vyakarana Part Ii. The Saraswathi Kanthabharana. 894 pgs. Unknown. Sanskrit. Sanskrit. 558 pgs... Pandit A Mahadeva Shastri. Sanskrit. Shripad Krishna Belvalkar. Shripad Krishna Belvalkar. The Sahitya Darpana. Unknown. Pandith Nava Kishore Kara Sarma. 524 pgs. The Samskara Dipika Part 3... Religion. Language. Pandit A. The Saiva Upanisads With The Commentary Of Sri Upanisad Brahma Yogini.. 315 pgs. 272 pgs. T. 1929. Sanskrit. Sanskrit.. 241 pgs.d. 334 pgs. 88 pgs. 1930.. The Sandilya Samhita Bhaktikhanda.... m m sri gadhadara bhattaocharya. 1929. 376 pgs.chintamani Dikshit. The Sangita Sudha. Sanskrit. Unknown. Unknown. The Santiparvan Part 3. The Samayamatrika. T. The Saiva Paribhasa. 1954. Sanskrit... 510 pgs. 410 pgs. 1936. 348 pgs.. 132 pgs. Sanskrit. 1948.. The Samanya Vedanta Upanishads. 1934... Mahadeva Sastri. Sanskrit.. Unknown.. 1925. Unknown. The Saiva Paribhasa.. Sanskrit. Pandith Nava Kishore Kara Sarma. Sanskrit.. Sanskrit.. Major B. Sanskrit. 400 pgs... Dhundhiraja Sastri. The Samgraha Chuda Mani. Pandit Sri Krishna Mohan Thakur. 1938. Sanskrit.. 554 pgs. The Samskara Dipika Part 2. 438 pgs. Unknown. Mahadeva Sastry A. Sanskrit. Pandit Durgaprasad.. Literature. The Saiva Upanisads. Venkata Kavi. 159 pgs. 1933. Pandit A. 1951.. P S Sundaram Aiyar. Unknown. 880 pgs. dhareshvara bhojadeva. Sayanacarya... Unknown.r. Upanishads.... Sayanacarya. 216 pgs. 1938. 563 pgs... 671 pgs. Unknown. 2002. The Saktivada... The Santiparvan Part Ii Apaddharma And Concordance.mahadeva Sastri. Linguistics Literature.. sanskritdocuments. Sri H. Pandith Anantharam Sastri Vetal. 1933.. Upanishads. The Sakta Upanisads. The Samanyanirukti. Sanskrit.. Unknown. 1921.… Th S t th b h A di T Th M dh di R i U k S k it 0 694 79/167 . 1935.2/14/2011 A list of scanned Sanskrit books at III… The Sabdha Kausthuba.. 1960.. 1938. Unknown.org/…/SanskritIIIT.. .. The Sacred Books Of The Hindus Vol Viii. 366 pgs. pandit nityananda panta parvatiya. 1950. Art. 1954.. 288 pgs. The Samkhya Karika. S. Unknown. 90 pgs.... pandit nityananda panta parvatiya. The Satapathabrahamana.. The Samanya Vedanta Upanishads. . Literature. The Sajjanendra Prayogakalpadruma. Sanskrit... Vidtasudhrakara Dr Har Dutt Sharma. 903 pgs. Unknown..rangaswamy Iyengar. 1950. The Sahridayananda Of Krishnanada.subrahmanya Sastri. Theology. The Saktivada. 1929. Sanskrit. Mahadeva Shastri. The Samgraha Cuda Mani. Rangaswamy Iyengar H R.. Unknown. Sanskrit. 1940.. Unknown.. T R Krishnacharya.. Sanskrit. 268 pgs.. A. 1950. The Samskara Ganapathi. Linguistics. Sanskrit. Unknown. Upanishads. Sanskrit. Sanskrit. 2002. Upanishads. Unknown. Gopala Sastry N.. The Sanskrit Third Reader. 1243 pgs. 1950. Unknown... Sanskrit. 1950. 300 pgs. 1947. Sanskrit..r.. Unknown. The Samnyasa Upanishads. Unknown. 1929. The Samnyasa Upanishads Vol Xii.. 1938. 265 pgs. Sanskrit. 546 pgs.chintamani Dikshit.. Sanskrit. 270 pgs. Sanskrit. Gopinath Kaviraj. 1930.. Sanskrit. The Sarasvata Vyakaranam.. Sanskrit. 146 pgs.basu. The Satapathabrahmana. 1921. Unknown. Sanskrit..

The Smriti Kaustubha Of Anantadeva. The Srauta Sutra Of Apastamba. Pandit Madhusudan Kaul Shastri. The Sri Mrgendra Tantram. Utpaladeva. 206 pgs...org/…/SanskritIIIT. 480 pgs. The Siva Sutra Vartika Vol Iv And V.. Sanskrit. 1921. Unknown. Unknown. Unknown. 360 pgs. Unknown. . The Sraddhaviveka. Unknown... Unknown. S S Surya Narayana Sastry. Unknown. A Mahadeva Sastri. Wasudev Laxman Sastri Pansikar.. Vishva Baandhu. 1930. 1950. 1925. 622 pgs. 0. Unknown. Sanskrit.. Sanskrit.. Unknown. Unknown... Sanskrit. The Satapathabrahmana According To The Madhyandina Recension Vol V. Sanskrit. 1958..… 80/167 .. The Savyabhichar Prakaranam. 848 pgs. Chatterji J C. 201 pgs. 0. K Balarama Panicker. Unknown.. The Siddhitrayi And The Pratyabhijna Karika Vritti Of Rajanaka Utpala Deva.... 260 pgs. 1931. Sanskrit. 240 pgs... Unknown. Unknown. The Satapathaprahmana. The Spandakarikas Of Vasugupta With The Nirnaya. 2002. J C Chatarji Vidhyavaridhi.. Unknown. Social Sciences.. 1913. 1944. Sanskrit. Narasimhachari. 1933. 1916.. Sanskrit.... Sanskrit. The Siddhantalesasangraha Of Appayya Dikshita... 1909. K Sambasiva Sastri. Unknown.. Sanskrit.. The Sriharicarita Mahakavya Of Srihari Padmanabhas Astrin. Pandit Madhusudan Kaul Shastri.. Sanskrit. The Sidhant Shiromany. 1929. 884 pgs. Vishva Bhandhu. 830 pgs. Jayakrishna. 1962. Sanskrit.. -. Sanskrit. 694 pgs. 1944. The Srautasutra Of Apastamba. Sanskrit. The Srungara Tilaka Bhana Of Amabhadra Deekshita... The Sivadristi Of Srisomanandanatha With The Vritti. The Shiva Upanisads. Sanskrit. Viswabhandu. Sanskrit. 1937.. Sanskrit. Unknown. pgs. Gita Devi Joshi. Sanskrit. Sanskrit. 240 pgs. Sanskrit. Kavyas.. Philosophy. 1983. 385 pgs. The Sri Bhramara Gita. Sanskrit. Unknown. pandit sivadatta shastri.. Sanskrit.. 282 pgs..... The Spanda Karikas With The Vivriti Of Ramakantha. The Shantakuti Vedic Series Vol X I I I. 139 pgs. 352 pgs. The Silparatna Of Sri Kumara. Philosophy. Sayanacarya. 1937. 1972. Social Sciences. 1901. M M Sri Rudradhara. -. The Srauta Sutra Of Apastamba... The Sree Narayana Vijayam. The Shantakuti Vedic Series Vol V I I I. Unknown.. Narasimhachari... Pandit Udai Narayan Singh. 1971. The Srinivasavilasa Champu Of Venkatesa Kavi Edition Iii. Pandit Kedarnath. Sanskrit.. 1940. 1965. The Shantakuti Vedic Series Vol Xv. Sanskrit... Sanskrit. Unknown. 182 pgs. 652 pgs.. Philosophy. Sanskrit. Kshemaraja. 963 pgs. Sanskrit. 182 pgs. 1934. 780 pgs.2/14/2011 A list of scanned Sanskrit books at III… The Satapathabrahmana According To The Madhyandina Recension.. The Siddanta Kaumudi Of Bhattoji Deekshit. 1963. Unknown.. 440 pgs. Sanskrit. 809 pgs. Unknown. Narasimhachar... Unknown. 809 pgs. 1910. 1944. The Siddhanta Kaumudi With The Tattvabodhini Commentary.venkatacharya.. Sanskrit. 1948. Sanskrit. Pandit Durga Prasada.... Philosophy. 156 pgs.. 98 pgs. Viswabhandu..s. 64 pgs sanskritdocuments.. M M Shri Gangeshopadhyaya. 324 pgs. 412 pgs. The Shantikuti Vedic Series Vol X I V. T.

Unknown.. Unknown. Unknown.. The Tantraloka Of Abhinava Gupta Vol X.. 350 pgs.. 1992. The Students Sanskrit English Dictionary.. 232 pgs sanskritdocuments. A list of scanned Sanskrit books at III… The Stapathabrhmana. 1986. Madhusudhan Kaul. Sanskrit.rajanaka. Sanskrit. Sanskrit. 444 pgs. 1986. Mahadeva Shastri A. 1928. 566 pgs. The Tautatitamatatilaka Part Ii. K Sambasiva Sastri. The Tantraloka Of Abhinava-gupta Vol 5. Unknown.guruprasad Shastri. The Taittiriya Brahmana Part Ii. 502 pgs... Sanskrit.. 266 pgs.. Jayaratha R.. The Svacchandatantra With Uddyota Of Ksemaraja Vol Iii.annambhatta. Sanskrit. 1943. 1918. 630 pgs. The Tattvatraya. A Collection Of Sanskrit Nouns.. 1913.. 1963. 242 pgs... Sanskrit. 1938. Rajanaka Jayaratha. 412 pgs. Sanskrit. The Udayavarma Charita.org/…/SanskritIIIT. The Ujjwalanilamani Vol 2. Unknown.. 170 pgs. Unknown. 1921. 1986. The Unadi Sutras. Unknown. 1936. 136 pgs.. Madhusudan Kaul Sastri.2/14/2011 pgs. 368 pgs. 1938.… 81/167 . . 678 pgs... Sanskrit. 366 pgs. The Svacchandatantra With Uddyota Of Ksemaraja Vol Ii. Madhusudan Kaul Sastri. 142 pgs. The Unadi Sutras In Various Recensions 2. 1939. Religion. 48 pgs.. Madhusudan Kaul Shastri. The Sushrutasamhita Of Sushruta. The Tarka Sangraha Of M. Sanskrit.. Vaman Shivaram Apte.. Chinnaswami Sastri A. 1986. The Students Guide to Sankrit Composition. The Stava Chintamani Of Bhattacharya. Rajanaka Jayaratha... vaman shivram apte. Pandit Bhavadatta Sastri. Sanskrit. The Tilaka Manjari Of Dhanapala. T R Chintamani.. 363 pgs. The Tantraloka. The Tantraloka Of Abhinava Gupta. Pandit Mukund Ram Shastri. Religion. 441 pgs... 1950.. Unknown. The Svacchandatantra With Uddyota Of Ksemaraja Vol Iv. Sanskrit. The Structure Of The Ashtadhyayi.. 392 pgs.. 327 pgs. Sanskrit. Sanskrit. A. Sanskrit. Mangal Deva Shastri.. Unknown... 356 pgs. 1932. 1936. Sanskrit. Sree Mukunda Bala Sastry.. Unknown... 265 pgs. 1916. 1936... 1936.. Madhusudan Kaul Sastri. Shri Rupagoswami. 0. The Tantraloka Of Abhinava Gupta Vol I. Jayaratha R. Pt. Sanskrit. Sanskrit.m. 253 pgs. 1942. Jagaratha. The Svacchandatantra With Uddyota Of Ksemaraja Vol I. The Tantraloka of Abhinava-gupta vol Xii.. 142 pgs.. The Tripurah Rashya. Unknown. Sanskrit... The Tandyamahabrahmana Part-ii. Unknown. Philosophy. Sanskrit... Sanskrit.. The Trikanda Cesha. Sanskrit. 694 pgs. Unknown. Religion... 1928.. Unknown. Sanskrit.. Unknown.. 1921. 306 pgs. Philosophy. Unknown.. Kshem Raju. Unknown. Unknown.. Sanskrit. 1933. I S Pawate. Unknown. Sanskrit.... 1932. Sri Ramachandra Panasikara Sastri.. 1918. Sayanacarya. The Trantraloka Of Abhinava Gupta Vol 3... The Tattvartha Deepa-nibandana. 788 pgs. The Tantraloka of Abhinava vol Ii... Madhusudan Kaul Sastri. 913 pgs. Sanskrit. The Tautatitamatatilaka Part I. Chinnaswami Sastri. 2002. 508 pgs. 1881. Seelakkhadha Maha Thera.. Unknown. 624 pgs. Sanskrit. Harishankar Onkarji Shastri. Sanskrit. 695 pgs. Sanskrit. Unknown. Sanskrit. Philosophy. Sanskrit. Jadavji Trikumji Acharya.. 0. Linguistic. Sanskrit.

Language. Sanskrit. Sanskrit.... Unknown. 91 pgs. The Upanishadbhashya Vol..2/14/2011 pgs.. 414 pgs. Sanskrit.. Sanskrit. The Vatulanatha Sutras. Unknown... 122 pgs. Pandit Sivadatta.. Art.... Madhusudhan Kaul. Unknown. Sanskrit. Vaidyasastranipunah.. Pandit Kedharinath Sarma. 1942.. Upanishads. The Unadisutras In Various Recensions 1 Of Svetavanavasin. 1928.. 1942. Unknown. Pandit Surendra Nath Shastri. The Varshakrityadipika With Kalanirnaya And Vratodyapan. Hari Raghunath Bhagavat. 338 pgs. Linguistics. Pandit Shankar Pandurang. The Vishnu Bhakti Kalpalata Of Purushottama. 1942. Pandit Mukunda Rama Shastri... The Vrishabhanuja Natika Of Mathuradasa. 1927.I I Part.. The Vidyaparinayana of Anandarya Makhi. pandit nityananda panta parvatiya. Unknown. 1989. Unknown. Sanskrit.. Sanskrit. T R Chintamani. The Vivadachintamani Of Vachaspati Mishra. The Vasistha Darshanam. Anand Swarup Gupta. 1985. Sanskrit. 104 pgs. 400 pgs. 400 pgs. Sanskrit. The Varaha Mahapurana. A list of scanned Sanskrit books at III… The Unadisutras In Various Recensions. 1891. Pandit Sivadatta.. 560 pgs.org/…/SanskritIIIT.. Unknown.. 1980. 1933..… 82/167 . Unknown.. Sanskrit.. Linguistics. Sanskrit. Hari Raghunath Bhagavath.. 1918. Linguistics Literature. Sanskrit.. 474 pgs.. Sir Ganganatha Jah.atreya. The Unadisutras In Various Recensions. T R Chintamani. Unknown. Svetavanavasin.. 236 pgs. The Vidusaka.. The Vivadhachintamani Of Vachaspati Mishra. Unknown. T R Chintamani. Arthur Venis.. 587 pgs. Upanishadas. Unknown.l. The Vikramorvasiyam Of Kalidasa.. Unknown. The Upanishad Bashya Vol Ii Part I. 1942. 64 pgs.. 1972. ganganatha jha. 1932. Unknown. Sanskrit. Sanskrit. The Vishnu Purana A System Of Hindu Mythology And Tradition.. Literature. 1968. 472 pgs. 1917.. 1096 pgs. Sanskrit.. The Vizianagram Sanskrit Series Volume Ii Part I. H D Velankar.. The Vajasaneyi Samihita. Language. 1933. 244 pgs. 307 pgs.. The Veda Bhasya Bhumika Samagraha. S B Athalye. The Vrishabhanuja Natika Of Mathuradasa Edition Ii. Sanskrit. The Unadisutras In Various Recensions Vi. Sanskrit. pgs. 1927. 1932. Sanskrit. The Vikramorvasiyam Of Kalidasa Edition I. Sanskrit. Sanskrit. Sanskrit. 1984.. Unknown. The Unadi Sutras..I I. The Vamana Purana.. Literature. Unknown. Pandit Sivadatta. K V Sarma. 1992. 296 pgs. Linguistics. The Vikramorvasiya Of Kalidasa. Dr Albrecht Weber. G K Bhat. The Vakyapadiya. 1927. Sanskrit.. The Vikramorvasiyam A Sanskrit Play Edition Iii. H H Wilson. 244 pgs.. Prof. 66 pgs sanskritdocuments.. 279 pgs. B.. Unknown. 1901... 764 pgs. 1893. Linguistics Literature. Sanskrit.. Sanskrit. Literature.. Language.. 642 pgs. Sanskrit... 58 pgs. 374 pgs. Sanskrit. The Vijnana Bhairava. 1923. 1961. Sanskrit. Sanskrit. Unknown. Acharya Baladeva Upadyaya.. 388 pgs. 307 pgs. 1993. Unknown. 285 pgs... Unknown. 1959..

Religion. 654 pgs. Thorale Shaahu Maharaaja Yaan'chen' Charitra Aavrxtti Da~vitiiyaa.. 305 pgs. 1930. Tiloya Pand-nd-attii Dditiiyo Bhaaga... Literature. 100 pgs. The Yatra Prabhanda.. Sanskrit. Sanskrit.chintamani. Tinantarnavatarani. Kamalakrishna Smrititirtha. Geography. Literature. Sanskrit. Archicture. Unknown. Sanskrit. 1948. 1952. 474 pgs. 1815. The Yoga Upanishads. Mahdeva Sastri.. Tirthacinthamani Vol 1. Sanskrit. The Yadhavabyudaya Of Sri Vedanthacharya. 1983. Tisastvustik. Theravada Buddhism In Burma. Philosophy. Sanskrit. Chaara~ya Yativrxshhabhaa. pgs. The Unadi Sutras. 0. Sanskrit... Sanskrit.. 99 pgs. sanskritdocuments. Art. . The Vyakarana Mahabhasya Part 2. Tittriyopanishat Atharaiyopanipancha.. History. 1944.. Geography. 1993. History. Brahmadattaji Jigyasu. 252 pgs. 0. 162 pgs. 1965.. 634 pgs. 1931. 68 pgs. Niharranjan Ray. 234 pgs. The Yudhishthiravijaya Of Vasudeva. 327 pgs.... Linguistics. 1936.. 1883. Tirthacinthamani Vol Iii.. Language. W Redloff..srinivasagopalachar. 1938. 516 pgs. Sanskrit. 202 pgs. Sanskrit. Bhagavat Patanjali. Shriidanapaala. Linguistics. Language. The Works of Sri Sankaracharya Vol Xvi. T. Sanskrit. Thrikalavachedhikavadhaha. Sanskrit. T T Srinivasa Gopalachar. Language. 0. 350 pgs. 272 pgs. 98 pgs. 1912.. Bhagavat Patanjali. 1950. Sanskrit.. Sanskrit. History... 1910. Sanskrit.. 116 pgs. 1951. Sanskrit.2/14/2011 pgs. 451 pgs. 602 pgs. The Works of Sri Sankaracharya. 126 pgs. Sanskrit. 1911. Unknown. Unknown. Thrastadyayi Bhashya Vol I. 1961.. 1931.... Vishrug. Sanskrit. Sanskrit. Chit'and-iisa Malhaararaamaarava. Tiloya . 190 pgs. Unknown. Unknown...r. Geography.Pannatti Part Ii.. Literature. 639 pgs. 0. Sanskrit. Kamalakrishna Smrititirtha. Thruhan Sutr. Sanskrit. The Works of Sri Sankaracharya... 622 pgs.org/…/SanskritIIIT. Tirthacintamani. Kamalakrishna Smrititirtha. .. Unknown. Art.. Sanskrit. Unknown. Burke A Hinsdale. 426 pgs.. T T Srinivasa Gopalachar. S C Sen Gupta. Subrahmanyakavi S. The Unadi Sutras. 1944. Sanskrit..… 83/167 .... Unknown. 1948.. Geography Biography History. Geography Biography History.. Thomas Hardy. 700 pgs. Mahamahopadhyaya Pandit Sivadatta. 1911.. The Works Of Sri Sankaracharya Volume Iv. 1994. Pandith Ramchandra Jha.. Unknown... Sanskrit.. Tilakamanj-jarii Da~vitiiyaavrxtti. Tirthacinthamani Vol Ii. Samarapungava Dikshita. A list of scanned Sanskrit books at III… The Vyakarana Mahabhasya Part 1.. T... 305 pgs. The Yadavabhayudaya Of Sri Vedantacharya. Unknown... Biography. The Yadavabhyudaya Of Sri Vedantacarya. The Unadi Sutras. Sanskrit. Unknown. Linguistics.. Biography... 524 pgs.. Sanskrit. Theology. Pandith A. Sanskrit.. Unknown. Thirteen Trivandrum Plays Attributed To Bhasa Vol Ii. Biography. 1920. Dr P L Vaidya.. Sanskrit. A C Woolner.

1953. Religion. Tristhaliisetu 78. Upanisad Vakya Maha Kosa Vol 1. Upadesha Sahasri. Naaraayand-a.. Upanishhadaan' Samuchchaya Da~vitiiyoyamang-kanaavrxtti. Unknown. 638 pgs. 238 pgs. Sanskrit.. Dr.. Sanskrit. Religion. Udararachavam of Kavimalla Mallacharya. Theology..m. Language. Unpublished Upanishads.. Unknown. 1929. The Arts.. Chintaamand-inaa. Sanskrit. Upanishhada Samuchchaya.. 256 pgs... Sanskrit. 1929.. Sanskrit.. Shaastri Shan'kara.. 1933. Aapat'e Hari Naaraayand-a... 194 pgs. Linguistics.modi. Sanskrit. Udaya Vadantha Granthamala. 1995.. 147 pgs.. Language. 1933. Linguistics Literature. Unknown. 532 pgs. Somatilakasuuri. Damodhara Pand-d'itavara. Literature. 1941... Sanskrit. Translation Of Siddhanta Bindu.. 1925.. Sanskrit.. Und-aadi Suutraand-i Grantha 7. Upanishads. Pandith Sri Durgadutta Tripathi. 1934.. Veeraraagaya. 97 pgs... K. Sanskrit. 665 pgs. Religion... Gajanana~ Shambu Sadhale Shastrii. Theology. Language. 1925. Religion. Sanskrit.. Trin'shachchha~lokii Grantha 104.. Linguistics. Religion. Kumham Raja.. Sanskrit.. 122 pgs... Und-aadi Suutraand-ii Bhojiiyaani Shhashht'ho Bhaaga. Chintaamand-ii Ti Ra. 237 pgs. Religion. 1934. 403 pgs. Unknown. Theology. Literature.… 84/167 . Sanskrit. 233 pgs. Tripurabhaaratiilaghustava granthaan'ka 1. 52 pgs. 1953. 316 pgs.. Linguistics.. Und-aadisuutraand-i. 1937. 62 pgs.. Theology... 284 pgs. 308 pgs.. Shriinaarayand-ashan'karaananda. 314 pgs. Literature.. Ullagharaghava Nataka. Ukttivyaktiprakarand-a. Unknown.org/…/SanskritIIIT. 1933.. Und-aadi Suutraand-i Ditiiyo Bhaaga Grantha 7. 283 pgs. Sanskrit. 158 pgs.sudhakar Malaviya. 201 pgs.. Sanskrit. Linguistics. P. pgs.. Sanskrit. Benoytosh Bhattacharyya. Sanskrit. Sanskrit. Sanskrit. Psychology... A. 1941. Und-aadisutraand-i Prathamo Bhaaga.. 1946. Upadeshasahasri Part I. 302 pgs. Sanskrit. Trikonamithi. 720 pgs. Upanishhada~vaakyamahaakosha Uttaraara~dhaha~. Umas Mirror.... Two Plays Of Bhasa... 0. Sanskrit. Toegyehak Libery Part I Vol 4.. Philosophy. Sanskrit.. 1952. 330 pgs. 1940. Sanskrit. Naaraayand-a Dand-d'anaatha. Krishnaswamy Iyer. 1959. 675 pgs. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Toegyehak Libery Part I Vol 4. Theology. 508 pgs. rajendra swarup gupta. 1961. shastri gajanan shambhu sadhale. Upakarma Paddhathi.. Language. Chintaamand-inaa Ti Raa. 210 pgs. Religion. Upadeshasahasri. K M Munshi. Unknown. Religion. Two Vajrayana Works. Sanskrit. 1952. Sanskrit. Language. Sanskrit. Literature. Simhavira Dura~ga.. Theology. Linguistics. Dinakar Krishna Gokhle. Vasudeva Lakshmana Sastri. 1984. Sanskrit.. Sanskrit. 1929. Triddnimathvibhodhini. Sanskrit. Sri Sankaracharya. Theology. Theology. Sanskrit. 94 pgs. 1923. 60 pgs. Jagadgurvo Vijaynante Taramah. Sanskrit. V Krishnamacharya. 544 pgs. 1936. 1933. Unknown. Und-aadisuutraand-i Bhojiiyaani Shhashht'ho Bhaaga Grantha 7.. 1933. Itaruka.. Art. sanskritdocuments.. Art. 1982. Unmattaraghava. Unknown. A S P Ayyar. Unknown. Unknown. Agama Prabhakara Muni Punyavijaya. C.. Unknown. 1929.... Chintaamand-inaa. Literature. 1966. Sanskrit.

. 1934. Sanskrit. Sanskrit. 1981. Sanskrit. Vadanakshatramala. 210 pgs.. Natural Sciences... Unknown. 639 pgs. Upanishhadratnaprakaasha Ratna Chhaandogyopanishhada~. 161 pgs. Sanskrit. Sanskrit. Sanskrit. 1935. Sanskrit... 444 pgs. 200 pgs. Narayan Ram Acharya. Appayya Dikshita. Unknown. Unknown. Vada Varidhi. W. Religion.. Urubhangam Breaking Of Thighs. Psychology. Philosophy. 376 pgs. 1928.. 1971.2/14/2011 A list of scanned Sanskrit books at III… Upanishhadbhashhyama~ Dvitiya Bhaaga Dvitiya San'skarand-ama~... Veng-kat'araamashara~maand-an. Upasakadyayan. Balakrishna Misra. sanskritdocuments.. Shaastri Shamaa. Vaikhamsa Gruhya Sutram vol Ii.. Visva Bhandu Sastri. 296 pgs. 450 pgs. Sanskrit. Sanskrit. 1930. Sanskrit. 348 pgs. Sanskrit. Sanskrit. Philosophy. Sanskrit. Sanskrit.. Sanskrit.. Paridath Kalarama Shastri. Vaidik Sahitya Ka Itihas. Srinivasamakhi Vedantadesika. 411 pgs. Upanishhadratnaprakaasha Ratna Chhaandogyopanishhada~. Bhid'e Sadaashivashaastrii. 391 pgs. 1949.. Usaniruddha. 1997. 142 pgs.. 355 pgs. M M Pandit Deviprasada Ravichakravarti. Vaidik Sathya Prakasha. 1932. Sanskrit. Shriimadahobalasuuri. Sanskrit. Psychology. Sanskrit. Religion.... 659 pgs.. Tirunoymozhi....Srautasutram. 172 pgs. Vaidika Padanukramakosa Vol 2 Part 1.. Sanskrit. 2001. Pandith Madhava Sastri Bhandari. Vaiiyakarana Siddhant Laghumanjusha. 1921.. 1933. 44 pgs. 576 pgs. Philosophy... 64 pgs.... 1941. Unknown. Vaidik Vadgamya Ka Itihas Vol I I. Unknown. Srinivasamakhi Vedantadesika. 66 pgs. Sanskrit.… 85/167 . Sanskrit. Vadavali.. 420 pgs. Upanishhaddaakya Mahaakosha Prathama Khand-d'a... Theology.. Sanskrit. Sanskrit. Unknown.. 1931. 516 pgs. Religion.. Sanskrit. Literature. Unknown. Vedas.. 766 pgs. Bhagva Dutt. Vag Vallabha Of Sriduhkhabhanjanakavi.. 693 pgs. S Subramanya Sastri. Bhid'e Sadaashivashaastrii.. 1940. Sanskrit. Unknown. Vidwan Satyadhyanacharya.. Theology. Gruhya Sutras. Unknown. 1945. Unknown. 1987. Vaishmavism. Sanskrit. Sri Somadev Suri. Vaakyaara~tharatnama~. Vaikhanasa Gruhya Sutram vol 1. Shriishan'karaachaara~ya. Theology. 1933. Uttara Purana Of Acharya Gunabhadra. Dr Gaurishnakar Mishra.. Vaidhyachandrodaya Vol Ii.. Unknown.. Gajaanana Shambhuputro. Sanskrit. 375 pgs.caland.. 1940... Advaitam. Religion. 605 pgs.. Sanskrit... Sanskrit. Subramanyamu V.. 1954. Pandit Pannalal Jain. 1943. 1925.. Bhishkakavi Sri Rashachandra. Dr Ram Murthy Sharma. Vaidik Avem Vedottar Bharatiy Sanskruthi. Vaalmiikiiya Raamaayand-ama~ Baala Kand-d'ama~ Paqs-chimottarashaakhiiyama~. 1949. Vaaraahagrxhma Suutra Bhaaga Xviii. Theology. Psychology. 672 pgs.. Utsarjano Pakarmapaddhatih. 1997. Vaikhanasa . Vaidyakiyasubhasitasahityam. 541 pgs.. 1932. Religion Theology. 309 pgs. 408 pgs. Vaalmiikii. Subramanyamu V.. 1976..org/…/SanskritIIIT. 1943. Sanskrit. Sanskrit. Sanskrit. Uttararamacharitra. 0.. Unknown... C R Devadhar. Vaijayanthi Kosa Volume Ii. 1954.. Vaajasaneyipraatishaakhyama~ Kaatyaayanaprand-itama~. 1912.. Pandarinathacharya. Unknown. 106 pgs.

. Literature. 0. 414 pgs. Sanskrit. 1928. Sri Nagesa Bhatta.. Unknown.. 1924.. 186 pgs. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… Vairagy Shatak... 88 pgs. 106 pgs. Unknown.. 227 pgs.. 1929. Vaisheshhika Dara~shana. Psychology. Literature. 1961.. 1929. Vaiyakarana Siddhanth Laghumanjusha. Vaisakha Mahathyam... Sri Nagesa Bhatta. Unknown. The Arts. 104 pgs. 1984. Vaiyakarana Siddhanta Laghu Manjusha No 192. 102 pgs. 104 pgs.. Unknown. Sri Nagesa Bhatta.. Sanskrit.. Religion.. Sanskrit.. Sanskrit. 1960. Vyakarnopadhyaya And Sahitya Tirthac. 1929. Unknown. . Unknown. Unknown.. Sri Nagesa Bhatta. Language. Vakyartha Vivechanam. Sanskrit.. Vaiyakarana Siddhanta Laghu Manjusha No 211. 2002.. Sanskrit. 106 pgs. Vaiyakarana Siddhant Laghumanjusha.… V h h L Li i ti Lit t S k it 0 502 86/167 . govindlal hargovind bhatta. 1925. Sanskrit. Vaiyakarana Siddhanta Laghu Manjusha No 212. Sri Parameswardin Pandey. venkatrao rayasam. Vaiyakarana Siddhanta Laghu Manjusha No 328. Indian Logic.org/…/SanskritIIIT. Vamanapurana. 1928. Language. 1172 pgs. Unknown. 376 pgs.. Vaiyakarana Siddhanta Laghu Manjusha No 191. 0.. Sanskrit. Vanamala.. Sanskrit.... Muni Sri Jambuvijayaji. Vaiyakarana Siddhanta Laghu Manjusha No 238. 314 pgs. Vaishampaayana.. Literature. Vaiyakarana Siddhanta Laghu Manjusha No 253. sanskritdocuments. Literature. Sri Nagesa Bhatta. Theology. Sanskrit.. 1953. Sanskrit. 1993. Vaiyakarana Siddhanta Laghu Manjusha No 237. Religion... 1913. Pandith Sri Sitaram Sastri.. 106 pgs. Sri Achyuta Krishnananda Tirtha. The Arts. Sanskrit.. Sanskrit. 1974. 0. 1927. Sri Nagesa Bhatta... 110 pgs. Shriijat'aasin'hanandi.. Sanskrit. Sanskrit. 144 pgs. Pandith Sri Sitaram Sastri. 110 pgs. Unknown. 354 pgs. 96 pgs.. Valmiki Ramayana Volume One. 222 pgs. 1954. Kand-ada Mahara~shhi. Sanskrit... 360 pgs. Unknown. Sanskrit. 108 pgs. Sri Ananta Sastri.. 1924.... . Unknown.. Sanskrit. 1929. Dr Dhanurdhara Jha.. Sanskrit... Vakrokti Jivita Of Raja Rathnakara. 1913. Vanamala A Commentatory On The Taittiriyopanishad Bhashya... 0. Unknown.. Vamana Suktam. Vaiyakarana Siddhanta Laghu Manjusha No 227. Vaiyakarana Siddhanta Laghumanjusha No 213. 508 pgs. Linguistics. Krishna Singh ji. Unknown.. Unknown. 114 pgs. 1925. Unknown. 104 pgs. Linguistics. 1929. Sanskrit. 1938. Pandith Madhava Shastri. Sanskrit. 292 pgs.. Sanskrit. 326 pgs. Sanskrit. Vaisesikasutra Of Kanada. Unknown. 190 pgs.. Sanskrit. 1961. Unknown. Sanskrit. Varaang-gacharitama~ Prathama San'skarand-ama~.. Linguistics. Vanshabhaskar. Sri Nagesa Bhatta.. Pandari Krishnacharya.. Vaiyakarana Siddhanta Laghu Manjusha No 228. Philosophy. Sri Nagesa Bhatta. 112 pgs. Literature. Language. Sri Achyuta Krishnananda Tirtha. Sanskrit. Vaishampaayananiitiprakaashikaa. Vaiyakarana Siddhanta Laghu Manjusha No 214.. Sanskrit. Sri Nagesa Bhatta.

.. Vedantakaustubhaprabha Accn0 478. .. 190 pgs.. Subramanya Sastri S. 236 pgs. 1953. Sanskrit. 522 pgs. 1984. Sanskrit. 1973. Sanskrit... 2000. Vedanta Darsana. Geography. Philosophy. Vedandak. 1951. Vedakalija Narisiksha. 193 pgs.. 1915... 1969. 1986.n. Narayana A.... 502 pgs.. 1971. Sanskrit.. Religion.r.. Unknown. 1911. 82 pgs. 504 pgs. 340 pgs. Psychology. Religion. Bhagavadraamaanujama. 440 pgs. Pramodini Pandu. 413 pgs. 1955. Mishra B N. Philosophy. Unknown. Unknown. R K Prapannacharya. Sanskrit. Sanskrit. Sanskrit. Vedanta Sutramu Mdravali. Shri Brajnath Sharma. Vedantanayabhushanam. Literature.. Vedanga Prkasa. 2004.... Sanskrit. 81 pgs. Chenna Reddy. Varahamihira Horasastram.org/…/SanskritIIIT.. 1986.. 249 pgs... Unknown. 237 pgs. Shriinrxsin'hashrami.. sanskritdocuments. Veda Pravachana. Sanskrit. 363 pgs.. 238 pgs. 1872. S S Suryanarayana Sastri. Vedaantaparibhaashaa. Vasu Caritram.. Vasantatilakabhaand-a. Sanskrit. pgs. 106 pgs. Sanskrit.. 1952.. Unknown.. Vasunandi Shravakachara. Biography. Sarasvatii Bramhaananda. B. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Varahamahapuranam. 548 pgs. Vaydyak Sabdasindhu. Vedas. Language. Sanskrit. 101 pgs. Philosophy. Vatsaraaja Udayand-a.. Narayana..n. Religion. Unknown. Sanskrit.. Vedanta Sutramu Mdravali. Sanskrit. Sanskrit. Sri Yudishtara Mimansa... Vedaantasaara.. Ganga Prasad Upadhyay. Sociology. 81 pgs. Pandit Harilal Jain. Unknown. 1986. Sanskrit.… 87/167 .. Sanskrit. 425 pgs. 0.. Unknown. Vedanta Sutramu Mdravali. 0. 1998... Unknown. 1838. 1991. 1964.srinivasaraghava Aiyangar. Ganga Prasad Upadhyay... Kaviraj Nagendra Nath Sen. Sanskrit Samhitas... . Baladeva Prasad... Ramananda Saraswati Swami. Sanskrit. Dr. Vedaantasutramukttaavali. Vedakhasarodhar. 1270 pgs. Unknown. 292 pgs.. Unknown. 1942.sree Krishna Sarma.. 872 pgs.. Psychology. Sanskrit. Psychology. 80 pgs. Unknown. Vaishmavism. Linguistics. Sanskrit. Namitha Garg. Unknown. Vedaanta Tattva Viveka.. 92 pgs. Unknown. A. Dr B Rama Raju. Unknown. Theology.. History.e. 1998.a. 1948. Aadhvrina~ Dhara~maraaja. Unknown.. 1965.. Sanskrit.. Kaviraj Nagendra Nath Sen. 62 pgs. Sanskrit. 2000.. Linguistics. Shriivaradaacharayaa.. Sanskrit. 234 pgs. 1976. 1942.. 0. 1967. Sanskrit. Varahi(bruhat) Samhita. Kaat'adare Maadhavakeshava.. Sanskrit. Language. Veda Praveshah. 215 pgs. 1984. 130 pgs. Shivasahaaya. Sanskrit. Sri Giridhar Sharma Chaturved... Literature. Dr. Sanskrit. 456 pgs.. Sanskrit. Vedanta. Veda Samiksa. Philosophy. Unknown. Vararuchasangraha.j.. Sanskrit. 1992. Psychology.. Varivasya Rahasya Accn0 1281.. 272 pgs.pandey. Sanskrit. Sanskrit. Vararuchi Avam Hemachandra Virachitha Prakrutha Vakarna 2739. Vedaanta Raamaayand-a Bhaashhaat'ikaa Sahita. Vedanta Prakasa. Philosophy. Vedanta Sara Cintamani. 460 pgs.venkatesacharya. Sanskrit.. Veda Bhasya Bhumika Samgraha.. Vararuchasanghrahar..

Vedardhasamgraha Geetha Bhashya.k.. 338 pgs.. Vedic Kosha. . P Bhagaddatta amp Hamsaraj. 261 pgs. Unknown. 1962. vishva bandhu.. S S Suryanarayana Sastri. Unknown. P Sambamoorthy. . 1969. 892 pgs.. Sanskrit.org/…/SanskritIIIT. 290 pgs. 644 pgs. Vedic Padhanukram Kosah. 1992. Vaman Bhattacharya. 366 pgs. T. Vedavyasaparampara. Unknown. 209 pgs. Unknown. Vedic Padhanukrama Kosah Vol 5 Part 1..... Sanskrit. Sanskrit. 500 pgs.. 55 pgs. Linguistics.. Veeramitrodaya.. 1989. Panchanana Bhattacharya Sastry. Vedic Hymns. Unknown. Vedhaththa Suthra Mukthavali. Philosophy. Vemanapadyamulu In Sanskrit Slokas.. G Swaminadhacharyulu.. 362 pgs. 150 pgs. Somraj Krishna Das. Prakasanamba. 1955. Vedic Padhanukrama Kosah Vol 3 Part 2. Sanskrit.... Unknown. Vedic Padhanukram Kosah Vol 1... 998 pgs. 704 pgs. 1952. 892 pgs... 500 pgs. Vedic Padhanukrama Kosah Part 2. 76 pgs. Vemabhupala Charitram. Sanskrit.... Art.. Unknown. -. Vema Bhupala Charitam.. 1939.krishnamurthy Shasthry. S N Srirama Desikan. Vamana Bhatta Bana.. Sanskrit.. Linguistics.. Unknown. vishva bhandu. Unknown. 1998. visva bandhuu sastri.. 1945. Sanskrit. 1961. 1959. Pandit Mitra Misra. Unknown. Visva Bandhu Sastri. 258 pgs. Venkatachala Ithihasamala Anantarya. Vishva Bhandu. Sanskrit. 700 pgs... Unknown... Visva Bandhu. Srimath Paramahamsa Parivrajakacharya. Philosophy.. 1964. Sanskrit.. Brahmanadha Saraswathi.. 846 pgs.. vishva bhandu... Sanskrit. Dr G Swaminath Charyulu.. Veershaivendru Shaker.. 1971.. Sanskrit. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Vedantaparibhasa Accn0 583. Sanskrit. 1988.. visva bandhu sastri. Vetaalapanj-chavin'shati. 115 pgs. 117 pgs. Philosophy. 1979. 238 pgs. Sanskrit. Venkateswari Thatkruthinam Adhyayanamu.. Sanskrit. Sanskrit. 1867. 1969.. Sanskrit. Sanskrit.krishna Swamy Aiyar. Dr Kunwar Lal. Venkatasuris Nauka Charitram In Sanskrit... Sanskrit. Literature. Vedic Padhanukrama Kosah Vol 4. Unknown. Literature. Vedastuti Volume Iii. Sanskrit. 260 pgs. Sanskrit. S. 1984... Pandit Shada Shiv Sharma.. Sanskrit. Vedanthanamaratnasahasram. Unknown... 1975.. Vedic Padhanukrama Kosah Part 3.r. Sanskrit. 1864. Jambhaladatta.. 1945.. 1970.. 290 pgs. Krishnamurthysahastryvarya. Vedharya Sangrahah Geetha Bashya Gadyayatra. 201 pgs. 666 pgs.. 520 pgs. 390 pgs. 0. 1969. 1992. Sanskrit. 240 pgs... Sanskrit. Language. Sanskrit.. Sanskrit. Language. 1959... Vedic Hymns. Wasudev Laxman Sastri Pansikar. Vedhantha Paribhasha. Venkatadvari Tatrkuthinam Adhyayanam. Sanskrit. Krishnamurthysahastryvarya. Unknown.. 1942. 1910. Vedic Padhanukrama Kosah Part 1. Sanskrit. Unknown. 758 pgs. 1988. 292 pgs. 2001. Veeramithrodaya. Unknown.… V t l P h Vi h tih S N Sh ti U k S k it 1949 66 88/167 . Unknown. Vedanthasindantha Mukthavali. Unknown. 1958. vishva bandhu. 362 pgs. Vedic Padhanukrama Kosah Vol 1 Part 2. Sanskrit. Sanskrit. sanskritdocuments. Unknown. 1945. Sanskrit. Vedantha Paribashaa... Srimithra Mishra. Sanskrit. Sanskrit.. 806 pgs. 1947. Unknown. Vedantnamaratnasahasram. Unknown. Literature. Vede Ashvinau Asvins In The Vedas.

202 pgs. Vishnu Prasad Sharma. Vidagghamukhamand-d'anakavyama~. Sanskrit. Vichara Ratnakara Kirtivijana. 106 pgs... shriramavathara sharma.. Sanskrit. 1978. 1997. Sanskrit. Vishnupurana With 2 Commentry amp Tika Vishnucitta amp Sridhara. Sanskrit.. Unknown. Vidhaanamaalaa Grantha 86. 240 pgs. 230 pgs. Unknown. Sanskrit. Pandit Mukunda Shastri. Sanskrit. Vibhaktyarthanirnaya Iii. 1987. Unknown. Viramitrodaya Bhakti Prakasha Vol Xi. Virodha-varuthini. 156 pgs. 1926. Visheshik Darshan. Unknown.. Sanskrit. Vikrantabharatam. 1986. Religion. Jagannath Sastri Hosinga. 106 pgs.. 0. Unknown.. 1986. 170 pgs.. Literature. 1901. Sri Giridhara Bhattacharya. Literature. Giridhara Upadhy... Somraj Krishna Das.... Deshapaan'd'e Ga Vi. 1926. Sanskrit.. 151 pgs. Somraj Krishna Das. Vidhyaamaadhava. Pt. 123 pgs. Vibhaktyarthanirnaya..dalsukh Malvania. 172 pgs. Vishnu Prasad Sharma. Virodha Varuthini. V Venkataramana Reddy. . Vibhaktyarthanirnaya Iv. Visesavasayakabhasya Part 1. Sanskrit. 382 pgs. Sanskrit. Sanskrit.org/…/SanskritIIIT. Viramitrodaya Vol Xx....2/14/2011 A list of scanned Sanskrit books at III… Vetala Pancha Vimshatih. Language.. Unknown.... . 66 pgs. Vidhura Nithi. 1867. Jyotira~vichchhridayaanaatha. 106 pgs.. Sanskrit. 364 pgs. Viramitrodaya Samaja Prakasha Vol X.. Bhat't'a Shriinrxsin'ha.. Unknown. Sanskrit. Unknown. 58 pgs. Biography.. sanskritdocuments. 1948. Unknown. Unknown. 0. 1954. Vimarshamruthamu. Shri Ram Sharma Acharya. Vishnu Dhrmoattara Puranam. Sanskrit. Vibhaktyartha Nirnaya. 428 pgs.. 1966. Sanskrit. Literature. Vidhyaamaadhaviiyama~ Trxtiiyasan'putama~ 11-15 Adhyaayaa.. Sanskrit. 677 pgs.. 1923. 0... Unknown. Dr B R Shastry.. Linguistics. Sri Paripurna Prakashnanda Bharathi Mahaswamin. Sanskrit. Sanskrit. Nanuji Bhatt. 1964. Vidyamadhaviyam Of Vidya Madhava. -.. Natural Sciences.. Sri Giridhara Bhattacharya. 124 pgs. Giridhara Upadhy..... Sanskrit. Viira Vinaayaka. 1645. Unknown. Dalshuk Malvania. Sanskrit... S N Shastri. 1925. Religion. R R Deshpande... 1949. History. Visakhadattas Mudraraksasa Edition I I. Vikramora~vashii trot'akama~ Chatura~tha San'skarand-ama~. 1901.… 89/167 . Giridhara Upadhy. Vishampadh Vakya Vritti. Unknown... Vishnu Prasad. 419 pgs. Mahaprubhu Lal Goswami. Sanskrit. 110 pgs.. 1939.. 67 pgs. Theology. Vimand-d'alavakravichaarah. Pandit Madhava Prasad Vyasa. Biography. Sanskrit.. Unknown. Swamy Vivekananda. 330 pgs. R Shama Sastry. 168 pgs. 1901.. 1901. Sanskrit. 0. Geography. Literature. 101 pgs.. 1966. Unknown... .. Vikramorvasiyam Of Kalidasa. 0. Sanskrit.. Sanskrit. Sanskrit. Shriidhara~madaasasuuri.. Sanskrit. Shriikaalidasa~. 257 pgs. Vikramarkandeva Charitram. Vibhaktyarthanirnaya V... Venkat Ramana Reddy. 1952.... Sanskrit. Sanskrit. Unknown. Sanskrit. Theology.. Unknown. 1916.. Vidhiviveka... 1987.. Unknown. 390 pgs. Vidura-niti. 0. History. 1920.. Natural Sciences. Unknown. Sanskrit.. 304 pgs. 334 pgs. 194 pgs. Sanskrit. 94 pgs. Sanskrit. Unknown. Unknown.. 400 pgs. 108 pgs. 1901. Vidhi Rasyana. Geography.. Visesavasyakabhasya With Srikotyaryavadiganis Vivarana Part Iii. V. 290 pgs. Sanskrit.

1935. Religion. 1969. Srinivas Ayyangar. Vyaakarand-amahaabhaashyama~ Tatraang-gaghikaara Da~vitiiyo Bhaaga. bhattoji dikshita.… 90/167 .shiv Dutt Mishra.2/14/2011 A list of scanned Sanskrit books at III… 1967. Sanskrit. Vizianagaram Sanskrit Series. . Sanskrit. Sanskrit. .. Sanskrit. 1981.. Unknown. Sanskrit. 1951. Vyutpattivada Of Gadadhara Bhattacarya. Shriibhagavatpatan'jala. 1921. Ganga Vishnu Sri Krishnadas. 168 pgs. 624 pgs. Religion. 81 pgs.. 865 pgs. Visnuvilasa. Sanskrit. Religion.org/…/SanskritIIIT.. 1940.... P Gopalachandra Vedanthashasri. 362 pgs.. Vivahapatlam Sarasamuchaya. Sanskrit. 277 pgs... Religion. B V Narasimhacharya. Pt. 1983. Vyasasidhanta Marthandam. Vishyanukramanika. Ramasastri Bhagavthacharya. 1993.. Mohamahapadyaya Kapisthalam Desikachariar. Sanskrit.. Unknown. 1926. Philosophy. Sanskrit. Psychology. 430 pgs. Sanskrit. Sanskrit. Unknown. Vyavahaaramayuukha. Visuddhimaggo Prathama Bhaaga. Linguistics. Bhat't'aachaara~ya Gadaaghara. sri vasudev dikshit.. 610 pgs. Vividha tiira~thakalpa. 605 pgs. V Rangaswami And Krishna.. Sanskrit. Sanskrit. Sanskrit... Sanskrit. Vrittaratnakara Edition Vi.. 1983.k.. 538 pgs. Sanskrit... Pandit V. Philosophy. 1948. Sanskrit. Unknown. Vyakarana Koumudri. 1891. Unknown.aryendra Sharma. 146 pgs. Unknown... Literrature. Visnusmrti Ii. Language.. sanskritdocuments.. Vyutpattivada.. Sanskrit. Pt. 1942. Theology.... Literature. 909 pgs.. Sanskrit. P. 1934. Sanskrit. Vyutpattivaadah Lakaaraara~thavichaarah.. Undemane Shankara Bhatta. Sanskrit... Vrttaratnakara. Sanskrit.. Unknown. Acharya Madhusudhan Shastry.. Literature. 1948. 541 pgs. . Sanskrit. Religion.. Anant Ram Shastri. 1943... Sanskrit. Visvamitra Samhita. 1954... Viveka Chudamani Of Sankaracharya.. Vyakaranabhushanasara. 0. Visnudharmottara Mahapuranam.. Sanskrit... Vyakaran Siddhanta Kaumudi Balmanorama Pradhamabagamu. ... Visukipuranam. 0. Sanskrit. 284 pgs. 1929. Unknown. 1929. 837 pgs.. Mahadev Chimanaji Apte. Sanskrit. Buddhaghosaachariya. Unknown. 245 pgs. Natural Sciences. 506 pgs. 0.. Vyakarana Mahabhasyam Of Patanjali Muni. 1957. 240 pgs. Vritharatnakaram. 1994. Eluu Eluu. Sanskrit. Psychology. Sanskrit. Vyakaran Maha Bhasyam.shiv Dutt Mishra. 1957. 1914.. 246 pgs.. 115 pgs. Sri Giri Sharma Chathurved. Dr. Somraj Krishna Das. Jinaprabhasuuri. Vyavahara Nirnaya Of Varadaraja. 1942. 1818. Unknown. Theology... Vrataraja. Veng-kat'araamashara~maa Ve. Theology. 668 pgs. 1991. 645 pgs. 339 pgs. 166 pgs. Vyakarana Siddhanta Kaumudi. Unknown. 228 pgs.krishnamacharya. 562 pgs. Unknown... 1964. Swami Madhavananda. 338 pgs. Sri Rudradharajha. 1954... Somraj Krishna Das. . Unknown. 535 pgs. Sanskrit. -.narayana Pillai. Unknown. Unknown. Sri Ramachandra Kavi Bharati... Unknown. 234 pgs. 616 pgs.. Unknown. Viwahsopangvidhi.. Vrttaratnavali. 304 pgs.. Vyayasasidhanta Marthandam. 312 pgs. Vyavahaaramaalaa.. 1988. Sanskrit.... 336 pgs. Sanskrit.

. -. Yadnyavalkyasmriti Of Yogishvara Yadnyavalkya Fourth Edition. Sanskrit. 716 pgs. Sanskrit. Yagavasista Vuthu Paryay Prakasika Part 3. Sanskrit.. 506 pgs. 1953. Sanskrit. 251 pgs.v.. Yathara Prakasa Part 1.. .. 196 pgs. Narendra Nath Sharma. Philosophy. Religion. Yajna Tattva Prakasa. Theology.. 258 pgs.. Literature. Unknown. 0. Saatavalekara~ vi esa~.. Sanskrit. Yajnavalkyasmrti. Yajurvediya Kataka Samhita.… 91/167 .. Unknown. 1980. Yatiindramatadiipikaa. 0. 186 pgs. . . Theology. Yatinder Matdipika.. Theology. Dhamodar.. Yagavasista Vuthu Paryay Prakasika Part 2. Unknown. Sanskrit. Sanskrit.. 360 pgs.chinnaswami Sastri. Girish Chandra Sharma. Aapat'e Vinayaka Gand-esha. 152 pgs. Sripad Damodar Saatvalekar. Yajura~vediiya Kaat'haka San'hitaa. Sanskrit.. Sri Swami Sivanandh. 1164 pgs. 2003... 162 pgs.. Theology. Yadavabhyudayam Sargas I To I V. Philosophy. Parikshit Sharma. Philosophy. Sanskrit. Yayathi Aakhyaan.. 0. Sanskrit. Yajhu Shakiyasanthikanda Pradeepa. Saan'tavalekara. Philosophy.. 196 pgs. 119 pgs... Sanskrit. Sanskrit. 2000. 89 pgs. 1976. Unknown. 1953. Yoga Karnika. Psychology.. Sahibji Maharaj Sir Anand Sarup. Sanskrit. Yatindramatadipika. 1904..2/14/2011 A list of scanned Sanskrit books at III… Word Index To Taittriya Samhita. 1927. Philosophy. Religion. Yathiraja Vijaya Natakam. 635 pgs... 132 pgs.. Sanskrit. Sanskrit.. 548 pgs. Yashodhara Mahakavyam.. Religion. Yekanki Saptakam. Yajura~veda San'hitaa Dditiiya Vaaran.. 1934.. 1949. Sanskrit. 176 pgs. Literature. 136 pgs. Yaanj-avalkya Smrxti Granth 46.. Pandit A. 183 pgs. Sanskrit.. Wasudev Laxman Sastri Paniskar.o... 1998. 0.. Unknown. Theology. Narayana Shastri Khiste. Yagavasista Vuthu Paryay Prakasika Part 1. 0. Philosophy. Sanskrit. 331 pgs. Yekankastakamu. . Unknown. 0. Sanskrit. Sanskrit. Unknown. Yajurvedasanhita Vol Iv.. Sanskrit. Sanskrit. Philosophy.. Sanskrit. Yoga Vedanta Dictionary. ... Damodar Bhattasununa. 2000. 1950. . Parashuram Shastri... Appayya Dikshita. Unknown. 0. Sudarsanacharya. Sanskrit. Yoga Chikista. Linguistics... Shriinivasadaasa.... Taitriya Samhita. 1930. 1868. 202 pgs. 1977.. Yajurvedha Maithrayani Samhitha. Mukunda Sharma.. 746 pgs. Sanskrit. 439 pgs.. Yajna Valky Smtuthi.. .. 162 pgs. Religion.. Sanskrit. Paraaditya. .. Sanskrit. Unknown. Philosophy. Religion.. Yagavasista Vuthu Paryay Prakasika Part 4. Language. 529 pgs. Yekankavalih. Maiva Ram Kattara Padka. 1936. 598 pgs. Acharaya Ram Kishore Misra.. Sanskrit. Umesh Chandra Pandey.. Yogachintamani Ki Anukramanika. Yatidhara~masan'grah Grantha 60. Sanskrit. . 0.. sanskritdocuments. 1864. 246 pgs. Bhat't'a Daamodara. Srinivasadasa. Sanskrit.. Philosophy. Philosophy. 1981. Yajura~vediiya Maitraayand-ii San'hita. 204 pgs..t. Yajnavaikya Smrti. 1924. 1954. 1953. 1956.. 0. Sanskrit.. .. 1945. 508 pgs. Philosophy-22. 266 pgs. .k... Sanskrit..org/…/SanskritIIIT... Sanskrit. Sanskrit. Unknown. 600 pgs. 101 pgs. Kesava Rao Sarma.. 748 pgs. 124 pgs. 1951.. .

. 854 pgs. Language. 1932. 1917.. Linguistics.… 92/167 .. Language. Sanskrit.. 183 pgs. aanandamaalaa. Yogi Nihrdayam. Language.. Jaggu Venkatachari. appayyadiikshita. Language. 1961.. Literature... 1979. aadipuraanama.k... Pandit Navya Chandidasa. Philosophy. 1909. Linguistics. Unknown. Sanskrit. aagamapraamaand-yamu. 1937. Yogavasista Vol 1. 1953.. Sanskrit. Literature. Sanskrit.. 1908. LINGUISTICS.. 346 pgs. Gandhi. Social Sciences.. Literature.. 1950. 1888. 172 pgs. 244 pgs. Linguistics.. 98 pgs.. Sanskrit. khemraj sri krishna das. Yougachikithsa Indication Of Drugs. Linguistics. Linguistics. Sanskrit. Religion. Sanskrit. aagamarahasyamu vaatulashuddhaaravyamu. Unknown. 1964. Sanskrit. 1915. Language. LITERATURE. 1067 pgs. Art. miimaan'sakashriiniilakan't'habhat't'a. Linguistics. Sanskrit. Sanskrit. Philosophy. Literature. Sanskrit... 220 pgs. Sanskrit. 440 pgs... 1943. Sanskrit. Youginithantr. Social Sciences.org/…/SanskritIIIT. Literature. a sanskrit reader. 1970. aadunika san'skrxta naat'aka nae tathya nayaa itihaasa bhaaga 1.. Language. Sanskrit. Gopinatha Kaviraja. Yogavasisht Bhasha. Shriibhoja Mahaaraaja~. 526 pgs. Literature. Sanskrit... Linguistics. aahnikapaddhati. Theology. Unknown... Sanskrit. Linguistics.. Not available. Pandit Dinanad. Kesav Srinivasulachari Kati. Yuddhakandam Part Ii. Bannanje Govindacharya. Literature. 0. Ravi Varma. Religion. Unknown. gurucharana. 0. Language. Literature..padmanaabha. 740 pgs.2/14/2011 A list of scanned Sanskrit books at III… Yogavashishtahah Panchama Bhaga. 248 pgs. aanandaashramasn'skrxtagranthaavali gran'nthaang-ka 70.. Sanskrit.. Language.. yamunaachaarya svaami. Yogavasishtu Dwithiya Bagamu. Yukthi Mallika Guna Saurabham. Sanskrit. Sanskrit. Sanskrit.. 105 pgs. aadaitabrahmasid'i. Sanskrit.. Unknown. Literature. Language.. 1929. Sanskrit. aagniveshyagrxhyasuutramn. 456 pgs. 1089 pgs. Sanskrit. Yukttikalpataru. aachaarendu. edward delavan perry. charles rockwell lanman. 0. L. 319 pgs. p. 352 pgs.. 1983. Yogini Jatakam. 0.m. Linguistics..a. Theology. Sri Krishnupanthshakina. Linguistics.. Sanskrit. 408 pgs. Unknown... Sri Pahvadatthareya Sastri.. 576 pgs. Literature.. Vasu Deva. 1979.. Linguistics. shriidharaachaarya. aabhaarapradashainamu.. Philosophy. 1912.... Bhagavadgita. 1940. Language... 321 pgs. Sanskrit. Sanskrit.. 288 pgs.. 1932.m. Ganga Vishanu Sri Krishana Dasini. Sanskrit. aanan'dalahari No. 268 pgs.. aagamashaastramu gaud'apaadiiyamu. 100 pgs. Language.. Sanskrit.m. . 1500. a consolidated glossary of technical terms. 370 pgs.. Yudhishthira Vijaya. 1614 pgs. 40 pgs. Sanskrit. Literature. a sanskrit composition and translation manual.2. Language. Linguistics. bhat't'aachaaryend-a vidhushekharend-a... 0.. raamajii upaadhyaaya. sanskritdocuments. Aathrideva Vidhyalanker. 0. 906 pgs. a sanskrit primer. 142 pgs. LANGUAGE.. 392 pgs. 1987.. Language. Shri Krishna Patna Shasthri. 0. 172 pgs. Literature. Philosophy. Sanskrit. Literature. Sri Madra Namikmaharshi.. 0. aachaaramayuukha dvitiiya. Linguistics. pandit sarada prasad bidyabhushan..

1970. r.. shriimanmuraarimishra. Linguistics. Natural Sciences. Bhattacharya. Sanskrit. Language.. Psychology. Language. Sanskrit. Sanskrit.. S. 1953.. 1931. suryanarayana.. Sri Bhavani Shankara Sharma. Sanskrit. aatha sankhya darshana bhashanuvaada. 1930... Sanskrit. Linguistics.. Literature. 0.2/14/2011 A list of scanned Sanskrit books at III… aanandamathaadhikarand-amaaramya pradhaman' paadan. aaryabhadt'iiyam'of Aryabhattacarya Part 1 gaanitapaada. D. Language. 0.. aang-agatvanirukti naama prabandha etatpustakan. 228 pgs. Sanskrit. Sanskrit. Sanskrit. haradatta mishra. Language. 340 pgs. aashvalaayaniiyaguhaasutraand-aa suchiipatramu. Literature... Literature.. Sri Ganapathi Sastri.. 513 pgs. T. not availabe. 340 pgs. Brahmasri Subrahmanya Suri... Philosophy. Linguistics. 216 pgs.. Literature. n. aangiirasasmrxtii. Linguistics. 270 pgs. Linguistics. kapardisvaami. 1944. Theology. aapastambiiya dharmasuutramu.. Language. 0. aarogyachintaamand-ii. 370 pgs. aashvalaayanagrxhyasuutran' shriiharadattamishravirachita anaavilaakhyayaa vrxttyaa sametn. Sanskrit.. Linguistics. 1951. 1898.. Literature. Srinivasachar. . 314 pgs.… aatma kathaa prathama khand-d'a mahaatmaa gaan'dhii General Sanskrit 0 421 pgs 93/167 . Literature. aaryemanju qs-imulakalpa tuutiyo bhaaga. Language. aanandananandinii. 1933. 1932. 76 pgs... 1940. aatakam. Linguistics. Ganapathi Sastri. aapastambasulbasuutran' kapaaradibhaashhyend-a karavindi sundararajavyaakhyaabhyan' cha sahitan. Religion.... 1928.. Language. Science. aapastambadharmasuutramu. aashvalaayanagrxhyasuutran.. 814 pgs. 1893. aaryemanju qs-imulakalpa prathamoo bhaaga.. 1922. Sanskrit. Linguistics. 196 pgs. Sanskrit. 130 pgs. Sanskrit.viswanatha Sarma. 1933.. sanskritdocuments....... Literature. Literature. Sri Ganapathi Sastri. aapastambaparibhaashaasuutramuu. Sanskrit. Sanskrit.. -. 233 pgs. aapastambhagrihyasuutra anakula tatparyadarshana. aapastambiiyam' shraotasuutram.. 1924. 278 pgs. 472 pgs. Sanskrit. T.. 318 pgs. Sanskrit. Sanskrit. 742 pgs. Literature..mlampalli Chandra Sekhar Sarma. Language. Linguistics. Literature.org/…/SanskritIIIT. . r... Sanskrit. Religion. Sanskrit. Yasneswara cimana Bhatta.. aaryemanju qs-imulakalpa ddhitiiya bhaaga. Linguistics.. n.. Literature. 1923. 1970. 0. 1920. Sanskrit. 130 pgs. mahaadevashaastri. Linguistics. not availabe. Language. Linguistics. Literature. 90 pgs. Sanskrit. Sanskrit. Linguistics.. aapastambashulbasuutramu. 122 pgs. suryanarayana. 236 pgs. aasechanakaraamaayand-amu. aapastambiiya dharmasuutramu. Theology. Literature. d srinivaasaacharya. Religion. Linguistics. 402 pgs. Sanskrit.. Language. Language. 1973. Language. Language. Ganapathi Sastri. . Language. Sanskrit.. aapastambadharmasuutramanj-jarii. Linguistics. e. aaryaividhaasudhaakaran. Literature.. Language. 177 pgs. 307 pgs. Literature. 373 pgs. Narasimhachar.. Ganapathi Sastri. Language. 1909. Dr. 0.... Sanskrit.. T. Pandith Sri Seetharam Bhakruth. Literature. Unknown. Linguistics. 1931. 308 pgs. Science. a n krishna aiyangar. Sanskrit. aapastambadharmasuutramanj-jarii.

. 561 pgs. Lakshmidhar. Linguistics. bhagavatiprasaada vaajapeiyi. pan' ramaakaanta jhaa. 438 pgs. Sanskrit.. Sanskrit. Philosophy. 1926. pandit shri bellakonda ramaraya kavindra.. abhilashhitaayrachintaamand-i. adhikarand-asaaraalalin.. 0. 100 pgs. 268 pgs. 1942. 829 pgs. 276 pgs. Language.. Sanskrit. Psychology. 0... 1969. Language. Linguistics. 1926. Literature.. virachitayaa. 216 pgs. Language.. achala meraa koii. 1630. addvatamaatend-d'a. Linguistics. 158 pgs.. Sanskrit.. Linguistics.. vendaachanalaala. abhijnana sakuntalam of kalidasa.. LINGUISTICS. General.. Language.2/14/2011 A list of scanned Sanskrit books at III… aatma kathaa prathama khand d a. Sri Udayana.. LANGUAGE. 1926.. Religion. 1875. Literature. aatmoduugaara. Sanskrit. LINGUISTICS. shrii kaasinaatha dviveidi. Sanskrit. Religion. 385 pgs. 2000. 242 pgs. Sanskrit. LANGUAGE. Literature. Literature. 1948. 1972. 0. 440 pgs.. Literature. diipikaa ghosha. 1934. Sanskrit. 1926. Sanskrit. 1925.. 92 pgs. Language.. Philosophy. Language. Sanskrit. Language. abhiraajasahastrakamu. Psychology. 498 pgs.. 1957. abhinava san'skrta pravesha. 1895. abhinava chandrikaayaamu... Literature. R. 131 pgs. 161 pgs. sanskritdocuments. 72 pgs. abhilekhamaalaa vishvavidhyaalayapariqs-aanirdhaarita abhilekhasan'graha raama hindiivyaakhyopetaa. Literature. mukula bhatta. aavyamimaan'saa. Philosophy. abhijnaashaakuntala.… adhikarand asaaraavali shriivand shat'hakopashriilaqs 94/167 ... 1916. Literature.. 336 pgs.. aatmatattva vivekaa. 142 pgs.. Psychology. abhinava vikrutivignaana.. Not available. LANGUAGE. Literature. Sanskrit. Sanskrit. ven'kat'a subramand-ya shaastri. Sanskrit. 154 pgs..org/…/SanskritIIIT. Philosophy. LITERATURE... Sanskrit. Sanskrit. aayaisaptashati. ramanath jha.. someshvaradeva.. 288 pgs. Language. Unknown. Sanskrit. 1926. Linguistics. 0..... Sanskrit. 174 pgs.. 440 pgs. adhikaarand-a saaraaval'i. ma shri deshapaan'd'e.. vaidha yaadavaji trikamaji aachaaryai.. 421 pgs. Sanskrit.. 136 pgs. LITERATURE. Sanskrit. Linguistics. abhidhaavrittimaatrika shabdavyaapaara vichaara. Sanskrit.. aatmatattvaviveka. Kumaravedantacharya. Sanskrit. abhilaashhitaarthachintaamand-i prathamabhaaga aadita trxtiiyaprakarand-antamu. Language. Literature. LITERATURE. 1984. Sri Ananta Krishna Sastri.. 1973. General.. Literature. Linguistics... Satya Nidhi Theertha. kalidasa. abhinana shakuntalam. Technology. Linguistics. Literature. shriigovadhainaachayai. Sanskrit. Technology. 1973.. Sanskrit. 428 pgs. 62 pgs. 296 pgs. Linguistics. 42 pgs. Literature. Language... aayurveidamahoodadhau annapaanavidhi.. Theology. Religion. Sanskrit. 238 pgs. addvataamakaranda. 1944. Linguistics. adhikaara kaa prashna.. soomeishvara deva... Theology.. srimad vedaanta desikulu.. Language. Triveni Kavi. Psychology. abhilashhitaartaaryaichintaamand-in.. Sanskrit. 1974. abhaavavimarsha. Sanskrit. Sanskrit. ad'agatvanirukitan. Murari Mishra. adbud vijay. Sanskrit. 0. LINGUISTICS. addvatatarand-i. Sanskrit. Sharma Sastri. Sri Natesh. 1950. Linguistics. mahaatmaa gaan dhii.. 1926.. Literature. Rajasekhara.

Literature. Literature. 44 pgs. advaitaamoda. Not available. Sanskrit. Sanskrit. advatatatvasudhaa prathamoo bhaaga. 1915.. Not available. Linguistics. 445 pgs. Psychology.. 0. vaasudevashaastrii. 0.. advaitibhraan'tiprakaasha. Linguistics. Language. 842 pgs. 0. Narayanasrama. advatadipikaa tutiiyo bhaagan. 1915.. Literature. Philosophy. Linguistics. Theology... Sanskrit. Philosophy. 617 pgs. Literature. Sanskrit. Social Sciences. 0. 0. Theology. Sanskrit.. Literature. 678 pgs.. 1927. 0. adhyaatmapat'alamam.. 1960. Literature. advaitasiddhi trxtiiyaasamput'amu. adhvaramiimaan'saa kutuuhalavrxtti. advaitaanyamatakhand-d'anamu. Sanskrit. advayavajrasan'graha. shriimatparamahan'samadhusuudanasarasvatii. advaitaaqs-aramaalikaa. Literature. Sanskrit.. 491 pgs. Religion. 487 pgs. 1987..… agamakoshaa dvadasho bhaagan S k ramachandra Rao History Sanskrit 1994 402 pgs 95/167 ....... 118 pgs. Narayana Sharma. adhyaatmakalpadruma adhirohand-iit'ippand-isahita. 1962. Not available. Linguistics. 1937. Sanskrit. Sanskrit.. Language. 1893. 1933. advaita siddi Vol. Linguistics. Sanskrit. Not available. 252 pgs.. Sanskrit.. Mahamahopadyaya Hariprasad Sastri.. Literature. Psychology. Linguistics. 77 pgs. Language. 0. shriimunisundarasuuri. Religion. Sanskrit. 1984. Not available.. 1960. Language. advaitasiddhi mithyatvamithyaatvaanto bhaaga. Language. Not available.. Sanskrit. advatasiddhaantasaarasam'grah.. Linguistics. 386 pgs. Language. advatadipikaa dhvitiyo bhaagan. Language.. advaitamanj-jarii brahmavidhyaabharand-amu. Sanskrit. Linguistics. Language. Language. Religion. 204 pgs. 78 pgs. 0. Language. 92 pgs.. Sanskrit... Literature. advatadipikaa.. Narasimha Sarma. 891 pgs. 250 pgs. 396 pgs. sanskritdocuments. Sanskrit. Not available. advatatatvasudhaa dvitiiya bhaaga.. Sanskrit. vidvan s narayanaswami shastri. Literature..... Literature. Sanskrit.. 302 pgs. Linguistics. adhyaatmaraamaayand-amu.. Not available. 1997... Sanskrit. Literature. 882 pgs. Chintamani. Literature. I. 1939. Philosophy. advaitibhraan'tiprakaasha. Sanskrit. Literature.. Sri Ganapathy Sastri. Not available. d'aa bii gopaalared'd'ii. Linguistics. Religion. 120 pgs. Linguistics. Sanskrit. Language. Linguistics.. 362 pgs... Sanskrit. Ganapathi Sastry. 373 pgs.... Literature. 120 pgs.. Psychology. Language. 660 pgs. 1969. shriivand-shat hakopashriilaqsmiinrxsin'vashat'hakopayatiindramahaadeshikaa. Language. Sanskrit. Sanskrit. advatamajjarii nyaayaraqs-aamand-in.. advaitasiddhi guruchanddrikaasavyakhyaayasamalang-krxtaa dvitiiyasamput'amu. 524 pgs.. 99 pgs. advaitasiddhi. Literature. Linguistics. shiromand-ishriimadhusuudanasarasvatii. shriinivaasaachaari. Pandit Anantha Krishna Sastri. 0. 1946. Sanskrit.. Sanskrit. Literature. Art. Language. 1935. advatatatvasudhaa prathamoo bhaaga.. Linguistics. Linguistics. advatacsiddddhaantagurucchandrikaa.org/…/SanskritIIIT. 92 pgs. advaitasabhaasuvarnd-amahotsave. advaitadiipikaa dvitiiyobhaaga.2/14/2011 A list of scanned Sanskrit books at III… adhikarand-asaaraavali. Language. sri Paramahamsa perivrajaka Chandrikacharya. Theology. d'i.. Sanskrit... Sanskrit. guruchandriikaa. Linguistics. adhikarand-asaraavali.. Religion. 1940. Theology. Language. 1928. Literature... 195 pgs. 1905.

1937. 236 pgs.. Language.. Acharya Satyavrata Samasrami.. parakaalasan'yamiindrai.. 884 pgs. Linguistics. Literature. 302 pgs. Linguistics. Sanskrit. 104 pgs. Literature. 874 pgs. 1929. Linguistics. Sanskrit. Sanskrit. vinaayaka gand-esha aapat'e.. Literature. aitareyabraahmand-amam. Language... Sanskrit. 1921.. Linguistics. amrxtavaand-i. Language. Literature. 1917. 1956.. 321 pgs. aitareyaalochanan. ajit' gaamaa Vol. Sanskrit. aitareyabraahmand-a. 358 pgs. Sanskrit. Literature. Linguistics. Language. Maharshi Vedavyas. Sanskrit. alang-kaaramand-ihaara trxtiiyobhaaga. 1916. Literature. 1942. shriikrxshhnd-abrahmatantraparakaalasan'yamindai. Not available. Literature... Linguistics. 1923.. d'urghaprasaada.. ananthabharathi.. Sanskrit. 386 pgs. 1957.ramachandra Rao. 540 pgs. 1977. aln'kaarakaustubhamuu. 312 pgs. LANGUAGE. mahaakavikalyaand-amalla. yashapaala. Linguistics. agnihotrachandrikaa. 750 pgs. agnipuraand-amu vedikaa.. Vishvanatha Balakrishna Sastri. agnihotrachandrikaa vaamana shaastri krxtaa. Language. 230 pgs. anargharaaghavamuu. yan. Sanskrit. Literature. L.. amarkosh. dr. shiivadatta. Sanskrit.ravi Varma. Sanskrit. 100 pgs... Literature. Not available. Sanskrit. 443 pgs.k. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… agamakoshaa dvadasho bhaagan. Literature. Linguistics. ambikaalaapa umaalaapa. Religion.. ananthakrishna sharma.. 1968... alang-kaaramand-ihaara dvitiiyobhaaga.. Linguistics. Haragovinda Sastri. LINGUISTICS. Linguistics. 1958. Language. amarakoshhan.. Linguistics. Sanskrit. Language. Language. aitareiya brahmanama.. 512 pgs. Sanskrit.. bhat't'a. Linguistics. Sanskrit... Baba Sastri Padake. Sanskrit... Not available....aar. Sanskrit. Sanskrit. Linguistics. 1921. Sanskrit. LITERATURE.... Literature. Literature.. Literature. shriikrxshhnd-abrahmatantraparakaalasan'yamiindrai. History. Sanskrit. 1968. 0. LANGUAGE. 54 pgs. Language. Language. not available. Religion. The Arts. Sanskrit. Language. en' . pro laqs-mand-adata gautama. 1973.. 1944. Theology.... Literature. LITERATURE. Sanskrit.. 1937. Linguistics. LINGUISTICS. Language.. Language. 139 pgs. an'bigara chaud'ayyana vachanagal'u. LANGUAGE. Language. amitaa. Linguistics. 0. 1967. Sanskrit. 402 pgs. Sri Mathsayana Aacharya. Literature. 238 pgs. agniveshyagruhaasutre. Literature. 505 pgs. Jinvijaya Muni.… 96/167 . Language. r.. vaamana shaastri. 30 pgs. aitareyabraahmand-a. Language. 39 pgs. 1921. Language.. aitareyaarand-yakan. akalanka grandhatrayamu.. Literature. LITERATURE. 1898. Sanskrit. alang-kaaramand-ihaara prathamo bhaaga. Literature. 1994. 226 pgs. banerji projesh. 0. jiivana. 0.. Sanskrit.. 550 pgs. alang-kaaramand-ihaara chaturtho bhaaga. Sanskrit. Literature..org/…/SanskritIIIT. sanskritdocuments. Linguistics. shriikrxshhnd-abrahmatantraparakaalasan'yamindai..ii.. 732 pgs. Language. S. 1906... 1898.. 222 pgs. Sanskrit... Linguistics. Linguistics.a. Literature. anang-garang-ga kaamakalaa hindiivyaa gopaniiyama. 306 pgs. an'cdhaa yuga samiiqs-a. 1940. History. LINGUISTICS.

shriimadvallabhaachaarya... anubhuutiprakaasha.. Literature. 0.. Sri Ganapathy Sastri.. 143 pgs... Sanskrit.org/…/SanskritIIIT.. arthasamgraha. A. 139 pgs. Language. shri laugakshi bhaskara. 194 pgs. 291 pgs. apastambagrxhyasuutran. suryanarayana shastri. Theology.… 97/167 . 438 pgs. arya san'graha. Linguistics. Sanskrit. 504 pgs. 274 pgs. Sanskrit.. 1985... 182 pgs. 1912.. asatmatattvodhyotaprakarand-amu. Language. Sanskrit. Sanskrit... aramelakalanidi. Religion. Literature. Athridev Gupta.... Sanskrit. 1844. andhradesiahasyakatha. anubhuutiprakaasha. Sanskrit. Theology. archaavaatara vaibhavam. Literature. 789 pgs. Linguistics. Literature. 0. shriimadvaagbhat't'a. Language. Sanskrit. Ramaswami Aiyar... 400 pgs.. Sanskrit. and-ubhaashhyamu.. 0. 92 pgs. 258 pgs. Literature... Sanskrit. ashht'aaadashapuraand-aparichaya pauraand-ikaprabhaaparishiilanamu. Language. Sanskrit.. Literature. Religion. Not available. 88 pgs.. 1964. Religion. 1950.. 1998. Linguistics. 1983. Language. 1935. raajya jyootishhi pan' devaraaja jii. Religion. Theology. Literature. Literature. d'aa shriikrxshhnd-amanditripaat'hii. 0. 252 pgs.. Lakshminarayana.p. Religion.. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… 399 pgs. 145 pgs. vaachaspatii upaadyaaya. Language. andhra baghvath parimal. 0... Language. Yudishtar Mimamasat. Theology. george buhler dr. 1990.malledevaru. Sanskrit. anyottayullaasan. Sanskrit.. Literature. 346 pgs. pandit r v krishnamaachaarya. Sanskrit.. Literature. Literature. Sanskrit. acharya hema chandra. Not available.. 320 pgs. aparoqs-aanubhuuti savyaaravyaa... Not available. 1915. 1932. 432 pgs. Religion. 142 pgs. Sanskrit.. 1985.... 448 pgs. Sanskrit. charu deva shastry. Linguistics. Sanskrit. Social Sciences. Linguistics. asalii tejii mandii sat't'aa. ashht'aan'gatddadayamu suutra shariira nidaana chikitsaa kalpa uttarasthaanavibhaktamu. ashht'adashapuraand-a darpaind-a. Theology. shriimadvidhyaarand-ayasvaami.. 138 pgs.. Philosophy. ashht'adashashmutuyahan. Language.. Psychology. 0. . H P Malledevaru. Sri Laugakshibhaskara. Linguistics. Literature. 1955. 871 pgs. 292 pgs.. 258 pgs.. Language. Sanskrit. Linguistics. Linguistics.. 459 pgs. 254 pgs. 1951.. 1921. Sanskrit. 312 pgs. ashht'aadashasmrxtaya ang-gira aadi 18 smrxtiyon' kaa san'graha. 1929.... Religion. Unknown. Sanskrit. Literature. Linguistics. 1932. 1925. 82 pgs. Religion.. varnasi ramamurty renu. Language. Sanskrit. Athridev Gupta. 1964. Sanskrit. Sanskrit. . ashht'aadashapuraand-a darpand-a.. Religion.. Religion... H. Sri Vidyaranya. ashht'aad'asagrand'aha. Sanskrit.. anekartha sangraha. ashht'adhyaayii bhaashhya pradamaavuti. Theology. Language. Philosophy. 2002. Chinnaswami Sastri. General. apastamba s aphorisms. 672 pgs.. 1980... Sanskrit. Psychology. ar^thasan'graha. Sanskrit. arpand-a patrikaa. anuvaad kala. Sri Krishna Tripati. Not available. 1928.. Literature. 224 pgs. 1931. Sanskrit.. ashht'adashapuraand-aparichayan. Linguistics. Linguistics. sanskritdocuments. Sanskrit. ar^thashaastram' Part Iii. anubhaashya baalaboodinii bhaaga 2. 1926.

a.. 1867. Sanskrit. Linguistics... Literature.. atha kalikaa puraand-amu. Literature. 0.... Religion. Acharya Sri Pandith Laxmanlal. 558 pgs... Sanskrit. Language. . 0. 95 pgs. Sanskrit. atha shriibhaavataat'appand-ii satyadhamayan'tikrutaa. . H. 1983. Ramachandra Savath.. Sanskrit. Theology. H. atha dugaipaasanaakalpadgumaavishhayaanukramand-ikaa. 0.a.. atha saamaanyakakqs-and-aa prakarand-amu. Religion.. ashtajai bhashya pradamavruti. vagbhatta... 621 pgs. Literature.. atha pramaand-apudvatan. Literature. 474 pgs. 1929. Sanskrit. Language.org/…/SanskritIIIT. 1892. Linguistics. atha pradhamamudrand-akaalikiiprastaavanikaa. Somraj Krishna Das. Sanskrit. . . Theology. Linguistics. 1936. Language.g.. atha shraamadbhagavataan't'oppand-ii man'danan'diniisaptaman' sn'kadhan. Sanskrit.r.. 1858. Language. Sanskrit. Sanskrit.… 98/167 . 1968. Somraj Krishna Das. atha gurubhavaprakaashikaa rukminishaa vijayamu. Linguistics. astaangahridaya.. Sanskrit. 0. 1146 pgs..2/14/2011 A list of scanned Sanskrit books at III… ashht'apraasashatakatrayamu. 1929. 0. Somraj Krishna Das. -. ... 195 pgs. Religion. 0. 0.. Literature. 379 pgs. kaviraj shrii athrii dhev guru. asvasastram. atha govidrchanaa chandrikaa. Religion.. Somraj Krishna Das. ashtangahridaya. 1929. . . Treble. Linguistics.. Sanskrit. Language.. not available. 1867. . atha shriikaashakhid'an' puvaathai. Treble. 258 pgs... Sanskrit. atha pradhamaadi chaturdaishaadhyaayaanaan.m. 602 pgs. Treble. sanskritdocuments.. Ramalingam. Sanskrit. Sanskrit. atha jaatakaabharand-an' praarabyate. 213 pgs. Literature. Language. atha bruhjjyaatishhaand-aivaishhashht'omishhrasakandhochakaavalisan'grahaa. atha shriikaalalokprakaasho ashht'avishatitaman. Language. atha maanasasaqs-aipaddatii. Not Available. . Sanskrit.. 0. 342 pgs.. Sanskrit.... Theology. 1948. Sanskrit. 1917. .. Literature. Sanskrit. 466 pgs. Sanskrit. 1950. 0. not Available.. Literature. Sanskrit. dr p srinivaasarao... 311 pgs. . . Sanskrit. Sanskrit. 0.. Sri Krishna Das.. asvaalayaana gruhama suutramu. atha kaasi khandaa dhvitiyo bhaagan... Sanskrit. Sanskrit. Sanskrit. 1939. 974 pgs. . 278 pgs. . 810 pgs.. 279 pgs. Somraj Krishna Das...a.. Linguistics. Sanskrit. Sri G Ramaswami Sastrigal. Savanur.. atha shriibhaavataat'appand-ii satyadhamayan'tikrutaadvadaso kandhan. 196 pgs. 1962. 512 pgs. Linguistics. Literature. . 177 pgs.. Sanskrit. 267 pgs. Sanskrit. H. 348 pgs. Literature. atha shikqs-aadiveidaang-gachatushhuta praaran'bha. Sanskrit. 1960. atha shraamadbhagavataan't'oppand-ii chet'tityaakhyaa. vaagbhata. . 630 pgs. 638 pgs. Language. 0.. Literature. 146 pgs. Technology.. 156 pgs. Sanskrit. . atha kiiraanya keshoyammatrasamhitaa. 0. Linguistics. Religion. atha haayanarantapurvaihai. 0. Theology. atakam. . . Literature. Unknown. ashtan'daghadhyaayam.... 46 pgs..... 254 pgs.. Theology.. 0.. 800 pgs. atha krumaimahaapurand-an. 338 pgs..

r.. Literature. 475 pgs. athaa hymaratanaa baalabhaadraa. . atha shriimudgalpuraand-an.. Sanskrit.. H. . Sanskrit. Sanskrit. athabrahaapuraand-asithatavishhayaanukramand-ikha. 0. General. atha shriimannyaayasudhaa.. Linguistics. athaaprabdhanoyaanamimaan'saa. Linguistics. 0.. Language.2/14/2011 A list of scanned Sanskrit books at III… atha shriimadbhagavadgiitaa. athashriimadgagavatat'ippand-ii yadupativirachitaa ekadaso skadhan. 0.org/…/SanskritIIIT. . Sanskrit... Sanskrit.g.. 1957. Religion. Treble. Shankar Panduranga Pandit. . Theology. .. athamn'tramahodadhit'okaanokaayan'trasahita. Literature. 1860. 0. Not available. . Linguistics. atha shriimannyaayasudhaa. Sanskrit. not available... 206 pgs. 0.. Literature. .. 620 pgs.. atharvaipraatishaakhayamu. 370 pgs. . 327 pgs.. 0.. 184 pgs. atharvaveida san'hitaa rxshhyaadi savalitaa.. saayand-aachaarya. 64 pgs. Sanskrit... 41 pgs.. Literature. Linguistics. atharvaveda san'hitaa. 600 pgs. . 190 pgs. sanskritdocuments. Language.. 0. Literature.. Sanskrit. 627 pgs.. 0. Religion. Sanskrit. 0. 0... Religion.. Sanskrit. 398 pgs. Surya Kantha.. Savanur.. Theology.. 484 pgs. atharvavedasan'hitaa bhaaga 3.. Literature. Sanskrit. Sanskrit. 0. 1963. Sanskrit. H. 554 pgs. Language. 342 pgs... 538 pgs. 352 pgs. Not available. Linguistics. 353 pgs. 565 pgs.. Treble. Sanskrit.. Savanur. athabrahaasutrabhaashhyan.. .. 0.g.. Literature. Sanskrit. Sanskrit. . Literature. 88 pgs. . Sanskrit. Treble. 390 pgs. 0. Sanskrit. 0. 1929.. Sanskrit.a. atha shriimadhbagavataa vijayadavaaja ekaadasobhaagan. Sanskrit. .. H. Gangavishnu amp Khemaraj. 856 pgs.g. atha shriimadhyaayasudhaat'ippand-i. Sanskrit. Literature. athashriibhaagavatat'ippand-ii t'ikaa shriidharaa. 1898.. 197 pgs. 258 pgs. 1929. Literature. athashriibhagavathat'ippanii karmakat'ikaa vijayavaad'aa tirtaa trayodase kandan.. atharvaveda san'hitaa. krishna Das... 1093 pgs. athashriimadgagavatat'ippand-ii yadupativirachitaa chatuthai skadhan. 1939. Sanskrit. saan'tabalekarakulajena daamodarabhat't'asuununaa shriipaadasharmand-aa. athashriimadgagavatat'ippand-ii shriinivaasatiithaiyaa ekaadashan..r. Sanskrit.… 99/167 . Literature. Sanskrit.. Sanskrit. 0. Literature. Language. saan'tabalekarakulajena daamodarabhat't'asuununaa shriipaadasharmand-aa. atha shriimannyaayasudhaa. Religion. 1989.. athaitareyopatishhatu. Literature.. athabadariimaahaatmya. Sanskrit. 1959. Sanskrit. 579 pgs. Sanskrit.. . Literature. 1929. 1860. atharvaveida san'hita. 1929.a. Treble. Language.. 1858. 549 pgs.. Theology. 1898. athashriibhaagavatat'ippand-ii satsadhamaikrutaa. H. . atha tatpurushhaprakarand-amu.. Language.. Venkatachala Sastry. sadaachaara. atha shriimadbhagavate ashht'amaskan'dhan. .. Linguistics.. Literature. Language. Sanskrit. Somraj Krishna Das. 1858. atharvaveidasan'hitaa bhaaga 4. Linguistics. .. Sanskrit. Sanskrit.. Linguistics. . Savanur. 460 pgs..a.a.r... Language. bhat't'aachaarya. .. 203 pgs.. 342 pgs. 0. athamn'tramahodadhigranthasyasyaivashhayaanukramand-ikaa.k. . saayand-aachaarya.. atha shriimadvagavate dvadashaskan'dha. 395 pgs.

Sanskrit. 1985. Sanskrit. 351 pgs. 1940. avadaanakalpalataayaa mand-ichuud'aavadaanan' naama trutiiya pallava. Religion.. 0. Religion. Jithendra Bajaj. shrii machchhang-karaachaarya. shriimadamarachandrasuri. 1869. Religion. athavaiveda san'hitaa trutigo bhaagan.. 0. d. K Vasudeva Sastri.t. baalabhaaratamu.. Literature. 1957.… 100/167 . Sanskrit.. Theology. THEOLOGY.... 171 pgs. 77 pgs. 1996..r. 856 pgs. 515 pgs.joshi. bhaamatii brahmasuutrabhaashya katusuutri. Religion. Art. Shankar Panduranga Pandit. Sanskrit. Literature..l. Acharya Mukunddevagya. -.. krishna Das. athashriimadgagavatat'ippand-ii yadupativirachitaapanchamo skadhan. ayurveda bhashym panch khandm.. Literature.. govindadeva. shriiabhinavakaalidaasa.. binod lall sen. Goswami. Literature. baalabodha san'graha. Technology.. Philosophy.org/…/SanskritIIIT. Religion. 1936. Religion.. athavaivediiyaa poppalaada san'hitaa navii kaandaa. athavaivediiyaa poppalaada san'hitaa ek kaandaa. Sanskrit. Sanskrit. Language. Raghu Veera.. athavaiveda san'hitaa pehalaa bhaagan.. 142 pgs.joshi. Sanskrit.. 2000. 358 pgs. Sanskrit. Literature. shriigang-geshopaadhyaaya. 1908. Linguistics.. Religion. 1959. 2000. . 323 pgs. Linguistics. 1973.. athashriimatryaayaamutodhvitiyan'parichchhaidan. Krishnacharya. 1894.. sanskritdocuments. Sanskrit. RELIGION. ayurveda vijnanam. aachaarya dand-d'i. Language. Linguistics.. athashriimatsayapuraand-akramaand-ikaa. 1901. Sanskrit. Theology. bahudarmaipuraand-amu. 34 pgs. Literature.. .. K. baadhan.. t.joshi. 2000. Sanskrit.. athavaiveda san'hitaa. athavaivedasan'hitaa tisaraa bhaagan. P Beniram Sarama Gaup.l. 0.. Sanskrit. . avantisundarii.. Sanskrit. 675 pgs... 810 pgs. Linguistics. Language.. Religion. . Not available. aumaapatamu.. Language. 2000.. Literature. 1916.. 257 pgs.k. avmanjari. 26 pgs. Religion. 1929. 170 pgs. Sanskrit. Sanskrit. 284 pgs. Language. mahaamahoopaadhyaaya shriigadaadharabhat't'achaarya. 1908. avayava diidhityaa diidhitiprakaashikamu. 126 pgs. 122 pgs. Literature.2/14/2011 A list of scanned Sanskrit books at III… athashriimadgagavatat'ippand-ii yadupativirachitaa trutiyo skadhan. 122 pgs. Not Available. Linguistics.. Sanskrit.l. 0. vaachaspati. Sanskrit. Sri Raghunathasiromani. 110 pgs. Sanskrit. 26 pgs. Linguistics. Religion... Psychology.. bhaamahiiya kaavyaalang-kaara udyaana vritti.. K.. Technology.. Raghu Veera. Theology. 644 pgs. Sanskrit. Unknown.. 613 pgs. 447 pgs.. Sanskrit. 1985. Sanskrit. Linguistics. Sanskrit... Sanskrit. Sanskrit. avataaravaadaavalin' pradamo bhaagan. 1989. 727 pgs. Sanskrit. 298 pgs... 351 pgs. 0. .. Sanskrit.. Language. baalaraamaayand-aannama. atran' bahu kurviita. 1934.. Sanskrit.. 1954. 1933.. Linguistics. Religion... Literature. Panduranga Pandit. 639 pgs.. Sanskrit. 672 pgs. Language. K. tataachaarya siroomani. Sanskrit. Sanskrit.... 0. Language. athavaiveda san'hitaa. 590 pgs. 864 pgs. bhaagavatachampuu. Literature. 1977... athavaivedasan'hitaa dusara bhaagan. avachchhedakataaniruktti diidhityaasaha.

Sanskrit. gaanjan chintaman deo.. Linguistics. Sanskrit. bhagadattajalhand-a virachitaa sukttimukttaavalii.. 0. Sanskrit. 70 pgs. Not Available. 1998.. Linguistics. 82 pgs. shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru. Psychology. Not available. bhaavaprakaasha bhaavabodhiniihindiivyaakhyaayopeta.. Linguistics. 0. Language... Not available.. Literature.. 0. Literature. Language. Language. Language.s. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… bhaamatiisamaaloochanamuu. 1951. 230 pgs.. Sanskrit.. Linguistics. 1914... Literature. 1961. 0. p.org/…/SanskritIIIT. Geography. Hari Narayan Apte. 1955. 1280 pgs. Philosophy. 0. 144 pgs. bhaat't'adiipikaa shriimatkhand-d'adevaprand-iitaa.. 708 pgs.. shriijagatraaya. Dravida Rajesvar Sastri. Literature. Language. Sanskrit. bhagavaan daasa.. 0. Literature. bhagavadgiitaa. bhaaratiiyamu athaishaastramu. bhaarata ko janagananaa 1981 part Iii B. History. Venkararaghavan Sastri. shrii gn-aanaanandendrasarasvatiisvaamii. Social Sciences. p. bhagavadgiitaya luupanyaasagal'u eran'd'anaya bhaaga.. Theology. Psychology. 0. bhaarata ko janagananaa 1981. Pachamukhi. Language. Psychology.padmanaabha. Linguistics. Literature.. niilakand-t'habhat't'asuunupand-d'ita. 426 pgs. Biography. LINGUISTICS. bhadranyaka upanishad. Sanskrit. Language. bhaarata chaampuu. Philosophy. Language.. bhaat't'amiimaan'sakaanaan' sarvasvamu shabdapramaand-asya vaishiptyamu. anantakushhnd-a. Language. 432 pgs. Linguistics. Sanskrit. 1913. bhaaminivilaasan. harinaaraayand-a.. bhaashhyaayairatnamaalaa. 1926.. Religion. 206 pgs. Psychology. Language. Literature. 624 pgs... Sanskrit. 1915.. Sanskrit. 332 pgs. Sanskrit. Sri Subramanya.. -.padmanaabha. Sanskrit. Linguistics. Language. 194 pgs.. bhaat't'adiipikaa uttarashhat'ahamam. Sanskrit. 174 pgs.. N. mand-d'anamishra. u krxshhnd-ashaastrii. Linguistics. 156 pgs. Language. 439 pgs..… 101/167 . Sanskrit. Embar Krishnamacharya.. 430 pgs. Literature.. 0. Sanskrit. bhaaratiiya raajaniiti prakaasha. 0. bhaashhyaatheratnamaalaa... bhaashhyagaambhiiyothenind-eyamand-d'anaaraye grantha. Psychology. Language. bhaarata charitra pariikqs-aa.. Linguistics. 1921.padmanaabha. Sanskrit. 902 pgs. Linguistics. 1999. Literature. Sanskrit. 0. 310 pgs. 1936.. Linguistics. bhaavanaaviveka sat'iika. LANGUAGE. 146 pgs.. Literature.. Literature. Sanskrit.. laqs-mand-a sin'ha khanna. 90 pgs. Sanskrit. bhaat't'adiipikaa Part I. bhaaskarodayaa tarkasan'grahadiipikaa prakaashasya vyaakhyaa padavaakyapramaandapaaraavaariind-a. bhaaratiiya vana adhiniyam miimaan'sa. 0.. Sanskrit. Sanskrit. Sanskrit. vaasishht'a gand-apati. Anantha Krishna Sastri. Linguistics.. Literature. Philosophy. Linguistics. Literature. 1921.. bhaashhyaartharatnamaala. Literature. Sanskrit.. 156 pgs.. Linguistics.. 584 pgs. Literature. 1894. Language. bhaarata ko janagananaa 1981. LITERATURE.. 348 pgs. Linguistics. 560 pgs. sanskritdocuments. Literature. p. 300 pgs. Philosophy. Sanskrit. 387 pgs.... Sanskrit... Philosophy... Sanskrit. Language.. 1938. bhagavadanudhaavananaamaa champuprabandha. 0. Literature.

bhasasastrapravesini. bhat't'akalpataru. bhagavadgiyaanasopaanamu. naanyabhupal. Literature. Linguistics... 294 pgs. Literature. 1900. Sanskrit. Language. god'avarti shat'hakopaachaarya.. Literature. Sanskrit. shriikshemendra. Linguistics. Krishhnd-akumaari. 1952. Linguistics. Literature.. tatachary siromani.. Language. Sri Rama Subramanya Sastri. Psychology. Religion. Linguistics. LINGUISTICS.. 0. 580 pgs. 1938. 260 pgs. 1983. shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru. Sanskrit. Philosophy... Language. Linguistics. Sanskrit. bhiimaparaakraman.. mand-d'ikala raamashaastriind-a. Not Available. 0. 120 pgs.… 102/167 . bhagavadraamaanujavijaya gadhyaprabandha. Literature. Sanskrit. 1952. bhavana viveka.. 1898.. Literature. Religion. Sanskrit. Religion. Philosophy... Psychology. Linguistics. Psychology. 2000. Linguistics. d. Sanskrit. 1912. 1999. Literature.. Linguistics. bhagavadgund-adapand-aakhyamu shriivishhnd-usahastranaamabhaashhyamu. Theology.. LITERATURE.. Language. Psychology.. 1934.. 1169 pgs. Sanskrit.. bhat't'ikaavyamu chandrakalaa vidyotinii san'skrxta hindii vyaakhyaadvayopetamu dvaadashaadi dvaabin'shatisarmaparyantamu. Sanskrit.. Sanskrit. Sanskrit. LANGUAGE. bhaktamaalaa raamarasikaavalii.2/14/2011 A list of scanned Sanskrit books at III… bhagavadgiitaya luupanyaasagal'u on'danaya bhaaga. bhat't'ikaavyamu. Not available. Sanskrit. Literature. 1942. sanskritdocuments. Sanskrit. 1914... khemaraaja shriikrxshhnd-adaasa. 424 pgs.. bhedasaamraajyamu. Philosophy. Language. 322 pgs. bhaimiiparind-ayannaama naat'akamu nalavijayaaparanaamakamu. Sanskrit. 420 pgs. Sanskrit. Language. 128 pgs. bhatta bhasha prakash. 1964. bhedajayaqs-i. Sanskrit. bhartrxharisubhaashhitamu. shriimannrxsin'gaashramamuni.. 66 pgs. venkata ramana sastri. 0. Language... Not available.. Sanskrit. 188 pgs. Language. 462 pgs.. Sanskrit... 74 pgs. 96 pgs. 252 pgs. Sanskrit. 96 pgs. venkat'asubrahmand-ya. Language. 84 pgs. Language. bhat't'ikaavyamuu.org/…/SanskritIIIT. Sanskrit.. Linguistics. Psychology. 1271 pgs. bhasa svapnavasavadatta. shriigovindadaasa. shriivatsaangkamishra.. bhamahas kavyalankara. 130 pgs.. Theology. bhakttisudhaataran'gand-ii. 178 pgs. bhedadhikkaara upakaaramapaarkarma vyaakhyaayasahitamu. shrii koliyaalamu svaamina:.. Religion... 282 pgs. bhat't'achintaamand-i. Language. Literature. bhat't'achintaamand-estar^kapaada. The Arts. 1915. Mandana Misra... Sanskrit.. Linguistics. Linguistics. 1934. Sri Visvesvara Siddi.... Literature. 222 pgs. shaataanandasunu. Sanskrit. 71 pgs.. Linguistics. bharatabhasyam part 1 chapt 1 5. bhaishhajyaratnaavalii. Literature.. 1930. 1933. Psychology. Literature.. 0. Language.. 661 pgs. Sanskrit.. Philosophy.. Sanskrit. Language. Linguistics. 1904. g k bhatt ed. 857 pgs. Linguistics. Philosophy. Linguistics... 1961.. Sanskrit. Philosophy. 1957. Language. jayamangalayaa. Literature. shriimadbhat't'i.t. Sanskrit. mahaakavishriibhat't'i. Literature. bharatamajjari. Literature.... Sri Ranga Ramanuja Desikan. Sri Tarkavagisa Bhatta Venidattacharya.. Sanskrit. 511 pgs. 0. -. 1947. 1954. Literature. 670 pgs. 138 pgs. 1914. Sanskrit. Linguistics. Language. Language. bhedasaamrajyamuu vedaantabhaaga.. bhedojjiivana. Theology.

. 324 pgs. 90 pgs.. 646 pgs. Biography. brahaasutrashaan'karabhaashhyamu dusaraa bhaagan.. Sanskrit. Rangaswami. 1989. bhushanam. 1927.. Language... baskaraachaarya. 1991.. 80 pgs. 1933.. 441 pgs. brahaasuutrashaan'karabhaashhyamuu With Commentaries of Shri Givindananda Vachaspati Anandagiri. 269 pgs. vi. Language.. Sanskrit. 1977. 1901. t'haakuur.. brahaasureabhaashhyamu. Sanskrit. brahadhogatarad'ugind-i asyaan' dhvitiyo bhaagan. 1918. Bhaskaracharya. Sri Nimbakacharya... gopalan s tr. Mahadeva Sastri Bakre. Literature. Sanskrit. Literature. Language. Philosophy.subramanyasaastri. 1955. Literature.. brahaasuutrabhashhyamuu Text with Tippanis. Sri Gnana Bikshu.. Psychology. 1949. Philosophy.. 1984. 354 pgs. Language.. 534 pgs. boddhi san'skruta grandaavalii 21. Language. brahaasuutrashaan'karabhaashhyamuu Vol I Chatussutri. brahaasuutrashaan'karabhaashhyamuu Part Iii With 9 Commentaries.. Literature. brahaasuutrashaan'karabhaashhyamuu Part Iii With 5 Commentaries.. Language..s. Sri Anantha Krishna Sastri. 42 pgs.panchamukhi.. Philosophy. LINGUISTICS. Sanskrit. 452 pgs. Psychology... boodhaayanaguhaya suutramu. shrii madhvaachaarya.. 0.. bodhaayaniiyagrxhyasuutra. aar.. gokarnd-a saan'badiiqs-ita. Sanskrit. 557 pgs. 236 pgs.. 1923. Geography. brahamiman'shatrishati..org/…/SanskritIIIT.. Brahmasutras. Literature.. 344 pgs. shriiballaala. Religion. Sanskrit. 106 pgs.. 1934. 494 pgs. 73 pgs. 1908. Linguistics. Literature. Linguistics. Sanskrit. Psychology. Linguistics. Psychology. Sri Vasudeva Brahmendra Sarasvati Swamigal.. Sanskrit.. R. raghunaatha. Linguistics.. Sri Subramanya Sastri. 1937. Psychology. shrii madhvaachaarya. Linguistics. 938 pgs. Geography. brahaamanhikamuu. 1929. Literature. 1984. Language. Sanskrit.. brahaasutrabhaashhyamu. 306 pgs. 524 pgs. brahaasuutrabhashhyamuu. Philosophy. Literature. Sanskrit. Sri Anantha Krishna Sastri. Linguistics. 0. Language. Sanskrit. 357 pgs. 0.. bijn'panaya.. Sanskrit. bhuddhabhuushhana.. 650 pgs.. Language. 100 pgs. Sanskrit.. Sanskrit. Dr Sureshchandra Mishra. Language. Sanskrit. bhoojanakutuuhalamuu. Sri Sankara Bhagavatpadacharya. 1932. .. Not available. Sanskrit. 1951. bhramasuutrabhaashya bhaaga 1. LANGUAGE.. Linguistics. brahaasutrashaakarabhaashhyamu bhaamatiikalpataruparimalopetamu. bhoojaprabandha. LITERATURE. Sanskrit. 0. Literature. Sanskrit. 649 pgs.. 0. bhuukailaasanaat'akamu. brahamiimaan'saabhaashhyamuu. 994 pgs. Language. Literature. Philosophy.. Sanskrit.. 355 pgs.d'i alan'kaar. Psychology. 708 pgs. hech. Sanskrit.p. Philosophy.… 103/167 . Sanskrit.. Sri Sankara Bhagavatpadacharya. 1941. 444 pgs.. Philosophy. Unknown. Narayana... bhramasuutrabhaashya bhaaga 1. Linguistics. Wasudev Laxman Shastri Pansikar. History. Linguistics.. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… bhonsle vamsa charitra. bhuhajjaatakamu. bhucvaneishalaukikanyaayasaahastrii. Sanskrit.. Psychology. Sanskrit. 1959. 1926. Psychology. Literature. Sanskrit.. Philosophy. 1956. 126 pgs. Religion. shaama shaastri. Sanskrit. Psychology. Philosophy..l. Linguistics.. Theology. 1920.. Vaidya. sanskritdocuments.. Linguistics. Sanskrit..

596 pgs. 453 pgs. 461 pgs. Sanskrit. Venkataramana Reddy. Sanskrit. 1927. T. brahmasuutrabhaashhyamu prathamo bhaaga. shriividhyaarand-ya. 102 pgs. 340 pgs. brahmasiddhi Of mand-namishra Vol 1 brahmakaandaa.. Literature. Brahmasutras... 198 pgs. Psychology. Language. brajavilaasa. 315 pgs.. 510 pgs.... Language. 604 pgs. Linguistics. brahmasuutrabhaashhyaalochanasya prathama chatu suutrii. 1991. Language. Sanskrit. brahmasuutrashaang-karabhaashhyamu sat'ippanan' muulakaatramu... 1991. Sanskrit. 2002.2/14/2011 g A list of scanned Sanskrit books at III… p y y gy pg brahasuutraanugund-yashiddhi. bran'hmaan'd'a puraand-amu. Literature. Sanskrit. 1981.. Linguistics. 0. Yogeswara Dutta Sharma. brahmasutraa nimbaakaibhaashhyamu. Language. Sanskrit. brahmaand-d'apuraand-ettarabhaagiiyan' lalitaasahasranaama saubhaagyabhaaskaraaravyabhaashhyan. Language. Sanskrit. V. 2003.. 340 pgs. Linguistics. 416 pgs.. Linguistics... 203 pgs. 441 pgs.. Sanskrit. brahmasutraavabhavamu vrittimit'aksaraa. 441 pgs.t. gan'gaavishhnd-u shriikrxshhnd-adaasa. t'i gand-apati saastri. 278 pgs. balagangadar tilak l. Literature.org/…/SanskritIIIT.. brahmasuutrabhaashhyamuu samalang-krxtamu.. Literature. Philosophy.... Religion.. 1933. Religion. hari naaraayand-a. Hari Narayana Apte. Sanskrit. 1967. Sanskrit. brahmasutraa nimbaakaibhaashhyamu. 200 pgs. 1957. Linguistics. Religion... Linguistics.. Religion. Sanskrit. Literature. Literature. Literature. 0... 1963.yal. Literature. Upanishads.. Sanskrit. Krishnasastri... brahmasutraa nimbaakaibhaashhyamu panchamo bhagan.. 1954. Linguistics.. brahmasutraavabhavamu. Literature. brahmavidaashiirvaada. Theology. Not available. brahmasutrabhasya of sri madhvacharya vol 1. 245 pgs. Philosophy. brahmasuutrashaan'karabhaashhyamuu. Sanskrit.. Sanskrit. Language. 1984. Not available. Linguistics.. brahmasutraa nimbaakaibhaashhyamu charma bhagan. Sanskrit. Sanskrit. sanskritdocuments... Prof. Theology.. 1894. 2000. 191 pgs. Sanskrit. Madanmohan Agarwal. vaasudevasharma.… bh ti ti k i i L Li i ti Lit t S k it 1941 188 104/167 . Language. 1923. 0. Brahmasutras. Brahmasutras.. Philosophy. Sanskrit.. Brahmasutras. Linguistics. 1922. 30 pgs.. 185 pgs. 322 pgs. Sanskrit. 1909. Language.prabanjanacharya. V. 1915. Brahmasutras. Language. shriimajjayatiirtha vyaasatiirtha. 290 pgs. Psychology.. vidhyaabhaaskara shriimand-ishang-karo vasantaraamaatmaja upaadhyaaya. Literature. 266 pgs.. 1937. Sanskrit. 1984. Literature. Sanskrit. Sanskrit. brahmaasuutraand-i. Theology.. brhamasuutra vrutti. sri bhagavad ramaanuja. 246 pgs. Theology. Sanskrit. brahmatatvaprakashika. bhaaskararaaya.. je. brahmamiimaan'saabhaashhyamu. Language. brhadaarand-yakopanishhatu. 530 pgs. brahma sutra sariraka bhaaga 1. Sanskrit. 2000.. Chandrasekharan. Not available. S. Philosophy.. Language. Madanmohan Agarwal. shaastri. Kuppuswami Sastri. Sanskrit. brahma suutraand-i. shriinimbaarkaachaarya.. Vira Raghavachaya... Linguistics.. Psychology.. Linguistics. 1983.

0. Not available. 480 pgs. chaand-akyashatakam.. Sanskrit. 1891. Literature.. Linguistics. 132 pgs... 460 pgs.. Sanskrit. THEOLOGY. Language. Literature. Sanskrit. Language. 552 pgs. Sanskrit. Sanskrit. shriibhoojaraajasaarvabhauma. 290 pgs. qs-hemendra. 0. 643 pgs. 1955. Linguistics. bruhadhyaavanaajaathakama. 0. shriiraamachandra budheindra. Language.org/…/SanskritIIIT. 1843. brxhadhyogatarang-agind-ii dvitiiyobhaaga. LITERATURE.. p. Linguistics.. Literature. ma.. budhabhuushhand-aman.. Literature. brxhatakathaaman'jarii.. 330 pgs.sudhaakara diveidi. 283 pgs.2/14/2011 A list of scanned Sanskrit books at III… brhaspatismrti. Sanskrit. P... k. Linguistics. Linguistics. Sanskrit. Linguistics.. King Sambhu. Sanskrit. Literature. Literature. Sanskrit. 0. 1926. Not available. sanskritdocuments. champuramayana kiskindha kanda and sundara kanda. Language. Literature. 1941. brxhatstotraratnaakara sachitra. bulletin of the goverment oriental manuscripts library madras.. 82 pgs. 0. 0.. Jwalaprasad Misra. Sanskrit. Literature.. 1933. Sanskrit.padmanaabha.. 1901. 188 pgs... 1914. Language. census of india 1981 series 1 part V A amp B.ma. 0.. Language. 1326 pgs. Language. Linguistics... Linguistics. champuuraamaayand-amu kalyaand-ii san'skrxta hindiivyaakhyaadvayopetamu. v. Sanskrit. Linguistics. 0.. trimallabhat't'a. Sanskrit. prabhaakaramishra.. 560 pgs... Language. Language. 1924. Natural Sciences..… 105/167 . hari naaraayand-a. 290 pgs.. Literature. Literature. 1979. THEOLOGY. 664 pgs. chalaraashikalanama. rangaswami aiyangar. Literature. Theology. champuuraamaayand-amu yuddhakaand-d'amu vyakhyaaya sametamu. Linguistics.... champuramayana. brxhadhdaan'turuupaavali. Philosophy. Sanskrit. chandrashekhran. champubhaaratamu.. kaviraj shrii athrii dhev guru.. Linguistics. shriibhojaraajasaarvabhauma. 1895. Sanskrit. Language. 32 pgs. Psychology. 110 pgs. LINGUISTICS. buhadaarnd-yakopanishhanmitaaqs-araa. buhadaarand-yakopanishhadushhyavaatokamuu. Literature. Sri Raghavendra Tirtha. 0. 1946. Sanskrit. Language. Literature.. Sanskrit.. Literature.... brxhaddhaan'turuupaavali.viswanatha Nayak. Sanskrit.. narayana raam acharya. Linguistics. 295 pgs. 1979. 256 pgs. 650 pgs. Sanskrit. t... 34 pgs. Linguistics. 1246 pgs. Language. Sanskrit. budgat 1966-67 finance minister's speech part -a. census of india 1981 series 1 part Viii. Language. 256 pgs. Sanskrit. 158 pgs. chimand-aajii aapat'e.. LANGUAGE. Not available. Sanskrit. Linguistics. bhoja. p. 643 pgs.. Sanskrit. Sanskrit. RELIGION. 1941. champuuraamaayand-amu ayodhyaakaand-d'amu. Religion. t'i aar krxshhnd-aachaarya.. Literature. Sanskrit. Language.. RELIGION. Unknown. chaalukyacharitamu... Art. Linguistics. Linguistics.. brihadaranyakopanishhat'a khandarthaa. 1943. t'ii aara krxshhnd-aachaaryand-a. Language. 122 pgs.. Not available... brxhatii shaabarabhaashhyavyaakhyaa. brxhadaarand-yakopanishhatkhan'd'a. Literature.. Language. Social Sciences. 1875.padmanaabha.

Literature. Sanskrit. Literature.. Sanskrit. 1904. 0. Sanskrit. Language. Literature. Language. Sanskrit. LINGUISTICS. Linguistics. paurnamasi katha bhatta. Literature. 1914.. Language. chaukhambaa saahitya 1996 97.r. shriimattaatparya. Sanskrit. devakiinandana. Language. Sanskrit.. Sanskrit. 0. Sanskrit. 1843.org/…/SanskritIIIT.. Not available. chandraaloka savimarsha prakaasha hindiivyaakhyaya panj-chamo mayuukha. Sanskrit. 190 pgs. shriimadyaamunamuni. chaukhambaa siiriija saahitya 1999 ii. Language. Sanskrit. Sanskrit. LITERATURE. Literature. Language.. Religion. Not Available. Sanskrit. Literature. Not available. Not available... 1907. Not available. charudattam.. Literature. Social Sciences. 386 pgs.. Linguistics. 394 pgs. LANGUAGE. Language. chaturvaand-ii.… chhaandogya braamhand-amu trxtiiyobhaaga. chandrakaantaa santati paan'chavaan' hissaa. Linguistics. Krishnacharya.. 156 pgs. 461 pgs... Language. chhaan'dogyopanishhatkhan'd'aartha. Hemadri. Literature. chandrasyasaarand-iiraashyaadi 321404. 115 pgs.. Linguistics. 1941. Chakripanidatta. Literature. Literature. shriibhoojaraaja. Sanskrit. 1993. Sanskrit. Linguistics. Linguistics. 1999. Sanskrit.. Sri Vallabhacharya. Linguistics.. 0... 1962. Literature.. 112 pgs. chhaan'dogyavedeshiiyat'iikaa. 1926. Sanskrit.. Linguistics. 230 pgs. Linguistics. 1937. 142 pgs. 0.. Sanskrit.. chatun'shlokii. Theology.. Literature.. 1959... Language.... 1912.. Sanskrit. Linguistics. chaukhambaa saahitya.. Literature. Unknown. 112 pgs. subramanya shastri s.. 0. Sanskrit. Language. Language. chaturvin'shatiimatasan'graha..t. viiranandii.. Literature. Language. Literature. Not available. 37 pgs. Linguistics. Literature. Not available. 251 pgs. 0. 1843. Not available. chaturdandi prakaashika. Linguistics. 398 pgs. 112 pgs. devakiinandana. Literature. Linguistics. Literature. chandraprabha charita.2/14/2011 A list of scanned Sanskrit books at III… Language.. Language. Not available.. Sanskrit... 322 pgs. LITERATURE. 112 pgs. Sanskrit. Religion... Not available. Linguistics. Sanskrit.. chandrakaantaa santati saatavaan' hissaa. 810 pgs. 86 pgs. Literature. Linguistics.. sanskritdocuments. Linguistics. Theology. chandra loka. Linguistics. 1962. Linguistics. Not available.. 106 pgs. devadhar g r tr. 0. Language.. Sanskrit. 1934.. chhaan'dogyavedeshiiyat'iikaa. 106/167 .. 342 pgs. chatur^thiikar^mapaddhati. Language.. Linguistics. Sanskrit. 0. chaukhambaa saahitya 1996 97.. Literature. charakasn'hitaa by agnivesha.. chaukhaambaa sahitya.. 672 pgs.. 194 pgs. chatushshlekii stotraratnanj-cha. Sanskrit... chatur^var^gachintaamand-e Part Ii.. 0. Sanskrit. Language. 0. 88 pgs. chandrakalodaahaara. Language. shriijayadevakavi... . 526 pgs. Sanskrit. 142 pgs. Linguistics. Social Sciences. Gopala Lala. Sanskrit. 0.. 127 pgs. 1960. champuuraamaayand-amuu baalakaand-d'amuu.. 126 pgs. Language. Linguistics. Language. Literature. Not available. Language. 1861. 184 pgs. chaturvaand-ii. LINGUISTICS. chan'drikaaprakaashaprasara. LANGUAGE. Technology.. chan'drikaaprakaashaprasara. bhat't'oojidiikqs-ita. 108 pgs. 1977. Sanskrit. Not available.

chhanda shaastramu mrxtasan'jiivanyaa vrxttii. Sri Gopala Shastri Darsanakesari. Sanskrit.. shivadat't'a. Ayurveda. 218 pgs. Sanskrit.. 209 pgs. Banamali Biswal. 366 pgs. 579 pgs. pan' harishang-kara sharmma. Literature. Literature. daarubrahaa. Rangaswamy. 160 pgs. chitramiimaan'saa sudhaa vyaakhyaasamalang-krxtaa. Linguistics. hari naaraayand-a aapat'e. Sanskrit.. 90 pgs.. Psychology.. chitraprabhaa. LITERATURE. 1964.... 1941. 470 pgs. chhandashaastramu. daanakelichintaamand-in.. 82 pgs. Linguistics. chitramiimaan'saakhand-d'anamu marmakaashena vimarshinyaa baalakriid'ayaa. daharavidhyaaprakaashikaa. 1958. Ananthanarayana. chitraprabhaa. Sanskrit. chhaandoogyabraahmand-amuu. mahaakavikaalidaasa. Not available. Vacant. Linguistics Literature. Sanskrit. chhandovichitin. chidagana chandrika sanskrit commentry and english translation. 1980. Linguistics.. 152 pgs. Sanskrit. Literature. 1938.. Sanskrit. Language. Linguistics.... Language. raamaraaju b. Raghunath Sharma. 2002. Linguistics. Sanskrit. B. mand-d'itaraaja shriijagannatha. sri pingalanaga. Literature.. chhaandogyopanishhatuu saamaveidaa. Sanskrit. 0. 256 pgs. Literature. ching-iyaaghara.. Linguistics. LANGUAGE. Language.. 1902.. Literature. 628 pgs. shriijovaanandavidyasaagarabhat't'aachaaryaa. Linguistics. Technology. shriiping-kalanaaga.. 1956. 213 pgs. Literature. K.. Sanskrit. Religion. 1991.. Sanskrit. sanskritdocuments. 322 pgs.. Language. 127 pgs. 2000. Literature. 232 pgs. Sanskrit.. Language.... Language.. Sanskrit.. Language. chhandas sastra.. daanakaand-d'amu panchamo bhaagan.. 1937. Linguistics... divaakara.. Language. 0. Literature..… 107/167 .m. 282 pgs. Literature. shriimadappayadiiqs-ita. Sanskrit.. 1962. 459 pgs. daanachanddrikaa.. LANGUAGE. LINGUISTICS. 1965. Sanskrit. 244 pgs..v. chitranibandhaavalin. Sanskrit. Sanskrit. Language.org/…/SanskritIIIT. 530 pgs..2/14/2011 A list of scanned Sanskrit books at III… chhaandogya braamhand amu trxtiiyobhaaga. Literature. shrii durgaamoohanabhat't'aachaaryaind-a. Sanskrit. Sanskrit.. 645 pgs. Sanskrit. Literature. shriiping-galaachaarya. 411 pgs. RELIGION.. 120 pgs. yash dev shaalya.t. LITERATURE. d'anavaara kii ghaat'ii. chhaandogyopanishhatuu. Theology. 1932. Linguistics.. 212 pgs. Literature. Sanskrit.. Linguistics. Language. The History Of Philosophy.. Sanskrit. 1971. contribution of andhra to sanskrit literature. Sanskrit.sharma.. Sanskrit. Language. 1941. kalidasa.. Language..s. 1989. Sri Paramasivendra Saraswati. 208 pgs. vord'ana d'ila... Literature. chitramiimaan'saa. 0. shriitaaraanaathatakivaacha. 2001. 1932. 1943.. Sanskrit. 1948. Linguistics. Sanskrit. 326 pgs. 830 pgs. Sharma. Linguistics. 1980. Sanskrit. daasakuut'a. Linguistics. 80 pgs. chhandobhyastaa.. Sanskrit.. Literature. chikitsaa saahitya.. Psychology. The History Of Philosophy. 162 pgs.r. THEOLOGY... 1938. Religion. Linguistics. 1908. Language. Bhabgavata Hari Sastri. 1873. 0.. Language. 125 pgs.. LINGUISTICS. Language.. The Four Vedas. bhiqs-u. daarshaanik pancham varshik shanaak. subrahand-ya shaastrii. chidagaganachanddrikaa kramaprakaashikaavyaakhyaaya.. Sanskrit. Linguistics. daasacharitamu. Philosophy.

Literature. 1895. mahaadeiva chimand-aajii aapt'e. Kashmir. Sanskrit. C. dharma shastra. sanskritdocuments. dhar^masaastraa Part Ii. tryamn'baka raayamakhi. 652 pgs. Literature. 1998. 1996. 1935. 98 pgs. Not available. 1954. 1933.... 518 pgs.. Linguistics. dhaaturuupa prakaashikoopoodhghaata. 126 pgs.. Sanskrit. lakshmipuram srinivasachar. Literature. dharma kuut'amu Vol. dhananj-jaya. Dr. Literature. Not available. 575 pgs. dasharuupakamu kaavalokaaravya t'iikaa sahitamu.. 0. shriiraama. Sanskrit... Bhagavdgita. Linguistics..kunhan Raja. Unknown. Iii Part Ii. Upanishads. 519 pgs... Language.. LITERATURE. Literature. 0... 1936... Sri Jayasimha Suri. deshopadesha namaimaalaagrantho. Not available.. devataadhyaaya san'hitopanishhadu van'sha braahamand-aani. darshapuurnd-amaasaprakaasha prathamo bhaaga. Linguistics. dasha upanishhadan' pradhamo bhaagan. Sanskrit.org/…/SanskritIIIT. kaviraja rakhaldaasa kavyaatiirtha. 545 pgs.. 363 pgs.. Language.… 108/167 . dasha upanishhada prathamabhaaga vyaakhyaayutaa. Theology. dharmaakuutamu 2 ayodhyaakaand-d'a prathamo bhaaga. 520 pgs... dasha upanishhadan' pradamo bhaagan.. Upanishads... 202 pgs. Social Sciences. 402 pgs. Linguistics.. Sanskrit. Sanskrit. Linguistics. LANGUAGE.kunham Raja. Religion.. Linguistics. Sanskrit. G. Religion. 1976. 1926.. 0. Theology. Linguistics.. Sanskrit. Language. Sanskrit. devabhaashhaa. 352 pgs. yashaavanth vaasudhev paatnkar.. Literature. C. dashanirnd-ayii. Religion.. B. vaad'iilaala... Sanskrit. shriivaidikasaarvabhaumai. Sanskrit.. 120 pgs. 130 pgs. Sanskrit. 101 pgs. Sanskrit. Manmatha Nath Dutt. Religion. 1987. dashaavataarastotramu. Sanskrit. Literature. 1909. Philosophy. 24 pgs. Kunham Raja. Language. 1934. darsanodaya. 602 pgs. Sanskrit. pan'd'it chamaraajanagar shriikaan'ta shaastri. 1998. dhaaturatnaakara. Sanskrit. 0. Sanskrit. ddvaitokttiratnamaalaa. Venkatanathacharya. 976 pgs. 370 pgs. 0.. 1898. Language.. 254 pgs. Philosophy.achari. Language. Sanskrit. 1983.. Sanskrit. Sanskrit. Language. Theology. Literature.. dashainashaastrasyaitihaasan.. 631 pgs. Language. 131 pgs. 1924. ke.. 1111 pgs. 341 pgs.shashibala Gouda. Language. dattaka chan'drika.. Art. 290 pgs. Religion. dattakamimaan'saa 1976. Sanskrit.. vinaayaka gand-esha aapat'e. LINGUISTICS.. 352 pgs. Literature. Literature. Sanskrit.. Sanskrit.. shriikaakhanaayai.2/14/2011 A list of scanned Sanskrit books at III… dakikhanii kaa padha aura. 106 pgs.. 1947.. Linguistics. 1935. Sanskrit.. Psychology. Sanskrit. LINGUISTICS... Sanskrit. dashanind-aiyai. deha prakriti vignyan. Linguistics Literature.. LITERATURE. 1936. Language. dharmaakuutamu 1 baalakaand-d'a. Language. Linguistics.. Linguistics. 1949. Theology. Literature... maarulkarashaastri. 426 pgs. 1878. shrii upanishhadbrahmayogi. LANGUAGE. Sanskrit.. dasha upanishhadan' dhvitiyo bhaagan. Sanskrit. 1928. naabaadarsgabaoaranaachaaryya.ramachandra Sharma. dhanan'jayavijayan. The History Of Philosophy. 1924.. dhamaupadeshaamaalaa vivarand-a.. Linguistics. Theology. C.

Sanskrit. Sanskrit. Literature. gautama. Sanskrit. Literature.. 1050 pgs. dharmatattvanirnd-ayaparishishht'amu. Sanskrit. Ganesha Sastri Ghokle. sanskritdocuments.. Literature. .… 109/167 . kurugan't'i shriiraamashaastri. Language. 373 pgs. Religion. Literature. dhatu sagara tarani.. 504 pgs. Language. Theology.. 1832. shriikaashiinaathopaadhyaaya. Vacant. 1972.. shriimadaanandavardhanaachaarya... Linguistics.. Language. 390 pgs.. diipikaasarvasvamuu. laqs-mand-a shaastrii. Literature. dhvanyaalooka. laqs-mand-a shaastrii. diinaarkaraajakukaarahemalekhamu. Linguistics. thakur udayanarayana singh.. Linguistics.org/…/SanskritIIIT. laqs-mandashaastrii joshii.. 1922. Literature. Linguistics. Theology... Sanskrit. Literature. ravisheikhara pan'd'ita badariinaatha sharma.. pan'd'ita durveika mishraa. 1914. 601 pgs. Language. 20 pgs. 162 pgs. Sanskrit.. Language. Sanskrit. dharmakosha Vol I Part II. 1968.. 712 pgs.. sripati sastry. draahyaayand-agrxhyasuutramu rudraskandavrxttisahitamu. Language. Sanskrit.. Sanskrit. 1935. 1056 pgs. LITERATURE. Literature. Linguistics. 214 pgs. 107 pgs.. dravyagund-asan'graha dravyagund-asan'grahat'iikaaravyakhyaaya trxtiiyavrxtti. Literature. LINGUISTICS. 1971. 1988. Linguistics. Linguistics. dhatu sagara tarani. mahaamahopaadhyaaya vaasudevashaastrii. LINGUISTICS. Literature. Literature.. 1968. 1933.. Sanskrit. LITERATURE. Sanskrit. Sanskrit. Linguistics.. Sanskrit. Sanskrit. Sanskrit... dharmasharmaabhyudayamu. 1938.2/14/2011 A list of scanned Sanskrit books at III… dharmaishaastrasan'graha. 855 pgs. 116 pgs. 1954. 1955. Literature.. vaidhyamahaamahopaadhyaayashriichakrapaand-idatta.. Linguistics. Language.. dharmoottarapradiipa volume Ii. sripati sastry. Literature. Literature. 831 pgs. Language.. Linguistics. Linguistics. dhvaivajnj-abharanamu. 1900. dutaangadamu. Linguistics. 694 pgs. 1937.. Sanskrit. Language. Sanskrit. dhvanyaa looka... shriipurushhottamasharma chaturveda.. Literature. 526 pgs. p. Sanskrit.. LANGUAGE. Sanskrit.. Linguistics. dharmasuutra. 120 pgs. Literature. 1969. gautama. 0. 270 pgs. dharmakosha varnd-aashramadharmakaand-d'amu prathamo bhaaga kramaanka 5. 200 pgs. Language. Linguistics. Linguistics. shrii badhiriinaatha sharma.. dharmakosha Vol I Part I. dharmasindhu dharmadiipiikaa vishaadahindiivyaakhyaaya sudhaat'iippand-ya.. 98 pgs. Literature... Sanskrit.. p. Literature. 1934. Sanskrit. Sanskrit. dharmasuutramu bhaashhya sahitamu.. Religion. Linguistics. Language.. Language. Linguistics. 1937. dhvanyaalokasaara. 1940. 250 pgs. Language.. Sanskrit.. Language. 114 pgs. Language. draahyayaand-agrxhyasuutravrxtti.. 1954. mahaakavishriiseqs-apivara. 640 pgs. Language.. 0. Language. lakshminarayana. mahaakavishriiharichandra.. Not available. Sanskrit.. diipikaasaahitamuu. 1968. LANGUAGE. Vacant.. dhvanyaaloka baalapriyaadivyaanj-janaabhyaan' lochanena. Linguistics. 0. Language. shriisubhat'a. 224 pgs.

Sanskrit. 240 pgs. 1940. 1910. 458 pgs. Sanskrit.. kavisaamraat'u vishvanaatha satyaanaaraayand-a.yam. 298 pgs.. 1920. 228 pgs. Religion.. dalal.. 1942. Sanskrit. gaadaadharii. 516 pgs. 108 pgs. gaathaasaptashaatii.r. Sritaranath... Linguistics. mitaddara. 262 pgs. Literature. Language... ti ve shriinivaasaashaastrind-aa. Sanskrit. 1983.. 1911.. -.raghuthamacharya. gaathaashaptashaatii.. Sanskrit.. Social Sciences..pi vandeishvari. Sanskrit. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… dvadashaaran' nayachakramu. Linguistics. 1881. 1942. gautamaprand-iita dharmasuutraand-ii. 452 pgs. eitareya braamhand-aa. Language. Literature..vindhyeswari Prasada Dvivedi. Literature. Linguistics. B.. dvatadhumand-in. 168 pgs.. Literature... Sanskrit. 1970. Linguistics. Language. gadhatrayamuu. Sanskrit.. Sanskrit. Language. Language. 1908. RELIGION.. eitareyaarand-yakamu. Religion. gand-akaarikaa.m. eitareya braamhand-aa. 1998. shriinivaasachaarya. dvijakanyaanamu vivaahakaalivimarsha. 766 pgs. c. Language.. Sanskrit. 380 pgs. Linguistics. Literature.. gaadaadharii tattvachintaamand-yaa diidhityaa cha garbhitaa. Pandith Gopeshkumar. 0. 149 pgs. Shadguru. Linguistics. 554 pgs. eclipse cult in veda's bible and koran. Sanskrit. Literature. Linguistics. Linguistics. Sanskrit. Aurobindo. 1912. 1908. 680 pgs. Linguistics. giita govinda rasikapriya rasamanjari.krishnacharya. gadaadharapadvatau aachaarasaara.. Linguistics. Sathavahana.. K Vasudeva Sastri. Literature. ganesh siddi.. 120 pgs. Literature. 149 pgs.. shriigadaadharabhat't'aachaaryachakravartti. 1895. gathaa bhrxgvajirasaatmakasya atharvavedasya upasthaanaamake bhrxgukhand-d'e. 1915. jayadeva.mathuranath Shastri. Language. eitareya taamaraaparinayamu. 432 pgs. 1950.. Gadadhara Rajaguru. Linguistics.. omaprakaasha.. 0.. gand-itaadhyaaya vyaakhyaaya samanvita.. Sanskrit.. 1929.. Munichaturvijay Pandit lalchandrsrva Bhagavan Sresthitanuj. Sri Mad Ramanuja... S. Language. 240 pgs.… giitaagn aana prathama adhyaaya arjuna kaa vishhaada pan' diinaanaatha bhaargava dinesha 110/167 . badarinaada.. M.r. 446 pgs... Language. 1932.org/…/SanskritIIIT. Literature. dvatasiddaantasaaran. Sanskrit.. Literature. Linguistics. Linguistics. Linguistics.. giita goovinda aur abhinaya. 666 pgs. 190 pgs. Sanskrit. gadya bhaaratii.. Anantakrishna Sastri. Sanskrit... Language. 770 pgs. epika Bhavaarth Bodhini. Sanskrit... Sanskrit.. gadaadhaarii. ekaviiraa. Sanskrit. 1978. Art. Philosophy. Sanskrit. 522 pgs. Religion. Sanskrit.. Language.. Literature. Sanskrit. Sanskrit. Religion.. Literature. Sanskrit. chimand-aajii aapt'e. Language. Sanskrit. 276 pgs. 1950. 1927.. Sanskrit. 202 pgs. 1906. gaayatriivyaakhayaa. Language. Literature. 72 pgs. 1944. 1978. Language. 82 pgs. Theology. Literature. Sanskrit. Sanskrit. Linguistics. gadya bhaaratii. 1875. Literature. 134 pgs.. T. Religion. 232 pgs. Unknown. 1969. Psychology.. ekaagnikaand-d'a. THEOLOGY.. 0. Religion. Religion. Language. Sanskrit. 240 pgs. shyamasastry r. Sri Aurobino. yam. Literature.... d... sanskritdocuments. jotindra mohan chatterjee. .. 1902. omaprakaasha.. dvisan'dhaanamu. Hulagi Sripathyacharya.

1947. gopeenauth pathuk. Literature. Sanskrit.. gootaavalii sat'iik.. subrahand-ya vidushha. 384 pgs...org/…/SanskritIIIT. 1815. 62 pgs. gobhiliiyagrxhyasuutramuu. Bommakanti. Linguistics. 0.. Sanskrit. 1971. Not available. Language. Sanskrit. giitaasamiqs-aa. Unknown. Linguistics. Language. Sri Rama Sharmacharya.. Linguistics. Linguistics.. Language.. han'sasan'desha.. 38 pgs. Linguistics. 1972. 514 pgs..m. Linguistics.... Language..2/14/2011 A list of scanned Sanskrit books at III… giitaagn-aana prathama adhyaaya arjuna kaa vishhaada. Tripitakacharya Mahapandita. Sanskrit. Language. 228 pgs.. Bhagavadgita. giitaasandesha. 0..... Language. Sanskrit.. bhat't'akumaarilasvaami.… 111/167 . Linguistics. jayadeva. Not available. gruhaasutra san'graha. Sanskrit. Language. Language. Sanskrit. Literature. Sanskrit. 257 pgs. gn-aanadiipikaa mahaabhaarata bhiishhmaparva. gurushushruubaa san'vargavidhyopadeshashcha.. chintaamaand-i bhat't'aa. Sanskrit. 1936. Literature. goobhila graahya suutra. 34 pgs. Sanskrit. Literature. Religion. Language. Sanskrit. guhyasamaajatantamuu. Literature. LINGUISTICS. 1956. Srinivasacharyulu. Sanskrit. Theology. 186 pgs. Sanskrit. 662 pgs.. 0. 0. Sanskrit. Linguistics. shriidevaboodha. 188 pgs. gramaand-avaatikabhaashhyamu pradhama puraand-amu. Literature. Not available. 288 pgs. 266 pgs. Literature. Shambhusinghji Suthaliyadheeshkruth. Sanskrit.. 1931. 1869.. 1952. 256 pgs. 0. Linguistics. Sanskrit. grxhyasuutramu grxhyaparishishht'amu grxhyakaarikaashcha. 140 pgs. Sanskrit.. Not Available. Not available. Sanskrit. 1936.. 170 pgs. Literature. guurvarthadiipikaa prathamaadhyaaya. Language. shriimadaanandatiirthabhaagavatpaadaachaarya. Literature. Sanskrit. Anil Varan Roy. Sanskrit. Linguistics. Sanskrit.. LITERATURE.. h Kalpmudram.. 1986. Marunda. Language. Literature. 1892.. grahalaadhavan' karand-amu t'iikaa. M. gopurasandesaa.. 182 pgs.. Literature. kavisamraat'a vishvanaatha satyanaaraayand-a. 352 pgs. Social Sciences. goopikoonmaada.. Sri Mukunda Jha Bakshi. 0.. Language. Linguistics. LANGUAGE. Linguistics. haaralataa.. Linguistics. sanskritdocuments. 1969. 330 pgs. 422 pgs. 1909. Linguistics. Literature..s. Language. Sanskrit. Literature. 1995. Literature. gand-eshadaivagn-aani.. 374 pgs... Aniruddha Bhatta. 814 pgs. 57 pgs. Religion. Sanskrit. K. guurvaarthadiipikaa dvitiiya pushhpamuu. Literature. Sanskrit. Sanskrit.. 0. Sanskrit.. Language. Literature. Literature.. 0. Linguistics. gitagovinda mahakavyam. Ramamurthi.... 1936. Benoytosh Bhattacharyya.. gobhilagrxhyasuutran.. Linguistics. grantharatnamaalaa.. 226 pgs.. Sanskrit. Literature.. Theology. 504 pgs. giitaashaastraarthaviveka. 1955. goomiliiyaguhakarmaprakaashikaa.. Language.. Religion. guptapaashupatamu amrxtasharmishht'hamu. shuuranaad'uu krxnjanuu pilla. 0. pan diinaanaatha bhaargava dinesha. 1948. 1846.. 219 pgs. 45 pgs. Language. Language. Art. Language. 43 pgs. ma daa khare. 390 pgs. giitopadesha. Linguistics. Literature. Literature. svaamii raamadaasajii kahaaraaja. Linguistics... Linguistics. Language. giitaapadmavikaasa. Sanskrit..

264 pgs.. Linguistics.. hashhachaaratasan'grahan. Literature.. Sanskrit.. Bhana Bhatta. Literature. . Sanskrit. Linguistics. Religion. Not Available.. Religion. Linguistics. 1900.. Sanskrit.. Sanskrit. Theology. Linguistics. 1960.org/…/SanskritIIIT. 0... hat'hayogapradiipikaa dhvitiyo bhaagan. 1971. Sanskrit. bodhendrasarasvati. harikavi alias bhanubhatta.samba Shiva Sastri.. 1950. Language. Vasudeva Agarwal. Language. Hari Narayana Apte.. shriidevimalagand-i. Literature. 0.. higher sanskrit grammar. Language... Sanskrit.. 108 pgs. Sanskrit. 1967. Language. harishrchandropaakhyaanama~. 0. Literature. 249 pgs. 1932. Linguistics. 336 pgs. R. 372 pgs. 1933.. 1822. shrii manimshradaamodarene. Sanskrit. Bhana Bhatta. 0. Literature. Linguistics. 262 pgs. 238 pgs..... 476 pgs.. Theology. 268 pgs. Literature. harisowbhaagyamu.. Sanskrit. khare kulotpanna harisuunu gand-esha. Sanskrit. k. Literature. Linguistics Literature. Literature.. 1933. hindhi patra lekhan.. harivamsa. Linguistics Literature. Linguistics. 414 pgs. hashhaicharitamu. Language. 718 pgs. 0.. 246 pgs. Literature.. 900 pgs.2/14/2011 A list of scanned Sanskrit books at III… hanumada rahasyamu hindiivyaakhyaaya vibhuushhitamu hanumatpuujaapaddhati. Sanskrit. 1772. 190 pgs. heitriiyoopanishhadi shiqs-aavalli. Philosophy. hariharadvaita bhusanam with karika.. 1934. Language. 1938. shriivibhuutibhuushhand-aabhat't'aachaarya. 1964. 196 pgs. 1946.… 112/167 . Sanskrit. aachaarya pandd'ita shriishivadattamishrashaastrii. 1935. Sanskrit. Linguistics. Bhana Bhatta. 112 pgs. harshcharitamu. Literature. Sanskrit.. Language. ramaswami shastri... Sanskrit.. Religion. Religion. Linguistics. 97 pgs. Bodhendrasarasvati.. Hathayoga. 38 pgs. Theology. Religion. hastalikhitagrandhavivarand-apajjikaayaan. hashhaicharitan' eka saan'skrutika gradhyayana. hanumannaat'akamuu. 1954. Sanskrit.. Literature.. Literature. hariharachaturang-gamuu. 1954. hariharaadvatabhushhand-amu. 1897. Literature. shan'karakrutayaa san'ketaakhyayaa. 198 pgs. Literature.s. 102 sanskritdocuments. shriikrxshhnd-adaasaa.. hayata. 218 pgs. Sanskrit.. Sanskrit. goodaavaramishra. Language.. Linguistics. Language. 941 pgs. Hari Narayan Apte. Theology.. hanumanatakam.. 1946. harameikhalaa maahukaviracchitaa sat'ikaa.. Language. 1791. K. ramchandra kale m. Linguistics. Sudarsana Sarma And Sahitya Siromani. 336 pgs. hastalikhitagranthaanukramand-ikaa.. 197 pgs. Sanskrit.. Linguistics. gode p k. 93 pgs. 1917. 96 pgs. Language. bhanabatta.. Psychology. 934 pgs. Sanskrit. Language.. parushuram lakshman vaidya. harivaasamu. Sanskrit. 1850. Sanskrit. hashhacharitasan'grahan. 272 pgs... Literature. Sanskrit. Psychology. 1960. Religion. Sanskrit. T P Upadhyaya. Sanskrit. hariharaadotabhushhand-amu.. Literature. Sanskrit.. Philosophy. Theology. Linguistics. haridiqs-atakrutaa buhaasutravutin. Language. haridiiqs-itakrutaa brahaasuutravt'anti. Sanskrit... Sanskrit. Language..... Subramanya Sastry. hashhaicharitan. Linguistics. bodhendrasarasvati.. Linguistics Literature..

. 145 pgs. Language.. Not available. 1931. Language. pandit narayanan. Language. shrii shang-karaachaarya. 0. Not available. hindi zou vacabulary.. Linguistics. Language. Linguistics. K .. Theology. Sanskrit. hoorabijnaanrahasyam jyotishkalpabriksha. hindusthaanakaa dand-d'asn'grah. Sanskrit. 64 pgs.. 413 pgs. 1935. naarayanachandra jyotirbhushan bhattacharya.. Language. 1917. 122 pgs. 335 pgs. Sanskrit. iishaadyashht'itarashtopanishhada aadyantatatachchhaantiyuj.. Sanskrit. Literature. 0... 1908. 1928. indraprasthaprabandha... Philosophy. Sanskrit. Hiriyanna. Sanskrit.. Theology. Linguistics. hitopadeshan.. Sanskrit... shriimatparamahan'sabrahmaanan'dasvaaminaa. khemaraaja shriikrxshhnd-adaasashreshht'inaa. vimuktaatma.. shriimadugadgasheipaadhpaadhhyaya.. Literature. 1972. 0. Language. Language.. Not available. ht'hayoogapradiipikaa. 750 pgs. 26 pgs. Sanskrit. Linguistics.. 456 pgs.. 1963. sanskritdocuments. hitopdesh.. Literature. Sanskrit. yashaavanth vaasudhev paatnkar.. Linguistics. Linguistics... Literature. M. Linguistics.… 113/167 . Language. 1933. ishht'aasiddhi savivarand-aa. Psychology.org/…/SanskritIIIT. Linguistics. 238 pgs. 55 pgs. Religion.. hitopadeshan. 306 pgs. i tsin'ga aura bhaarata yaatra. 1980. Linguistics. Language.... Literature. Sanskrit. T. 163 pgs. Literature. ishaadidashopanishhada bhaashhya sametamu. Literature. Literature. Literature. iishaadhyaashht'ottarashatopanishhada aadhyantatattachchhaantiyuja. 103 pgs. hitoopadeisha. Philosophy. irishadi dashopanishada. Language. jayakaanta mishra. Psychology. Sanskrit. Psychology. iishvaradarshanamu tachchaitatu. shriijaganaathapand-d'ita.. 166 pgs. Religion. Technology. Language. Literature. shrii naaraayand-a pan'nd-d'it'a. pand-d'ita baladeivapraasaada. Linguistics. Language. Linguistics. 266 pgs.. 1915.. 1825. Linguistics. Sanskrit. Sambasiva Sastri. Language. Literature.. 0.. Sanskrit. 1020 pgs.. iishaavaasyat'iikaaraghunaathariirthiiya. Sanskrit. Sanskrit. Literature. 0. Language. Literature. Sanskrit. 445 pgs.. dasharatha sharma. Language. 0. Not Available.. 1975. Language. 574 pgs. Sanskrit. Literature. 62 pgs. Linguistics. Ganapathi Sastri. Language. 42 pgs.. Technology. Language.. 1981. Sanskrit. Literature.. Sanskrit. 1916. iishvarapratipattiprakaasha qs-imadhusudanasarasvatiprand-ita. 1894. Theology.. Sanskrit. Vishnu Sarma. ishht'asiddhi. shankar bhashya. Sanskrit. Linguistics.. 1964. indrajaalavidyaasan'graha. Linguistics. iishvaraanumaanan. 152 pgs. Linguistics.. iishaavaasyoopanishhada.. 1921.. Sanskrit.. 1932. hstyaayuveda book 1. iishaavaasyopanishhatuu khan'd'aartha. pandashiikaropahvavidvadddaralaqs-kand-asharma.. Philosophy. Sanskrit.. 1959.. Literature. 231 pgs.. paalakaapyamuni. 382 pgs. shriinaaraayand-apand-ita. hrxdayapriya of parameshvara. 42 pgs.. Literature. Linguistics. Religion. Literature.2/14/2011 A list of scanned Sanskrit books at III… pgs.. 192 pgs. Sanskrit. Sanskrit. hrxdayaamrxtamu. 1933.. 138 pgs. vasudevasharamand-aa. Linguistics. Sanskrit.

Raghu Veera... 476 pgs. jaiminiiyasuutraand-i subodhiniit'iikaasametaani prathamamadhyaayadvayan' sat'iikamagriman. Literature. Linguistics.… 114/167 . LANGUAGE. 1969. Religion. shriimadvachaasa. Sanskrit. 405 pgs. 0. 1890.. Language. 397 pgs. Literature.. Philosophy. Literature. utpaladeva. 1934. 1844...... jiind-iidvarahavanapaddatin' san'praaqs-and-avidhitra. 296 pgs. Linguistics. Language. 1904.. Theology. Sanskrit. Biography. 82 pgs. Sanskrit. 298 pgs. Sanskrit. 288 pgs. Not available. 1973. Venkataramaiah. Sanskrit. jagadaguru shriisachchidaanandasivaabhinava nusin'habhaaratiivijayakaavyamu. Linguistics. v... Ramakrishna Bhatt. Sanskrit. pat't'abhiraama. 84 pgs. Linguistics. Sanskrit. jaambavati parinayam.. 434 pgs. 1996. jiivandharachampun... subrahmanyashastri.. Linguistics Literature.. A Collection Of Essays On 21 Temples Located In Tamil Nadu. aachaarya shrii pan' lashhand-alaala bhvaa. Linguistics.. utpaladeva.org/…/SanskritIIIT. Sanskrit. 380 pgs. jaa ta ka t'a ka thaa padamo bhaago. jayapura raja vamsyavali. itihaasasamuchchaya. 0. 133 pgs... Sri Meethalal Himmatram Oojha. 52 pgs. 1938. jaagadiishiisaamaanyaniruttki (manuscript). Sanskrit. Religion. 1957. Sanskrit. Language. Language. Sanskrit. 365 pgs. Theology. Literature. Literature. Literature. 0. LITERATURE. 1937.. Sanskrit.. shriikaalidaasa. Dr R Latcha Raman.. Geography. Literature.. Language. History. Language. Psychology. Linguistics. jaiminiiyaarshheya jaiminiiyopanishhada braahmand-e. maharshhi shriijaiminimuni. Language.. sanskritdocuments. Religion.. shrii shaantisuuriisvaraji. 1891. 42 pgs. Madhvacharya. 428 pgs. Sanskrit. jaataka ratnaakara. ishwarapratyabhijnaa vimarshinii. 178 pgs. Language.. -.. 1980. Literature. Literature. jiivavichaara prakarand-amuu. Religion. jaanakiiparind-ayanaat'akamu. 1921.. 352 pgs.. Sanskrit. Linguistics. Language. Language. 468 pgs. Raghavendra Acharya. jyotirgand-itamu. 0. Linguistics. 1873. 0.. 1918. Pannalal Jain.... pn' . Sanskrit. jaagadiishiivyadhikarand-amu. be raamachanddrasharmand-aa. Sanskrit... 1921. LINGUISTICS.. kai jyotishhaachaarya dvaarakaanaatha naaraayand-a raaje. 0. sa raajavallabha sastrigala. Sanskrit. Vacant. Unknown. Theology.. 290 pgs. Linguistics. 1969. 357 pgs. janmapatra vidhaanamu sodaaharand-a tattvaprabhaa hindiivyaakhyaaya. pundit ramanatha anda sarma. Religion. utpaladeva. 295 pgs. iya Kunadali Vigyan. Literature. 1947.. jaatakapaarijaata adhyaaya 11 15. 0.... krishnadevaraaya. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… ishvara pratyabhijna vimarshini vyaakyaayasahitamu bhaaga 1. Linguistics. Language. R. 322 pgs. Sanskrit. Sanskrit.. Sanskrit..... ishvara pratyabhijna vimarshini vyaakyaayasahitamu bhaaga 2. 428 pgs. jaatakaabharan. 178 pgs. Theology. Not Available. jiivasaj'jivijnaat'akamu... Language. 242 pgs. Vacant. Literature.. Sanskrit. jyotirvidaabharand-aamu sukhabodhikaa.. 1966. Literature.. 1992. Sanskrit. jaiminiiyanyaaya maalaavi. Sanskrit. Sanskrit. Vacant. jauminiiyanyaayamaalaa Part I. Sri Kasinatha Sastri. Sanskrit. Linguistics. Sanskrit. -.. jaiminiiyashrotasutravrutin. 160 pgs. Sanskrit. jaatakaabharan.. Literature. Philosophy. Linguistics.. 446 pgs.

Language. kaarikaavalii nyaayasiddhaantamuktaavali. Not available. Linguistics. kaamasuutramu t'ikayaa sametamu. 854 pgs. 1803. 1956. Sanskrit. Linguistics. Literature. kaarikaavalii. 374 pgs.. Sanskrit. 1900. Natural Sciences. jyotishhatattvasudhaarnd-ava bhaashhaat'ikayaa. kaarakasan'bandhodhyota. Literature.. Religion. Vishwanatha Panchanan Bhattacharya. Sanskrit. Sanskrit.. Literature. Linguistics. Linguistics. 675 pgs. Literature.. Language. 1932. 0. 596 pgs.. Sanskrit.. Not available. 0. Sanskrit. 1915. Linguistics. Language. kaan'timati parind-ayamu... Raghunatha Bhatta. Language. Sanskrit. Language. 0. 360 pgs.. kaadambarii. 1965. kaamasuutramu.… 115/167 . Language.. rabhaasanan'di. Literature. 1951... 0. 422 pgs. shriivishvanaathapanj-chaananabhat't'aachaarya. Linguistics. Language. 556 pgs. Language. 218 pgs. 228 pgs. Literature. Linguistics. 392 pgs. vishvanaatha panchaanana bhatta.. Sanskrit. Sanskrit. 1848. Literature. 1924.... Sanskrit.. Sanskrit.. Literature. Literature. shriiraamaanan'dayativara. Linguistics. durgaaprasaada. shriivishvanaathapanj-jaananabhat't'aachaarya. Philosophy. LITERATURE. 194 pgs.. Sanskrit. Literature. Sanskrit. 0. 534 pgs. 1939. shriivaatsyaayanamuni. kaarikaavali siddhanta muktavali. Literature. 516 pgs. 89 pgs. Mahadev Shivaram Apte. Peterson. Linguistics. 1973. 280 pgs. Sanskrit. Linguistics. kaalaamrxtei savyaakhyaanei. Language. Sanskrit. 350 pgs.. Literature... Theology. shriichannaviirakavi. LANGUAGE. Language.. manubhai s. jyotishha shiromand-i bhaaga duusaraa drxshht'aan'ta vibhaaga 4625 janmakun'd'alike shaata nirayana chitraan'sha. 286 pgs.. Language.. vishvanaathapachaana. 0. 108 pgs... 1933. Sanskrit. Linguistics. kaarikaavali nyaayasiddhaantamuttkaavalii. Linguistics.. Sanskrit.. 90 pgs. Sanskrit. kaarikaavali siddhaantamukttaavali t'ippand-ii. 1895.. Linguistics. vidvaanu khan'd'avilli suuryanaaraayand-ashaastrii. kaalidaasakaavyasaurabhamu. 0. shrii chokkanaatha makhi. Literature... Language. shah. kaadambarisaaraa. Not available. Sanskrit. Linguistics. shriimanmahaamahopaadhyaayavidhyaanaathapanjchaananabhat't'aachaarya.. kaalagn-aanamu bhaashhaat'iikaasametamu.. Sanskrit. sanskritdocuments. kaarikaavali nyaayasiddhaantamuttkaavalii cha chitravali. 0. Not available. 1903. 98 pgs.. kaashiikhan'd'an' t'iikaa. Sanskrit. Psychology.. Vishwanatha Panchanan Bhattacharya.. Sanskrit.. Not available.... Linguistics... kaalatattvavivechanamam' Part Ii. Theology. 64 pgs. Literature. 338 pgs. LINGUISTICS. kaamandakiiyaniitisaara bhaashhaat'iikaasahita. Language. Philosophy...2/14/2011 A list of scanned Sanskrit books at III… 1988. kaadambarii kalikaataaraajadhaanyaan. Psychology. kaalatattvavivechanamam' Part I.. 1984. kaashaakrxtsna dhaatuvyaakhyaanamu naat'akat'ikaa san'skrxtaruupaantaramu. Religion. Sanskrit. Social Sciences. 306 pgs.. Language. Social Sciences. Literature. Language. Raghunatha Bhatta.. 560 pgs. kaarikaavalii muktaavalii.org/…/SanskritIIIT. 0. kaashikaa. Sanskrit. 344 pgs. 419 pgs. Language. daralaalasharmand-a.. Linguistics. 1889.. Sanskrit. Literature. Literature.

kaavyakalaapan. kaavyaalaa chatudaishoo gun'chchhakan. kaavyadapaind-an. 174 pgs.. Linguistics. chat'arjii.. LITERATURE. Sanskrit. Banhatti N d... Sanskrit.. Sanskrit. Linguistics. Psychology. 1953. Linguistics. Literature. 0. kaavyaalan'kaarasuutrand-i svavrxttisamalan'krxtaani. Language. 624 pgs. kaavyamaalaa Part X. 327 pgs. Literature. kaavyadarshanamulyam. kaashyapasan'hitaa. Literature. Sanskrit. Language. Linguistics. kaashikaa dvitiiya bhaaga. kaashyapajnaanakaand-d'an. Linguistics. Literature. kaavyaavali ke ratnaapaanchaalikaa. kaavyaanushaasanamuu.. kaatyaayanashrautasuutramu bhaashhyasahitamu. 176 pgs. 1924. je. LINGUISTICS. Literature. Sanskrit. Singabhupala. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… kaashikaa. kaavyadiipikaa.. Linguistics. pand-d'itavaravaamana. Linguistics..si.. Literature. 1908. kaavyamaalaa haravijayamu. Sri Yathiraja Sampathkumaramuni.. 0. 0. Temples. 1970. 905 pgs. Linguistics. 160 pgs.. 1953.. Sanskrit. 0. Language. Sanskrit. Literature. shriiratnaakara. 1911.. Sanskrit. 1903. Language. Sanskrit. maithilashriigang-gaanandakavindra. durgaiprasaadena. pand-d'itavaravaamana. kaashmiiragranthaavalii prathamakhand-d'amu. Literature. gulaabaraaya. Literature. Sanskrit.. 1911. 246 pgs. sanskritdocuments. Linguistics. Sanskrit. 114 pgs. mahaamahopaadhyaaya shriikarkaachaarya. 1933. Sanskrit.. 270 pgs.. 484 pgs. Language. 1938. shriijagadiishachandra chat't'opaadhyaaya. Language. Language. Sanskrit.. Sanskrit. 102 pgs. Sanskrit. -.. S. Linguistics. parameshvaraananda. aachaaryadand-d'i. Sanskrit. Sanskrit. kaasyapasan'hitaa. vaagbhat't'aa. kaavyaalan'kaarasuutrand-i svavrxttisamalan'krxtaani.. 312 pgs. LINGUISTICS. Sanskrit. Sanskrit. Literature. Philosophy. 70 pgs... 712 pgs. Linguistics. 1941. kaavyaadarsha. Literature. Not Available. Literature.. Language. Narayana Iyyar. Ranga Swamy. Theology. kaavyaalan'kaarasaarasan'grahan. Language. Linguistics. 1968. Sanskrit. 1958.. 1933. aaryeindhra sharma. Linguistics. 220 pgs.. 1936. Narayana Daso Banhatti.iii. Linguistics. kaavyamaalaa ashht'amoguchchhakan.. 540 pgs.. kaashyapa san'hitaa. 1292 pgs. . 1915.. Linguistics Literature.. Religion. 238 pgs... 235 pgs. 359 pgs. Language.. 1894.. Language. Linguistics. Sanskrit. Linguistics... shivad'at't'a. durgaiprasaadena. Sanskrit. Language. Language.. 214 pgs. kaashikaand-d'a grantha. S.org/…/SanskritIIIT. Language. 82 pgs. 1891. Language. Ranga Swamy. Literature. 216 pgs.… 116/167 . Literature. Econo Politics. Sanskrit. 1941. Not available. Literature.. Literature. Sanskrit.. 400 pgs. Language.. Not available.. kaasmiiragranthaavali Vol. kaashmiirasandhaanasamudyama. Language. kaavyad'aakinii. Literature. Sanskrit. Sanskrit... LITERATURE. kaavya ke ruupa. Literature. 1948. Language.. 100 pgs. Linguistics...singaraiyengar... 32 pgs. 0.... kaavyamaalaa dashamoguchchhakan... 69 pgs.. LANGUAGE. Not available. LANGUAGE.. 1948. Sanskrit. Linguistics. Temples. Sanskrit. 1952. 122 pgs.. 1925... J.

... Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… kaavyamaalaa navamoguchchhakan.. Not available.. kaavyashilpamu.. kaing-karyaratnaavali. 1812. Sri Krupa Chanda. Rasikalal Chotalal Parikh... Sanskrit. 1932.. Linguistics. Language. kaavyaprakaashakhand-d'ana.. 166 pgs. mammat'a. 0. 477 pgs. Literature. Language. Sanskrit.... Literature. -... 1939. 207 pgs. kalapasuutramu. kalaamaadhavaa.. 296 pgs. Language.. Linguistics. 0.. 224 pgs.. bhaaradvaja. Sanskrit. kar^mapradiipa... Language. 502 pgs. 329 pgs. Theology. Linguistics. Linguistics. Language. Social Sciences. Linguistics. vinnakoot'a maadhava raavu. kaavyaprakaasha.. Not Available. 1936. Language. Linguistics. Sanskrit. Natural Sciences.. Linguistics. Poems. Sanskrit.. Language. 299 pgs. Language. karand-aratnamu subodhinii samaakhyavyaakhyaaya. Language. 770 pgs...… 117/167 . Chandrakanth.. Sanskrit. . Literature. Language... 68 pgs. 184 pgs. narasimhakavi. Sanskrit.org/…/SanskritIIIT. . Sanskrit. 178 pgs. Sanskrit. 1913. Literature. Literature. kaavyasaarasan'graha. Linguistics.. Sanskrit. 1932. Literature.. Sanskrit. 524 pgs. Literature. kaavyonmoshhan... kaavyaprakaasha krxtayaa vivrxtti. kanadasiddaantachandrika. Literature. Literature. LITERATURE... LANGUAGE. kadhambari. 280 pgs. kaavyaprakaasha naageshvarii t'iikayaa samalang-krxta. LANGUAGE. kaavyapradiipa. sanskritdocuments. shriimammat'aachaarya. Sanskrit. kadaliimanj-junaathamaahaatmyamuu. Language. Language. 1980. 2002. 1967. 0. Language. Linguistics. kamakalavilas. Literature. LITERATURE. Literature. 631 pgs. Linguistics... Language. Linguistics. 60 pgs. kalyaand-avaartikamuusiddhaantaniddddaana. kaavyaprakaasha kaavyaprakaashavistaarakaaravyayaa vyaakhyaaya vibhuushhita. Sanskrit. kaavyaprakaasha naageshvarii t'iikayaa samalang-krxta. mammat'aachaarya.. Literature. Sanskrit.. Language. 39 pgs. kanakaavalii. Literature. 311 pgs. paravastukrxshhnd-amaachaarya. Language. keshava.. Sanskrit. 80 pgs. Somashambhu. 0... Natosa sastri.. Religion. 1838. Sanskrit. Literature. kalyaand-apiiyuushhavyaakhyaasametaa pan'chadashii tattvavivekaprakarand-amu. 0. kalpadrukosha Vol II. topalli ven'kat'araamadaivagn-ena.. kand-aisundarii. Not Available. 329 pgs. 584 pgs. 268 pgs.. Linguistics. Sanskrit... Sanskrit. 143 pgs. Sanskrit. K. Literature. Sanskrit. 616 pgs. Linguistics. Linguistics. suryanarayana sastri. Technology.. Sanskrit. 1976. Not available.. 165 pgs. 280 pgs. banabhatta. Linguistics. Sanskrit. Linguistics. Sanskrit. Language. Sanskrit. 372 pgs. shriibihand-a. 1895. Literature. 244 pgs.. Linguistics. kadambari. LINGUISTICS. Sanskrit. Sanskrit. kalapurnodaya. naaraayand-aacharya. kadambari kalyanam. shriimammat'aachaarya. kamaikaarad'akramaavalii. 1918.. 1932. 1968. 608 pgs. Literature. Sanskrit. t'i gand-apati saastri. 0.. punyananda.. Literature. Linguistics.g. Language. Linguistics. LINGUISTICS... durgaiprasaadena. 1947. Literature. 1963. 1993.. Language. Harishchandra Renupurakar. 1893. Sanskrit. 1967. 1918. 1986. mahaamahopaadhyaayashriigovinda.. 0. ..

.. raghuveera prasad trivedi. Sanskrit... Sanskrit. Linguistics.. bilhana.k ramachandra aiyar. Literature... Language.. kaumarabhrityam with navya balaroga. 230 pgs. Technology. Sanskrit. Sanskrit. Language.. Linguistics. 152 pgs. Linguistics. kavalamkara sara samgraha. kavyanusasana. Sanskrit. kaushhiitaki braahmand-opanishhatu diipikaa. 1950.. Literature. mahaakavi shriideveshvara. 1966. khaadiragrxhyasuutramu vyaakhyaayasahitamu. 185 pgs. Literature. 194 pgs. Literature. Unknown.. Language. Language. Sanskrit. kavyaprakash Rahasyam. Sanskrit. Sanskrit. Theology. Language. kavimanoranjakachampu. vikrama deiva varma.. kenopanishad bhashya. T. Literature. 62 pgs. Linguistics. Religion.. 1968. Linguistics.. 1932. 1961. pandit durgaprasada ed... 0. Sanskrit.. Sanskrit.. Language. Literature. Linguistics. rangaraamanuja. 184 pgs. kavalayananda. rudraskanda. Literature. Psychology. Sanskrit.org/…/SanskritIIIT. 140 pgs..anann'ta krishhana saastri. Sanskrit. kavikalpalataa. Linguistics. khaadiragrxhyasutrama~.. kelikutuuhale prathamastarang-ga. 104 pgs. Sanskrit. khaadiragrxhyasuutramu vyaakhyaayasahitamu. kaumudiisharadaagamamu dvitiiya bhaagamu.. karnd-akutuhala. kaviindraacharyasuchi patramu. Literature. Linguistics. Sanskrit. Religion. 402 pgs. Language. puraatattvaachaarya jinavijaya muni. 2000.. Dr. Language. Sanskrit. Language. 322 pgs. Sanskrit.. Sanskrit. shang-karaananda. 217 pgs. 512 pgs. Vasudeva Jnana Muni. bhat't'a someshvara. Sanskrit. Literature. 1881. kathaakallolini paand-iniiyalaukikavyaakarand-asamaapaniiyaa. aar. kavikalpalataa.2/14/2011 A list of scanned Sanskrit books at III… karnasundari... 98 pgs. Literature. 344 pgs.. Philosophy. raamasharand-ashaastrii. Sanskrit. swami satchidanandendra saraswathi. Language. Linguistics. 0.. Sanskrit. 61 pgs.. Language. kaun'shhiitakagrxhya suutraand-i. Literature. swami satchidanandendra saraswathi. rudraskanda.. 190 pgs.. Literature. 106 pgs.. Literature. 1911. Linguistics. 204 pgs. Not available. kavyamala. Theology. 368 pgs. Language. Literature. kathaka upanishad.. sankara rama sastry c. Language. 133 pgs. Linguistics. 1913. kat'hakagrxhyasuutran' bhaashhyatrayasaarayutan... 1987... 78 pgs.. Literature.. 1964. Linguistics. Linguistics... Language.. sanskritdocuments.. Literature. Literature. 1895. 57 pgs. Literature.. Linguistics... 1956. Literature... kavayadarsha. 1963. 1913. d'aa en gn-aanappa naayud'u. 1913.. 1885.. karnd-aamrxta prapaa.. Literature. Language... siitaaraaamasuuri. Religion. ubhata. Linguistics. Linguistics. Linguistics. Language. Linguistics.. 158 pgs. keshava saahitya mein' samaaja san'skrxti evn' darshan. Sanskrit. 54 pgs. 730 pgs. Language.. 1925. Literature. acharya hemachandra. Language. Sanskrit. t'i ara chintaamani. Shriipat't'abhiramachara~ya. 1942. 480 pgs. Pt. 1944. 1955.seetharam Jayramjoshi. kenoo upanishad. Theology. Literature. Sanskrit. 174 pgs. 1925. 1942. Sarat Chandra Sastry.. Language. Sanskrit. 0. Sanskrit. keivalyaratnamuu. 1978. Willem Caland. Linguistics. Sanskrit.… 118/167 . Sanskrit. Linguistics. Language. Language. Linguistics. 1921. 396 pgs. Sanskrit..

1913.. Ramanuja Swamy. 1934. 1954. Language.. Samhita. Literature. krishhnd-a yajurveidiya taitiriiya san'hita. 428 pgs. Sanskrit. rudraskanda. 100 pgs. 1917. Technology. Ganapati Sastri. 868 pgs. Linguistics. 0. khaadiragrxhyasuutrn' rudraskandavyaakhyaasahitan. Language. Literature.. 1964. bhaaravi.. Language. 502 pgs. Sanskrit.. Literature. Kasinatha Sastri Agase. Philosophy. Linguistics. Language. Sanskrit. Sanskrit.. chan'd'iiprasaada sukla.p. Economics. kiraataarjuniyamu. kruushhnd-ayajuvaidiyataittiriiyasan'hitaa bhaaga 8. Language. 1924. khand-d'anakhand-d'akhaadhyamu. krishhnd-a yajurveidiya taitiriiya san'hita. RELIGION. Literature. 1966..t. Theology. 88 pgs.2/14/2011 . kriyaadhikaaran' bugusan'hitaa.. 318 pgs. 204 pgs. 434 pgs. 1937. 1904.. Literature. 438 pgs. 1965. 1901. 442 pgs. THEOLOGY. Linguistics. G. 180 pgs.. A. Jha..… 119/167 .. Sanskrit.. Literature. Language. Sanskrit.. 586 pgs..... 1997. Religion. Sanskrit. visnutrata... 0. Sanskrit... 1905. hari naaraayand-a aapat'e. kaasmiirika keishava bhat't'a.. Language. Literature. Linguistics. kruushhnd-ayajuvaidiiyataittiriiyasan'hitaa_bhaaga_7.y. shriiniilakand-t'hashivaachaarya. Linguistics. Bhrugu Maharshi. 1940. THEOLOGY.. Literature. 588 pgs. sri vishvanath divedi. Sanskrit.. shriishriiharshha. Sanskrit.... Linguistics. Sanskrit. Linguistics. Sanskrit. Literature.. Language. bhaaravi. Language. Sanskrit. kanhaiyaalaala krxshhnd-adaasa.org/…/SanskritIIIT. Sanskrit. Literature.. Language. krama diipika. Linguistics. Literature. Linguistics. 1913. Sanskrit. Language. Sanskrit.... 125 pgs. Linguistics. Language.. 642 pgs. kinkind-ii maalaa. hari naaraayand-a aapat'e. kaashinaatha saastri. khand-anakhand-akhaadhamu.. 1905.. 294 pgs. Sanskrit. shriiniilakand-t'hashivaachaarya. kiskindhakanda. Sanskrit.. 580 pgs. Theology. kishhkin'dhaa kaand-d'amuu. Sanskrit. kaashinaatha saastri. 1936. kriyaasaara upadeshachatushht'ayaatmaka prathamo bhaaga. Literature. Sanskrit. Mahadeva Sastri.. 522 pgs. 217 pgs. Language. kriyaasaara upadeshachatushht'ayaatmaka prathamobhaaga. kriyatmaka ausadahiparichaya vijnan. d'an' chandrabhaana raavata. Theology. krxshhnd-a bhakti saahitya vastu srota aura san'rachana.. 0. Sanskrit.... Religion. kowt'iliiyan' arthaishaastramu. 584 pgs. Sanskrit. Linguistics. kiraataarjunaayamu. kriyaasaara upadeshachatushht'ayaatmaka prathamo bhaaga. kokasandesa. 1954. 1905. sanskritdocuments. 128 pgs. Psychology.. 248 pgs. shriiniilakand-t'hashivaachaarya.v. pg A list of scanned Sanskrit books at III… khaadiragrxhyasuutramu vyaakhyaayasahitamu. 315 pgs. 1954. 1957.. Sanskrit.. khand-d'anakhand-d'akhaadya Part 1. Literature.. shriiniilakand-t'hashivaachaarya.. krxshhnd-aayajuvediiyataittiriiyasan'hitaa Kanda Ii Part Iv. 1917... Language. RELIGION. Sanskrit. valmiki.. kriyaasaara panj-chamaadichaturdashopadeshaanta dvitiiyobhaaga. Sanskrit. Bhrga Samhita. 584 pgs. Literature. Mahalinga Sastry. Linguistics. Linguistics. 586 pgs. Language. Religion.. Linguistics. Literature. 542 pgs. Sanskrit.. Linguistics. 1953. Literature. khilaadhikaaran' bugusan'hitaa.

. shrii vaasudeivadiiqs-ita. krishna kumar davan. 1932. Literature. Linguistics. Language. Literature. Linguistics. Linguistics. kushhnd-agiiti. Religion... Sanskrit. 178 pgs. 1937..org/…/SanskritIIIT. kun'damaala.... Language.. Sanskrit. Linguistics.. Social Sciences. Literature. 1922. Language. Bhatta Lakshmidhara. ksemendra.. krxshhnd-ayajuvaidiiya taittiriiyasan'hitaa prathamo bhaaga. Bhatta Lakshmidhara. 1901. Linguistics.. Raghu Vira.2/14/2011 g . Literature... Linguistics. krxtyakalpataru daanakaand-d'an' Vol 5.. Sanskrit. 646 pgs.. krxshhnd-ollaasa champuukaavyaprakaand-d'amu. kundmala. Language. kusumaanj-ajalibodhanii. shriiratnapaand-i. krxtyakalpataru shraddhakaand-d'an' Vol 4. krxtyakalpataru raajadhar^makaand-d'an' Vol 11. Sanskrit. 1901.. Language. krxtyakalpataru niyatakaalakaand-d'an' Vol 3.. Not Available. Social Sciences. Theology. Language. Sanskrit. 0. Sanskrit.. Linguistics. dinnaaga. 468 pgs. Religion.. Literature.. 390 pgs. Literature. Social Sciences. Linguistics. Sanskrit. 1962. 1950. Sanskrit. Linguistics.. 176 pgs. Literature. Language. 1922. Linguistics. soomanaatha.. 0. 1961. Sanskrit. Language. 300 pgs. krxtyakalpataru grahasthakan'd'aa vol 2. 646 pgs. sanskritdocuments... Sanskrit.. 276 pgs. 1948. 1912. Sanskrit.. shri paa raa subrahmand-yashaastriind-aa. 354 pgs. kutuuhalavrxtti. Language. 340 pgs. Sanskrit. Sanskrit. kusumaanj-jali shriimadudayanaachaar^yavitachita. Literature.. Language. Linguistics. mahaakavishriikaalidaasa. Linguistics.. ksemendralahukavya sangrha.. Theology. Language. Sanskrit. Literature. 58 pgs. Theology. Language. 358 pgs. 659 pgs. 1901. Theology.. ayendra sharma gen ed. bhakta Darshan. krxshhnd-ayajuvaidiiya taittiriiyasan'hitaa ddhitiiyo bhaaga. 1950. 1941. Literature.. 566 pgs. kutuuhala vrxtti. 32 pgs. Linguistics. Social Sciences. 268 pgs. 420 pgs. Psychology.. 1951. Sanskrit. Language. 1956. kusumaanj-jalibodhani.. Language..... bhat't'a lakshmidhara. 1960. Language. krxshhnd-ayajuravediiyaa kapishht'ala kat'ha san'hitaa. 478 pgs. Literature. 646 pgs. 1908. 308 pgs. Literature. Literature.. krxshhnd-ayajuvaidiiya taittiriiyasan'hitaa trxtiiyo bhaaga. 1943. 402 pgs. Religion. varadaraaja..… 120/167 .. krxtyasaagara. Religion. Bhatta Lakshmidhara. 422 pgs. Linguistics. Sri Kasinath Sastri. Pandit Laxman Sastri Dravid. Linguistics. Sanskrit. Sri Varadaraja Mishra. Literature.. Sanskrit. 486 pgs. Philosophy.. Language. Sanskrit. 406 pgs. Bhatta Lakshmidhara. 297 pgs. Sanskrit. Literature.. Literature. kumarasambhava. 545 pgs... Sanskrit. Shriimatsaayand-aachaara~yaa. kalidasa... Sri Kasinath Sastri... Kasinatha Sastri Agase... Sanskrit. Sanskrit. 1977.. Literature. Sanskrit. 1944. 0. Sri Kasinath Sastri. Philosophy. shriimatsaayandaachaarya.. Sanskrit. Language. krxshhnd-ayajurvediiyataittiriiyasan'hitaa bhaashhyasametaa etatpustakamu.. krxshhnd-ayajura~vediiyataittiriyasan'hitaa Shhashht'ho Bhaagah. 1961. ksemendra. kumaarasambhavan' mahaakaavyamu pun'savaniivyaakhyaaya sanaathiikrxtamu. 1901. Linguistics. Sanskrit. 1900. 580 pgs. krxyajuraveda. Psychology. Linguistics. A listpg of scanned Sanskrit books at III… krxshhnd-aayajuvediiyataittiriiyasan'hitaa Part Ii. Sanskrit. Sanskrit.

2/14/2011

A list of scanned Sanskrit books at III…

kutuuhalavrxtti... bhakta Darshan, Language. Linguistics. Literature. Sanskrit, 1960. 526 pgs. kutuuhalavrxttisaarasam'graha... Not Available, Philosophy. Psychology. Sanskrit, 0. 368 pgs. kuvalayaananda chanddraalokasahita alang-kaarachandrikaavyaakhyaaya cha vibhuushhita... budhavarashriimadappayyadiiqs-ita, Language. Linguistics. Literature. Sanskrit, 1833. 282 pgs. kuvalayaanandachandrikaachakairan'alad'akaaratatvaj'ja... Venkatachari, Art. Sanskrit, 1943. 319 pgs. kuvalayaanandakaarikaa alan'kaaradiipikaavyaakhyaayaa san'valitaa trxtiiyaavrxtti... shriiyutaashaadharabhat't'a, Language. Linguistics. Literature. Sanskrit, 1927. 114 pgs. kyo uttaraadhai... Madavacharya Sastri, Religion. Sanskrit, 1982. 693 pgs. laayanashrautasuutramu vrxtti... naaraayand-a, Language. Linguistics. Literature. Sanskrit, 1917. 471 pgs. laghu upanishad... narayana swamy aiyar k tr, Religion. Theology. Sanskrit, 1967. 302 pgs. laghukaumudii... varadaraaja, Language. Linguistics. Literature. Sanskrit, 0. 415 pgs. laghukomudii... 0000, Linguistics Literature. Sanskrit, 0. 147 pgs. laghumaanasamuu... Gangadhar Bapurao Kale, Philosophy. Psychology. Sanskrit, 1944. 40 pgs. laghupaaniiyamu... Rajaraja Varma, Sanskrit Grammer. Sanskrit, 1911. 228 pgs. laghupaaraasharii bhaashhya... diivaana raamachandar kapuura, Religion. Theology. Sanskrit, 0. 396 pgs. laghusabendusekjara... nagojibhatta, Language. Linguistics. Literature. Sanskrit, 1927. 846 pgs. laghushabdedndushekhara vyaakarand-avibhaage saptadasan'pushhpamu napadaantasuutraanto bhaaga... mahaamahopaadhyaayashriinaageshabhat't'a, Language. Linguistics. Literature. Sanskrit, 0. 264 pgs. laghushabdendukalaa... pand-d'ita shrii shobhaakaanta jhaa, Religion. Theology. Sanskrit, 1970. 144 pgs. laghushabdendusekhara... khuhiijhaa, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1938. 264 pgs. laghushabdondushokhanamulapuvedhve... , . Sanskrit, 0. 163 pgs. laghushabdondushokhanamulapuvedhve dvitiyo bhaagaha... , . Sanskrit, 0. 163 pgs. laghusiddaantakomudii... Kaushika Venkatanarasimhachari, Linguistics Literature. Sanskrit, 1937. 186 pgs. laghusiddanta kaumudi... varda raja, Language. Linguistics. Literature. Sanskrit, 1948. 180 pgs. laghusiddhaantakaumudii anuvrxttyaadisuuchakena t'ippand-ena pratyaahaara varnd-avyavahaaragnaapaka koshht'akau... shriivaradaraajapand-d'ita, Language. Linguistics. Literature. Sanskrit, 1894. 176 pgs. laghusiddhaantakaumudii san'skrxta hindiit'iikaa... shriivaradaraajaachaarya, Language. Linguistics. Literature. Sanskrit, 1970. 382 pgs. laghusiddhaantakaumuditattvaprakaasha sottaraa prashnaavali 20 varshhaand-aan' prashnapatrasahita... pand-d'itashriiraamagovindashukla, Language. Linguistics. Literature. Sanskrit, 1974. 248 pgs. laghustuti... t'i gand-apati saastri, Language. Linguistics. Literature. Sanskrit, 1917. 63 pgs. lalitamaadhavan' naat'akamu t'ikayaa... shriiruupagoosvaamiprabhupaada, Language. Linguistics. Literature. Sanskrit, 1969. 310 pgs. lalleishvariivaakyaani... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 36 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

laqs-and-aavimashe... V. Subrahmanya Sastri, Philosophy. Psychology. Sanskrit, 0. 32 pgs.

121/167

2/14/2011 A Sastri, list of scanned Sanskrit books at III… laqs and aavimashe... V. Subrahmanya Philosophy. Psychology. Sanskrit, 0. 32 pgs.

laqs-miisahasramu... Not available, Religion. Theology. Sanskrit, 0. 813 pgs. laqs-miitantramu... vi. krishhnd-amaachaarya, Language. Linguistics. Literature. Sanskrit, 1959. 389 pgs. laqs-miitantramuu volume 87... pan'dita vi krxshhnd-amaachaarya, Language. Linguistics. Literature. Sanskrit, 1959. 391 pgs. lat'akamelakamu... shriishadgadhara, Language. Linguistics. Literature. Sanskrit, 1900. 36 pgs. laugaaqs-i grxhya suutraand-i bhaashhyopetaani dvitiiyobhaaga uttaraarthamu... devapaala, Language. Linguistics. Literature. Sanskrit, 1937. 460 pgs. laugaaqs-i grxhya suutraand-i devapaalakrxtabhaashhyopetaani Vol 2... Madhusudan Kaul Shastri, Language. Linguistics. Literature. Sanskrit, 1934. 448 pgs. laukikanyaayaanj-jali dvitiiyobhaaga... colonel g a jacob, Language. Linguistics. Literature. Sanskrit, 1925. 94 pgs. laukikanyaayaanj-jali trxtiiyobhaaga... colonel g a jacob, Language. Linguistics. Literature. Sanskrit, 1911. 158 pgs. lectures on patanjali s mahabhasya vol I... subrmanya sastry p s, Language. Linguistics. Literature. Sanskrit, 1944. 384 pgs. life divine... aurobindo, Language. Linguistics. Literature. Sanskrit, 1942. 160 pgs. liilaavatii uttaraardharuupo dvitiiyobhaaga... shriimadbhaaskaraachaarya, Language. Linguistics. Literature. Sanskrit, 1937. 180 pgs. ling-ganushaasanamam... Panini, Philosophy. Psychology. Sanskrit, 1885. 192 pgs. ling-kapuraand-amuu... mahaarshhi vedavyaasa, Religion. Theology. Sanskrit, 1885. 848 pgs. list'as aaph manuscript's... Not Available, General. Sanskrit, 1925. 106 pgs. lokaparalokakaasudhaara bhaaga 2... hanumaana prasaada, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 0. 244 pgs. lokaparalokakaasudhaara bhaaga 4... hanumaana prasaada, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 0. 288 pgs. lokikanyaayaatralin' tutiyo bhaagan... jaakobha, Language. Linguistics. Literature. Sanskrit, 1904. 169 pgs. maadava vijaya... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 457 pgs. maadhamaahaatmaya... , Religion. Theology. Sanskrit, 0. 134 pgs. maadhavanala kaamakn'dalaa... shriikrxshhnd-adaasaatmaja, Language. Linguistics. Literature. Sanskrit, 1889. 214 pgs. maadhaviiyaa dhaatuvrxtti paand-iniiyadhaatupaat'havyaakhyaanaatmikaa... shriisaayand-aachaarya, Language. Linguistics. Literature. Sanskrit, 1964. 720 pgs. maadhurii darshanamu... raayaproolu subbaaraavu, Language. Linguistics. Literature. Sanskrit, 0. 69 pgs. maadhvamukhabhad'ga... Sri Surya Narayana Shyam Sukhla, Philosophy. Psychology. Sanskrit, 0. 48 pgs. maal'avikaan'gnimitramu naamanaat'akamu... shriimatkavikulashiromand-inaa shriikaal'idaasamahaakavi, Language. Linguistics. Literature. Sanskrit, 1892. 282 pgs. maalatiimaadhavan' prakarand-amu vyaakhyaaya... mahaakavishriibhavabhuuti, Language. Linguistics. Literature. Sanskrit, 1864. 500 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 122/167

2/14/2011

A list of scanned Sanskrit books at III…

maalatiimaadhavan' prakarand-amu vyaakhyaaya... mahaakavishriibhavabhuuti, Language. Linguistics. Literature. Sanskrit, 1864. 310 pgs. maanameyarahasyalokavaatvikamu... Srinivasa Charya. L, Sanskit Sastras. Sanskrit, 1925. 672 pgs. maanameyoodaya... t'i. ganapati saastri, Language. Linguistics. Literature. Sanskrit, 1912. 133 pgs. maanasaprachaarikaa... Not available, Language. Linguistics. Literature. Sanskrit, 1885. 156 pgs. maanava dharma saara... Not Available, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1943. 285 pgs. maand-d'uukyaadhupanishhatrayii... pn'. raamadevaachaaye, RELIGION. THEOLOGY. Sanskrit, 0. 474 pgs. maatukaabhedatantramu... Pandit Amareswar Thakur, Lord Hanuman. Sanskrit, 1933. 153 pgs. maayaavaadakhan'd'anamu... Srimadananda Theertha, Art. Sanskrit, 1875. 165 pgs. madanapaamnidhant... krishna das, Technology. Sanskrit, 1954. 192 pgs. madanapaamnidhant... krishna das, Technology. Sanskrit, 1954. 328 pgs. maddhvamukhaalankaara... Vanamali Misra, Philosophy. Psychology. Sanskrit, 1936. 148 pgs. madhthasida ntakaumudii... prabhaakara, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1939. 693 pgs. madhuraan'jali... G.ramacharya, Literature. Sanskrit, 1996. 346 pgs. madhusuudanasarasvati kruti advatasiddhi... Sri Harihara Sastri, Philosophy. Psychology. Sanskrit, 1893. 344 pgs. madhuvidhyaa shriivishvakarmapaaramyaparend-a sauparnd-ena vyaakhyaanena samaalin'gitaa... durishet'i ven'kat'araamaachaarya, Language. Linguistics. Literature. Sanskrit, 0. 70 pgs. madhvanidanmu... shrii sudarshan sharma, Technology. Sanskrit, 0. 530 pgs. madhvasiddaan'tasaarasan'grahada vishhanurxmand-ii... Not available, Language. Linguistics. Literature. Sanskrit, 0. 253 pgs. madhvatantramukhamadarnamu... shriimadappayadiiqs-ita, Language. Linguistics. Literature. Sanskrit, 1940. 156 pgs. madhyakaaliina san'skrxta naat'aka... raamjii upaadhyaaya, Language. Linguistics. Literature. Sanskrit, 1974. 516 pgs. madhyamavyayoga... bhasa, Language. Linguistics. Literature. Sanskrit, 1948. 56 pgs. madhyasiddhaantakaumudii... shriimadvaradaraaja, Religion. Theology. Sanskrit, 1906. 312 pgs. madyakalin sanskrit natak... ramji upadya, Language. Linguistics. Literature. Sanskrit, 0. 522 pgs. mahaaban'dho... Sripati Sharada Misra, Literature. Sanskrit, 2001. 493 pgs. mahaabhaarata aranyakaparvam bhaaga 4... vishnu s sukthankar, Language. Linguistics. Literature. Sanskrit, 1942. 610 pgs. mahaabhaarata sabhaaparvamu gn-aanadiipikaa... shriidevabodha, Religion. Theology. Sanskrit, 1949. 55 pgs. mahaabhaarata san'skrxta muula hindii anuvaada... Not available, Religion. Theology. Sanskrit, 0. 1282 pgs. mahaabhaaratama~ shaantipar^vand-i Part I... P. P. Subramanya Sastri, Language. Linguistics. Literature. Sanskrit, 1935. 690 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

h

bh

hh

k

j hik

d

bh

d d' l

t

t'h

d'hii

i

i

d

123/167

... Linguistics.. 310 pgs. Sanskrit.. 1926. mal'aya maaruta part Ii. 173 pgs. Spiritual Experience And Mysticism. Linguistics. 1964. 1896. raaghavan. Literature.. Damodar Jha. 301 pgs. Sanskrit. 1920. 151 pgs. 0. 1891. manasollasa vol Iii. Language. 1979. Literature. 1961. 1982.. maharastriya gyan kosh sharir khand. Sanskrit. 0.. 50 pgs. Sanskrit. 894 pgs. ke. Literature. malavikamitra naatakamu. Sanskrit. Linguistics. 554 pgs. Literature. sheishhasharma. Language. Language.. Language... mand-isaara anumaanakhand-d'a. Language. Sanskrit. Language. Sanskrit. Sanskrit. mahinmastotramu madhusuudanii vyaakhyaa trxtiiyan' san'skarand-amu. Sanskrit.. 482 pgs. Literature. malayamaarutan' dhvitiyan' spandan. Literature. Sanskrit... Ramakrishna Harshaji Sastri.... Sanskrit. Pandit. V. mahaapuraand-apanachamapathalakaand'aa. mantraratna manjushhaa. Not available. Language. 202 pgs. 1965.. Literature. 804 pgs. Sanskrit. mantraayechandodaya. 110 pgs.. Sanskrit.. 456 pgs. Language..… i t N t il bl L Li i ti Lit t S k it 0 350 124/167 . manoramaashabdaratna praqs-aittaraava liipradhamakhand-d'an.. THEOLOGY. 1971. 1828. shriidaqs-ind-aamuurti.. mahaabhaashhyamuu. Literature. shrii raajanaaraayand-a shaastri. mahaavidhyaavid'ambanamu t'ikaabhyaan' dashashlokii vivarand-a t'ippand-i. 1914. Linguistics. Sanskrit. Not available. Sanskrit. Literature. 0. RELIGION.. Sanskrit. 0. shrimadhusuudanasarasvatii. Sanskrit. Literature. Sanskrit. Language. manmahaabhaaratamu bhiishhmaparva 6. Sanskrit. 1901. Linguistics. Literature. Language. Literature.2/14/2011 A list of scanned Sanskrit books at III… mahaabhaashhyakunj-chikaa darabhang-gaamand-d'alaantargara t'haad'hii graamanivaasinaa. 442 pgs. Linguistics. Literature. Linguistics. trivikramabhat't'aaraka.. Linguistics. mahaakaavyaa ratnaavalii. Language. 48 pgs.... mahaaviiracharitamu. Linguistics. 1971. 575 pgs. mantramahaidadhigrandhahaa. mahaaradha padakooshaa. 0. . Language... goopiinaatha..org/…/SanskritIIIT. 1970. Linguistics.raghavan. Literature. Literature. shriibhavabhuti.. . Language. Theology. General... Somraj Krishna Das. Literature. Linguistics. Sanskrit. 112 pgs. 1971. mahabharat sahitha pradma kand. mahaabhaashhyat'iikaa chaturthaanhikaparyantaa bhaaga 1. Literature. Sanskrit. 248 pgs. 0. Language. Language... manusambhava. Linguistics. Language. Sanskrit. Language. Language. vyasa. 330 pgs.. Linguistics. 302 pgs... 190 pgs.. Language. maitraayand-iiyamaanavagrxhyasuutarman.. 790 pgs. 50 pgs. vi. Sanskrit.. Linguistics. sanskritdocuments.. Theology. 0. Linguistics. 795 pgs. Sanskrit. Literature.. t'ii aara krxshhnd-achaarya. majamuuaajaabtaa phaujadaarii. -. king someswara.. Linguistics. 166 pgs.. mantroddhaarakosha saubhaagya tantrashcha. Sanskrit. Literature. 1928. mand-d'ala braahmand-opanishhatuu. pandd'itashriiharishang-karatbhaasharmand-aa.. shrii vii svaaminaathana. Sanskrit. manu... Literature.. . Language. Sanskrit. Linguistics. mahadeva.. Linguistics. manu smruti. 0. 1926.. Religion.. 1968. Language. 190 pgs.. . 170 pgs.. Linguistics. baladeva upaadhyaaya. mahaakavibhaasa eka adhyayana. Sanskrit. sridhar venkatesh kethkar. 1941. bhat't'avaadiindra. Literature. Not available. Linguistics. 163 pgs.. 1066 pgs. Religion. Linguistics.

120 pgs. 1930. General.. .. Language. 536 pgs. LITERATURE.… 125/167 . manusmrxte.. 1898.. miimaan'saakoshha Part 3. Not available. LITERATURE. 246 pgs. Sanskrit.. Literature. Sanskrit.. miimaan'saanyaayaprakaasha aapodevii. 1940... 427 pgs. manusmuuti Vol I. LINGUISTICS. miimaan'saabhyudayan. LANGUAGE.. Philosophy. not available.. LINGUISTICS. 0. Literature. Sanskrit.. mimaan'saanukramand-ikaa. gan'ganatha. LINGUISTICS. 1930. Sanskrit. gan'ganatha jaha.. 539 pgs. Sanskrit.. Language. Not available. LITERATURE. 1909. 0. kalidasa. LANGUAGE... Tatacharya. Linguistics. Halayudha. 1932. Sanskrit.. manusmrxtivishhayaanukramand-ikaa. 1914. Sanskrit.. mimaan'saanukramand-ika. Linguistics. Sanskrit. Language. Literature.. Literature. Linguistics... 570 pgs.t. Literature. maraat'i gran'thaan'chii bayaajavaara yaadi bhaaga nowlaa. Language. Sanskrit. miimaan'saadarshanamuu. mimaan'sha darshanam pada I. aapadeva. Language. 214 pgs. 1940. 1961. 1934.. Linguistics. LINGUISTICS. 740 pgs. Sanskrit. Sanskrit. Sanskrit.. shriimadaapadeva. Literature.2/14/2011 A list of scanned Sanskrit books at III… manuscripts. shrimajjaimini.. Sanskrit. mediniikosha. 216 pgs. Sanskrit... 48 pgs. Linguistics.. miimaan'saashlokavaartikamu nyaayaratnaakaraaravyayaa vyaakhyayaa. miimaan'saadarshani. Literature. Sanskrit. 541 pgs. 613 pgs... Religion. shriikrxshhnd-adaasaatmaja. Language. miimaan'saanyaayaprakaasha saaravivechinyaakhyaayaa. Literature. LANGUAGE.... Sanskrit. Sanskrit. 1980. miimaan'saashlokavaartikama. LINGUISTICS. 0. . Literature... Sanskrit. 350 pgs. Language. Linguistics. Linguistics. shriimatkrxmaarilabhat't'a. Literature. 238 pgs. 1948. Religion.. miimaan'sasaarasang-graha. 96 pgs. shriimatkumaarilabhat't'apaada. Sanskrit. Sanskrit. meghasandesa. Linguistics. shriimadaapadeva. Philosophy.. kevalaanandasarasvati. Linguistics. LITERATURE. 1021 pgs. 1956. miimaan'saakoshha Part IV. Linguistics. 405 pgs. LINGUISTICS. Theology.. 554 pgs.. shriishang-karabhat't'a. Language.. Sanskrit. 0. Ganganatha Jha. sanskritdocuments.. manusmaruthihi.. 1928. Literature. LITERATURE. miimaan'saanyaayaprakaasha saaravivechinyaakhyaayaa. LANGUAGE.. Language.. 1925. raamachandra. Psychology. Literature.. 645 pgs. mevad'a patana. mandana mishra. 502 pgs. 638 pgs. Sanskrit. 531 pgs. Sanskrit. Literature. 86 pgs. Linguistics. sabhara bhaasya.. miimaan'saaprakarand-agrantha miimaan'saanyaayaprakaasha t'ippand-yaadisamalan'krxta.. 142 pgs. miimam'saashaastrasavasve. LITERATURE.. 238 pgs. Language. Linguistics. Not available. Language. LANGUAGE. kevalaanandasarasvatii. LANGUAGE.. 210 pgs. LANGUAGE. Literature. 90 pgs. LITERATURE.. Sanskrit.. aapadeva. 1954... Sanskrit. Theology..org/…/SanskritIIIT. Linguistics. Sanskrit. miimaan'saakoshha Part II.. 1943. LINGUISTICS. Sanskrit. kevalaanandasarasvatii.d. Linguistics. manuscripts. 1948. 0. Sanskrit. 1948. 1831. 0.. mimaan'saamand-d'anena mand-id'ataa... Language. 1953. 1898. 551 pgs. Language. Malkuluka Bhatta. Literature. kevalaanandasarasvatii. Language.

. LINGUISTICS. Mimamsa Shastram. 1918. muhurta chintaamand-i. Literature.… 126/167 . mitralaab. Sanskrit. mukttipradiipa. Sanskrit. muhuurtachintaamand-i pramitaaqs-araat'iikaasameta.... Not available. 1882. LANGUAGE. 30 pgs. Linguistics. 278 pgs. Sanskrit.. swami satchidanandendra saraswati. Literature. Linguistics. 146 pgs. na ii hindii rachana pahalaa bhaaga. 82 pgs... Sanskrit.. Literature.. Not available. 1893. Sanskrit. -. mumuksu savasvaasaraa sangrahaa. Linguistics. 0. General. Linguistics. Religion. Linguistics. 1894. 1882. mukundaanandabhaand-an. Not available. mulagadaadhariyo shabdakhand-d'an. Sanskrit. Not Available.2/14/2011 A list of scanned Sanskrit books at III… miman'sadarshanei. Language. Sanskrit. shrudrakavi. 1945.. Linguistics.. 1904. Linguistics... Kastnath Trimbak Telano. Linguistics. 84 pgs. Literature. visakhadatta. Sanskrit. General. Language. Linguistics..org/…/SanskritIIIT..a.. muuhuurtamaartan'd'a maartad'avallabhaaravyavyaakhyaasahita. Literature. moqs-akaand-d'amu chatudaisho bhaagan. naaraayand-araam aachaarya. mrxgendragam.. mrxchchhakat'ikei. 320 pgs. 1961. 1925. Linguistics. Sanskrit. Literature. mugendraagaman. Language. mundaka upanishad. Literature. Linguistics. Language. Sanskrit.. Sanskrit. mudrakshasa. Language. Language. muchchhakat'ikan. muhutairatnamu. subramanyasharmand-a.. Sanskrit.. 107 pgs. Linguistics. 228 pgs. Julius Jolly. 453 pgs. mudraaraaqs-ase pradhamo kand'khaha.. LITERATURE. Language... N R Bhatt.. Sanskrit. Linguistics. 380 pgs.. Literature. Literature. Literature. mudraraksasa. varashudrakaraaja. Literature. Language. 0. 1850. Literature.. 386 pgs. bhatta naaraayand-akaant'a. 390 pgs. Sanskrit. Literature. 1986. 382 pgs. ke e krxshhnd-asvaani ayyara. 580 pgs. Language.. Sanskrit. mruchhakatikamu. Language. shriiraamaachaarya. Language. Language. Language. Sanskrit. Sanskrit. saahityabhuushhand-a shriijonnalagad'd'a satyanaaraayand-amuurti. Literature... 2000. 1975. LITERATURE.. Sripada Bhat.... Language. Sanskrit. Not Available. Sanskrit. Language.. LINGUISTICS. 1943.. Visakadatta. 156 pgs. 274 pgs.. Language. mudraaraaqs-ase. shriikaashipati.. mishrabandhuvinoda bhaaga 3. 0. 1970. 1970... 1937. Linguistics Literature.. Sanskrit. Sri Gadadara Battacharya. 138 pgs. Sanskrit. mitaaqs-araat'iikaayaa. . Language. 433 pgs. Sanskrit.. . 1962.. sanskritdocuments. LANGUAGE. 0. Sanskrit.. 1948.. Literature.. Literature. Linguistics. Linguistics. Literature..v. not available.. Linguistics.rangaswami.. Literature. 1918. LINGUISTICS. 382 pgs. Sanskrit. Linguistics. LANGUAGE. K. Literature.. 1999. 130 pgs. Theology.. muulaavidyaniraasa. ramnaraya lal beni madhav. mishrabandhuvinoda bhaaga 1.. 0. 330 pgs. Sanskrit. Not Available. mnut'iikaasad'gahan. Language. Sanskrit... 0. 433 pgs. mulaavidhaa bhaashhyavaartikavirudva. 1962. 128 pgs.... 0. 501 pgs. 798 pgs. muulavidayaa niraasa. LITERATURE.. 490 pgs. Sanskrit. 394 pgs. Linguistics. Sanskrit.. 336 pgs. naa mahaaraashht'ra yaatra... Sanskrit. 466 pgs. Visadhadatta. Not Available. Astrology.

krishna Das. Literature. Sanskrit.. nandisuttram. Literature. Sanskrit. Linguistics.. Sanskrit. naatyashaastram. Sanskrit.. Linguistics. nalacharitranaat'akamu. 0. 1962.2/14/2011 A list of scanned Sanskrit books at III… Language. 90 pgs. Language.. 0. 380 pgs. History. Sanskrit.. Theology. 584 pgs. Sankara Rama Sastri C... 0. Sanskrit. Linguistics.. 1961. Literature. naat'uuyadarpand-amu prathamoo bhaaga. 1951. Linguistics.. Sanskrit. 220 pgs. Literature.. bharata. 460 pgs.org/…/SanskritIIIT. 254 pgs.. baabulaal shukla... Sanskrit. Sanskrit. 1940. Sanskrit. naasikeita paakhyaanamu. naaradhiya mahaapuraand-amu. Sanskrit.. kheimaraaja shriikrxshhnd-adaasane. namalinga sasanam.. Language. Linguistics. Linguistics. 1925. 0. 135 pgs. Linguistics. natyasastra. Sanskrit. Literature. raamachandra.. Language. Sanskrit. Linguistics. Literature. Religion. Literature. 676 pgs. 1966. Linguistics. 292 pgs. 18 pgs. The Arts.. Sanskrit. 550 pgs. Sanskrit. 1927.. naanaartharnd-avasan'qs-eipa.. raamachandra. . nagananda.. naat'yadarpeind-amuu volume 1. 1929. naishhakarmya sidhdhi. Sanskrit. narapatijayacharyaasvarodaya jayalaqs-miit'iikaasameta. Sanskrit. Sanskrit. Literature. Linguistics. Linguistics. 84 pgs. Language. Sanskrit. 204 pgs. 274 pgs. 184 pgs. Literature. Language. naat'akachandrikaa. Literature. 1903. Sanskrit..ramakrishna kavi.. 1506 pgs. Sanskrit. 1964. Language.. shriimachchhiromand-isudhii.. m. Language.. Language. 267 pgs.. Linguistics.. naageshaashayanind-aiyan' pradhamo skandhahan.. Literature.. 0. 242 pgs. Language.. 0. naaraayand-iiyan. nalopakhyanam. 1899. 270 pgs. Language. Language. Literature. sri bharatamuni. Literature. Language. Language.. Linguistics.. Literature. shriimadvedavyaasa. shriimannarapatikavi. Not available.. -. amarasimhudu. Sanskrit. c.. naishhadhakaavyam vyaakhyayaa sameitam. 265 pgs. Linguistics. Language. 54 pgs. Literature.. Literature. 1956. Narayana Sastrigal. Language. 2005. Linguistics. 1965. naaraayand-abhat't'a. Language. venkataramaniah.. -. naushada charitam.. Literature. 612 pgs.. 1817.. Literature. Biography. 252 pgs.. nalooparavyaanamuu. naat'yashaastramu vivrxtisametamu bhaaga 1. Linguistics. Linguistics. 366 pgs. Sanskrit. Literature. Language. 724 pgs... Linguistics.… 127/167 . 1911. Sanskrit. Sanskrit. K. Literature. Language. Language. Linguistics.. The Arts. vyasa. Language.. Sanskrit. Linguistics. Literature.. 1929. 518 pgs. Language.. mahaakavi shriiharshha. Language. 396 pgs. 216 pgs. Sanskrit. 1956..... Sanskrit. narakasuravijaya vyayoga.. shri suresvaracarya. 350 pgs. dharmasuri. naishkarmya siddhi. naishhadhakaavya. sanskritdocuments.. -.. bharatamuni. 0. 77 pgs. natyasastra with the commentary of abhinavagupta vol-iii.... shri devavaccaka. Literature. 1932. 1954. Sanskrit. Linguistics. Literature. Literature. nanj-avaada nanj-avaadasan'gn-akayinaddigajatna t'ikayaa. naaradapancharaatran. 1912. navagiitaakusumaanj-jali. chan'drika. 1943. Linguistics. Linguistics. narasin'gapuraand-amu. Literature... Language. 1913. Sanskrit. Geography. Linguistics. ta gand-apatishaastrii. Literature.

Sanskrit. 625 pgs. 68 pgs.2/14/2011 A list of scanned Sanskrit books at III… nayaayaamrutamu dhvitiyo bhaagan. niilakand-t'havijayan. Sanskrit.. 85 pgs. 482 pgs. 1926. 76 pgs. ng-aapakaasan'grahamuu. Literature.. Mahesvara. 91 pgs. Sanskrit. Language. 649 pgs. Sanskrit. 1936. 1955. 1927. C.. 1967..... Literature. jvaalaapraasaada mishra.. Sanskrit. Sanskrit. LANGUAGE. Sanskrit.... nir^nd-ayasindhau. Someswara Sarma.. 1951.. 1949.. Social Sciences.. 746 pgs. 1827. nipaataavyayopasagraivuttin' t'ilaka... Language. Philosophy. 1940. Thallahtanath Pandit. Linguistics. shriimanmaharshhivarayaaskiiya. Literature. 1937. 286 pgs... Sanskrit.. LINGUISTICS. 1908. A. LITERATURE. niitipaat'han. nirnayasin'd'hu. 320 pgs. nrxgamooqs-aprabandha.v. Social Sciences.. Linguistics. 1972. Literature. 166 pgs.org/…/SanskritIIIT.. Psychology... P V Ramanujaswami. 1942. Sanskrit. nayadhyumand-i. Narayanarya.. nipaataavyayopasagaivuttin.. niitimaalaa. Vasudeva Sarma. Narasimha Vijapeyt Vol Ii. 86 pgs. sanskritdocuments. 1925. Sanskrit. Sanskrit. nayachandrikaa praaramyate. pan' prabhunaaraayand-a tripaat'hii sushiila. Bhatta Nilakantha.. Sanskrit. Literature.t. 1940. Literature.… 128/167 . Sanskrit. nityaachaarapradopan.. nityaachaarapradiipa Part I. Sanskrit. Literature.. Sanskrit.. 1951. Brahmanandaji. 179 pgs.. Social Sciences. Social Sciences. 1930. Sanskrit. shriimadhyaarakaachaarya. Pandith Priyanath Vidyabhushan. Sanskrit.. Sanskrit. Language. 1941. 456 pgs. nirnayasindu.. A. Sanskrit. vaagbhatta.rangaswami. nagesha bhatta. niruttk bhaashhyat'iikaa. Religion.. Linguistics. bhaavanaatha mishraa. Linguistics. Sanskrit. Sanskrit. 76 pgs. 1928. Language. Psychology. .. 283 pgs. nidraa vign-aana kyon' kahaan' kaise aura kaba sonaa chaahiye. neetisataka. Psychology. 1918.. 174 pgs. nir^nd-ayaamrxtamam. Literature. 127 pgs.. Philosophy.. Psychology. nityotsavan. 248 pgs. 1967. 768 pgs. Literature. Language.. meighanaadaarisuuri. T.. 1951. 1912. 1926. Linguistics. Linguistics.. nayaayakusumajjalii. Linguistics. 545 pgs. Bhavanatha Misra. Sanskrit. Linguistics. Sanskrit.. Language. K.. 0. se . 1950. Linguistics. Sanskrit. 86 pgs. Language. . Literature. Theology.. Sanskrit. Sanskrit. Language. Sanskrit. raamanaathashaastri. Linguistics. nayadviveka. 133 pgs. swetaranyam narayana sastriar.r.shankara Rama Sastri. Philosophy. Literature. shrii kamlakar bhatt. Narasimha Vajapeyin.. Linguistics Literature. 1941. Language. Literature. Literature. 140 pgs.. 330 pgs. Linguistics.. Language.... Sanskrit.. nityaachaaradapaind-an. nayamanjarii.. Religion.mahadeva Sastri.. niitimayuukha. Linguistics... 768 pgs. Language. Philosophy. Language. Theology. niruttkalaghuvivrxti panj-chapaadikaa. Sanskrit. Literature. 0. 321 pgs. Literature. Sanskrit.. niruttkmn. Literature.. naaraayana bhat't'aa. 158 pgs. 1937. niruktan' nighand-t'upaat'hasamupetan' dvitiiyobhaaga.. niyatakaalakaand-d'amu trutiyo bhaagan. Linguistics Literature.... Language. 246 pgs. 1956. neiminirvaana. 480 pgs.. Language. 1907. nayaviveka. 226 pgs. Literature. Linguistics. Natural Sciences. Srimad Appaya Diksita.. Linguistics. Sanskrit. nayaviveika. 1937.. kuu. Mahamuni Vyasakcharya. 365 pgs. Krishnacharya.viraraghavacharya. Sanskrit.

Psychology. 1941. Language. Sanskrit. Theology. Sanskrit. Linguistics. Language. Linguistics. Theology. 1924. Literature. nyaayaprakaasha nyaayashaastra. Psychology. Sri Appayah Dikshita. 0.. 592 pgs.2/14/2011 A list of scanned Sanskrit books at III… nrxtta san'grng-aha. Saktism. Dwaita Philosophy. 1937. Philosophy. Linguistics. Philosophy. 1935. Not Available. nyaayakalaapasan'graha.. Philosophy.. paarthasaarathimishraa.. Not available. nyaayakulishamu. Parthasarathi Misra. Literature. 0. 421 pgs... 426 pgs. Psychology. Psychology. 0. Literature. 218 pgs. 1931.. 1918. lakqs-mand-aachaaryand-a. Religion. 96 pgs. Language. nyaayakaalaapasang-agraha. nyaayabodhinii vaakyavrxtti nirukti. Linguistics. nyaaya jaagadiishiivyadhikarand-amu.. 0000.. Sanskrit... 1940. Atreya Ramanuja. .. Philosophy. nyaayakusumaanj-jali Vol 1.. Language. viiraraaghavachaayaund-a. nyaayaratnaakarakhyaavyaakhyaasahite shlokavaartike. ti . 1956. chidaghanaanandagiri. 1923. nyaayaratnamaala.. Athreya Ramanuya. 91 pgs... Philosophy. Psychology.. Linguistics. nyaaya muktaavali raaghavendra yati. nyaayaashiddhaajnaamuu. Sanskrit. nyaayaliilaavati. nyaayabodhinii niilakan't'hiiya vishhauamaalaa. 1934. Linguistics. 1010 pgs.. Sri Kamakshi Amma. Sanskrit. Religion. Linguistics.. 1953.org/…/SanskritIIIT. Linguistics... 622 pgs. Sanskrit. 1969.. Literature. pat't'aabhiraama.. 1915. 222 pgs. Sanskrit.. Literature.. Sanskrit... Sanskrit. Sanskrit.. nyaayaparishudin. 350 pgs. Sanskrit. 379 pgs. Sanskrit. 0. gautama. Psychology. nyaayabindu qs-idhamakiirti prand-iita.. Sanskrit. 0. Sanskrit. Philosophy. Philosophy.. Psychology. 0.sambashiva Sastri.. nyaayadarshanamu bhaashhya vrxttisahitamu. Language. shriiseneshvaraaryai. Sanskrit. Sanskrit. Philosophy. 94 pgs. 298 pgs... 1912. 299 pgs. 1919. anuruddhaachaarya... Nyayasar. Linguistics.. Sanskrit. Sri Senesvaracharya. Literature. sanskritdocuments.. Language.. . Sanskrit.. 534 pgs. 1938. 1937. Sanskrit. 178 pgs.. T.. 461 pgs. Sanskrit. Language.… nyaayasudhaamand-d'anamu. Sanskrit. 291 pgs. Venkatanath Sri Vedantacharya. Viraraghavacharya. Linguistics. d'aa priyabaala shhaa.. Language. nyaaya parishuddii. 118 pgs. nyaayadarshana suutras bhasya. 444 pgs. Sanskrit. Sanskrit. 315 pgs. Sanskrit. Linguistics. Sanskrit. 432 pgs. Sanskrit.. 1941. Theology. Religion. 68 pgs. shekhara. nyaayakusumaanj-jali Vol I. nyaayakusumaanj-jali Part 2. Chandrashekhar Shastri. Religion.. Language.. Literature. si.. Sanskrit. 524 pgs.. 0. Viraraghavacharya.. Language. nyaayabhaashhyavaarttikataapyarya vivarand-apanj-jikaa 2 5. 1925. nyaayaboodhini baakyavrxtti. 1962. 432 pgs. Literature.. 1970.... nyaayasaara shrii bhaasar^vagn-aprand-iita. nyaayarakqs-aamand-i. vaatsayaayanamuni. Literature. nyaayaratnamala. Sanskrit. shrii vallabhaachaarya. nuutanadhrmmaniyamasya... nyaayanibandhaavalii.. Not available.. Psychology. T. 90 pgs. Sanskrit. Psychology. K. Philosophy. Satyapramotheertha sripada. Literature.. LITERATURE. Language. 168 pgs. LANGUAGE. Psychology.. 426 pgs. Sanskrit. Theology. 363 129/167 . 204 pgs. 1938. Literature. nyaayakulishamuu.. LINGUISTICS. Not available. 1941.. Philosophy.

175 pgs. Linguistics. Sanskrit. paand-iniiyavyaakarand-ebhinavavaarttikaani. Sanskrit Grammer. 1962. 364 pgs. saishasrikrishna. paavaitiiparind-ayamu. Sanskrit. depatment of pali. Language. Literature.. 487 pgs. Psychology. Linguistics. Philosophy.. Vacant..2/14/2011 A list of scanned Sanskrit books Philosophy. 1900. at III… nyaayasudhaamand d anamu. Literature. Philosophy. 1972.. Sanskrit.k. 1983. vishvabhandhu. Literature.. LINGUISTICS. paarijaataharanachampu.... 88 pgs. T. 77 pgs.. Literature. Sri Koliyalam Swami.. panchatantramu 1.. 1953.. Sanskrit. 1941. Geography. Sanskrit. pan'chamapushhpamu shriiguruchartrikaavyan' shriidattachan'puu sat'iikaa.. Kishore Nath Bha... 1939. Literature... 1954. 1893. Sanskrit. Linguistics. padasan'grahan' bhaaga pahilaa. 342 pgs. Linguistics. Sanskrit. paarijaataharand-achampu. 144 pgs. Sanskrit. 118 pgs.. Language. Chintamani. 64 pgs. 1894. 324 pgs. paat'hashodhanamuu.. Biography. Philosophy. Linguistics. 0. kurugand-t'i suryanaaraayand-ashaastri. khemaraaja shriikrxshhnd-adaasa.. Dwaita Sanskrit. 1104 pgs. paaia sadda mahand-nd-aavo praakrxta shabdamahaarnd-ava.. Psychology. Ramakrishna. nyaayasudhaamand-d'anamuu... Sanskrit. 172 pgs. 204 pgs. ruupalaala kapuur. Language.. nyayakhosh. 1944.. Sanskrit. 0. Literature.. History. Linguistics. Language. Language. Literature. 0. Linguistics. trinaatha sharma. Vidyasekharalu.. Literature. Literature. 716 pgs. 1992. 1889. 1902. Linguistics. vishhnd-u sharma. Sanskrit. Literature. paarabhaashondradipikaa. 0. 568 pgs. pandit durgaprasaada.. Philosophy. Rama Murti. Literature. . panchasiddaantikaa... Sanskrit.. Satyapramotheertha sripada. Language. Sanskrit.. 390 pgs.... 64 pgs.r. panchadashagiitaa. 1953. Not available. 1930. Sanskrit.. Sanskrit. 579 pgs.. Sanskrit. Not available. Psychology. pachchatantrakamuu. Language. shriibaand-abhat't'a. nyaayatatvaalokan.. Linguistics. Language. panchadashii. paaribhaashhikapadaaryasan'graha.. Language. Language.. bhimacharya jhalakikar. mahaamunishriimadvyaasa. Sanskrit. 1896.… 130/167 . LITERATURE. 1918..org/…/SanskritIIIT. Language. Sanskrit. Literature. pan'chaprakriyaa.. pajjadashii. palitipitakasassanukkamanika part 2. 538 pgs. Linguistics Literature.. 56 pgs.. paat'hakamukhavispot'akamu. Literature. Sanskrit. LANGUAGE. Psychology. 1200 pgs. panchaman' pushhyamu. 1973. Language. Sri Mad Ramakrishna. Sanskrit. Philosophy. paarijaatahrnacampa.. kielhorna. Language. Natural Sciences.. Literature. 1926. 38 pgs. not availabe.. shriivaasudevaanandasarasvatiit'embesvaami. 338 pgs. Sanskrit. Sanskrit. Language.. 1818. Literature. Vamana Daji Oka. Sanskrit.. padmapuraand-amu tatraadimamaadikhand-d'an' dvitiiyan' bhuumikhand-d'an' chetyetaddvayaruupa prathamabhaaga. pan'chaadashi bai vidyaarand-ya.. 1946. 363 pgs.. 0. Sri Sadasiva. varaaha mihiraa.. Sanskrit. Linguistics. pancharatnakaarikaa. 408 pgs. 60 pgs. 54 pgs. Sanskrit. Psychology. paadukaapat't'aabhishhokamu. 654 pgs... 258 pgs. Sanskrit. Language. Linguistics. Literature. 1874.. Linguistics.. Sanskrit. sanskritdocuments. Sanskrit. Linguistics.s.. 0. Linguistics..u. Literature. Linguistics.

Sanskrit.. Linguistics. vaiyaakarand-ashiromand-i sukla shrii vendiimaadhavashaastrii. Linguistics. Sanskrit. Language. Sanskrit. parijataharanachampu. 56 pgs. Literature.s. Literature.. paribhaashheindu sheikhar. 1898. Language. 2000. panj-chalaqs-and-iisarvasve.. 140 pgs. panj-chatantramu. jayadeivasharma mishra. Linguistics.. Linguistics. Sanskrit.. Sanskrit. nagojibhatta. 1959. Language.. vinaayaka gand-eish. Sanskrit. Philosophy. parishhkaaradarpand-a saastraarthakalaasahita. 1926. 202 pgs. Linguistics. 1916. 578 pgs. pashvaalambhamiimaan'saa.. 1992. Language. 389 pgs. Language. Sanskrit. Dr.. paribhaashheindu sheikhar 1938. Sanskrit. 162 pgs.. Saktism. Language. Language. Linguistics.. sesha srikrishna. 1989. parishhkaaradapaind-an. Parasara Samhita.. Language. Sanskrit. Language. Philosophy.. Sanskrit. 1923.. Literature. Abhinava Gupta.org/…/SanskritIIIT. LITERATURE. 136 pgs. 0. paramaarthasaara. 1934. 0.. Literature.. parashuraamakalpautramu. Literature. 1943. 434 pgs.2/14/2011 A list of scanned Sanskrit books at III… panj-chadashii. 1958.a. Linguistics. Literature. sayana madhvacharya. not available. paraasharadharmasn'hitaa vyavahaarakaand-d'amu practhamoodhyaaya. 1946.... vishhnusharmaa. paribhaashhendrashokharan.. Language. shriiraamashaastriind-aa.. 1923. Language.. 1868.. Language. shriimadhdighaarand-yamuni. Literature. 412 pgs.. Sanskrit. Not available. LANGUAGE. Theology. paramaayesaaran. 1900. 144 pgs. Psychology. 280 pgs. maadhavakaravirachitaa.. kumaratatacarya. 62 pgs. Abhinava Gupta. 581 pgs. Language.. Sanskrit. Sanskrit. 60 pgs. veind-imaadhava shaastri. 0. Religion. 1833.. 1995. Sanskrit. Language. shivadatta.. shriibhagavadaadisheshha.. parayaayaratnamaalaa. 505 pgs. pashht'aalambhamiimaam'saa. paramaarthasaara. 1114 pgs. Linguistics.. Religion. Sanskrit. paraashara san'hitaa. 282 pgs. 370 pgs. Linguistics. Literature.… 131/167 . Sanskrit. 344 pgs.. 0000. Language. 114 pgs.. 68 pgs. pashavalaan'ba mimaan'sa. Sanskrit.. Sanskrit. Philosophy. 1911.. Psychology.... 234 pgs. Padmanabhan. 1916. Linguistics. paramasan'hitaa. 216 pgs. Sanskrit. Mahadeva sastry. panj-chatantramu. Literature. Sanskrit.. Literature.. paramaarthabhuushhand-amuu. Linguistics. Language. 1940. Ropahavvamana Sastri. Literature. Sanskrit. 200 pgs. Sri Venumadhava Sukla. sanskritdocuments. 60 pgs. vinaayaka gand-esha aapat'e. Linguistics. Linguistics. Literature. 1923.. paribhaashheindu sheikhar vyaakarand-a vibhaagamu. Sanskrit. Language. 1949.. Sanskrit. Psychology.. Theology. Sanskrit.. Sanskrit. Literature. 1306 pgs. Sri Bhagavad Adesesha. vaamanasharma. LINGUISTICS.. Sanskrit. 518 pgs.. Krishnaswami Aiyangar.. . 1105 pgs. Sanskrit. Linguistics. shrii viiraraaghavaachaaryaind-a. Literature... paramaarthasaaramu vivarand-ena sametamu. Linguistics.. Linguistics. Linguistics. Literature. Philosophy Psycology. Language. Linguistics... Literature. 1923. 1935. Literature. 1938.. Literature.. S. Sanskrit. paribhaashendusekharaa... parijata natakam. paqs-ataaprakarand-amuu. parasara dharma samhita vol 2 part 1...

shriimaddidhaarand-yamuni. Sanskrit.. Literature. prakrita sarvasva. LANGUAGE. Literature. 1908. Literature. 0.. Vaishnavism. prabodhachandrodayamuu. sanskritdocuments. praakrutapingalasutraand-i. Sanskrit.t. Sri Ramnath Sastri.. prakat'aathaivivarand-amu. Literature.. Literature.. 1961. 1862. 0. mantreshvaraa. Language. 160 pgs. T. praakrutamand-idipan. shriimatkrxshhnd-amishrayati.. 1935.. 119 pgs. 174 pgs. pattuppaat't'u san'skrxtaanuvaada. Sanskrit. Linguistics. Sanskrit.. 1935.. shriibhat't'aniilakand-t'ha. Philosophy.. T.. prakaasha shriimadbhaagavatadashamaskandha. Linguistics.. Psychology. praathamika san'giita. d'aakt'aru jagadiishachandra jaina.chinatamani. swmi vivekananda. 0. 134 pgs. Linguistics. 1915. Linguistics. 252 pgs. 71 pgs. Language. Sanskrit. Philosophy. Sanskrit. Linguistics. Sanskrit. 292 pgs. Buddhism.. Sanskrit. Language. 1894. Religion. yas n shriiraama deishikana. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… patanj-jalayogasuutraand-i vaachaspatimishravirachita t'iikaavyaasabhaashhya sametaani. Linguistics.r. 470 pgs. Theology. 1953. 1973. Language.. Linguistics. 365 pgs... patanjali yoga sutrani. Bhattacharyya. Sanskrit.. prakriyaasarvasvan' dvitiiyo bhaaga. 285 pgs.. Literature. 612 pgs.. prabodhachandrodayamu chandrikaavyaakhyaa prakaashaakhyavyaakhyaabhyaan' shhashht'haavrxtti. 674 pgs. 256 pgs.srinivasagopalacharya. Sanskrit. 230 pgs. B. Literature.. 430 pgs. Language.. Language.. -. 0. Sanskrit. pand-d'ita vishveishvaranaaya reit'ha... 116 pgs.. pracya pascattyam.. Linguistics. Linguistics. praaryavidhaanamuu. Language. praayashvattamayuukha dashaman.. Literature. Psychology. 1974. praakrxta pushhkarind-ii prastaavanaa sahita. Sanskrit.. Kasi Nath Sastri... Psychology. prakrita sarvasva.. 585 pgs. 280 pgs.. Language. Sanskrit. Sanskrit. 1968. shriipurushhottamajiisahaaraaja. 1968.. krishna chandra acharya. Linguistics..… prakriyaasarvasvan' savyaakhyamu prathamo bhaaga. Sanskrit. 1956. Psychology. 292 pgs. Not available. bhagavatiiprasaada vaajapeiyii. 1968. Language. 1932. Psychology. 1972.. Sanskrit.. The Arts. Language.. Linguistics... 246 pgs. Linguistics. 1937. Sanskrit. Linguistics. 1949. Language. bhattacharya. Philosophy. prabhakaradijaya.. Sanskrit. 259 pgs. shriinaaraayand-abhat't'apaada. krishna chandra acharya. LITERATURE. Language. 132 pgs. Linguistics. patyadarshii.. 1935. Literature. LINGUISTICS. Literature. prakiirnd-aaprabandhaa prathama khand-d'a. Language. Literature. Sanskrit.. Literature... Linguistics. Sanskrit. 1904. Sanskrit. Literature. pand-t'itapravara shriiraamaavataarasharma. Language. b. shriinaaraayand-abhat't'apaada.. Philosophy. Language. phaladiipikaa adhyaaya 1 28. LITERATURE. 670 pgs.. pragnaapaaramitaasa pradhamo bhaagan.. LANGUAGE. laqs-minaadabhat'a..... Sanskrit. 1940. 1932.org/…/SanskritIIIT.. pro shan'kara gand-eisha vyaasa. Literature. LINGUISTICS. pradhikaara kaa prashna. mukunda. 257 pgs. Language. prajnapaaramitaas abhisamayalankaaralooka bhaaga 1.. Sanskrit. 101 pgs. Philosophy. 308 pgs. prakarand-apajjikaa. praakrxtasarvasvamu. Sanskrit. raamadaasa. 132/167 .. Sanskrit. Literature.

Sanskrit. Sanskrit. prapatrapaarijaatan... Sanskrit. 160 pgs. 858 pgs. Not available. Not Available.. Jayadeva.. Literature.. Language. LITERATURE. Pandurangacharya Srinivasacharya Waiker. Linguistics. Language. maheindrakumaar shaastri. Sanskrit.. 0. 323 pgs. 1950. Linguistics. raghunaatha kavi.. prand-avavaadan' pradhamabhaagan. Linguistics. Religion. Linguistics. 342 pgs. Sanskrit. Literature. Sanskrit. THEOLOGY.. . 146 pgs... Literature. Sanskrit. 1963. Philosophy. 1915. shriividhyaanaatha.. pramaand-ayavaada. 426 pgs. prataaparudrayashobhuushhand-an' ratnaapand-aaravyat'iikayaa. Jayadeva. Sanskrit. 223 pgs. Language. 82 pgs.. T. Language. prajnaakaragupta. 1964. 1954. Linguistics... 1945. . 391 pgs.. Literature...2/14/2011 A list ofbhaaga. Language. Linguistics.. 350 pgs. Literature. pratidvarasutramu.v. subramand-ya saastri. 1973.shastri... Sanskrit. prapannaparijatam. LANGUAGE. san'kara bhagavatpaada. Sanskrit. 0... Literature. Linguistics.… 133/167 . Tantras. Language. prasthaanaratnaakara. prashanj-aanamu. 1964.. Sanskrit. Linguistics.. prasnopanishhatuu. Literature. Literature.. 1999. pramaand-a vachana sadgahan' tutiyan'samput'amu. Bellokoth Ramachandra Sharma. Language. Sanskrit. Sanskrit. Sanskrit. 1950. sanskritdocuments. pramaand-amajjarii.. 0.. prashnootararatnamaalikaa. 1949. Language. Sreenivasachariar. Literature.. scanned Sanskrit books at III… prakriyaasarvasvan savyaakhyamu prathamo shriinaaraayand abhat t apaada. Language. prameyakamalamaarataand'aa. pramaand-ayavaada. 0. prashnashiromand-i bhaavaarthabodhiniibhaashhaat'iikaasahita. prameya kaamalamaarthanda prabhaachandraan. Linguistics... Linguistics. sri vatsya vardacharya. 1953. 694 pgs. 390 pgs. Linguistics. prashropanishhatan't'iikaasan'valita san'karabhaashhyasametaa. Sanskrit. prasang-kavign-aanaatsiddhamu. Linguistics. 194 pgs. 104 pgs. Literature. Literature... Language. 1979. Literature. Language. 1973.. 1954.k. Sanskrit. pan'd'itarudramund-i.. Pattabhiram Sastri. Sanskrit. Sanskrit. 106 pgs. Sanskrit. prameiyakamalamaarttaand-d'a. Anandagiri. prakrutaananda.v. ratna gopala bhat't'a. 73 pgs.. 1942. Language.. Sanskrit. prataaparudriiyamu alan'kaarashaastramu vyaakhyaaya. LINGUISTICS. 1896.. 215 pgs. Literature. 0. . Sanskrit. T. Linguistics.. Literature. Theology. 140 pgs... Pandit. Sanskrit. Not available.. Sanskrit. Linguistics. 0. Religion. Sanskrit. The Arts.. prasannaraaghavamu sat'iikamu. hari naaraayand-a. 1953. Religion. prasannaraaghavaa. K. Linguistics. Not available. 106 pgs..... RELIGION.. 916 pgs.. 1992. 123 pgs.. Sanskrit. Linguistics. Sanskrit.n. Sanskrit. 668 pgs. prapan'chasaara saara san'graha bhaaga 2. Sanskrit.. pramaand-amajjarii granthaan'ka 4. . 1894. Sudara Chary. 1896... Language. Jinaviya Muni.. Language. Vaishnavism.. . Literature. pramaanavaartikabhaashyam vartikalankaarah. vidhyaanaatha. 1984. Language. Literature. Literature.. pramaand-aprameyakalikaa. 48 pgs. 126 pgs. 121 pgs. girvanendra saraswathi. Language.. Theology.. H.org/…/SanskritIIIT. 529 pgs. 690 pgs. pramaand-avaattaka bhaashhyamuu. Theology. 121 pgs. 360 pgs. Sanskrit.. 1909.

Language. Philosophy. Literature... 1928. Literature. T.. 1962.. Religion. Language.. Sanskrit. Sanskrit.. Literature. priitilataakusumopetaa vrxttamaalaa. Sanskrit. 0. pratyakatvachintaamand-i Vol 2. Language. Literature. Sanskrit.. 392 pgs.. Linguistics. . Sanskrit . Literature. 174 pgs. Linguistics. purushhaarthachintaamand-isthavishhayaanukrama. Shaacharya Shidarajamaloki. 646 pgs... Linguistics.. Linguistics. 320 pgs.. pratap singh. Sanskrit. 1935. 1955. Linguistics.org/…/SanskritIIIT. Language. purushhaathaichin'taamand-o. 596 pgs.. Linguistics. 1955. krxshhnd-adatta maithila. purushhaathaisudhaanidhin. purushhaarthasudhaanidhi. 0.. e pi karmaarkara. Not available. Sanskrit. Religion. Literature. 138 pgs. 0. emil baer ed.. Sanskrit. Sanskrit. . Sanskrit. 0.. pratistaa sangrahn.. puraand-aparyaloochanamu. Sanskrit. Language. not available. 674 pgs... 1917. premarasaayana. Language. puraand-akaavya stootra sudhaa. purajjanacharita naat'akamuu. Sanskrit. pravachanasaara.… 134/167 . 1911. Sanskrit.. Sanskrit. Language. Language. 679 pgs.. Linguistics. visvanaatha pandit. Sanskrit. 100 pgs. Literature. 1975. shriikushhnd-amand-itripaat'hii. Language. Literature.. 109 pgs. prayaaga mahaatyamu.. 388 pgs. 1914. 1956. 1961.. Language. 0.. sayaana kaarya. 432 pgs.chandrasekharan. shriikund'akund'aachaarya. Unknown. Language. 1991.... prayogaratnamaalaa. 140 pgs.. Sanskrit. 324 pgs.. shrikhand-d'adeva. purchryarnav. Sanskrit. Unknown. Sanskrit..ramanuja Tatacharya. Linguistics. 346 pgs. 488 pgs.. Language. Literature. Language.. 608 pgs. . Sanskrit. Literature.2/14/2011 A list of scanned Sanskrit books at III… pratijnj-ayaugan'dharaayand-amu. Linguistics. 64 pgs. 443 pgs. Literature. Linguistics. shriikushhnd-amand-itripaat'hii.. 35 pgs. Linguistics Literature.. 134 pgs. Sanskrit. K. 626 pgs. Hanumacharya. purushhasitramu. Linguistics..... Sanskrit. 608 pgs. 248 pgs.Religion. Sri Sadanandha Vidyadhar.. 454 pgs. Literature. puurvamiimaan'saadarshanamu dvitiiyasamput'amu. pratyaqs-attvachintaamand-ivimashain. 319 pgs. puraand-amu. Sanskrit. 0. Linguistics.. shriikhand-d'adeva. Sanskrit.. hari naaraayand-a. si ar deivadhar. preimavijaya. sanskritdocuments. 1943.. pratyabhijnahrdayam. Linguistics. Linguistics. 1938. Literature. Literature. Theology.. Sanskrit. 1976.. Sanskrit Grammer. 0. No.. Vasudeva Sarma. N S Ramanuja Tatacharya. Literature. purushhaarthachintaamand-i. Linguistics. 17 pgs. Sanskrit... praud'hamanooramaakhand-d'anagranthasya.. 1992. Psychology.. sundareisha sharma. 1922. . puurvamiimaan'saadarshanamu trxtiiyasamput'amu. Linguistics. Unknown. Pandit Ramlal. Sanskrit.. puraand-aparyaloochanamu bhaag Ii. Sanskrit. Language. Language. 1942. Sanskrit. 1955.. prodamanoramaa.. Literature. Language. 1941..

2/14/2011

A list of scanned Sanskrit books at III… puurvamiimaan'saadarshanamuu chaturthasamput'amuu... shriikhand-d'adeva, Language. Linguistics. Literature. Sanskrit, 1916. 428 pgs.

puurvamimaan'saa darshanamu Vol.i... e mahaadeiva saastri, Language. Linguistics. Literature. Sanskrit, 1908. 372 pgs. qs-airatarad'agnd-ii... Kshira Swami, Sanskrit Grammer. Sanskrit, 1955. 417 pgs. qs-i bhagavadraamaanujavirachite qs-ishaarirakamiimaan'shaabhaashhye Part 1... Sri Lakshmi Narasimhakumar, Philosophy. Psychology. Sanskrit, 1936. 434 pgs. qs-i bhuvanadevaachaayevirachitaa aparaajitaprachha... Popatbhai Ambashankar Mankad, Religion. Theology. Sanskrit, 1950. 791 pgs. qs-ibhaashhyamuu chatushuutribhaaga... Maha Mahopadya Sudarshana Vyasabhatta, Philosophy. Psychology. Sanskrit, 1916. 290 pgs. qs-iimada naarand-yamuniprand-iitaa panchadashii... Narayana Ram Acharya, Philosophy. Psychology. Sanskrit, 1949. 580 pgs. qs-imaddhekhaanasekaasyapajaanakaand-d'a... Parthasarathi Bhattachar, Philosophy. Psychology. Sanskrit, 1948. 214 pgs. qs-imadraamaanujaachaayeprand-iitan' qs-ibhaashhyamuu Part Ii Introduction And Notes... Vasudev Shastri Abhyankar, Philosophy. Psychology. Sanskrit, 1916. 368 pgs. qs-imatsanatsujaatiiyamuu... B. Gururaja Rao, Religion. Theology. Sanskrit, 1940. 144 pgs. qs-inad'apaadavirachitaa seikodheshat'iikaa... Mario E. Carelli, Religion. Theology. Sanskrit, 1941. 148 pgs. qs-ivanamaalivirachitaabrahaasuutrasiddhaantamuktaavali... Not Available, Religion. Theology. Sanskrit, 1942. 252 pgs. qs-utiratnaprakaasha qs-itimateudyota... Tryambaka Sastri, Philosophy. Psychology. Sanskrit, 1910. 102 pgs. raadhaaparind-aayamuu mahaakaavyamuu... Not Available, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1931. 304 pgs. raagaratnaakara... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 706 pgs. raagaratnaakaraa... khemaraaja shriikrxshhnd-adaasane, Language. Linguistics. Literature. Sanskrit, 1966. 702 pgs. raagatattvaviboodha... shriinivaasa, Language. Linguistics. Literature. Sanskrit, 0. 84 pgs. raaghavanaishhadhiiyamu savisheshhavimarshinii prakaashasan'skrxta hindiivyaakhyopetamu... shriiharadattasuuri, Language. Linguistics. Literature. Sanskrit, 1969. 95 pgs. raaghavanaishhadhiyamu... shriiharadattasuri, Language. Linguistics. Literature. Sanskrit, 1896. 74 pgs. raaghavapaand-d'aviyamu... shriikaviraaja, Language. Linguistics. Literature. Sanskrit, 1897. 216 pgs. raajadhamaikaand-d'amu... K.v. Rangaswami, Language. Linguistics. Literature. Sanskrit, 1944. 117 pgs. raajadhamaikaand-d'amu ekaadasho bhaagan... K.v.rangaswami, Language. Linguistics. Literature. Sanskrit, 1943. 410 pgs. raajatarangind-i... durgaprasada, Language. Linguistics. Literature. Sanskrit, 1892. 393 pgs. raajatarangind-i Ii... durgaprasada, Language. Linguistics. Literature. Sanskrit, 1894. 308 pgs. raajatarangind-i Iii... durgaprasada, Language. Linguistics. Literature. Sanskrit, 1896. 410 pgs. raama charchaa... premachanda, Language. Linguistics. Literature. Sanskrit, 1948. 168 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

d

kh

j

h iik

hh d d

L

Li

i ti

Lit

t

S

k it 0 920

135/167

2/14/2011

A list of scanned Sanskrit books at III… raamaayand-a... khemaraaja shriikrxshhnd-adaasa, Language. Linguistics. Literature. Sanskrit, 0. 920 pgs.

raamaayand-a baalakaand-ad'a... tulasiidaasa, Language. Linguistics. Literature. Sanskrit, 1886. 553 pgs. raamaayand-a sampuurnd-a qs-epaka... khemaraja shriikrxshnd-adaasa, Language. Linguistics. Literature. Sanskrit, 1827. 753 pgs. raamaayand-amajjari... shriikshemendra, Language. Linguistics. Literature. Sanskrit, 1903. 519 pgs. raamaayand-amu ayoodhyaakaand-d'amuu... shriimayaakavishrivaalmiiki, Language. Linguistics. Literature. Sanskrit, 1923. 316 pgs. raamaayand-amu baalakaand-d'amuu... shriimayaakavishrivaalmiiki, Language. Linguistics. Literature. Sanskrit, 1867. 224 pgs. raamaayand-amu kishhkindhaakaand-d'amu... shriimadvalmiiki mahaamuni, Religion. Theology. Sanskrit, 1915. 318 pgs. raamaayand-amuu arand-yakaand-d'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 0. 342 pgs. raamaayand-amuu baalakaand-ad'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 1912. 426 pgs. raamaayand-amuu sundarakaand-d'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 1916. 354 pgs. raamaayand-amuu uttarakaand-d'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 1920. 362 pgs. raamaayand-asan'qs-eipasagrarasasvaada... Not Availble, Language. Linguistics. Literature. Sanskrit, 0. 124 pgs. raamakarnd-arasaayanamu prathamo nishhyanda... Not available, Language. Linguistics. Literature. Sanskrit, 0. 74 pgs. raamakathaa... vaasudeva, Language. Linguistics. Literature. Sanskrit, 1929. 66 pgs. raamasandesha padaarthaprakaashaakhyayaa t'iikaayaa sameta... shriiraajaraajeshvarapuujyacharanda, Language. Linguistics. Literature. Sanskrit, 1917. 140 pgs. raamasvayan'varsya vishhayaanukramand-ikaapraarambha... mahaaraaja shriiraghuraajasen'hajii deiva, Language. Linguistics. Literature. Sanskrit, 1822. 1006 pgs. raavand-aarjuniyamu... shriibhat't'abhima, Language. Linguistics. Literature. Sanskrit, 1900. 218 pgs. raghunaathavilaasamu naama naat'akamu... yagn-anaaraayand-adiiqs-ita, Language. Linguistics. Literature. Sanskrit, 1958. 174 pgs. raghuvan'shamuu... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 576 pgs. raghuvan'shavimarsha... ra. krxshhnd-amaachaaryend-aa, Language. Linguistics. Literature. Sanskrit, 1908. 168 pgs. raghuvansh... kalidasa, Language. Linguistics. Literature. Sanskrit, 1944. 360 pgs. rasa mitra... tryambak nath sharma, Technology. Sanskrit, 1965. 276 pgs. rasa mitra... tryambak nath sharma, Technology. Sanskrit, 1965. 382 pgs. rasachandrika... pande v, Language. Linguistics. Literature. Sanskrit, 1913. 110 pgs. rasachandrika... parbatiya pandita vishweswara pandeya, Language. Linguistics. Literature. Sanskrit, 1926. 108 pgs. rasadiirdhikaa... kavi vidhyaaraama, Language. Linguistics. Literature. Sanskrit, 0. 102 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 136/167

2/14/2011

A list of scanned Sanskrit books at III… rasadiparigyan... jaganath prasada shukla vaid, Natural Sciences. Sanskrit, 0. 174 pgs.

rasagan'gaadharahrudayamu... jnj-aanachandrastyaagii, Language. Linguistics. Literature. Sanskrit, 1964. 138 pgs. rasagangadhar... jaganath, Language. Linguistics. Literature. Sanskrit, 0. 430 pgs. rasamajjarii... bad'ri natha, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1929. 222 pgs. rasamiimaan'sa... aachaarya raamachandrashuklaa, Language. Linguistics. Literature. Sanskrit, 0. 516 pgs. rasasadanabhaand-an... yuvaraaja, Language. Linguistics. Literature. Sanskrit, 1893. 70 pgs. rasavilas... bhudeva sukla, Language. Linguistics. Literature. Sanskrit, 1952. 162 pgs. rasen'drasaarasan'graha bhaashhaat'iikaasahita... mahaamahopaadhyaaya gopaalakrxshhnd-abhat't'a suuri, Religion. Theology. Sanskrit, 1844. 528 pgs. ratiratna Pradiipika... liilaadhara sharma, Language. Linguistics. Literature. Sanskrit, 1930. 148 pgs. ratna samuchchaya... not availabe, Language. Linguistics. Literature. Sanskrit, 1928. 504 pgs. ratnaavali kii kathaavastu... Not available, Language. Linguistics. Literature. Sanskrit, 0. 366 pgs. ratnaavalinaat'ikaa... shriiharshhadeva, Language. Linguistics. Literature. Sanskrit, 1953. 216 pgs. ratnaavalinaat'ikaa... shriiharshhadeva, Language. Linguistics. Literature. Sanskrit, 1953. 270 pgs. ratnakiirtinibandhaavalii volume Iii... anantalala t'haakuura, Religion. Theology. Sanskrit, 1957. 220 pgs. rattamatam... h. sesha iyengar, Language. Linguistics. Literature. Sanskrit, 1950. 174 pgs. rauravaagaamaa Vol.i... yan.aar bhat't'a, Language. Linguistics. Literature. Sanskrit, 1961. 277 pgs. rauravaagaamaa Vol.ii... yan.aar bhat't'a, Language. Linguistics. Literature. Sanskrit, 1972. 366 pgs. rig veda samhita volume Iv mandala X... max muller f ed, Religion. Theology. Sanskrit, 1892. 732 pgs. rigbhaashhya bhuumika... vi. kapaali saastri, Language. Linguistics. Literature. Sanskrit, 1952. 284 pgs. rigveda samahita (manuscript)... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 830 pgs. rigveda samhita... f max muller ed, Religion. Theology. Sanskrit, 1890. 974 pgs. rigvedasanhitoupanishadchatakam... -, Religion. Theology. Sanskrit, 0. 490 pgs. riitikaalina kavitaa men' abhivyaan'janaa evan' shilya... Not available, Language. Linguistics. Literature. Sanskrit, 1966. 491 pgs. rudraadhyaaya bhaashhya etatpustakan... saayand-aachaaryabhat't'a, Language. Linguistics. Literature. Sanskrit, 1976. 186 pgs. ruupamaalaayaamu bhaage Iii... not Available, Language. Linguistics. Literature. Sanskrit, 1982. 70 pgs. rxgbhaashhya... Not available, Religion. Theology. Sanskrit, 0. 73 pgs. rxgbhaashhyasan'graha... sva d'aa devaraaja chaananaa, Language. Linguistics. Literature. Sanskrit, 0. 440 pgs. rxgveda prathamos-shht'aka chatuthes-shht'ake shhashht'os-dhyaaya... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 952 pgs. rxgveda san'hitaa Part I... daamodara bhat't'a, RELIGION. THEOLOGY. Sanskrit, 0. 776 pgs. rxgveda san'hitaa Part II... daamodara bhat't'a, RELIGION. THEOLOGY. Sanskrit, 1940. 978 pgs. rxgvedaanukramand-ii... kunjanuu raajena, RELIGION. THEOLOGY. Sanskrit, 1932. 160 pgs. rxgveida bhaashhyamu volume 15... udgita aachaarya, Language. Linguistics. Literature. Sanskrit, 1935. 124 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 137/167

Sanskrit. Literature. Linguistics. 20 pgs.. 1908.. 100 pgs. 0.. Language. Literature. Not available. Indology. Language. shrii vai raamamuurtishrautii. 426 pgs. Religion.. shrisaayand-aachaarya... saamaveidasan'hitaa aagneiyakaand-akamuu prathamoo bhaaga. Not available. Linguistics. Language. Religion. Language. C. saamavedasan'hitaa. saamavediiya ashht'a braahmand-e saamavidhaanan' aarshheyan'cha gn-iiqs-aadi san'valitamu dvitiiyo bhaaga. 217 pgs. 1024 pgs. Language. 772 pgs. 1863. Linguistics... 1982. Theology.v. 2002. Literature.. Not available. uppalla someshvarasharma. Literature. Language. Linguistics. Linguistics Literature Sanskrit 1973 327 pgs sanskritdocuments. 1933.. shriikrxshhnd-asuurind-a. Sanskrit. Sanskrit. prof. 1873. Literature. 516 pgs. Literature. Sanskrit.. 1897. LANGUAGE.. Not available. rxkuusuuchii. Linguistics.. Literature. Sanskrit.. Sanskrit. 0. 1148 pgs. t'iikaachatushht'ayasanaathii. 1933. Language. rxgveidasan'hitaa trxtiiyoo bhaaga. Literature. rxgveidasan'hitaa dvitiiyoo bhaaga. 299 pgs. Sanskrit. rxgveidasan'hitaa panchamoo bhaaga. 64 pgs. Language. 1958. rxtuvarnd-ana vyaakhyaaya. Linguistics. 1941. 1947. Linguistics.. 313 pgs. shriivishvanaathakaviraaja... LITERATURE.. raamachandravinaayaka pat'avardhana. saamaanyaniruktti. Surya Kanta Shastri... Linguistics. Not available.. Linguistics.. durlabhaa. saahityakaumudi. Sanskrit... Not available. Language. krxshhnd-amoohan shaastri. shriimatsaayand-aachaarya. Sanskrit. Language. Linguistics. 0.. 193 pgs.. rxvedavyaakhyaa bhaaga 2 ashtaka 1 adhyaaya 5 8. Literature. Language.. 644 pgs.. Language. Sanskrit. 500 pgs. Literature.. Sanskrit. 1056 pgs.2/14/2011 A list of scanned Sanskrit books at III… rxgveida prathamoshht'aka... Sanskrit.. 362 pgs. Linguistics. Literature. Language. Sanskrit... 180 pgs. Linguistics. Literature. Sanskrit. Language. LINGUISTICS. Literature. Linguistics. Theology. vidhyabhushand-a. saahityaratnamanj-jushhaa. Sanskrit. 1969.. Literature.. rxgveidasan'hitaa chaturthoo bhaaga. 1858.org/…/SanskritIIIT. Kunhan Raja. Not available. Literature. Language. Language. Literature. saamaveda uuhauuhyagaanamu anubandhasahita trxtiiyo bhaaga san'put'amu 1. Sanskrit. 2002. 630 pgs.u oriental journal vol-1... 639 pgs. Literature. 939 pgs. 1900.chenna reddy. Linguistics. 1981. Theology. 234 pgs. 1955. Prof.j. Sanskrit. Linguistics.… 138/167 . Not available. saamavediiya ashht'a braahmand-e taand-d'yamu pad'avin'shabraahmand-an' prathamo bhaaga.. 1147 pgs. Literature. shrii vai raamamuurtishrautii. Linguistics. Language. 1111 pgs.. Linguistics. rxveda san'hitaa bhaaga 1. saahitya darpand-a. Sanskrit. saahityavimarsha sakalasaahityaan'shasang-grahatmaka. Sanskrit... Language. Sanskrit.. 0. madhava. 1062 pgs.. Sanskrit. Sanskrit. Literature.. Language.. Sanskrit. 1867. rxgveidasan'hitaa prathamoo bhaaga. Linguistics. saahityadarpand-amu vyaakhyaamavalambaa samudbhaasitamu panj-chamasan'skarand-amu. rxktantran' saamapraatishaakhyam. Sanskrit... Linguistics. shriimadhvaachaarya. 1951.. s. saamaveda uuhauuhyagaanamu anubandhasahita trxtiiyo bhaaga san'put'amu 2. saahityadarpand-amu.. 0. Religion. Language.

Linguistics. Sanskrit. 202 pgs. 327 pgs. Language. Language. Sanskrit. Sanskrit... sachitra jyotishha-shiqs-aa. Sanskrit. sahityaratnakosh abhilekha sangrha. saaraavali kaantimati hindii vyaakhyaa sahitaa. Linguistics.. 266 pgs. 370 pgs. brahmha charya raam. saamavidhaana braahmanamuu. Sanskrit. not Available. 1983. LANGUAGE. saayand-iiyargvedabhaashhyabhuumikaayaa vaadashiinaathii t'iikaa. Sanskrit. saamyavaada..r. Literature. 1908. Sanskrit. Sri Amalananda. 1966. Sanskrit. Language. 138 pgs. 1942. Theology. 1919... 1940. naaraayand-a raama aachaarya. Literature. 1939. Theology. 0. Sanskrit.. sachithra yogaasan.. Literature.. 98 pgs. 62 pgs. 1930. 414 pgs. Language.… 139/167 . 272 pgs. Literature. Language. Language.. saaraavalii. 476 pgs. Language... 0. Sanskrit. baabuu raamachandra. sanskritdocuments.. Language.. saarasiddhaantakaumudii raakaa san'skrxta hndiivyaakhyaaya dvitiiya khand-d'a.s. saariirakanyaayasan'graha By Prakasatmayati. 751 pgs. 1964. 0. pan' shriitrilokanaathamishra. T. Theology. bhadhur chand chhabra.. 208 pgs. Sanskrit. Sanskrit. Language. shriimatkalyaand-avarmaa. sahaavein' pustaka. Literature. Literature. 1941. Linguistics. Language. 1890. 1992. Linguistics. saaravyaayanagrxhyasang-graga kaushhiitakigrxhyasuutrand-i. 430 pgs. 140 pgs. Linguistics. Linguistics.. d'aa bii aar sharmaa.... Literature.. LINGUISTICS. Not available. sahityaratnakosh pradama kand. Sanskrit. 208 pgs. Linguistics. 1916. Philosophy. 252 pgs. Language. Literature. saarasvatavyaakarand-amuu. V. Religion. 580 pgs. saang-kaadarshanamu.. Literature. 194 pgs. Language. Linguistics. 1973.. 0. Literature. Psychology. Sanskrit.. Language. Religion. saang-khachaayanagrxhyasang-graha.v. shriimatkalyaand-avarma. Religion. t'haakura jyotishhaachaariyaa. Guruswamy. sadaashivendrastuti. kausun'varavaastavyapand-d'itavara vaasudeva. saariirakavyaaravyaaprasthaanaani. 0.chintamani. Not available.. 1913.. Linguistics. 108 pgs. Literature. Literature. Sanskrit. saastradapend-amuu. saan'khyaakaarikaa. laqs-and-a.. sabhaashhyarxksan'hitaayaa varnd-anukramasuuchii. 342 pgs... Religion. 310 pgs. Sanskrit. Linguistics. Sanskrit. Sanskrit. Sanskrit. ji... Philosophy. LANGUAGE. Literature. LINGUISTICS. d'aa shriikrxshhnd-amand-i tripaat'hii..... Sanskrit.. shriimadvaradaraajaachaarya.. Linguistics.. Linguistics.. Sanskrit. Sanskrit.. Sanskrit. 511 pgs. Linguistics. Sanskrit. 1907. 96 pgs.. 1906. LITERATURE.org/…/SanskritIIIT... Theology. Literature. Psychology. Literature.2/14/2011 A list of scanned Sanskrit books at III… Linguistics. 0. Language. Sanskrit. Linguistics. kai pan' vishhnd-u naaraayand-a bhaatakhan'd'ei. Language. vishva bhandu ed.. 572 pgs. 164 pgs. LITERATURE.. Linguistics. saarasvatiikand-t'haabharand-amu.. Literature. saastradiipikaa. shriivaasudevavidvadvara. saata inakalaabii itavaar bhaaga tiisaraa. 222 pgs. Psychology. shriipataraaya. saambapuuraand-amu upapuraand-amu.. Language. thibaut'a.... Linguistics. shriisachchidaanandashivaabhinava. Literature. 1937. 1908. Sanskrit. 1989. Philosophy..

Sanskrit. Language.. 600 pgs. sam'skaararatnamaalaa Part Ii..2/14/2011 y p A list of scanned books gy at III… .. Sanskrit. krishnamacharya. Literature. Literature. Sanskrit g .. Linguistics. sakhyakarikaa. san'giitaratnaakara etatpustakan' kalaanidhyaaravyat'iikaasan'valita. Sanskrit. sakalapuraand-aabhyarhita shriibhaagavata dashamaskandha puurvaardhamu. Srirama Krishna. Literature.. Sanskrit. Linguistics. Mahamahopadhyaya. Linguistics. Linguistics. Linguistics. 1932. Theology. Linguistics. Psychology.. krishand-amaachaari. Literature.. Literature. Religion. Linguistics. Kasinath Sastri. 417 pgs. 855 pgs. Literature. Sanskrit. samayochita padamaalika.. Literature. Sarvajnatma Muni. 1971.. 1948. Literature. Sanskrit. shriini shang-kashaang-giideva. 263 pgs. sakalaagama saara sang-graha shaiva aagama. 1895. 296 pgs. Social Sciences.. san'qs-epasaariirakamu vyaakhyaasamalang-krxtamu prathamobhaaga. shrii vein'kat'anaatha. vimand-d'alavakra. Literature. raajen'dranaatha pan'd'ita. sam'skaaragand-apati Fasciculas Vi and Vii. Language.. Literature. 1897. Philosophy. 194 pgs. sampaadhya prakaashataan' niita. Sanskrit. 514 pgs. Linguistics. 1948. Language. 1974. Language. mahaamahopaadhyaaya pan' raamashaastribhaagavataachaarya svaamii.. 1864. Linguistics. 1896. 0. Sanskrit.. Sanskrit.. Sanskrit. 84 pgs. 1899. 143 pgs. Sanskrit.. Linguistics. 202 pgs.. Literature. Sri Ramnath Sastri Vaidye. 1930. 508 pgs.. Language. Sanskrit. Language. 1937. pg saitubandhamu.. 830 pgs. 1917. sanskritdocuments. Linguistics. Language. sam'skaararatnamaalaa Part I. Language. Literature. Literature. Social Sciences. 1936. 1973. Sanskrit. 1953.. jaiminii. 48 pgs.. gangadhara krishna draavida.. LINGUISTICS... samkalpa suryodaya part-2.. 236 pgs. Philosophy. san'kalpasuuryodayanaat'akamuu Part I.. adi sankaracharya. Language. Sanskrit..v... san'karshha kaand-d'amu shhod'ashaadhyaaya sheshhachaturadhyaayiisvaruupamu. Language. Linguistics. shri kunda kunda acharya. Literature. Literature. 820 pgs. samraat'uu shubhaagamana. Sanskrit. Literature.. Sanskrit. 1912. shriiraamadaasabhupatiprand-itadhaa. 255 pgs. san'kalpa suuryoodaya. 1938. 75 pgs. samskruthapadamaala trutiiya kusumam. Language. 82 pgs. shrii kuruganti veinkataramand-a shaastri. Sanskrit. Sanskrit.. LITERATURE.. Sanskrit.. samasyaasamajyaa. Sanskrit. 490 pgs. Not available.org/…/SanskritIIIT.. Linguistics. Language. shrii a vi narasin'haachaarya... shriinirang-kashaang-giideva. Linguistics. Sanskrit. 460 pgs. san'qs-epashaarirakamuu with Thatvabhodini Part 3. Psychology.. shriimatsarvagn-amuni. Sanskrit. 1919. Language.. Social Sciences. sam'skaaradiipaka Part I. Language.. 1955.. Linguistics. 1910. san'qs-epa shaarirakamuu Vol 2 Adhayas 2 ... samayasaara bhaaga 8.… 140/167 . Language.. Sanskrit. san'giitaratnaakara kalaanidhyaaravyat'ikaa prathamo bhaaga.. LANGUAGE. Literature. Linguistics. sam'skaaragand-apati Kandika Xii Of Kanda Ii. 644 pgs.4.. Kasinath Sastri. Yajnika Srirama Krishna Sarma... Language. 250 pgs. 110 pgs... 1899.

76 pgs. Linguistics. 1955. Language. General.. Philosophy. Sanskrit. 370 pgs. sang-aameshar krodamu.. Linguistics. Linguistics. san'skuuta kal'aapuurnd-odaya. LITERATURE. 274 pgs. Linguistics. 858 pgs. 1950. 1965. sankhya karikas. 630 pgs. Sanskrit. miimaan'sakashriinilakand-t'habhat't'a.. Literature. Literature.. Literature. Sanskrit. Philosophy. Language. Literature. malliyan' raamaachaaryasuununaa. 1984. Venkataramana Sastri. Sanskrit. Sanskrit. 1933... 770 pgs. san'skaaragand-apati. 498 pgs. 1958. Literature. Theology. Sanskrit. sangeethgnan ke sansmar. 0... san'skrxtadvitiiyapaat'ha san'skrxtabhaashhaayaan' san'bhaashhand-ashiqs-aka. 1956.. san'skrxtaan'dhranighan't'uvu. Language. Literature. 292 pgs.. Language. 528 pgs. Literature. 0. Sanskrit. Sanskrit. Literature. san'skrxta naat'aka udabhava aura vikaasa siddhaan'ta aura prayoga. Sanskrit. 1954. isvara karikas.. d'aa brahmaananda sharmaa. sanskritdocuments.. Language. Literature.. Sanskrit. 264 pgs. 0. san'skaaravidhi shhod'ashasan'skaarai. Religion. Sanskrit. Sanskrit.. 1934... 1996. san'skrutaavataaran. Neelakanta Shankar. 308 pgs.. Linguistics. san'skruta saahitya itihaasan. san'skaaramayuukha ekaadasha.. Linguistics. Linguistics. vyasa. Not available.. Linguistics.. Linguistics. Sanskrit.. berriedale keith. 1947. yagn-adatta.. sanskrit pravaahini shabd kosh. Literature. san'skrxta vyaakarand-ashaastra kaa itihaasa prathamabhaaga. Literature. 1884. Language. Literature. Linguistics. Language. Sanskrit.. Sanskrit.. 432 pgs. Sanskrit. Theology. shriiveng-kat'aramand-aaryend-a. 100 pgs. 248 pgs. san'skrxta vyaakarand-a shaastra kaa itihaasa dvitiiyabhaaga. Pandit Sri Rama Krishna.. Literature. 1941..2/14/2011 A list of scanned Sanskrit books at III… Sanskrit. Sanskrit.. Literature.. Linguistics. 1977. Not available.. 522 pgs. Sanskrit.. san'skrxta vyaakarand-a shaastra itihaasa trxtiiya bhaaga.. yam.. 1959. 172 pgs. san'qs-epashaarirakamuu with Thatvabhodini Part 4. Literature. Sanskrit. sankhya sara. 127 pgs. 1913. The Arts. Sanskrit. vilayat hussian khan.. 126 pgs. 1934.. sankshepa sarirpaka. Religion. 1946. Literature. Linguistics. 48 pgs. a. vyasacala. san'skrxta kavi jiivitamu. savanjatma muni. Language.. LINGUISTICS. Linguistics. Linguistics. Sanskrit. LANGUAGE. Language.. san'skrxta saahitya men' saadrxshyamuulaka alan'kaaron' kaa vikaasa. Sarvajnatma Muni. Language. Sarvajnatma Muni. 0... Not available. mallikaarjuna raavu. Sanskrit. Psychology. Sanskrit. Language. not availabe. 1979. Literature. Sanskrit...… k it lf t h t2 d t l k L Li i ti Lit t S k it 1971 60 141/167 . 1939.org/…/SanskritIIIT. sanshipt mahabharath dritya kand. 340 pgs.. anjinyea murthi. Language. Psychology. 439 pgs. sankaravijaya.. Psychology. Linguistics. Language.. Philosophy. Not available. Language. suuryanaaraayand-a shaastri. Literature. Sanskrit.. 86 pgs.. Language... 650 pgs.. 68 pgs. Sanskrit.. shriisholataataachaayaind-a. sanaatana vign-aana samudaya. 1926.. san'qs-epashaarirakamuu with Thatvabhodini Part 5. san'skrutakaadambarikathaa. 0. 338 pgs. 1938. Language. 430 pgs. Vijnana Bhikshu.. Linguistics.. 183 pgs.

Literature.. satapathabrahmana.. Linguistics... Linguistics.. 1965. 130 pgs. paand'eya bechana sharma.. LITERATURE. 1997. Language. Literature. 1908. LINGUISTICS. jayantkrishna h dave. Sanskrit. LINGUISTICS. Literature. Linguistics. Literature. LITERATURE. Literature. Not Avaliable... Linguistics. Not Available. satyaashhaad'haavirachitan'shrotasuutran' saptadashaashht'adashaa prashraatmaka saptamo bhaaga. 1965. Linguistics.. saundarananda kaavya. Language.. 600 pgs. Literature.org/…/SanskritIIIT... shriiprataaparudramahaadevamahaaraaja. saral sanskrit bala bhodh. Linguistics. Sanskrit. 150 pgs. sarala kahaaniyan' bhaaga 2. Language.. 372 pgs. mahtma gandhi.. Sanskrit. -. 0.... 60 pgs.chennareddy. satyaatheprakaasha. Linguistics. sarvaveidaan'tha sidhaan'ta saara san'graham. 60 pgs. sanskritdocuments. Sanskrit. satyaashhaad'haavirachitan'shrotasuutran' dashamo bhaaga. Literature. Linguistics.. saral sanskrit shikshak bhag 4. 60 pgs. 0. Psychology. 62 pgs. sarasvatiivilaasa vyavahaarakaand-d'a. Literature. Linguistics. 1907. Language.. 202 pgs. 162 pgs. Literature.. Language. -. Literature. Linguistics. Sanskrit.. Sanskrit. satya shodhanam. 1927. Literature.. Sanskrit. Linguistics. arya bhadanta asvaghosa. Sanskrit. Sanskrit. Sanskrit.. Vacant. Language. Not available. satyashhaad'havirachitan' shootasuutran. 1927.. Sanskrit.. Sankara Sastri Marulkar. Linguistics. -.. 537 pgs. 0. Sanskrit.. Linguistics. 222 pgs. saral sanskrit shikshak bagh 2. 60 pgs. Language. 150 pgs. Sanskrit. 1970. LANGUAGE. 438 pgs. 1942.. satyaashhaad'haavirachitan'shrotasuutran' ekaadashaadichatudeshaantaprashraatmaka panchchamo bhaaga. LANGUAGE. satyaartha prakaasha. saral sanskrit sikshak baag 8. 1928.… 142/167 . Linguistics.. 0.. sapal jiivan ki mahatvapoorn gatnaaye. harinaaraayand-a aapt'e.. Literature. sat'iikaamarakoshasya. 1994... Language. 52 pgs. Unknown. sarakaara tumhaarii aan'khon'men'. LANGUAGE. Literature. Literature. Literature. 1962. 1928. Sanskrit. m. Language. 0... 88 pgs.dhaprashratrayaatmaka prathamo bhaaga.. Not Available. Language. Philosophy.. Language. Biography. Sri Kasinatha Sastri Ahhore. Language. Psychology. 426 pgs.. 166 pgs. sarvalaqs-and-asang-graha hitachintaka. Linguistics..2/14/2011 A list of scanned Sanskrit books at III… sanskrit self teacher part 2. Language. Sanskrit. 0. 930 pgs.. Literature. satyaashhaad'haavirachitan'shrotasuutran' panchchadashashhod'ashaprashraatmaka shhashht'amo bhaaga. Literature. Literature. Shankara Sastri Marulkar. -.. sarvadarshanasan'graha prasthaanabhedashcha. 1932.. Sanskrit. bhiqs-ugauriishang-karend-a. 1912. 308 pgs. Philosophy. Language. 396 pgs.. History. sri sarangadhara acharya. Linguistics. 0.. LINGUISTICS.. -. Geography. 1927.. santhrajshakunam. Not available. Sanskrit. Sanskrit. Linguistics.. Sanskrit. Language. Linguistics. sarvavedaanta siddhantasaarasan'graha. LITERATURE. satyaashhaad'haavirachitan' shrotasuutran' tatraas-s. Language. Sanskrit. Sanskrit. s d satwalekar. 1971.. 1939. Language. 0. Language.. Literature. Shankara Sastri Marulkar. 204 pgs.. Sanskrit. 155 pgs. shriimanmaadhavaachaarya. Sri Shankaracharya. 468 pgs. Sanskrit. Language. Sanskrit. 1937. Sanskrit. Sankara Sastri Marulkar.. Sanskrit. Linguistics. sarangadhara samhita.. 394 pgs. Sanskrit.. 724 pgs..

Language. shriimadven'kat'anaatha vedaantadeshika.. Linguistics. Sanskrit. sri shankaraacharya. Linguistics. Language. shaatpit'akamu. LANGUAGE.. Theology. Linguistics. 238 pgs. 1052 pgs.... Lokesh Chandra.... Sanskrit.. shaastradarpand-amuu. 386 pgs. 141 pgs.. 1974.. Language. 296 pgs. Literature.. 563 pgs. 1896. Somanatha. Literature. 152 pgs. shaastrasiddhaantaleshasan'graha. 1913. 400 pgs. Literature. Sanskrit. LINGUISTICS.. Sanskrit.. LINGUISTICS. LINGUISTICS. Linguistics.. Literature. sevantikaaparind-ayamuu. 1074 pgs. sautasuutramu san'kalitaprayokachandrikaa. shaastradiipikaa... satyashhaad'ha. 0. gand-apati. vyaasa.. Religion. Literature. shaastradiipikaa. Linguistics. 1971. shaastrasiddhantaleshaasan'graha of Appaya Dikshita. Linguistics... Sanskrit.. shaastrarambhasamarthanamu. Language. 0.. shabdaarthachan'drika aan'dhranighan't'uvu. Not Available. Sanskrit. Not available. Philosophy. 383 pgs. 356 pgs.. LITERATURE. Sanskrit. 1971. Literature. 1969. Linguistics.. Not available. Literature. savesamavrxttaprabhaava.. 0. Sanskrit. 2258 pgs. Sanskrit. Religion. pat't'abhirama. 0. Sanskrit. Literature. Language.. sanskritdocuments. Linguistics. 320 pgs. Philosophy. 414 pgs. Literature. 1933. Sri Venkatraman.. Language. 1281 pgs. Sanskrit. Linguistics. Language. shaan'karapaadabhuushhand-amuu.. 0. Language. Sanskrit.. 1917. Sanskrit. shrii shriisachchidaanandendrasarasvatii. Language.. Literature.. 51 pgs. bhagavadamalaananda. 1992. Sanskrit. Appaya Dikshita... Sanskrit. Literature. shaastradarpand-amu. Sanskrit. laqs-mand-a shaastri. 560 pgs. Language. Language. Linguistics. shaarirakanyaayasadgagrahan' pradhamodhyaayan.. LANGUAGE. shaang-karn' vedaantamiimaan'saabhaashhyamuu kramaang-ka 1. shriimadden'kat'anaatha vedaantadeshikulu.. Theology..org/…/SanskritIIIT. Sanskrit. 0. Sri Radhanath Suri. 1930. shabdakaustubha trxtiiyobhaaga. 1935. Not Available.. Linguistics. Sanskrit. bhat't'ojiidiiqs-ita.. Sanskrit. shriimadabhat't'ojiidiiqs-ita. 307 pgs. Language. LITERATURE. Linguistics. saurapuraand-a. Linguistics. shabdakaustubhe. Psychology. Psychology.. seshvaramiimaan'saa miimaan'saapaaduke miimaan'saapaadukaa parittraand-amu. Sanskrit. 1982. 394 pgs. 1924. shaastramuktaval'ii. Literature. shabdakaustubha Vol II. gn-aastradarpand-amu.. mahaakaal'isubbaaraaya. Literature.. Language.. LITERATURE.. 1915. 1822. 1921. Sanskrit. Not available.2/14/2011 A list of scanned Sanskrit books at III… saundaryalahari bhaavanopanishad devi panchastavi vyakhyaaya sahita. Sanskrit. Sanskrit. Language. Literature. 98 pgs. Language. 1938.. 174 pgs. Literature. Sanskrit. . Language. savyaakhyonind-aiyasindhoo pradhaman' parichchodan. Literature. LANGUAGE. seshvaramiimaan'sa miimaan'saapaaduke. Linguistics. 240 pgs... Sanskrit. Philosophy. 1913.. shaastrashuddhapan'chaan'ga ayanaan'sha nirnd-aya. 294 pgs... 476 pgs. 1937. Social Sciences.… shabdashaktiprakaashikaa shriijagadosha takailadkaara Language Linguistics Literature Sanskrit 143/167 . Psychology. Linguistics.. Linguistics. 510 pgs.

aadityaachaarya. Literature. Theology. 182 pgs. Linguistics. Literature. Language... shevan'tikaaparind-aya naat'akamu. 0... Language. 567 pgs. shriijagadosha takailadkaara.. Motilal Sharma Bradwaj. Literature. 90 pgs. 218 pgs. Sanskrit. Language.. 1927. Language.. V. 0. Sri Gadadhara Bhattacharya. shriimajjagadiishatarkaalang-kaarabhat't'aachaarya. Linguistics. Sri Yamuna Muni. Literature. 334 pgs. shhrii vishnusahasranama.. Linguistics. 1956. Sanskrit.. shhrii aniirud'ha samn'hita.. shabdendusudhaa. 1881. Linguistics. Not Available.. Sanskrit. Sanskrit.. shrii sridahara venkateshakrutha. Linguistics. shang-karavijaya. Religion. shatapathabraahaand-a Part 5. 1952. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… shabdashaktiprakaashikaa. Psychology. Literature. Linguistics. Theology.. jagadiish. 1904. 0. Religion. 188 pgs. Sanskrit.. 1981. S N Sriramadesikan.. shrii dattakasuunumahaakavi shriimaaghaprand-iitan. shabdashakttiprakaashikaa krxshhnd-akaanti t'ikayaa prabodhinii vyaakhyaaya tippand-yaa. 240 pgs. shriimadiishvarapratyavitgnakacharyachakravarthi.. 1911. 1961. Language.. Sanskrit. 1340 pgs. 1825. Sanskrit. Philosophy. 100 pgs. 185 pgs... shivasan'hitaa. Sanskrit. Language. Linguistics. sanskritdocuments.. khemaraaja shriikrxshhnd-adaasane shreshht'inaa.. Sanskrit. Linguistics. Language. 0. 1971. A Sreeenivasa Iyengar. Literature. 169 pgs. shivaadvaita nirnd-ya. 148 pgs. 186 pgs.. Sanskrit. Language.… hi t ttik bh k R li i Th l S k it 1970 210 144/167 . Language. Literature. Sanskrit. 68 pgs.. Philosophy. khemaraja shriikrxshnd-adaasa. 1927.. shatakataryam shrii bhatrxharivitachitam.. Sanskrit. 260 pgs. Linguistics. shattlivaada. Linguistics. Language. Sri Uttamur Viraraghavacharya. 104 pgs. Philosophy.. shivastotraavalii... shaindravilasa.. 1935. sri gadadhara bhattacharya. Literature. Sanskrit. Linguistics. Literature. 1958.. Language. 1947. 29 pgs.. Linguistics... Sanskrit. shiroomand-iikutadiidhitya anumitigrantha. Linguistics. Linguistics. shhood'asa raamaayand-a san'grah a. shishupaalavadhamuu. 1960. Language. 239 pgs. Literature. Sanskrit. 194 pgs. 264 pgs. 1984. Literature. Linguistics. Philosophy. Linguistics. Sanskrit.org/…/SanskritIIIT.. Language. Sanskrit.. Language.. Language. Religion. not available... Sanskrit. 1900. Sanskrit. 124 pgs. Literature. Linguistics. Literature. 0. Sanskrit. appayya diiqs-ita. pan' raamalochanashaastrii. shabdashittkprakaashikaa. Linguistics.. Sri Barthruhari. 1951. Narasimhacharya. 1973. Literature. shishhyadhiivrxddhidamu vivarand-a. Sanskrit. shatapathabraahaand-a Part 3. shaktivaada manjusha vivrxtti vinoodhini.. Literature. shishht'aprayegasn'graha. Sanskrit. shhrii an'daal tiruppavai. 421 pgs. shiqs-aamanovinj-aanamu. Sanskrit.. 226 pgs. Psychology. Language. shriilallaachaarya.venkata Raghavacharya. Psychology.... Literature. 386 pgs..s. Language. Literature. aanandagiri.. Literature. Language.... Language. 1929.. 249 pgs. Sanskrit. 484 pgs. Sanskrit. shhad'ashiiti.. Literature. Psychology. shrii chokkaanaatha. 1956. Sanskrit. shiddhitaryamuu..

1959.… 145/167 . shrii bhaaskaroodaya. Literature. Sanskrit.. 1939. 0.... Linguistics.. 528 pgs.. amrxtaanandayogivaryand-a.. Language. 1946.. shlokavaar^tikat'iikaa shar^karikaa.2/14/2011 A list of scanned Sanskrit books at III… shivasuutravaarttikamu. Sanskrit.. shrii paanj-charaatre mahoopanipadi utsava san'graha prathama bhaaga.. Sanskrit. Sanskrit. Linguistics. Sanskrit. Sanskrit. daamoodara.. 77 pgs.. Linguistics.. Religion.. Linguistics.. Sanskrit. 1970. shrii ramakrishna maha kavayam. Theology. suryakant tripathi. narayanadasa adi bhatta. 1927. Linguistics. ramtej pandeyan.. Language. Linguistics. Psychology. Literature.. Literature. 0. shrii raamakrishnavachanaamruth.. shonakiiyamn' rxgaveda pratishaakhayamn.. K.... Literature. Sanskrit. Theology. Sanskrit. s. Linguistics. Linguistics. 176 pgs. shriimanmaharshhikaatyaayana. 188 pgs. 300 pgs. Literature. styanarayana raju. 1960. Language.. Rangaswamy.. shrauta sutras and prayogas.. 530 pgs. 1972. shraadvakaand-ad'amu chatutho bhaagan. Language. 1972. shrii harikathamrutham.. Sanskrit. Sanskrit. Sri Pasupathi Sastri. 210 pgs. Sanskrit. sethumadhavaacharya. ramaswami shastri. Linguistics. Sanskrit. Sanskrit.. 96 pgs. Literature. aar krxshhnd-asvaami ayyar. Not avilable. 242 pgs. Religion. shrii raamaayand-aasaar kaavya tilakamu. 256 pgs. Linguistics. Philosophy. The Arts. Theology. shrii raajaratnakaamaachampuu. shrii phakkika ratna manjusha. Language. bhaaskaraa.v. Sanskrit. Literature. 104 pgs. shrautasuutramu devayaagn-ikapaddhati. 99 pgs. shraaddhamayuukha chaturtha. 34 pgs. Sanskrit.. Linguistics. Language. 322 pgs.. Sanskrit.r. Linguistics.. not available. Sanskrit. Not available. shrii mahaabhaaratamuu.. 0. Linguistics.. 1962. Literature. Sanskrit. shri deisikaashatakamu. Language.. san'patkumaar. Literature.. 500 pgs. Sanskrit.. Linguistics. 1955. 0... 64 pgs.. Language. Sanskrit. 421 pgs. Religion... Sanskrit. shri vyaasa paanini bhavanirnaya. Sanskrit. 1968. 1942. shrii krishna leela tarangini. Sanskrit. Linguistics. 200 pgs. 0.. shriiniilakand-t'habhat't'a. Linguistics. 566 pgs. Language. Language... sanskritdocuments. K. Literature. Literature. shrii hanumat shahastri naamaan'jali. 1956. 1946.. 1933. 1950. Linguistics. Venkata Raman. 232 pgs. ramarayakavi bellamkonda. Literature. s. Religion. gopinath kaviraj. Literature. shrii harikathamrutham... Language. Literature. 244 pgs. 1939.. not availabe. Literature.. 1920. k. 616 pgs.. shrii prabhudev vachanamrut. Language. Theology. Sanskrit. madhuravaand-i. 0. ubhayabhaashhaasanaatha dvibhaashhi somanaatha. Linguistics. shrii dgargaachaaryasan'hitaa dashakhand-d'atmikaa mahaatmyasametaa. Language. Language. shivavilaasakaavyamuu. 0. Language. Sanskrit.. Language. Literature. Literature. Language. Linguistics. Not available. 266 pgs. 0. shivatatvaratnaakara. Literature. Language. shivatatva ratnakaramu. Literature. 212 pgs.org/…/SanskritIIIT. Religion. Theology. narayanadasa adi bhatta. Sri Bhattaputra Jayamishra.. 1942. Sanskrit. 475 pgs.. shrii guruvaayupureishvara. 253 pgs.. 132 pgs. The Arts. Language..

General... Sanskrit. Literature. Linguistics. 746 pgs. shriigautamamuniprand-iitan' nyaayadar^shanan. Language. Sanskrit. Literature. shriibhagavadbhakttirasaayanamu t'ikayaa premaprapayaa.. Philosophy. 210 pgs. Literature. Language. shrii kun't'imahi sheshhasharma.org/…/SanskritIIIT. shriicharakasan'hitaa taatparyetyaparaparyaaya aayurvedadipikaakhya vyaakhyaaya samalang-krxtaa prathamavrxtti. 1926. 145 pgs. Theology.. 1917. 1954. Sanskrit. shrii tyaagaraaja shatavaarshhika smrxti gran'thaaval'i 1947. shriigiitaasvaamivijaya. Language.. bhagiirathaatmajena. Language.. 170 pgs. Literature.. shriimadhusuudanasarasvatii. Linguistics.. Sanskrit. Sanskrit. Linguistics.. Language. Religion. Sanskrit.. 222 pgs. shriibhagavadraamaanuja.. shriidattapuraand-amu sat'iikamu. 564 pgs. Literature.. Literature. 186 pgs.… shriigurucharitamu dvisaahastrii sat'iikamu sachuurnd ikan'cha shriivaasudevaanandasarasvatii 146/167 . 416 pgs. Language... Linguistics. shrii vimaanaa charna kalp.. Language. Sanskrit. Linguistics. shriimachchrakachaturaanana shriichakrapaand-idatta... Religion. 1944. Language. Religion.. sii ema paadmanaabhaachaarya. Literature.. Sanskrit. Sanskrit. Sanskrit. sanskritdocuments. -.. 240 pgs. Sanskrit. 1922.. Sanskrit. Sanskrit. Sanskrit. shrii vyaasa panni bhavanaaraayand-a. Sanskrit.. Linguistics. 1942... 735 pgs. Linguistics.. shriigiitaagovindakaavyamu. 255 pgs... Linguistics. Literature.. Language. Language. 1960. Linguistics. Theology. shriibhuvaneshvariimahaastotramu. 159 pgs. Sanskrit. 1948. 727 pgs. Sanskrit. 1989. Linguistics. Literature. 234 pgs. Language. 74 pgs. Linguistics. 1922. Language. 0.. Religion.. Literature. Sri Padmaprasad Sastri. Literature. 1972.. 1926... Literature. Language. Language. shriiprxthviidharaachaarya.. shrii shankara shankara bhasya vimarsha. Theology. yas seitumaadavaachaarya. shrii shaang-akhaayana grxhyasuutra. Literature. 0. 1943. shriigautamamuniprand-iitanyaayasuutraand-i. 1989.. Language. Sanskrit. shrii keshri kant sharma. Literature.... Theology. 0. shriigitaa bhaavachandrikaa. Sanskrit. 1974. Literature.. 1984. 286 pgs. Not available. Literature. vinaayaka gand-esha aapat'e. Psychology. Lakshmana Suri. 448 pgs. 856 pgs.2/14/2011 A list of scanned Sanskrit books at III… shrii ramayanasaar kaatha tilakamu. Linguistics. Linguistics... Sanskrit. Language. Linguistics. 222 pgs. shriiyuta raa raa mootiilaala ravishan'kara ghood'aa. shriilaqs-miidhara. esa anantaachaaryand-a. 1954. shriibhagavannaamakaumudii miimaan'saa prakaashat'ikayaa sahitaa. 1947. Sanskrit. 266 pgs. aar ran'garaamaanuja ayyan'gaaru bi ye yal t'i.. shrii vishhnd-uchitiiyamuu. shrii rxgyaju shaavri vaishhnd-avaanaan' brahmakarma. bellamkonda ramaraya kavi. 1362 pgs. tyagaraja. 0. Linguistics.. shrii sitarmayanam. shriivaasudevaanandasarasvatiit'en'besvaami. 478 pgs. Sanskrit. shriibhaashhyamuu.. shriibhaashhyamuu shrutaprakaashikaaravya. Literature. shrii venkatachalamahatyam. Not available. 0. Religion. Sanskrit. Sanskrit. 111 pgs.... 690 pgs. Theology. shriibhagavadraamaanuja. shrii yatipativaibhavadiipikaa cha.. shriibhagavatpaadaabhyudayamu. 1989. madhuravani. Linguistics.

maharshhi vedavyaasa. Linguistics..… h ii dbh d iit bh hh kh b dhi ii d'h th t tt l k 147/167 . 610 pgs. Literature. Linguistics. 0. 1928. shriiharivan'shachampu. 614 pgs. Literature. Sanskrit. Literature. 1997.. shriimadanuvyaaravyaanan. 1953. Religion. 480 pgs. Sanskrit. Not available. shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru. Language.. Linguistics. Sanskrit.. Sanskrit. Sanskrit.. Sanskrit.. maharshhipravara shriikrxshhnd-aadvaipaayana. 317 pgs. Literature. shriimadbhaashhyat'iikaabhaavadiipedditiiyaadhyaaya. shriimatpuujya shang-kara bhagavatpaadaachaarya. Linguistics. Sanskrit.. 166 pgs. Sanskrit. 492 pgs. GENERALITIES. Language... 467 pgs.. si . 0. Sanskrit. shriivaasudevaanandasarasvatii.. 1997. Linguistics. shriimadbhagavadgiita san'put'a 2 ( 10 rin'da 19 adhyaayagal'u ). 120 pgs... Theology. 1936. shriimadaand-ubhaashhyamu.. shriilokaprakaashan' dhvitiya bhaagan. 1954. 768 pgs. kapaali shaatri. shriimadadvaita siddhaanta krama prasthaanatraya bhaashhyaanusarend-a. Language. shriimadbhagavadgiitaa. 330 pgs.. Not available. Language. 0. 601 pgs. 0.. Literature. Literature. shriimadvallabhaachaarya. 1902.. 114 pgs.. sanskritdocuments. Literature. Language. Linguistics. Not available. Linguistics. 1942. hayavadanaravuu. Philosophy. 62 pgs. 1958. kaaluuri hanumantaraavu. shriikoshha. Language. 1935.. 1983. shriimadbhagavadgiitaa. 1985. Sanskrit. Linguistics.. Linguistics. Sri Madramanujacharya. 397 pgs. Sri Rajagopal Shastri.. 274 pgs. Not Available. 1997.. Psychology. Sanskrit. Language. Linguistics. Not available. pand-d'itaratna rayapaalya raaghavendraachaarya. 284 pgs.. Sanskrit.. shriimadraamaanujaachaarya.. shriimadavaalmiikiraamaayand-amu saralagadyatmakam. . Religion. Language. Not available. Linguistics.. 1987. Sanskrit. shriikand-t'hacharitamu t'iikayaa. Literature. 0... shriimadbhaagavatamahaapuraand-amu muulamaatramu. shriikarabhaashhyamuu. 570 pgs.. Religion. 599 pgs. Sanskrit. 1946. Sanskrit.. shriimadamarasin'havirachitei. Language. Literature. 156 pgs. shriikushhnd-avilaasakaavyamu.org/…/SanskritIIIT. Sanskrit.. shriilokaprakaashan. Linguistics.. Sanskrit.. Religion. Sanskrit. Literature. Sanskrit. 1110 pgs. shriimabrahmasuutrand-i saadhanaadhyaaya. sukumaara kavi. Language. LINGUISTICS.. Sanskrit. shriilalitaasahasranaamastootramu. LANGUAGE. Linguistics. kedaaranatha... Theology... Literature.. 279 pgs. Sanskrit. 67 pgs. Language. 0. Sanskrit. 0.. 2004. Linguistics. Sanskrit. maagad'i shriiveng-kaachaarya. Sanskrit. LITERATURE.. 26 pgs. 748 pgs. Literature. Sanskrit.. 590 pgs. Linguistics. Literature. Literature. 233 pgs. Literature.. shriimadbhagavadgiitaa.. moot'e aqs-aravaalii. Language. shriimadbhagavadgiitaa. shriikand-t'hacharitamu t'iikayaa. Language. Sanskrit. Theology. Language. Language.. Language... .. Linguistics.. Language.. shriimadbhaagaravamu pan'chama khand-d'a. Linguistics. Language. 1923.2/14/2011 A list of scanned Sanskrit books at III… shriigurucharitamu dvisaahastrii sat iikamu sachuurnd-ikan cha. 1921. Literature. 1923. shriimadbhagavadgiitaa bha t't'aatmajasham'karashaastrind-aa sam'shodhitam. shriimaatrxtattvaprakaasha.. Theology. Theology. Literature.. Linguistics. Literature. shriimadbhagavadagiigaa. Religion.

130 pgs. Linguistics. Literature. bala gangadhara tilak. 1955.… shriimadveidaantadeishikagranthamaalaa shrii kan'chi pi bi annangaraachaaryaara Language 148/167 . shriimadbhagavadgiitaa shriimachchhang-karabhaashhyayutaa.. shriimaddeidaantadeishika granthamaalaayaan.. Literature. Psychology. Linguistics. Sanskrit.. t'ii aar krxshhnd-aachaarya.. shriimachchhaang-kara. Sri Valmiki... Sanskrit. Philosophy. yadupatii.. 1917. 1941. shriimadbhagavadgiitaa gn-aanakarmasamuchchayaakhyayaa vyaakhyayaa samaln'krxtaa. 1834. Linguistics. 273 pgs. shriimadbrahmasuutratadaabhaashhya trxtiiyaadhyaaya.. Not available. Language.. Language. 353 pgs. viddaanu a san'patkumaaraachaarya. Language. 155 pgs.. shriijagannathayatii. Sanskrit. Linguistics. Sanskrit. shriimadbhrahmasuutraand-i saadhanaadyaya.. Language. Language. aanandagiri. sanskritdocuments. Sanskrit. Not available. harinaaraayand-a aapat'e. Theology. Not Available. Theology. Theology.. 202 pgs. Religion. Literature.. 0. Literature... shriimaddeidaantadeishikagranthamaalaayaan. 346 pgs. shriimadbhagavatamu ashht'ama skn'dha. Sanskrit. 1926. Linguistics. Sanskrit. Language. 420 pgs. shriimadvalmiikiraamaayand-amu yuddakaand-amuu 6.. shriimadbhahmasuutraand-i saadhanaadhyaaya. 392 pgs. Literature. 270 pgs. 0. shriimadvalmiikiraamaayand-ama~ ayodhyaakaand-d'a Part I. shriimadvalmiikiraamaayand-ama arand-yakaand-d'a. 807 pgs. Linguistics.. Vadiraja. Linguistics. shriimadveidaantadeishikagran'thamaalaa. Language. Language.. 1912.. 1911. Linguistics.. Religion. Religion. Sri Brahma Yogin.. Sanskrit. shriimadvalmiikiraamaayand-amuu yuddakaand-d'amu 6. Language.org/…/SanskritIIIT. Linguistics. shriimadvadiraajiiyagrandamaalikaayaan' ashht'aman. Literature. Literature. shriimadbhahavadgiitaas-r^thaprakaashikaa. t'ii aar krxshhnd-aachaarya. Not available. shriimadvalmiikiraamaayand-amu prathamoo bhaaga.. Religion. shriimadvalmiikiraamaayand-ama~ uttarakaand-d'a~. Language. 1965.. 949 pgs. 0.. 1834. Linguistics. shriimadgand-eshagiitaa. Sanskrit. Sanskrit. Sanskrit. Linguistics. Literature. shriijagannadthaya.. 449 pgs. Linguistics.. Linguistics.. 1941... shriijakannatha. 0. Theology. Theology. Sri Valmiki. Sanskrit... 309 pgs. 1964. vidvaan a san'patkrxmaaraachaarya. 1941. Literature. shriimadbhagavatgiitaa. Sanskrit. shriimadbhagavadgiitaa dvitiiyyashhat'kamu. 1887. Theology. Sanskrit.. Sanskrit.. Linguistics. Linguistics. 338 pgs. Language. Religion. Language. Language. Language. 324 pgs.2/14/2011 A list of scanned Sanskrit books at III… shriimadbhagavadgiitaa bhaashhya vyaakhyaaya subodhinii guud'haarthatattvalokan.. 0.. Literature.. 1827. 476 pgs. Philosophy. Sanskrit. Not available.. Literature. 1917. Literature. 1940. 144 pgs.. 0. 591 pgs.. aanandavardhana. Sanskrit. 170 pgs. Sanskrit. 782 pgs. Sanskrit. Sanskrit. 0... 492 pgs. shriimadbhagavata pan'chama skan'dha.. Religion. 1903. 783 pgs. Literature. Language.. 958 pgs. Literature.. Sanskrit.. vidvaanu a san'patkumaaraachaarya... shriimadragavadraitaa. t'ii aara krxshhnd-achaaryand-a. Sanskrit. Theology. Sanskrit. Religion. shriimadbhraahmasuutraand-i samanvayaadhyaaya.. Sanskrit. Literature. 386 pgs.

Sanskrit.. Linguistics. yer'r'aapreggad'a rachiyin'chinadi. Language. Linguistics. 1941. Religion. Language. Sanskrit. Sanskrit. Sanskrit. Sanskrit.… 149/167 ... 1909. Linguistics. 1934. Literature. shrii kan chi pi bi annangaraachaaryaara. Literature. Religion. t'ii. Sanskrit. 1846.. Literature... 262 pgs. Theology. pan' jvaalaaprasaadajii sharma. Religion. 419 pgs. aara krxshhnd-aachaaryan. 238 pgs... 1911.. shriimanmahaabhaaratama~ anushaasanar^vand-i. Sanskrit. Sanskrit. Linguistics.. Religion. Maharshi Vedavyasa. 1901.. Language. shrii a vi narasin'haachaarya.. Literature. Subramanya Sastri. Linguistics.. Theology. 1907. Linguistics. Theology... 310 pgs. shriimanmantraarthamanj-jarii. 86 pgs. Language. shriimaath kapilananda swamy. t r krishnaacharya. Literature. shriimahaabhaaratamutoojeirina 1901.. shriimaggavth kapila githa. shriimallalitaraamacharitramu baalakaand-d'an' sat'iikamu. 0. Literature. Linguistics. 292 pgs. Religion... Sanskrit.. 0. 789 pgs. 207 pgs. 0.org/…/SanskritIIIT. 508 pgs. Language. 251 pgs. Not available. 0. Literature. shriiman mahaabhaaratamu upoodghaatamu. Not available. shriimahaabhaaratamu shaan'tiparvamu. Sanskrit. 0. 822 pgs. 0.... Not available. 0. shriimata jayatiirtha.. 1832. t r krishnaachaarya.. Theology.. Theology. Language.. Sanskrit. 1932. Language. 341 pgs. Linguistics. Sanskrit. Language. Not Available. 1914. Literature. 1912. 1905. shriimanmantrarthamanj-jarthaa. Not Available. shriimanmahaabhaarahamu. Sanskrit.. Sanskrit.. Linguistics. Literature... 368 pgs. shriimanmahaabhaaratamu. shriiman mahaabhaaratamu vishhayaanukramand-i. Language. Not available. Language. Sanskrit. 276 pgs.. Linguistics. shriikaanj-chi prativaadibhayang-kara and-ndan'garaachaarya. Religion. Theology.. P. Sanskrit. Language. Theology. Linguistics. 0. Religion. shriimadvishhnd-utattvavinirnd-aya.. shriimajjeiminiiprand-iite mimaan'sadarshind-i. shriimana nyaayasudhaa. Literature. Sanskrit. Literature. Theology. Literature.. Religion. Language.. Language. shriimahaabhaaratamuu drond-aparvamu. 727 pgs. Sanskrit.. Religion... shriimanmahaabhaaratamu udyoogaparvamu.. shriimahaalaqs-myupaaravyaana. Sanskrit. 1940. Linguistics. 842 pgs. 225 pgs. Linguistics.. shriimahaabaarataantargata shriimadbhagavadgiitaa dvitiiyyashhat'kamu.. Not available. 200 pgs. Sanskrit.. Not available. shriimahaabhaaratamu shaan'tiparvamu. Sanskrit. 431 pgs. Sanskrit. Not available. shriijaanakiivallabha.. P. vinaayaka gand-esh.. Not available.... Language. shriimadviddyapayonidhitiirtha shriipaa. Theology. 1951.. Theology. shriimadveidaantadeshikagranthamaalaa. Linguistics. 716 pgs. 722 pgs. 538 pgs. Sanskrit.. Sanskrit. 215 pgs.2/14/2011 A list of scanned Sanskrit books at III… shriimadveidaantadeishikagranthamaalaa. sanskritdocuments. Literature. Not available. Literature. Religion. shriiman mahaabhaaratamu anushaasanaparva 13. shriimanmaharaaja san'skrxta mahaapaat'hashaalaa patrikaa. 0. 540 pgs. Religion. 0.. Sanskrit. 1811. Theology. shriimanmahaabhaaratama~ bhiishhmapar^va. 860 pgs.

Sanskrit. m. Literature.. 48 pgs. shriimadraaghavendragurusaarvabhauma.... 0. 128 pgs. Sanskrit. shri direndra tirth. Linguistics. 1986. Literature. Language. 248 pgs. Religion. 760 pgs. shriiraamadaasasvaamiin'che samagra gran'tha shriisamarthagran'thabhaan'd'aara. 120 pgs. Theology.. 1929. 1960. 0.. Language. Sanskrit. Linguistics. dvibhaashhi somanaatha. Sanskrit. shriiraajaratnamaalaachampuu. shriiraamaliilaa raamaayand-a sat'iika. Sanskrit. Literature. shriiraamaayand-asaara kaavya tilakamu.2/14/2011 A list of scanned Sanskrit books at III… shriimannaaraayand-iiyamu. Sri Raghvendra Swami.. Literature. Sanskrit. RELIGION. Literature.. Sanskrit.. khemaraaja shriikrxshhnd-adaasa. 0. Sanskrit. Language.. Literature. Sanskrit.. Sanskrit. shriimannyaayasuudhaa sheshhavaakyaarthachan'drikaat'ippand-i. 1100 pgs. 101 pgs. Language. 1829. shriimatyaagaraajavijayamu prathama sn'skarand-amu. shriimatsarvamulan'san'puurnd-a. Seshasayi Iyengar. Not available.. 402 pgs. shriinaaraayand-iiyamuu.. 0. shrii vaadiraajabhagavatpaada. Theology. . shriiraamaayanama. Literature.. Language. shriiraamaayand-a mahaakaavya bhaaga 5. 1974. Sanskrit.. Sanskrit... 260 pgs. Sanskrit.. . Linguistics. shriimanyaamutan. daamodara saatavalekara. 0. Sanskrit. shriimatuu saathand-aachray. Literature. 267 pgs.… 150/167 . 0. raamachan'dra. Language. Linguistics.. Religion. Pandit R. Linguistics. Language. Theology. Language... 0.. 240 pgs. shriinarasimhapuraanamu.. Linguistics. LINGUISTICS. 0. Linguistics.. LITERATURE.. Philosophy. 1952.. n ramaswamy iyer. shriimannyaayamrxtataran'gind-i. Linguistics. 1987. sanskritdocuments. shriimatryaayasudhaaparimat't'an. Sanskrit.. 1956. Language. shriimanu nyaayasudhaa prathamoobhaaga. 1958.. Linguistics. 391 pgs. shriimattan'trasaara chhallaarii vyaakhyaana. 0. 1110 pgs. Literature.. 1942. Language.. Language. Not available. Religion. Sanskrit. Language. Linguistics.. Language. shriimannigamaantamahaadeshikaa. Sanskrit. Literature. 226 pgs.. mootiilaala jaalaan. 240 pgs. 244 pgs. Literature. 0.. Psychology.. Sanskrit. Linguistics.. 1930.. 38 pgs.. Literature. shriinyaayamutttaavalin... Sanskrit.. 1972. THEOLOGY. 584 pgs. shriipanj-charaatraraqs-aa paanj-charaatragamasya. 408 pgs. . Dwaita Philosophy. shriirahasyatrayasaarasan'graha.. shriimatsanatsujaatiyamuu kramaang-ka 8. madhuravaand-ii. 1940... shriinaaraayaneupanishad. Sanskrit. 153 pgs. 411 pgs. Literature.. shrii mudigond-d'a subrahmand-yasharmand-aa. Language. Literature. 0. Sanskrit.. Literature. Sanskrit.org/…/SanskritIIIT. Linguistics. Linguistics. Language. 228 pgs. Language. shriimannyaayasudhaaparimal'e dvitiiyadhyaaya prathamapaada. Not available. 0. saqs-mand-a raamachan'dra paan'gaarakara. Linguistics.. Sanskrit.. not availabe.. Sanskrit. Sanskrit. 1968.. Language.. Linguistics. LANGUAGE. Language. Literature. shriimadvedaantadeshika. shriipaadukaasahasramu muulamaatramu. 485 pgs. siddheswar jena. Linguistics. Not available.. 617 pgs. Sanskrit. Linguistics. shriiraamalin'gheishvarasthavaraaja. Not Availble. 424 pgs. 308 pgs. Linguistics. Literature. Not available.. Literature.

0... shriishan'karaachaayaivirachitagran'thasan'grahan'prakarand-agran'thaan. Theology. Literature. shriishivasvaroodaya. Sanskrit. 1937. shriiupaasanaatrayasidddhaan'ta... Language. Sanskrit. 244 pgs. LINGUISTICS. Language. Linguistics.. LITERATURE. LITERATURE. 120 pgs. bhaalachandra jagannaatha dvivedii. 1972. Linguistics... 0. 1918. 368 pgs. 274 pgs. Not available.. prabhudatta brahmachaarii.. shriisubodhinii t'ippand-isahita sampradaayavidushhaa. pand-d'itavara shriikeshariikaantajiisharma. Sanskrit. maadhavaachaarya.. Sanskrit. LANGUAGE. LANGUAGE. 0. Literature. shriishriichaitanya charitaavalii bhaaga 3. khemaraaja shriikrxshhnd-adaasa. Sanskrit. 1898. Hari Raghunath Bhagavat. Linguistics. Language. 299 pgs.. shriiveng-kat'aachalamaahaatmya prathamabhaaga hindii anuvaada sahita. Not available.. 749 pgs. Sanskrit. shriivishhnd-enaamasahasramu.. 1929. shriishriichaitanya charitaavalii bhaaga 2. LINGUISTICS. shriirang-garaamaanujamuniiprand-iitaa. shriishriichaitanya charitaavalii bhaaga 4. Religion. Literature. shriivishhnd-uyaagapaddhati navagrahamakhasahitaa. shriimahaamaheshvarachaarya. ti viiraraaghavaachaaryaind-a. Literature. Sanskrit. 170 pgs.. Literature. Language. shriiveng-kat'aachalamaahaatmya dvitiiyobhaaga hindiibhaashhaamayt'ikopeta... 0.. LINGUISTICS. Linguistics. prabhudatta brahmachaarii. 1921. Language. 224 pgs.. Sanskrit.. 0. LITERATURE. shriishriichaitanya charitaavalii bhaaga 5. shriishang-karadigvijaya hindii anuvaada vistrxta t'ippand-e tathaa vivechanaatmaka bhuumikaa. Linguistics.. Not Available. 376 pgs. 384 pgs. Linguistics. shriiveidaantaachaaryavijaya. prabhudatta brahmachaarii. 2000.. Language. Linguistics. shriisvachchhandatantramu. Sanskrit.. Literature. shrii krxshhnd-adaasa. 190 pgs.2/14/2011 pg A list of scanned Sanskrit books at III… shriiramayansaar kavya tilakam madhurvani.... Sanskrit.… 151/167 .. Linguistics.. Sanskrit. Sanskrit. 1947. LINGUISTICS.. Literature.. Literature. Linguistics. Sanskrit. Literature. Language.. shriishaantikalpadruma vaastushaantisahita. 340 pgs.. jagannaatha parashuraama dvivedi. Literature. Not available. Sanskrit. 1986.. Sanskrit. shriishriichaitanya charitaavalii bhaaga 1. 814 pgs. sanskritdocuments. LANGUAGE.. 1938.. 1950. Language. Language.. Literature. Sanskrit. shriikrxshhnd-adaasaatmaja.. 300 pgs. Sanskrit. 0. Sanskrit. LITERATURE. Language. LANGUAGE. 789 pgs. LINGUISTICS. Literature. 338 pgs. Linguistics. Language. Linguistics. LANGUAGE. shriitantralooka vivekaakhyat'iikopeta dvaadashobhaaga... Language. Linguistics. prabhudatta brahmachaarii.. 1852. Linguistics. shaaravot't'ai kushhnd-aasvaamyayya. shriivign-aanabhairava. ramaraju b ed. Language.org/…/SanskritIIIT... Sanskrit. Sanskrit.. Literature. 242 pgs. shriivallabhaachaarya. 230 pgs.. 0. 0. Religion.. Sanskrit. 568 pgs. shriiyaajnj-avalkyasmrxti. LITERATURE. 0. 279 pgs. Theology. shriiven'kat'aachaletihaasamaalaa. prabhudatta brahmachaarii. Sanskrit. Language. 288 pgs. Linguistics.. Sanskrit. Literature. shriimadabhinavagupta. Linguistics. Language. 1925. Literature. Literature. 318 pgs. 1955. 108 pgs..

shrikaara bhaashya vol 1.. v. Linguistics. Religion. Language. Language. shrungarabhushhand-amu... 294 pgs.. Sanskrit. 1862. Literature. 240 pgs. Linguistics. 1950. K. Linguistics.. sahadayaaliila. 1959. Literature.v.. Not available. Religion. Sanskrit.. LANGUAGE. 1936. 946 pgs. Literature.. Language. Sanskrit. Sanskrit.. shripatipaddhati adhyaaya 1 8 bhaaga 7. 1968. Religion.. Sanskrit. Literature. Sanskrit. Religion. hiiraalaala.. 352 pgs. Sanskrit. 1937. Sanskrit. Sanskrit. mahaadeivashaastri.. 486 pgs. 0. Language. Linguistics. Theology.. Language.... 283 pgs. Sanskrit.. 232 pgs... THEOLOGY. shuddhadhar^ma mand-d'alam' shriimadbhagavadgiitaa.. gad'gan'prasaadajii. 480 pgs. Literature. Linguistics. Sanskrit. Literature.rangaswami. iishvarasharma. 0. shriibaladevavidhyaabhuushhand-a. shrudhikaand-d'amu dashamo bhaagan. Language. 1890. 164 pgs. sidantabindu. jiivaanandavidhaasaagara. shrungarasarvasvasvabhaand-an.org/…/SanskritIIIT. LANGUAGE. 1899. Literature. siddaantalaqs-and-amu. 1923.. Literature. Language. Linguistics. Literature. Linguistics.. shriinallaa. LINGUISTICS. Language. Sanskrit. 68 pgs. Linguistics. 0. 200 pgs.. shrishivamahaapuraand-mu. shriiraamabhadra. Linguistics.v. Rangasawami Aiyangar.2/14/2011 y j j y A list of Sanskrit books at III… gscanned g g pg shriiyatiindrapravand-aprabhaava. Not available. pn' . shrudikaand-d'amu dashamo bhaagan. siddaantaratnamusat'iikamu. Language. Linguistics. 282 pgs. 171 pgs.. swamy maheshvarananda giri. Sanskrit.. shung-garatilaka. Language. Language. Literature. Language. 632 pgs. 1896... Linguistics... 1894. shriivaamanabhat't'a. Philosophy. Linguistics. Language. 1945. Language. shuklayajurveda sahitpani shachhtakamu. Literature. Sanskrit. 240 pgs... shrimadbhrahmasuutraand-i. bhat't'aachaaryend-a shrii paadasharmand-a.. Theology. 46 pgs... 846 pgs. shrxng-gaarasundarabhaand-a. shrii harshha. 1964. Linguistics. RELIGION. sanskritdocuments. Sanskrit. 23 pgs. Theology. 65 pgs. 640 pgs. Sanskrit. Sanskrit. 1902. shuklayajurvediiya kaand-va san'hitaa. LITERATURE. Sanskrit. 108 pgs.. 1968.. 1919.. Sanskrit.. maagad'i shriirang-ganaathaachaarya. Literature. LINGUISTICS. Sanskrit. Psychology. subrahmanya shastri. Linguistics. Literature. Language. e . shukraniitisaara. Linguistics.. shrundgaratilakamu. Literature... shrxn'gaara haaraavalii. Language. 1950.. vi .. Bhrga Samhita.. Sanskrit. Linguistics. shriimadgang-geshopaadhyaaya. 1912. 107 pgs. shrishang-karabhagavatpaadiiyaprakarand-aprabandhavali trxtiiyasan'put'amu. Literature.. shuddhiprakaasha. shuudrakamalaakaramu. LITERATURE. shrii madanan'da jagapati. 1965. 1932. 1956. e. Not Available. shukasaptati agn-aatakartrxkaa kathaakrxti. K..… 152/167 . 744 pgs. 0. shukraniiti. krishnajanth panth. Sanskrit. 154 pgs. Theology. shripati.. Literature.. Sanskrit. ilaivilli jagguu veng-kat'aachaarya. Sanskrit. Sanskrit.. 232 pgs..

Sanskrit. Language. 358 pgs. Theology. sidditrayii. Language. Linguistics.. Linguistics. Psychology. Literature. riitaaraamashaastrii. sri ramnatha shastri tr. Sanskrit. 132 pgs. Language.. 1917. 380 pgs. 170 pgs. 236 pgs.. Tryambakam Sastri. Linguistics. siddhantabindu nyayaratnavali laghuyakhya... 810 pgs.. Language. siddhanta kaumudi. Literature..org/…/SanskritIIIT. 0. 562 pgs. Sanskrit. Sanskrit. prataap sin'ha. 90 pgs. Linguistics. Linguistics.. Language... 1916. Linguistics. Linguistics. shriikrxshhnd-aanandasarasvatii. THEOLOGY. Linguistics. siddhaantasiddhaanj-janamu. Literature. Language. Sanskrit.… smrxtichandrikaa shraaghdakaand-ad'a. 1914. balabhadra. Psychology. 1921.. Literature.. Sri Krishnananda Sarasvati. siitaaraavand-asan'vaadajharyu ttarabhaaga.... Linguistics.. 1925.. 404 pgs. 102 pgs. Psychology. Sanskrit. sindhukaustubha. Sanskrit. 156 pgs. 242 pgs... Literature. LANGUAGE.. Linguistics. Sanskrit. pandit durgaprasada ed. 1928. Language... Sanskrit. Language. siddanta rahasyam. Sanskrit. sitaaraavand-asamvadaajharya uttarabhaaga. Not available. Language. Psychology. Psychology. shrii yaagn-ikadevand-abhat't'opaadhyaaya. Religion. shrii yaagn-ikadevand-abhat't'opaadhyaaya. Sanskrit.. Philosophy. Not available. Sanskrit.. Literature.. siddhasiddhaantasan'graha... Language. Literature. Sanskrit. Language. 566 pgs. 490 pgs. Sanskrit.... 1932. Literature. Linguistics. Linguistics. Philosophy. Language. parashuraama shaatri. Literature. sanskritdocuments.. 1917... Linguistics. Sanskrit. Sanskrit. 0. 0. 0.. sivalilarnava. Philosophy. Language. Sanskrit. siddhaanta shiromand-e grahargand-itaadhyaayo vaasanaabhaashhyasahita. Sri Krishnananda Sarasvati.. Sanskrit. Philosophy. 410 pgs. 1993. Language. siddhaantabindu of madhusuudanasarasvati.. Sanskrit. devana bhatta. Literature. Linguistics. RELIGION. Literature.. siddhantasiddhaajann'part 2. siddhaantashiromand-e gorlaadhyaayo vaasanaabhaashhyasahita.2/14/2011 A list of scanned Sanskrit books at III… siddanta kaumudi. Sanskrit. 54 pgs. Sanskrit. 1918. siddhaantasiddhaanj-janan' trxtiiyo bhaaga. Literature. siddhantasiddhaajann'part 4. Philosophy. 1919.. 1911.. 153/167 . Literature. wasudev laxman sastri pansikar ed. 469 pgs. LINGUISTICS.. Not available. 152 pgs. 1929.. Literature. Language. Sanskrit. Literature. 1928. Not Available. nilakanta dikshita.. 170 pgs. 1914. 156 pgs.. 810 pgs. 112 pgs. 1940. sidditrayamu vedaantaprakarand-amu vishishht'aadvaita brahmaniruupand-aparamu.. Linguistics.. Language. smritichandrika 3 vyavahaara khanka bhaaga 2. vasudev lakshman shastri pansikar ed. Language. 146 pgs.. siddhaantaleshasan'graha sat'ippand-abhaashhaanuvaada. smrxtichandrikaa aahnikakaand-d'amuu 2. sisupalavadha of magha.. Not available. smrxtichandrikaa san'skaarakaand-d'a 1. shriimadappayyadiiqs-ita. 0. Sanskrit. 1917. madhusudana sarasvati. Linguistics. pan' svaamishriiraamamishrashaastrind-aa. 0. Sanskrit.. siddhaantachandrikaa san'qs-iptabaalabodhinii t'iikaa. 596 pgs. LITERATURE. shrii yaagn-ikadevand-abhat't'opaadhyaaya... 1919. Literature.

Religion. 478 pgs. Language. Linguistics... smrxtyarthasaagara. shriimada aapadevatmaja anantadeva. Language... veda vyas. Linguistics. 1970. Literature. Literature. Linguistics. Language. sribhasyaprakasika.. Literature. Linguistics. aapstaan'baa. 439 pgs. sanskritdocuments. 1914. 1902. damodar s. Sanskrit. Language.. smrxtikaustubha. Language. Sanskrit. Theology. Literature.2/14/2011 A list of scanned Sanskrit books III… smrxtichandrikaa shraaghdakaand ad a. ramanujacharya.. smrxtichandrikaa vyavahaarakaand-d'a 3 bhaaga 1. smurichandrikaa asaucha kaanda. Language. Not available. vinaayaka jand-esha aapat'e.. Literature. smrxtichandrikaa yaamaashauchakaand-d'e.. Language. aachaarya mand-d'anaamishra. sri tuurvaasamunivar. Linguistics... 497 pgs. 326 pgs. Literature. Literature. Literature. spandakaarikaa. smrxtinaan' samuchchaya. -. sri suresvaracarya. Sanskrit. Sanskrit. srimad bhagavatam. Linguistics. 236 pgs. Linguistics. 1885. kallat'a. Literature.. Language.. Sanskrit. Language. Sanskrit.. Religion. 29 pgs. shriimadvidhanaada. srimad bhagavatam tasya dritya bagh. 339 pgs.. 1835.… 154/167 . Not available. Linguistics.. sri svayamvaraa paarvatii man'tramaalaa stootram. Linguistics. 232 pgs. sottaraaprashnaavalii dvitiiya khand-d'a 23 varshhaand-aan' prashnapatrasahita. 852 pgs. Sanskrit. sri vemageeta prathama sahasram.. 40 pgs.. veda vyas. sphoot'asiddhi.. 1961.. Literature. sri raamaanuja champu.. Linguistics. Sanskrit. Sanskrit. Sanskrit.. 1944. devanabhatta. 610 pgs.. Sanskrit. 1244 pgs.. Literature. Theology... khemaraaja shriikrxshhnd-adaasane shreshht'inaa... 0. 0.. Linguistics. 809 pgs. 148 pgs. Language. 776 pgs. Sanskrit. Sanskrit. srimad bhagavadgita purushaarth bodhani bhaasha tika. Language. Literature. sragii. Sanskrit. Language. Literature. Linguistics. Not available. Linguistics. Sanskrit. vemana. 230 pgs.. Literature. Sanskrit. tukaaraam. 1974. 222 pgs.. smuti kaustubhan. Literature.. prashnapatrasahita. spandakaarikaa... Sanskrit. Sanskrit. Language. Sanskrit. Linguistics. Religion.. Sanskrit. 42 pgs. 222 pgs.. Linguistics. 1930. Literature.org/…/SanskritIIIT. 1986. srautasuutra 1-5. Literature. Literature. Language. sri bhaashhya paart' I.. Sanskrit. sri raama giita. Language. Language. 1902. 386 pgs. Linguistics. Religion. sowgandhikaaharand-amu. Sanskrit.. 1969. 0. Literature..... Language. 1931.. 1970. Linguistics. 0. 158 pgs. Language. 314 pgs.. Literature. 1921. 1852... Language. Linguistics. Sanskrit. Theology. shrii yaagn-ikadevand-abhat't'opaadhyaaya. Linguistics. Sanskrit. 0. Linguistics.. spandakaarikaa.. Language. Literature. Language.... raamaanujaachaarya. Language. 824 pgs. g krishna shaastri.. Linguistics. Linguistics. Linguistics. 1969.. veda vyas. Sanskrit. Sanskrit. 0. Literature. shrii yaagn ikadevand abhatat t opaadhyaaya. 514 pgs. Theology. Srinivasagarya. 184 pgs. Not available. 1942. 1918. 208 pgs. 1909. Language. Sanskrit. 1914. srimad bhagavatam tasya chatutho bhag. Literature.. 490 pgs.

. valmiki. Language. shriimadullabhadeva. Linguistics. 1924. Sanskrit. sugamaa. Linguistics.. 556 pgs... subhashita niva. subhadraaharand-amu. Linguistics. Sanskrit. subhaashhitaniivyaan' durvrxttapaddatishchaturthii 4. Psychology. 192 pgs. Literature. 1911.bapat. veidaantadeishikulu.. 1971. Language. 0. 258 pgs. ti.. 1940. Linguistics. subhadraadhananj-jayamu. Sanskrit. 569 pgs. Sanskrit.org/…/SanskritIIIT. 0. Linguistics. Not available. 0. 1916. sanskritdocuments. si sundara shaastriyaara. 416 pgs. 86 pgs. srngara sekhra bhana.. 999 pgs. Literature.. 0. 1971. 1935. 584 pgs. 1988.. Language. 0. Language.. Linguistics. Sanskrit. Sanskrit. Linguistics. Sanskrit. Linguistics. Sanskrit. Psychology.. Literature. Technology. Linguistics. Literature.. Sanskrit. Sanskrit. Linguistics.. 1899. 890 pgs.. srimadbhaagavatam skandhas 8 ..2/14/2011 A list of scanned Sanskrit books at III… srimad ramayan dritya bagh.....12. subhaasita ratna bhaand'aagaaramu. Literature. 812 pgs.. Sanskrit. 142 pgs. chandrashekarana. Language. subhaashita ratna bhaand'aagaara. Literature. Sanskrit.. Theology. subhaashhita sudhaanidhi. sundararaamaayand-amu aura satiivilasitamu. Literature.. bhartrihari. Linguistics. kaashinaatha panduranga paraba. Not Available. 1951. Sanskrit. 1961. Pandith Laxmikanth Kanyaal. 218 pgs. 412 pgs. Literature. 1968. pandita nilakanta devarao deshpande. 111 pgs.. r. subhaashhitaniivii. abhinava kalidasa. Language. 156 pgs. Sanskrit... 84 pgs. Sanskrit. shriimaadhavabhat't'a. 1925. Linguistics. Philosophy. Literature. Sanskrit. 1912. Language. Not Available. kulashekara varmaa.v. Language.. krishnaachaarya. shriisachchidaanadendrasarasvatii.. 422 pgs. Linguistics. 1933.. sushrutasan'hitaayaa. Linguistics.. Sanskrit.... Linguistics. Language. Not available. sushrata sanhita sharira staanamu... 322 pgs. 0... Language. 170 pgs. Sanskrit. Literature. Sanskrit. Literature. abhinava kaalidaasa. 1917. statvaprakash. suuryyasidddhaanta. subod sanskrit vyakhan pradhama bhag. 1952. Linguistics.… 155/167 . subhaashhitaniivii. Not available. Philosophy.. Language. Psychology. Sanskrit. Language. Language. Linguistics. shriirang-kanaatha. Literature. 1955. 238 pgs. Literature. saayand-a.. 1134 pgs. 25 pgs. subhaashhitaavalin. naaraayan ram acharya. kaasiinaatha paan'd'uran'ga paraab. Unknown.. Literature. suutraarthaamrxtalaharii. Literature. Linguistics. Language. Sanskrit. srimad valmiki ramayanam. Language.. Language.. suurasaagara.. srngarasekhara bhana. subhaashita trishaati vyaakhyaayasahita. sutravt'ati. Literature. Language. sri vedanta desika. subhashita ratna bhaandaagaaram. Linguistics.. 350 pgs. Sanskrit.. Sanskrit. Literature. Literature. Literature. 916 pgs. 1931. 198 pgs. Linguistics. -.. Philosophy. Sanskrit.. 260 pgs. t. Language.. Religion.. Language. P.. Language. Sanskrit.. Literature. Linguistics.. Language.. Language. Linguistics. valmiki. 1961. 138 pgs. Language. 1941.. shriinigamaantamahaadeshikaa.. Sanskrit.. sumadhvavijaya. Literature. Sanskrit.. Sanskrit. suttanipaato. Literature.. 1891. Literature.. 1886. Sanskrit. 498 pgs. Linguistics. 74 pgs.

. 550 pgs. Language. taddhitaantaa kechanashabdaa. Linguistics.. svasthavrxttasamuchchaya bhaashhat'iikaasahita. Language. 221 pgs. Linguistics. Linguistics.. 0. 470 pgs. Literature. Linguistics. Linguistics. 1961.. 471 pgs.iv. Literature. Linguistics. Not available. 1896. Sanskrit. Literature. Literature. Literature. Linguistics. 454 pgs. Sanskrit. taajika niilakand-t'hii t'ikayaa savisheshhopapatti sodaaharand-a bhaashhaabhaavaarthana..iii. svaanandavanavihaarakaavyamu. 374 pgs.iii. Bhatta Kumarila. Linguistics. Language. Literature. Linguistics. shriisambhavai jyothorupaaya. e. mahaadeiva saastri. 470 pgs. Language. siitaaraama shaastri. 1898. Sanskrit. shivaraamakushhnd-ashaastri. kaashiinaatha vaasudeivashaastrii. Linguistics.. 362 pgs. Sanskrit. 136 pgs. Sanskrit. 306 pgs.v. Language.. mahadeiva saastri.. 1983.. Literature. ramanujacharya. svaravyaajjanamu. sanskritdocuments.. Sanskrit. Language. Sanskrit. Theology. svachchanda tantramu Vol. 0.. qs-emaraajaa. d'aa maagiirathapraasaadatripaat'hii vaagiisha shaastrii.. 1917.… 156/167 . Philosophy.. Theology.. Language. taatparyachandrikaa. 454 pgs. 1904.. Not available. 1948. Linguistics. Sanskrit. Language.. Literature.. Not Available... taitiriiya brahmand-a baashha part Ii. Language. Sanskrit. 224 pgs. Language. Language. Literature.. 1927. Literature.. taitiriiya san'hitaa. 362 pgs. Language. 34 pgs. 288 pgs. 478 pgs. Linguistics. Religion. Language. 1956.. Linguistics. Sanskrit. Language. e. Linguistics. Language.. ke maadhava krxshhnd-a sharma. Literature. shriimadgrund-i shan'bhubhat't'a. shriiniilakand-t'haachaarya. Sri Ganapathi Sastri. 1926. Literature.. t'ood'araanandamuu volume 1. taatparyachandrikaa dvitiiyasamput'amuu.. Linguistics. Sanskrit. Literature.. 0.. Sanskrit.. Literature. 1902. Literature. taajiiraatahinda.. pan'd'ita harishan'kara. Not Available. A.. Language. 0. Literature. Linguistics. Linguistics. 101 pgs. Psychology. mahaadeiva saastri. Sanskrit. 170 pgs. Linguistics. Linguistics. taittiriiya rand-yakan' bhat't'abhaaskara bhaashhyasahitan' Vol 3.. svaraajyasiddhi qs-igagd'adharendra sarasvati virachitaa. Literature.... Mahadeva Sastri.. Sanskrit. svayambhupuraand-amu. Sanskrit... 89 pgs.. Sanskrit. 480 pgs.. shriisachchidaanadendrasarasvatii.. mahaadeiva saastri.ix. 1896. 360 pgs. Language. 126 pgs. 1898. Literature. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… suutrabhaashhyaarthatatvavivechani. Language. 1895. Sanskrit. Sanskrit. Literature. svaanubhavaadarsha. Linguistics. Literature.. svarasiddaanta chandrikaa. taitiriiya san'hitaa krishna yajurveida Vol. svaraprakriyaa. vyaasatiirtha.org/…/SanskritIIIT.. 1964. 0. Philosophy.. Sanskrit. t'upuut'iikaa. 0. Linguistics. Sanskrit.. Language.. 0. Language. Language. Sanskrit.. Psychology. Religion. 570 pgs. Sanskrit. Sanskrit. Sanskrit.. aachaariyaraghuviirend-a. 1896. taaraanaayatarkavaachaspati jiivanacharitamu.. taitiriiya san'hitaa krishhnd-a yajurveida Vol. e. 0. 346 pgs.. 0. taitiriiya san'hitaa krishna yajurveida Vol. 540 pgs. Literature. taitiriiya san'hitaa krishhnd-a yajurveida Vol.

-. Sanskrit. Psychology. 227 pgs. 1894. taittiriiyasan'hitaa bhaaga 12. 1922. Psychology. Linguistics...b. taittiriya upanishad. abhinava gupta. Sanskrit.. takra sangra. Religion. 0.annanagarachari. Literature... Sanskrit. Sanskrit. tantralooka bhaaga 8.. tarka sangrah. Sanskrit. Religion. Sanskrit. abhinavagupta. Linguistics. taittiriiyasan'hitaa bhaaga 10. Language.. 102 pgs. tantrarahasyamn. Madhusudhan Kaul Sastri. 0. 98 pgs. Not available. 206 pgs. Sri Lowgakshi Bhaskara. abhinavagupta. Philosophy.. 1915. taittiriiyabraah-hmrxnd-amam. Sanskrit. 1952. tarkabhaashhaa. Not available... Psychology. Religion. 1953.. 1921. tantralooka Volume Iii.. 1898. Psychology. tarkai shaastra nirupand-amu. 1989. Psychology. Sanskrit. Literature.. Language. Theology. 140 pgs. 104 pgs.. Linguistics. Language. 454 pgs. tantraadhikaaranirnd-aya. tark shastra terminology of logic part 1. Religion. 1930. Sanskrit. Sanskrit..… 157/167 .. tantrasaara. Sanskrit. Sanskrit. 1949. Religion... Sanskrit.. Sanskrit.. Religion. 72 pgs.. 1911. Ramanujacharya. 1918.... Sanskrit. 1952.. Language... Ganapathi Sastri. Literature. abhinavagupta. RELIGION. Religion. Theology... Psychology. 239 pgs. Sanskrit. 186 pgs.. mallaadi vasun'dhara. Theology. Religion.org/…/SanskritIIIT. swami satchidaanandendra saraswathi. bhat't'abhaaskaramishraa.. Religion. mahaamahopaadhyaaya parashuraamashaastrind-aa. 512 pgs.2/14/2011 A list of scanned Sanskrit books at III… taittiriiya san'hitaa Vol II. -. Religion. parvatiiya shriivishveshvarapaand-d'eya.. 48 pgs. 1918. Language. mahadeva shaastri. Literature. 271 pgs... 1924. 558 pgs. 1934. bhat't'abhaaskaramishra. Religion. 333 pgs. 1918. tantrasaara.. Sanskrit. 0. Literature. Philosophy. Theology.. Not Available. 1917. Theology. 238 pgs. bhat't'abhaaskaramishraa. 66 pgs. 361 pgs. Language.. Sanskrit. Language. 38 pgs. Language. bhat't'abhaaskaramishra. Sanskrit. Sanskrit.. Philosophy. Literature.. 0... Philosophy. Religion. 370 pgs. abhinavagupta. Theology. 1894.. tan'jaavuurupatanamu. Literature. 374 pgs. 102 pgs.. Language. taittiriyasan'hitaayaa padaanukramand-ii prathama khand-d'a. raghu vir. 443 pgs. Linguistics... Sanskrit. taittiriyopanishhata. Psychology. 230 pgs. THEOLOGY. Sanskrit. Narayana Sastri. Sanskrit. Theology.. T. 1971 512 pgs sanskritdocuments. tarkakutuuhalamu. Sanskrit. Sanskrit.. 480 pgs. 244 pgs. taittiriiyasan'hitaa bhaaga 2. Linguistics. Sanskrit. Philosophy. taittiriiyabraahmand-amu prathamaashht'akamu. tantralooka bhaaga 2. Linguistics. 1923. 1897. 1921. Philosophy. Theology.. Sanskrit. taittiriya upanishad anandavalli bhriguvalli. Sanskrit. P. 280 pgs. Theology. 1882. 425 pgs. tantralooka bhaaga 4. Philosophy.. Linguistics..... 1930. Literature. shriikeshavamishra. 1962. tantralooka bhaaga 1. Linguistics. tantraprakaashikaasamete mimaaman'sa ar^thasan'graha. Theology. bhat't'abhaaskaramishraa. Theology... Theology.. Sanskrit.. Religion. Sanskrit. Linguistics. taittiriiyabraahmand-amu trxtiiyaashht'ake prathamabhaaga 1 7 prashnaa. tantrashuddvaya prakarand-an' bhat't'aarakaqs-ivedottama prand-itan. tantrayeprasuunamaalikaa. Literature.. 216 pgs. abhinavagupta... shrii sachchidaanadendrasarasvatii.

Linguistics. sri vachaspati mishra..… 158/167 . 360 pgs. Linguistics. LANGUAGE. Language. tattvapradiipikaa chitsuravi nayanaprasaadiniisamaakhyayaa vyaakhyaaya sahitaa... 1953. tarkakutuuhalamuu. 1944. Language. tattvachintamand-i Part I. Literature. 0. Sanskrit.. Psychology... 1938. Literature. 200 pgs. shrii vyaasatiirtha. Language. shriimadavedaantadeshika. 518 pgs. Sanskrit. Literature. Sanskrit. Language. Sanskrit. Language.. 1915... 398 pgs. Language... tarkasan'graha nyaayabodhini vaakyavrxtti niruktti t'iippand-yaa. janaardanashaastrii paand-d'eya.. shriimadannambhat't'a. tarkataand-d'avamu trxtiiyan' san'put'amu. Literature. 116 pgs. 1932. Literature. 0.. tattvabodhinii puurvaarddha viyaakarand-asiddhaantakaumudiivyaakhyaaruupan... Philosophy. Language... 1916. LITERATURE. Psychology. Linguistics. 0. Linguistics. Linguistics.... Literature. Philosophy. 1932. 612 pgs. Jayarasi Bhatta. Literature.. Sanskrit.. Linguistics. Language. 2003.. 512 pgs. Sanskrit. tattvachintaamand-e saamaanyalaqs-and-aprakarand-amu.. 830 pgs. Literature. Sanskrit. 216 pgs. Sanskrit. tattvabindu. Language. 552 pgs. Linguistics. Not avilable. 456 pgs.. 520 pgs. 448 pgs. tarkakutuuhalamuu. Sanskrit. Linguistics. Linguistics. Sanskrit. aanandajnana... 1888. 1940... 401 pgs. sanskritdocuments. 1917... tarkasangraha. tattvopaplavasin'ha. 1924. tarkasangraha. tattvasan'graha volume 1. 0. Sanskrit. shriimadannabhat't'a. 386 pgs. Not available. 1003 pgs. s chandrasekhara sastrigal. Literature. jvaalaa prasaada kaanod'iya. Linguistics. Language. Linguistics. shriimadvaradaachaarya. LANGUAGE. Linguistics. Language. LITERATURE... Language. LITERATURE. Linguistics. Linguistics. Sanskrit. 0. Language. Linguistics. mahaamahopaadhyaaya shrii ganggeshopaadhyaaya. Language.2/14/2011 A list of scanned Sanskrit books at III… 1971. 1938. Language. 278 pgs. Language. 364 pgs. 1992. Sanskrit. Literature. 60 pgs. shriimadannan'bhat't'a. Sanskrit.. tatva vichaar. LANGUAGE. Sanskrit. kamalashiila. tattvasaara samanugrxhita.. Language. llokaacharya. Literature. yativarashriignaanendrasarasvatii. jayadayaala. Linguistics.. tattvatrayamuu.. Literature. Literature. shriivyaasatiirtha. tarkasang-grahasarvasvamu tarkasan'grahavyaakhyaa t'ippand-yaacha samalan'krxtamu.. tarkasan'graha diipikaa nyaayabodhiniisamalan'krxta. 523 pgs. Linguistics. Literature... Literature. shriimachchitsuravaachaaryamunivara. LINGUISTICS. 1969. tatvabodhanyaa uttaraardhda. Sanskrit. 1917. 0... 0. 315 pgs.. pan' shriiaanandabhtaa nyaayachaarya. Sanskrit. Sanskrit.org/…/SanskritIIIT. tatvabiidhinyaa uttaraardha subiidhinyaakhyan' svaravaidikaprakarand-an. Language. 32 pgs. 214 pgs. Sanskrit. tattva chintaamand-i bhaaga 6. Linguistics.. tarkataand-d'avamu prathamasamput'amu nyaayadiipaaravyaakhyaaya... Language. Sanskrit. Sanskrit. LINGUISTICS. Sanskrit. Literature.. tattva chintaamand-i bhaaga 7.. Linguistics. Sanskrit. Gangesopadhayaya. tarkasan'graha nyaayabodhinii siitaa padmaabhyaan' san'skrxta hindii vyaakhyaaya. janaardanashaastrii paand-d'eya. tattvat'iikaa shataduushhand-ii. Sanskrit. Literature. Literature. 192 pgs. Language.. 52 pgs. jayadayaala. Linguistics. 1926. 349 pgs. Literature. 1974. LINGUISTICS.. Sanskrit. Literature.

. the supreme epic of devotion. srisa chandra vasu. Philosophy. tatvashuddhijaanadhanapuujyapaadavirachitaa.i. the students sanskrit-english dictionary.. Literature. 1989. 1955.. not avaliable.. 1941. pandit durgaprasad. 750 pgs. 946 pgs. swami satchidanandendra saraswati. k. Literature. Literature. Language. Psychology.. tatvamukta kalaapa Vol. kasinath pandurang parab. Sanskrit... Linguistics. S. Sanskrit. 0. 542 pgs. Psychology. 60 pgs. Linguistics. Language.. tatvamuktakalaapa Vol..s. 1933. 106 pgs. Linguistics. the meghaduta. Linguistics. Sri Mallikacharya. Literature. Language. ramaswami shastri.. the saundarananda. Not available. 830 pgs. the dasakumaracharita of dandin. tatvamukta kalaapa Vol. Linguistics. Language. 362 pgs. vaman shivaram apte.. Sanskrit.ii. Literature. 448 pgs. Language. Language. 1941...2/14/2011 y A list. Sanskrit. 746 pgs. Psychology.… 159/167 .iii. 0. the ashtadhyayi of panini vol . Sanskrit. Literature. 670 pgs. 1953 262 pgs sanskritdocuments. Sanskrit. Literature. Linguistics.. the pratyabhijna hridaya. the essential gaudapada. 1954. Language. 1900. 428 pgs. of scanned books at III… g g Sanskrit g . Dr Suresh Chandra Mishra. Suryanarayana Sastri. 670 pgs.. 1956. sambasiva sastry k... Psychology... 1928. Linguistics. veidaan'taachaarya. Literature. Psychology.. Sanskrit. Srinivasachar... 254 pgs. t'i.. 1975. Philosophy. Sanskrit. the anargharaaghava of murari. Philosophy. Sanskrit. Language. tatvat'iikaa. Religion.. Philosophy. Language. 356 pgs. shriinivaasagopaalaachaarya.. moreshwar ramachandra kale tr.... 1925...suryanarayana Sastri. Sanskrit. 1944. shriinivaasaachaar. Linguistics. Sanskrit. Linguistics.. 152 pgs. Iv. Sanskrit. 1926. tatvashuddhi.. Sanskrit... 466 pgs. t'i. Linguistics. Theology.org/…/SanskritIIIT. 29 pgs. Language. Unknown. 1945. Literature.. Literature. Sanskrit. Literature. Literature... tatvatrayamuu. the students guide to sanskrit composition. 306 pgs. Linguistics. Sanskrit. 0. 298 pgs. Sri Nigamantha Mahadesikar. Sanskrit. Language.. krishhnd-amaachaarya. 1936. 1933. Sanskrit. Sanskrit. 100 pgs.. Linguistics. asvaghosa.. 0. kshemaraja. 0. Psychology. Sanskrit. Sanskrit. the raghuvamsa of kalidasa. thakavarg Mahanibandh. Language. Literature. Language. pg tatvakostubha Part 1. Literature.. Linguistics. Linguistics. tatvasan'graha. Philosophy. Language. Linguistics. the jnanadipika tika mahabharata tatparya tika.. Language. Language. Literature. di. 1937. Sri Bhattoji Dikshita. Sanskrit... Literature. narayana balakrishna godbole.s. kalidasa. 50 pgs.. 330 pgs. Linguistics. Linguistics. Sanskrit..... the ranadipika of kumaraganaka. Philosophy. Sanskrit. 212 pgs. Sanskrit. the panchatantrika of vishnu raman. 1938... tatvasan'khyaanaraaghaven'dratiirthiiyat'ippand-ii.s. Sanskrit. 430 pgs. Literature. tatvamuktaakalaapa Vol 1. Philosophy.. Sanskrit. 1917. 1997. Language. S. devabodhacarya. D. Psychology. 406 pgs.

Linguistics.. 1942. bhat't'ojidiiqs-ita. tithisaamaanyanirnd-aya. A list of scanned Sanskrit books at III… the taittiriya upanishad. tithaivivechanakaand-d'avishhayasuchikaa. Linguistics. Language. Religion.. Sanskrit... 389 pgs. Literature. 1930. kalidasa. Badi Mudgara Kuthara Kumara Swami... Sanskrit. Psychology. 413 pgs. Sanskrit. Literature. Sanskrit. Literature. 0... 1962. 90 pgs. 1937. 346 pgs. Philosophy.. Psychology. Literature.. 1949.. Sanskrit. 443 pgs.. Literature. Philosophy. 0. Linguistics. Literature. the uttararamacharita of bhavabutta. Linguistics. 1915... Linguistics. Language. 1903. 1957. Literature. Language. Linguistics..… upanishhadaan' samuchchaya hari naaraayand a aapat'e RELIGION THEOLOGY Sanskrit 1895 160/167 . suranada kunjan pillai. 262 pgs. shriiharisin'hajii. ung-ad'aamareshvaratantramu... I. Sanskrit.. upaakhyaanamaalaa.. 360 pgs. Language.. 107 pgs. Sanskrit. Not available.. 394 pgs. 298 pgs. 140 pgs. Sanskrit. Language. Social Sciences. Language. upadesasahasri. the vikramorvasiy.. Sanskrit. 124 pgs. Not available. tritalaavachchhedakataavaada. Literature. the vikramorvasiyam of kalidasa. Sanskrit. 473 pgs. Not available. Linguistics. kalidasa. Literature. Language. Linguistics. 1914.. hari raghunaath. 380 pgs. 1947. 1915. bhava butta. shriibhaaskara. 63 pgs.. 1918.org/…/SanskritIIIT.. tripuradahanamu. udhaanapatrikaa.. upadeshasahasri Part I and Ii (prose and Poetry).. trikaakhaad'amakhad'ana. trin'shachchhlokii sat'iikaa. LITERATURE. tithichintaamand-i. trim'shaachchhalokii pat't'aabhiraamat'ikaasahitaa. Sanskrit.. the vikramorvasiya of kalidasa. pand-d'ita shriishashinaatha bhkaa. Philosophy.. Linguistics. Language.. Philosophy. 0.. 0. Sanskrit. Srimad Bhagawatpadacharya. tristhaliisetu tiirthendushekhara kaashiimoqs-avichaara. LANGUAGE. Not available... Bhrga Samhita. shriibhagavadramand-amaharshhi. Language. Language. Rangaswami Aiyangar. Psychology.. Language. Sanskrit.. Literature.. Language. vinaayaka gand-esha aapat'e... Literature. Linguistics. sanskritdocuments.. Srinivasachariar. LINGUISTICS. Literature. Sanskrit... Linguistics. 1942. Psychology. upanishhad'asa Vol.2/14/2011 1953.. upakramaparaakrama. tristhaliisetu. kalidasa. Sanskrit. Psychology. Literature.. Narayana Bhatt. Sanskrit.. Linguistics. naaraayand-abatta. 446 pgs.. Not Available. Literature. Not Available. 1922. Language. 73 pgs. Language. upadeshasahastrii gadyaruupa sat'iikaa. 154 pgs. trin'shachchhulokii. swami satchidanandendra saraswati. 112 pgs. 1922.. Linguistics. Theology. tisarii kitaaba. Literature. Sanskrit.. Linguistics. Sanskrit. 1924.. Language. Sanskrit. Linguistics. Sanskrit. Sanskrit.. Philosophy.. Linguistics..v. 194 pgs. Linguistics. 20 pgs. Sanskrit. 382 pgs. 1997. Sanskrit. 0. Sri Rama Pisharoti And Subrahmanya Sastri. Sanskrit. 1954. 178 pgs. Sanskrit. Sanskrit.. K.. 160 pgs. Literature. Literature. 262 pgs. upadeshasaara bhaashhyasahita. Psychology. Pandit A. srimad ramatirtha. Language. Language. unmattaraaghavamu. 19 pgs. 52 pgs. 135 pgs. Linguistics.m. Language. Philosophy.... 1934. Sanskrit. 1936. 144 pgs. 0. Sanskrit. trishaati seituhu. Literature. veidaantaachaaryaa. 1977. 1899.

Literature. uttararaamacharitamu naat'akamu. Sanskrit. Literature. 0. Language. uttaragitha. upanishhadddakya koosha. 536 pgs. Linguistics. Literature. Religion. uttararaamacharitamu. Sanskrit. 0. Sanskrit. 1988. Sanskrit. 1934. Language. 1823. Literature. Linguistics. vaakyapadiiyamu trxtiiyakand-d'amu vrxttisamuddesaatmakamu ambaakartriivyaakhyaaya samalangkrxtamu. Language. Linguistics. shriimadvedavyaasa. Literature. Literature.. shuuranaad'a krxjjanuu pilla. shuuranaad'a krxjjanuu pilla. 1943. utsargapatrtramu. vaadaavalii praaran'bhaha. Sanskrit.. uttararaamacharitamu. Literature. uttararamacharitam. Sanskrit. Sanskrit. mahaakavishriibhavabhuuti.. 1895.. mahakavi bhavabhuti. RELIGION. Literature.. 187 pgs. Literature. ushhaaparind-ayaprabandha. Sanskrit. bhartrxhari. 216 pgs.. 1944. LITERATURE. Linguistics. 84 pgs. Literature. Sanskrit. 1891... 1937.. 1926. vaakyavrxtti. Language. vaakyapadiiyamuu brahmakaand-d'amuu. Literature. upasamhara vijaya. Linguistics. Sanskrit. 0. Appaya Dikshita. 467 pgs. Language. shriimachchhan'karaachaarya. 182 pgs. Language. Sanskrit. hari naaraayand-a aapat e. 491 pgs.. Sanskrit. 1835. Sanskrit.. bhartrxhari. Language. Philosophy. Linguistics. vaajaneyipraatishaakhyan' kaatyaayanaprand-iitan. Not available. aachaarya karapuut'ugala shrii dharmmashrii. 1977. Sri Madahobala Suri. 1903. Linguistics. ushhaaparind-ayaprabandha. LINGUISTICS. 212 pgs. 164 pgs.. Linguistics. jagadguru vijendra trtha... 0. Sanskrit. 128 pgs. Literature. Linguistics. Sanskrit.. 366 pgs.. Psychology. 1956.2/14/2011 A list of scanned Sanskrit books at III… upanishhadaan samuchchaya.. Language.. 1912. 392 pgs. Linguistics.. 1966. Linguistics. shriibhavabhuti. 1915.... not availabe... Sanskrit. Language. Psychology.. -. shriimadgod'apaadachaarya. 384 pgs. pand-d'ita brahmashang-karamishra. Literature. vaadaavalii. Literature. Sanskrit... Sanskrit. Language. Linguistics. suuyranaaraayand-aa. Sanskrit.. THEOLOGY. Language. Philosophy. 1980. vaakyapadiiyamu dvitiiyobhaaga vaakyakaand-d'amu t'ikayaa ambaakartriivyaakhyayaa. Linguistics. Theology. vaamadeshvaratantraantargatanityaashhod'ashikaarnd-ava vyaakhyaaya.. appaya diiqs-itaa.. gi. 572 pgs. Sanskrit... Language. Literature. uttaragiitaa. Sanskrit. Sanskrit.... 1103 pgs. 1908. jaakooba. 1912. Literature. 56 pgs. vaakyaatharatnam. Language. Literature.. Language. Language. LANGUAGE..… 161/167 ... Literature. uttararaamacharitamu t'iikayaa sametamu. 126 pgs. Linguistics. sanskritdocuments. 154 pgs. 38 pgs. Sanskrit.. Linguistics. veimuuriraamagovindashaastrii..org/…/SanskritIIIT. Sri Venkatarama Sharma. 1957. mahaakavi shrobhavabhuuti. Linguistics. 214 pgs. 0.. uttaramiimaan'saa vidaantadarshanamu shaariirakanaamnaabhaashhyan' t'ippand-ii. shriibhaaskararaayonnitasetubandhaara.. vaadanaqs-atramaalaa.. Sanskrit.. 475 pgs. Language. Language.. Literature. Language. 500 pgs. 82 pgs. 1956. vaadanaakshatramaalaa puurvoottaramiimaamsa.. Sanskrit. Language. 374 pgs.. Linguistics. Sanskrit. Literature. Language. Linguistics. Linguistics.. Linguistics. uttarapaqs-aavali.. Language...e. 618 pgs. Linguistics. 62 pgs. Literature.

1828. 568 pgs. vaishhnd-avadharmaratnaakara. vaidik sahitya charitram. Language. 804 pgs. vaiyaakarand-asiddhaantakaumuti paand-iniiyavyaakarand-asuutravrxtti.. Literature.. Sanskrit.. 619 pgs. vaiyaakarand-asiddhaantakaumudii. Sanskrit. vadavali.. Language. 1822. sri t viraraghavacharya. Sanskrit. Language. 1901. 476 pgs. 75 pgs. Literature. taranatha tarkavachaspati.. Language. 105 pgs. Literature.. Literature. Sanskrit... 198 pgs. Language. Theology.. 1961.. vaasavadattaa.. Chandrasekharan. pi bii annangarachaarya. hamsaraaja. Literature.. Literature. Linguistics. Literature. Language. Sastri and K. Literature.. vaishhnd-ava upanishhada. kalahasti kavi. a mahaadevashaastriind-a. vaishampaayananitipraashikaa. Theology. sanskritdocuments. 375 pgs. vaidikamanoharaa. Literature. Language. Social Sciences. Sanskrit. Dr. Linguistics... 65 pgs. Sanskrit. Literature. vaiseshika darsana. vallabhapushht'ipradkaasha chaaroon' bhaaga.. Sanskrit.org/…/SanskritIIIT. Linguistics. vaiyaakarand-abhuushhand-asaara abhinavasaralaa vyaakhyaaya t'ippand-ayaa samalang-krxtya. Linguistics. vajjaalaggan. 65 pgs. 55 pgs. Sanskrit... 704 pgs. 1943. Sanskrit. Kunhan Raja. Religion. Linguistics. Literature. bhaskararaya makhin. 1923. Sanskrit. vakrottkijiivitamu khopagn-avrxtti.. Theology.. Linguistics. 240 pgs..… 162/167 . Religion. khemaraaja shriikrxshhnd-adaasa. 380 pgs. 1934. khemaraaja shriikrxshhnd-adaasa. vikhaanas.. 1288 pgs.. Sanskrit. Language. V. C.. Language. Linguistics. Language. anantashaktipada. Theology. Sastri. Sanskrit. L.. Language. Language. Religion. 68 pgs.. Linguistics.. 374 pgs. 222 pgs. 1953. Literature... shriimadvaadhulamahaachaarya... Linguistics.. 1892. 1952. vachaspatya part 1. bhat't'ojidiiqs-itulu. 1872. shriimadraajaanakakuntaka. Linguistics. vaididasaahityacharitrama'm... Not available. Literature. 1937. 0. Literature. Literature. 0.. Religion. gan'gaavishhnd-u shriikrxshhnd-adaasane.. vaikhaanasadharmaprasna. 1927. subramanya shastri p p. var^shhakrxdiipaka... 1932. 1913. 1958. 1926. 442 pgs. 1927. T. Linguistics. vaiyaakarand-asiddhaantakaarikaa vaiyaakarabhuushhand-asaaravyavyaakhyaaya.. Literature. 270 pgs. 1961. 1957. Literature. Sanskrit. 144 pgs. Theology. Linguistics... Linguistics. 1923. Language. 134 pgs. Religion. Sanskrit. maadhava vaasudeiva.. P. mahaakavi subandhu. 1458 pgs.. Sanskrit. jayatirtha. Sanskrit.. Language.. 1938. Sanskrit. vallabhapushht'iprakaasha chaaroon' bhaaga. Literature. bhat't'ojidiiqs-ita. Mahamahopadhyaya. vaatulanatha sutras vritti.. vaidikakoshha prathamo bhaaga. shriimatkaund-d'abhat't'a. Sanskrit. vasu charitam. Theology. vararainugrxhiteshhu panj-chasuvijayeshhu. Linguistics. Religion. 1828. Sanskrit. Literature. 1933. Linguistics. varivasya rahasya. shriikaund-d'abhat't'a.. Literature. Sanskrit.. Sanskrit. General. Sanskrit. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… vaaraahagrxhyasuutramu. vaiyaakarand-a bhuushhand-asaara. 166 pgs.. Language. Language. Language. Linguistics. 1965. P. 1873. bhat't'ojiidiiqs-ita... Language. 270 pgs... 407 pgs. Sanskrit. Linguistics. S. Sanskrit. Sanskrit. vararuchaniruktasamuchchaya. Linguistics.. Sanskrit. Language. Sanskrit. 406 pgs. Linguistics. 122 pgs..

Philosophy. harikrxshhnd-adaasa goyandakaa. 0. Dharmaradhwarindra. Language. Sanskrit.v.. Language.. 1959. 1965. Sanskrit. vedanta desika. Psychology. vedhaantaraqs-aamand-ivimashe. Literature. 0.. Not Available. 236 pgs.... 230 pgs.. Philosophy. vedaantavichaaramaalaa. 0.. 1927. Psychology. Sanskrit. Linguistics. Literature. Philosophy. vedaantaparibhaashhaa dhameraajaadhvarendrakruti.. vedadhammevyaakhyaanamn. Language.. Language. veidaantavijayamang-galadiipikaa. 416 pgs. Literature.. goopaalaachaarya.. vedaantadeepa bhaagha 2. vedaartha bhuumikaa...org/…/SanskritIIIT. Literature. veidaanta darshana brahmasuutra.. Literature. Linguistics. qs-emaraajashriikrxshhnd-adaasa. Linguistics. Language. Philosophy. vedaanta darshana. 0. vedaantapan'chadashi. shriimatsvaamidayaanandasarasvatii. Sanskrit. Sri Satyajnananda Tirtha. Linguistics. Sanskrit. Literature. vedantapanchadashi. 219 pgs. Language. 0. Language. shrii bhagavad raamaanuja. veidaantabaalaboocdhini kramaan'ka 99. Raja Sri Sri Rama Varma. Sanskrit. Literature. 1942. Linguistics.. 300 pgs..… 163/167 . 0. 62 pgs. Psychology. vedaantaparibhaashhaasan'graha. 614 pgs. shrii baalaghanvi jaggu veng-kagaachaarya. Sanskrit. 1887. 233 pgs. 1902.. 142 pgs. 1969. Linguistics. Language. veimabhuupaalacharitamuu. Literature. Sanskrit. Language. Sanskrit. -.2/14/2011 A list of scanned Sanskrit books at III… vasu charitram... Language. Sanskrit.. Psychology. Not available. Literature... Literature. vedaantaparibhaashhaa. Literature.. 0. Sanskrit. 154 pgs. 480 pgs. Sri Madhusudan Prabhuji. kalahasti kavi. Linguistics. vedaprakasa. 370 pgs. Sanskrit. vedaang-gaprakaasha navamobhaaga vyaakhyaaya. 166 pgs. rayaprolu l somyaji. Sanskrit. Language. 1942. Linguistics... Linguistics. shriimaddharmaraajaadhvariindra. Sanskrit. Sanskrit. Language. vedaantaraqs-aamand-ivimarsha chaturthabhaaga. 617 pgs. veidaantaraqs-aamand-ivimarsha trxtiiyabhaaga. 1937. Sanskrit. 463 pgs. Language. 620 pgs. Literature.. Sanskrit. Religion. Linguistics.. Sanskrit. 314 pgs. Linguistics... 176 pgs.. Language.. Literature. 1985. Linguistics. Literature. Linguistics.. A. Language.. Literature. 490 pgs. Swami Govindasingh Sadhu. 1949. pan' bhat't'ashriigauragoopaalashamaa... 1965. Psychology. Philosophy. vasu charitram.. Linguistics. Linguistics. Lingannasomayaji... 1943. shriimanmaharshhi vedavyaasa.. 0. Sanskrit. 106 pgs. vedaantapan'chadashi. sanskritdocuments. 242 pgs.. shriibhagavatpaadaachaarya. 524 pgs.. Sanskrit. vedaanta dharshana brahmasuutra sarala hin'dii vyaakhyamu... Sanskrit. Literature. kalahasti kavi. Sanskrit. Theology. 1992. Language. 1928. Literature. vedaantaparibhaashhaa. Sanskrit.. Linguistics. Language. 1934. 1833.. Literature. 1942. Psychology. 51 pgs.. Sanskrit.. Sanskrit. Literature. Linguistics. svaamii vidhyaananda sarasvatii. shriividyarand-aya. Not available. Language.. 145 pgs.. Philosophy. Sanskrit. Linguistics..gopalacharya.. vedaantaparibhaashhaa. 580 pgs. Language. 190 pgs. Linguistics.

. Sanskrit. Linguistics... Language. 382 pgs. 1935.. viiramitroodaya Vol. Mahamahopadhyaya Pandita Mitra Misra. Linguistics. 1959.. Sanskrit.. Linguistics. Social Sciences. Literature.. kalidasa. 381 pgs. viiramitrodaya shraaddhaprakaasha. Language. 1972. Literature. Sanskrit.... Social Sciences. sanskritdocuments.... Literature.. Linguistics. Language. Sanskrit.. Literature. Mahamahopadhaya Pandita Mitra Misra. ramamurti. 614 pgs. viduraniiti. Language. 1925. raamajii upaadhyaaya. Sanskrit.. shrii veera raja charan gupta. 228 pgs.x. Literature. 1932. Literature.. Literature. Language. Sanskrit.. Language. Mahamahopadhyaya Pandita Mitra Misra. 1991. 501 pgs. Language. Sanskrit. 50 pgs. Linguistics. Literature. nyaayaacharya. Language. viiramitrotayasya shraaddhaprakaasha.. Linguistics. Mahamahopadhaya Pandita Mitra Misra. 1916... 1917. Sanskrit.. 1959. shriimahaamahopaadhyaayashriimitramishra.2/14/2011 A list of scanned Sanskrit books at III… vekramorvasiyamu. 1955. Sanskrit. Linguistics. Theology.. Linguistics. 383 pgs. jagadgurukrutayaa t'ippapyaa. Sanskrit.. 1903. 494 pgs. 674 pgs.. Linguistics.. mahaamahopaadhyaayashriimitramishra. Sanskrit. Sanskrit. vidhyaamaadhaviiyamu prathamasan'put'amu 1 5 adhyaaya. Language. 266 pgs.. 1925. Literature... Religion. vishhnd-usharmaa... Literature. Literature. bhatta narayana. viiramitrodaya paribhaashhaaprakaasha.. vidyamaacdhaviiyamuu.. viiramitrodaya tiir^thaprakaasha. 0. 610 pgs. Literature. parameishvara. vemana padyamulu.. Sanskrit. 1913. kalidasa. Language... Literature.. Language. shriikaalidaasa. Sanskrit. 1913. Xxi. 578 pgs. Sanskrit. Literature. 166 pgs.. vish vekharaanandasan'sthaaniiya hastalekhasan'grahaparitaalikaa saacha khand-d'advayavatiisati. Sanskrit. Theology. viiramitrodaya puujaaprakaasha. Linguistics. viiramitrodaya laqs-and-aprakaasha. Sanskrit. 208 pgs. 577 pgs. Sanskrit. Sanskrit.. Language.. vidhyaamaadhava. 292 pgs. 1917. 85 pgs.s. venisamhara. Social Sciences. Mahamahopadhaya Pandita Mitra Misra. Language.ii.. vikramorvasiyam. Linguistics. 1070 pgs. Linguistics. Sanskrit. Language. Social Sciences. Literature. vishatantram. vijaya vikrama vyayoga.. dr sir c p raamaswamy aiyar. Theology. Literature.k. 1916. vin'shashataabdikan' san'skrxta naat'akamu. viind-aalaqs-and-amuu. vikramorvasiya. 1939. Religion.. Literature. 158 pgs.. 234 pgs... Language. Linguistics. Linguistics. Linguistics. vikramoovrashiiyamuu. Linguistics.. 1906. vend-iisan'haaramu. 394 pgs. Sanskrit. 194 pgs. 1913. Social Sciences.. srirama desikan siromani. 256 pgs. Sanskrit. 158 pgs.. mahaamahopaadhyaayashriimitramishra.org/…/SanskritIIIT.. Vishva Bandhu.… vishhnd ubhaktikalpalataa mahidharakrutayaa t'ikayaa Language Linguistics Literature Sanskrit 164/167 . 1914. viiramitrodaya Part Vii. Literature. viiramitrodaya raajaniitiprakaasha bhaaga 6. viiramitroodayei bhakti prakaasha Vol. 1936... Language. Sanskrit. Literature. Linguistics. 161 pgs. Sanskrit. Sanskrit. 147 pgs. 1923. Sanskrit. Sanskrit. mahaamahopaadhyaayashriimitramishra. Language. 225 pgs. Religion.. Language. viiramitroodaya Vol. viiramitrodaya Part Ii. kaalidaasa. 1897. 1962. mitra mishra. Linguistics. mitra mishra. 0. 0..

Theology. vrxttaalang-kaararatnaadlii. Kuberanath Shukla.2/14/2011 A list of scanned Sanskrit books at III… vishhnd-ubhaktikalpalataa. vivarand-apajnikaa ekaadasho bhaagan. Not available.. shriimadappayadiiqs-ita. 413 pgs. Theology. Linguistics.. Language. Sanskrit. Linguistics. vishhnd-udharmoottara puraand-e trxtiiya khand-d'a... Linguistics.v. Sanskrit. Not available. vrajavilaasa. Sanskrit... Sanskrit. vivarand-aprameyasan'graha. K.. bhaaratiitiirtha. Literature.… 165/167 .. Language. Literature. shriikrxshhnd-aabhat't'a. Sanskrit. Linguistics. T. 44 pgs. Language. 1963. Linguistics. Religion. 1942. nijagund-ashiva yoogi. vivarand-aprameyasan'graha vidhaarand-ayamuniprand-ita Vol 5 Sanskrit Text.. Sanskrit.. 1965.. Literature. shriisachchidaanan'dein'drasarasvati. Language. 0. Literature. Sanskrit. 1893. Rangacharya. Language. 376 pgs. Religion. 186 pgs.. 2001. 1931. Language. Sanskrit.... Sanskrit.. 1961. -. Language. 118 pgs. Linguistics.. 298 pgs. vivarand-apajnikaa dvadasho bhaagan. 1925. 1964. 1879.. shriishn'karabhagavatpaada. vivaakachuud'aamand-i kramaan'ka 93. 0.. 264 pgs. 1972. vivarand-apajnikaa trutiyo bhaagan. Religion. 244 pgs. 1958. 516 pgs... vrxttivaartikamu. Linguistics... Sanskrit. mahidharakrutayaa t ikayaa. Sanskrit. 0.. Swetharnia Narayana. Linguistics.. Literature... 511 pgs. 440 pgs. Linguistics. 1957. vratakaand'amu chado bhaagan. Linguistics.. Sanskrit. Linguistics.org/…/SanskritIIIT. 1909. Sanskrit. 518 pgs. 1940.. M. Language. gan'gaavishhnd-u shriikrxshhnd-adaasa. Religion. 62 pgs... 237 pgs. 268 pgs. Sanskrit.. Religion. 1956. Literature.. M Rangacharya.. Literature. Language. Linguistics. vivarand-apajnikaa saptamo bhaagan. Language. 407 pgs. 1892. 169 pgs. M. vrxddhasuuryaaruund-akarmavipaaka. Philosophy. not available.. Ramasastri Tailanga. Sanskrit. 146 pgs. 1972. Literature. Sanskrit. Sanskrit. 725 pgs. Theology. Sanskrit.. Sanskrit. 354 pgs. Language. vishhnd-udharmottaramahaapuuraand-a. b j sandesara.. Literature.. 0. Rangacharya. 1895.. Literature. shriimaduraadaasa. Rangacharya. Literature... Linguistics.. vrxttaratnaakara. vivarand-apajnikaa ashht'amo bhaagan.. Sanskrit. 676 pgs. Religion. Language. 482 pgs.. 120 pgs. 327 pgs. Sanskrit. Language. vistaarikaavyaakhyaaya san'valita kaavyaprakaasha dvitiiyobhaaga. vivarand-apajnikaa dashamo bhaagan. vishhnd-usan'hitaa. Religion. Not available... Not available. Linguistics... vrxttamuktaavalii... Literature.. 382 pgs. Religion. Sanskrit. vushhabhaanujaa. 272 pgs. Sanskrit. Sanskrit.. viveika chuud'aamand-i. 1982. 440 pgs. Rangaswamy Aiyangar.. 286 pgs. Sanskrit. Theology. viveikachin'taamand-i paart' I... Philosophy. Language. Psychology. lakqs-mii narasin'ha bhat't'aa.. Sanskrit. 147 pgs. Religion. Literature. 988 pgs.. Literature. visvasanskrit shatabdi granth yojnaaya.. Sanskrit. Bhrga Samhita. Religion. 1965. viveikachuud'aamand-i. vivarand-apajnikaa dvitiyo khand-d'an. 1814. Ganapathi Sastri. Language. 1964.. vishhvaksenasan'hitaa. paramaanandachakravarti. sanskritdocuments. Language. Literature. M. Rangacharya. Linguistics. Sanskrit. Language. Sanskrit. T P Upadhyaya. 1962. M. Linguistics.. vyaakarand-a granthaa. Psychology. Linguistics. Literature. vuttamautkika. Literature. 1953. 1926. Sri Kedara Bhatta. Sanskrit.

. Pandit Durgaprasad. Religion.. 556 pgs.. Linguistics. Sanskrit. vyaktiviveka of rajanaka sri mahimabhatta. Sanskrit.. 0. LINGUISTICS.. Linguistics. Sanskrit. 886 pgs. Linguistics. shriimadagadaadharabhaat't'aachaarya. Language.. Sanskrit. 1964. Theology. 0.... Linguistics. Sanskrit. Language. Sanskrit. vyakaran pradip.. Literature. yaadavaabhyudaya. Literature. Sanskrit. Literature.. LITERATURE. Linguistics..... Sanskrit. 0. mahaamahopaadyaya kapistalama desikaachaariyara. 1950. 166 pgs.. Social Sciences. shriimitramishra. Linguistics. yaajushha jyautishhan' bhaashhya aarcha jyautishhan.. Literature. shriivedaantachaarya. 1150 pgs. LITERATURE. Language. shriiraajaanakamahimabhat't'a. Religion. hari naaraayand-a aapat'e. Literature. vyaasasiddaantamaartaand-d'a. 484 pgs... Theology.2/14/2011 A list of scanned Sanskrit books at III… vyaakarand-a puurvapashnaavalii. Literature. 1892. Literature.. vyaasaadhikaarand-amaalaa. Sanskrit. vyaasashiqs-aa. 114 pgs. Sanskrit. 430 pgs. vyutpattivaada guud'haarthatattvaaloka. 0.. bapu shastri moghe. 722 pgs. Sri Varadaraja. shriiniilakand-t'habhat't'a. vyadhikarand-aprakarand-amuu. LANGUAGE. Language... -. 1977. Sri Maha Mahopadya Kapisthalamdesikacharya. Linguistics. Literature.... 1908. Linguistics. 1230 pgs. yaajnd-aavaalkyasmrithi. 1942. Linguistics. sanskritdocuments. 1929. Linguistics.. Language. Sanskrit. Sanskrit. yaagn-avalkyasmrxti trxtiiyaavrxtti. 310 pgs. pand-d'ita veing-kat'araamashammrond-aa. yogiishvarend-a maharshhind-aa yaagn-avalkyena.. 116 pgs. Literature. Literature. Literature. 492 pgs. Linguistics. 1892. Linguistics.. Literature... vidvadbhi ke vi subrahmand-yashaastrii... vyaaptipanj-chakamu. J. Language. Language. 76 pgs. 1931. Literature. Language. 283 pgs. Literature. Linguistics. Sanskrit. Philosophy. 1933. Language... Not available. 90 pgs. Not available. Language. Language. Language.. 124 pgs. Not available. 568 pgs.org/…/SanskritIIIT. Literature. somaakarasudhaakara. vyutpattivaada. 1942. 0. Linguistics.. Sanskrit.. Sanskrit. LANGUAGE. 480 pgs. Sanskrit. 0. Sanskrit. vyakaran siddanta kaumadi.. Linguistics... Sanskrit. Balasubramanyam.. Language. shriimathuraanaathatarkavaagiisha.. 1993. Language. Linguistics. 680 pgs. 270 pgs. yajnj-avalkyasmuti Vol I. Literature. gopaalashaastrind-aa. Philosophy.. 630 pgs. 98 pgs. LINGUISTICS.… 166/167 .. Sanskrit. vyutpattivaada guud'haarthatattvaalokena samudbhaasita. yaagn-avalkyasmrxti viiramitrodaya mitaaqs-araa t'iikayaa.. Literature.. vyaasasan'grahamu nov 1933. Literature. vedavidhaalaya. Sanskrit. 0. vyaaktiviveka vyaakhyaaya madhusuudaniivivrxtyaa.. 122 pgs.. Sanskrit.k.. rewaprasada dwivedi. Sanskrit. Language. vyaakarand-abaalabodha prathamobhaaga. Language. 190 pgs. 0. vyavahaaramayuukha miimaan'sa. Sanskrit. sircar mk. Linguistics. 1937. Psychology. Psychology. Literature. Language. vyaasashiddhaantamaataand-d'a. 0. Linguistics. vyaatpipanj-chakarahasyamu sin'havyaadhralaqs-and-arahasyan. Sanskrit. Sanskrit. Language.. Language. vyaasataatpayenind-eya. vyavahaaranir^nd-aya. shriimadagadaadharabhat't'aachaarya. 306 pgs. 1927. Linguistics.. 1929. 1986.

. Literature. Literature. 218 pgs. Language. Sanskrit. Sanskrit. Linguistics. 802 pgs.. 484 pgs. Language. 202 pgs. Sanskrit. Literature. Linguistics.. Philosophy. 1849. 322 pgs. khemaraaja shriikrxshhnd-adaasane. Psychology. Theology.. 616 pgs. 252 pgs. yatiindramata diipika. Theology. Religion. Language.. yudhishthiravijayamu. khemaraaja shriikrxshhnd-adaasane. Search matched 4853 books with 1743368 pgs. 0. shriivaasudeva.org/…/SanskritIIIT. Language. Literature. yoogavaasishht'he. 1834. yajurveda san'hitaa. 0. Language. yuktimallikaa. Linguistics. 1857. Literature.. Linguistics. 1949. mahaakavi shriivaasudeva. yogavaasishht'a bhaashhaa bhaaga 2 6 t'haa nirvaand-aprakarand-a puurvaarddhottaraarddha.. Sri Vijnana Bhikshu. Sanskrit. ghatikasatam vatsya varadacharya. Literature.. vaajasaneyi madhyaandina shukla. Not available. 597 pgs.. yoogasandhyaa.. Linguistics. 1909. Sanskrit. Language. yogaratnaakara vaidyakagran'tha dvitiiyaasrxti. Literature. 969 pgs. yashasitalakamu... Sanskrit... hari naaraayand-a. Language. 1946. Language.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit. 0.. Sanskrit. 126 pgs. Language. Sanskrit. yojavaar^tikama~. 1919. Linguistics. Linguistics. Literature.. 212 pgs. yuktimallikaayaan'gund-asaurabhan. yudhishht'hiravijayamu vyaakhyaaya.. Not available.. Language... shriishrutasaagarasurikutayaa. Linguistics.. 1903.. navare ityupaabhidhakrxshhnd-asharmand-a.. 226 pgs. 802 pgs... 246 pgs. 1983. Sanskrit. 1884. Religion.. Sanskrit. Sanskrit. Not available. Sanskrit. Literature. Not available. yathiraja vijaya natakam. 493 pgs. Literature. yogaratnasamuchchaya dvitiyo bhaaga. Linguistics. Sanskrit. Language.. Literature. 1897. Linguistics.… 167/167 .. Sanskrit. Linguistics. 1903. 1 0-9 A-D E-H I-L M-P Q-T U-Z sanskritdocuments.