2/14/2011

A list of scanned Sanskrit books at III…

12780 laghupaaraasharii... gagaavishhnd-a shriikruushhnd-adaasa, General. Sanskrit, 2005. 44 pgs. 127801 vrxddhayavanajaatakama... davis pingree, General. Sanskrit, 2005. 452 pgs. 12782 kaavyaadashar... acharya ramachandra mishra, General. Sanskrit, 2005. 332 pgs. 12783 muhhuurtachintaamand-i... narayana acharya, General. Sanskrit, 2005. 492 pgs. 12787 taajikaniilakand-t'hii... pandit srimadhukantagana jyotishacharya, General. Sanskrit, 2005. 478 pgs. 12789 liilaavatii... pt.shri lakhanlal jha, General. Sanskrit, 2005. 386 pgs. 12790 rupachandrikaa... ramachandrajhaa vyaakarand-aachaayra, Religion. Theology. Sanskrit, 0. 318 pgs. 12790 rupachandrikaa... ramachandrajhaa vyaakarand-aachaayra, Religion. Theology. Sanskrit, 0. 672 pgs. 12793 sachitra jyotishha - shiqs-aa... b.c thakur, General. Sanskrit, 2005. 270 pgs. 12794 jyotishha vdaaraa roga upacchara... prem kumer sarma, General. Sanskrit, 2005. 214 pgs. 12795 shatayoogaman'jari... madhurakrishnamurthy sastry, General. Sanskrit, 2005. 92 pgs. 12796 muhuurtadarpand-amu... vavilla rama swamy sastrylu and sons, General. Sanskrit, 2005. 180 pgs. 12798 vitti evan' vuutti prabandha... aacharya mukund devagna, General. Sanskrit, 2005. 254 pgs. 12802 Jyotishha ratnaakara... devakiinandana sih, General. Sanskrit, 2005. 1118 pgs. 12803 dasharsurpakamuu... keshavaraava musalagaavakara:, General. Sanskrit, 2005. 574 pgs. 12804 saahityadaprand-ama... aachaariya sheshharaajashamaa regmii, General. Sanskrit, 2005. 1146 pgs. 12805 chamatkaara chintaamand-i... malaviyadaivajna dharmesvara, General. Sanskrit, 2005. 556 pgs. 12807 bharatiiya jyotishha... nemichandra sastri, General. Sanskrit, 2005. 450 pgs. 12808 sachitra jyotishha shiqs-a... b.c thakur, General. Sanskrit, 2005. 904 pgs. 12809 shhad'avagar phalamuu... krishan kumer, General. Sanskrit, 2005. 450 pgs. 12810 ladhupaaraasharii madhyaparaasharii... kedaaradatta joshii, Religion. Theology. Sanskrit, 0. 128 pgs. 12811 vrxddhayavanajaaakamuu... davis pingree, General. Sanskrit, 2005. 414 pgs. 12812 vasan'taraajashaakuna... -, General. Sanskrit, 2005. 610 pgs. 12815 saaraavaali... -, General. Sanskrit, 2005. 400 pgs. 12816 sarvaarda chin'taamand-i... sri kambampati ramgopalamurthy, General. Sanskrit, 2005. 328 pgs. 12817 maanasagarii... Dr . ramachandra pandey, General. Sanskrit, 2005. 540 pgs. 12818 brxhatparaasharaherashaastramu... madhurakrishnamurthy sastry, General. Sanskrit, 2005. 408 pgs. 12819 sachitra jyotishha shiqs-a... bii . ela . t'hakura, General. Sanskrit, 2005. 286 pgs. 12821 jyothisyashhabdakoshha:... Pandit Sreemathru Prasadha Pandeya, General. Sanskrit, 2005. 440 pgs. 12822 sachitra jyotishha shiqs-a... b.c thakoor, General. Sanskrit, 2005. 252 pgs. 12823 jyautishha- san'hhitaa... aacharya baskaranand lohini, General. Sanskrit, 2005. 272 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 1/167

2/14/2011

A list of scanned Sanskrit books at III… 12824 bhuvanadiipaka... pandit kashiram, General. Sanskrit, 2005. 88 pgs. 12826 svapnavaasavadantamuu... gang-ga'saagararaaya:, General. Sanskrit, 2005. 278 pgs.

12828 jyotirveidan... gobboru venkatananda raghavarao, General. Sanskrit, 2005. 230 pgs. 12831 prashnachand-d'oshvara... pandit vishnu dutt, General. Sanskrit, 2005. 88 pgs. A Catalogue Of Sanskrit And Prakrit Manuscripts In The Rajasthan Oriental Research Institute Part Iii A... Muni Jinavijaya, Unknown. Sanskrit, 1967. 626 pgs. A Cattalouge Of The Sanskrit Manuscripts... Dr.aryendra Sharma, Unknown. Sanskrit, 1964. 338 pgs. A Critique Of The Brahmasutra Part 1... P M Modi, Unknown. Sanskrit, 0. 530 pgs. A Critique Of The Brahmasutra Part 2... P M Modi, Unknown. Sanskrit, 1956. 422 pgs. A Descriptive Catalogue Of Sanskrit Manuscripts Volume I Part Ii... T P Upadhyaya, Religion. Sanskrit, 1953. 266 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts... P P S Sastri, Unknown. Sanskrit, 1929. 530 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts... Vidya Sagara, Unknown. Sanskrit, 1934. 452 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts Vo Iii... P P S Sastri, Unknown. Sanskrit, 1929. 632 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts Vol 14... Tanjore Maharaja Serfoji S, Unknown. Sanskrit, 1932. 523 pgs. A Dictionary English And Sanskrit... sir monier monier williams, Unknown. Sanskrit, 1957. 666 pgs. A Dictionary Of Sanskrith Grammar... Kashinath Vasudev Abhyankar, Unknown. Sanskrit, 1961. 436 pgs. A Grammatical Dictonary Of Sanskrit Vedic... Surya Kanta Sastri, Unknown. Sanskrit, 1953. 308 pgs. A Grammatical Word Index To Atharvaveda... vishva bhandu, Unknown. Sanskrit, 1963. 734 pgs. A Grammatical Word Index To Rigveda... Vishva Bhandhu, Unknown. Sanskrit, 1963. 648 pgs. A Grammatical Word Index To Taittiriya Samhita... vishva bhandu, Unknown. Sanskrit, 1963. 376 pgs. A Grammatical Word Index To The Four Vedas... Vishva Bandhu, Unknown. Sanskrit, 1963. 506 pgs. A Grammatical Word Index To The Principle Upanisads... vishva bandhu, Unknown. Sanskrit, 1966. 579 pgs. A Handful of Popular Maxims... Dr.m.d.balasuramanyam, Unknown. Sanskrit, 1983. 336 pgs. A Short History Of Sanskrit Literarure... T K Ramachandra Iyer, Literature. Sanskrit, 2002. 220 pgs. A Study Of Bharatas Natyasasatra And Avaloka On Dhananjayas Dasarupaka... Dr Manjula Gupta, Unknown. Sanskrit, 1987. 342 pgs. A Vedic Word Concordance Vol 5 Part 2... Visva Bhandu, Religion. Sanskrit, 1965. 174 pgs. A Vedic Word Concordance Vol Ii Part Ii... Visva Bandhu Sastry, Religion. Sanskrit, 1936. 746 pgs. Aachaara Bhuushhand-ama~ Grantha 57... Paahatryambaka Oko, Religion. Theology. Sanskrit, 1908. 449 pgs. Aachaara~yaa Abhyudayaa... D'indi'ma Raajanaatha~, Language. Linguistics. Literature. Sanskrit, 1945. 130 pgs. Aachaarendu Grantha 58... Aapat'e Hari Naaraayand-a, Religion. Theology. Sanskrit, 1909. 415 pgs. Aadhaanapadhdati... Aapat'e Mahaadeva Chimand-aajii, Religion. Theology. Sanskrit, 1947. 145 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 2/167

2/14/2011

A list of scanned Sanskrit books at III… Aagaashe Ispupaahai Gran'tha 5... Aapat'e Hari Naaraayand-a, Philosophy. Psychology. Sanskrit, 1912. 103 pgs.

Aanandakandachampuu... Mishraa Mitra, Social Sciences. Sanskrit, 1931. 260 pgs. Aapastambashulbasutrama~... Aapastan'ba, Philosophy. Psychology. Sanskrit, 1931. 352 pgs. Aapastambiiyan' Shraotasuutrama~... Chaara~ya Narasin'haa, Religion. Theology. Sanskrit, 1944. 816 pgs. Aapracharya Yasak Ki Vedvyakhya Paddhati... Dr Gyan Prakash Shastry, Unknown. Sanskrit, 1985. 164 pgs. Aapradarshprastavmala Vol I... Pandit Sri Vishwanath Shastry, Unknown. Sanskrit, 1951. 147 pgs. Aaprayyorday Kavyam Poorvadharm... Pandit Ganga Prasad Upadhyay, Unknown. Sanskrit, 0. 250 pgs. Aapstamba Shulba Suutrama~... Chaara Shriinivaasa, Religion. Theology. Sanskrit, 1931. 352 pgs. Aara~tha Shaastra Padasuuchii Trxtiiyo Bhaaga... Shaastri Shamaa, Social Sciences. Sanskrit, 1925. 358 pgs. Aara~thavara~nd-a Jyotishhama~... Dattaa Bhagavata, Religion. Theology. Sanskrit, 1924. 45 pgs. Aara~yaasaptashatii Faskikyulasa~1,2 Cha... Shriivishveshvaraapand-d'ita, Religion. Theology. Sanskrit, 1925. 376 pgs. Aashvalaayana Shraota Suutrama~ Prathamo Bhaaga... Shaastri Man'gala Deva, Religion. Theology. Sanskrit, 1938. 187 pgs. Aath Shri Madrunu Bhasyam... Shri Vallabha Charya, Unknown. Sanskrit, 0. 792 pgs. Aath Shrimadbhagwatha Darshini Ekhadarshaskarandra Prarbhaythe... -, Unknown. Sanskrit, 0. 478 pgs. Aath Smrithisaarodhwarprarambh... -, Unknown. Sanskrit, 0. 102 pgs. Aath Vamanpuranam Prarabhyathe... -, Unknown. Sanskrit, 0. 420 pgs. Aatmadarshanam... Vedhanth Anjaneyakumara Swamy, Unknown. Sanskrit, 1987. 178 pgs. Aatyoug pradipika... Shemraj Shri Krishnadass, Unknown. Sanskrit, 1874. 236 pgs. Aayura~vedasutrama~... Yogaanandanaatha, Philosophy. Psychology. Sanskrit, 1922. 356 pgs. Abhidavimarsh... Yogeshwar Dutt Sharma, Unknown. Sanskrit, 1980. 150 pgs. Abhidhaana Ratnamaalaa... Aupharet'a, Language. Linguistics. Literature. Sanskrit, 1928. 419 pgs. Abhidhana Manjari Of Bhishagarya... Shankar Sharmana, Unknown. Sanskrit, 0. 530 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrit Vol I... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 1056 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrit Vol I I I... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 1378 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrith Vol I V... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 1297 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrithvol I I... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 728 pgs. Abhidhanarajendrah Prakriti Magadhi Sanskrit Vol 6... Vijayarajendra Suri, Unknown. Sanskrit, 1985. 1482 pgs. Abhidhanarajendrah Prakriti Magadhi Sanskrit Vol 7... Vijayarajendra Suri, Unknown. Sanskrit, 1985.
sanskritdocuments.org/…/SanskritIIIT.…

1217

3/167

Sanskrit. 0.. Adharva Vedha Samhitha. Addaitasiddhi Dditiiyan' San'skarand-an.. Abhijnana Sakuntalam. Sarasvatii Madhusudhanaa. 0.. 326 pgs. Sanskrit. 364 pgs. Sanskrit.. Sanskrit. 208 pgs. Satavadhana Srinivascharya. Sanskrit. Theology. Acharya Jinabhadras Visesavasyakabhasya Part Iii. 161 pgs. Advaithdeepika. Advaitasiddhi Prathamasamput'ama~. Sanskrit. 304 pgs. 120 pgs.. 648 pgs. 620 pgs. Linguistics. Abhijnana Sakuntalam Of Kalidasa. Th Aufrecht. Abhinavam Prasutitantram First Edition. Abhidhara~maamrxtama~. 1990. Advaitasiddhi Trxtiiyasamput'ama~. Sanskrit. Abhinavaratnamaala Davitiiya Bhaaga.. Unknown... Abhidhanarajendrah Vol. Sanskrit.. Religion. Sri Guru Prasad Shastry. 170 pgs. Abhilekha Sangraha Sixth Khandah.. Vijayarajendra Suri... Ganesh Kashinath Kale. 1950. Philosophy. Unknown. 284 pgs. Sanskrit. Unknown. Abhidhara~masamuchchaya. Philosophy.obermiller. Sanskrit. Adharsha Prasthav Rathnamala. Sanskrit. Abhinava Vaasavadatta.. Unknown. Asan'gaa. Unknown. Pandit Ramachandra Sharman. Theology. 1950. Religion. Mahakavi Kalidasa. Unknown. Sanskrit.4. 1900. Sanskrit... Sanskrit. Vasubandhu. Sanskrit... 1922. Aasn'ga.. Abhijnana Sakuntalam Naam Natakam. 1992. Social Sciences. Sanskrit. Sanskrit. Language.. 1968..kale... 1937. Sanskrit. 1992.. Unknown. 1982.. Srimannarayana.... 1910.. Sanskrit. 130 pgs. Shanti Bhikshu Sastri. Paand-d'uran'ga Oke Mahadevo. Sanskrit. 210 pgs. 152 pgs. Unknown. Unknown. Unknown. Unknown. 1861.. Unknown. Agnipuraand-ama~ Grantha 41. 260 pgs. sanskritdocuments.. Ghoshhaka. Psychology. Unknown.. 1953.. 1946.. 1945. Sanskrit.. Literature. Technology. Unknown. Sanskrit.. 100 pgs... Bahadur Chand Chhabra. 134 pgs. Aapat'e Hari Naaraayand-a.. 194 pgs. 993 pgs. Sanskrit.. Abhisamayalankara Prajnaparamita Upadesa Sastra. Unknown. 1921. 464 pgs. Unknown.. Sarasvatii Madhusudhana. Rasiklal C. Abhijnana Sakuntala. 522 pgs. A N Krishna Aiyangar. Dalshuk Malvania.. Narakand-t'hirava Shaastri Vat't'ipalli. Abhidharmamrta Of Ghosaka. 879 pgs. Psychology.. 732 pgs. Sanskrit. Religion. Sanskrit. 172 pgs. Abhidharmakocarikah.2/14/2011 A list of scanned Sanskrit books at III… 1217 pgs... 0. 690 pgs... 1964. Unknown. Shaastri Vaamana. 1953. 1910. Sanskrit. Pandith Damodar Sharma Gaud.. 0. Parikh. Psychology. 1950. Abhijnana Sakuntalam Of Kalidasa. 0. Abhidhanarajendrah Vol.. 882 pgs. 518 pgs. Sarasvatii Madhusudhana. 532 pgs. 40 pgs. 405 pgs. Mr.. Sri Viswanatha Shastri Prabhakar. 1933. Sanskrit. E. Abhijnana Sakuntalam. Sanskrit. Abhidhanaratnamala. 1950. Acharya Ddhruva Smaraka Grantha Vol 3. Sri Chelamcheral Rangacharya. Sanskrit. Acyutarayabhyudaya Of Rajanatha Dindima. Vijayarajenda Suri. Unknown.. 1912. 0. Religion. Theology. Sanskrit.. Sanskrit.org/…/SanskritIIIT. Adhyathyamramayana Vol Iii. Agnihotra Chandrikaa Grantha 87. 1618 pgs.. 1301 pgs.. Philosophy.. Srimath Paramhans Parivrajakachary. 1940. Theology. Unknown. Abhidhara~maasamuchchayasya....… 4/167 ..... Unknown.5. Unknown. 1991..

1923. Sanskrit.. 1987. Language. Alang-kaaramand-ihaara Trxtiiyo Bhaaga. 1921. Sanskrit. Alankara Sangraha Of Amrtananda Yogin. Aitareyopanishhata~ Panj-jamii Khand-d'a Grantha 11... Sanskrit. Sanskrit. Parakaalasvaamii Shriikrxshhnd-abrahmatantra. Aanandagiri. 1981. k bhaskara rao. Misropahvedacharyapandithsrivamshidharshastriyna. 1931. Sanskrit. Akasmika Dana Laba Ke Yoga. 319 pgs. 1982. R. History. Amara Bharathi. Alang-kaara Kaumudii. Sanskrit. Sanskrit. Linguistics. Literature. 282 pgs. Mm. 69 pgs.. Linguistics. 369 pgs. 1943. Sanskrit. Gaurinath Sharmana.2/14/2011 A list of scanned Sanskrit books at III… Aitareya Brahmana Of Sadgurusisya Vol I 1 To 15 Adhyayas. All India Oriental Conference Thirteenth Session Nagapur University October 1946... 334 pgs.. Unknown. 138 pgs.. Sanskrit. Parakaalasvaamii Shriikrxshhnd-abrahmatantra. Sanskrit.. Language.. Sri Bharateeya Yogi. Paand-d'eya Shriivishveshvara. Alang-kaaramand-ihaara Da~tiiyo Bhaaga. Amarakosa Namalinganusasanam Of Amarasimha. 1997. Alang-kaaramuktaavalii... 46 pgs. Literature. 339 pgs. Parakaalasvamii Shriikrxshhnd-abrahmatantra. Sanskrit. Aldankar Sarvasvam. Sanskrit. Theology. Language. Amara Shatakamu. Jaggu Venkatachari. Language..sivadatta.. Sanskrit. Sanskrit.. 1929. 559 pgs.org/…/SanskritIIIT. 520 pgs. Alankaraustubha Of Visvesvara Pandita.. Alamkaras In The Works Of Banabhatta.. 1929. 1996.. 1982.… 310 pgs 5/167 . Language. Sanskrit. Biography. Parakaalasvamii Shriikrxshnd-abrahmatantra. Sanskrit... Dr Raj Kumari Trikha.. Amara Bharathi Astami Kaksha. Literature. 441 pgs. Literature. Sanskrit. Alang-kaaramand-ihaara Prathamo Bhaaga. 1986.. 1923. Suranad Kunjan Pillai. v krishnamacharya. Alankaramand-ihaara Trxtiiyo Bhaaga. 252 pgs. 1917. 368 pgs. 1942. Unknown. 182 pgs. Sri Amaru Kavi. Alphabetical index Of The Sanskrit Manuscripts Vol I... 1927. 134 pgs. Unknown. 338 pgs. Theology.. Parakaalasvamii Shriikrxshnd-abrahmatantra. Alamkarasamgraha Of Amrtanamdayogin. 1923.. Sanskrit... 1950.v... Alang-kaaramand-haara Trxtiiyo Bhaaga.. Anantakrisna Sastri. Linguistics. Religion. 98 pgs.. Alang-kaaramand-ihaara Chatura~tho Bhaaga. Linguistics. 366 pgs. 449 pgs. Unknown. Literature... Unknown. 94 pgs. Geography. Religion. Sanskrit. Alankarakaustubha Of Kavi Karnapura. Linguistics..... Literature. Unknown. Theology. 0. C.. 876 pgs. 262 pgs. Parakaalasvaamii Shrii Krxshhnd-abrahmatantra. 1949. Linguistics. Sanskrit.. Kondapudi Apparao. Biography... Surya Narayana Murty... 139 pgs. Sanskrit.. Unknown. Sanskrit.. Ajnanadhavanta Candabhaskarah.. 1984.. Alankarathatvascha. Unknown. 100 pgs. Religion. 1964.. 1951.. 1983.. Lokanatha Chakravarthin. Sanskrit. Sanskrit. Theology. Unknown. Sanskrit. Shastrii Esa~ena~. 1957. 662 pgs.. H L Jain. Alang-kaaramand-ihaara~ Chatura~tho Bhaaga. Unknown. Language. Religion. 242 pgs. Art. brahmananda tripathi. 0. Sanskrit. Subrahmanya Sharma. Literature. Enter Subject Of The Book.s. Unknown. sanskritdocuments. History. Sanskrit... Unknown. Geography. Akaradhanukrmanika. Parakaalasvaamina~ Shriikrxshhnd-abrahmatantra.

1955. Sri G A V Ms Uppalacharyulu. 239 pgs. Amarzakosha Vigraha Comm. 1995. 1864. 377 pgs.. 1939... Language. Ramaswarupa Bholanath Pandit. Sanskrit.r. Sanskrit. Unknown. Linguistics. Sanskrit.. 400 pgs. 736 pgs. Geography. Unknown.aruna Gupta. Unknown. Sanskrit... Andhra Bhagvthanuvad. 233 pgs.. Unknown. Linguistics. 66 pgs. 0. Amhar Vani (sathvi Kaksha). An Anthology Of Poetry And Drama Part I. General. 305 pgs. Shiromani Sannidhanam Suryanarayanshastry.. 1940. Sanskrit.. Shriman Mahadev Chmanji Aftee.. Dr.s. Literature. 709 pgs. . 1952.2/14/2011 A list of scanned Sanskrit books at III… 310 pgs.. 1947. Dr Ram Naresh Tripathi. 1985. 242 pgs. Unknown. 328 pgs.. 0. Sanskrit. Anu Bhashya Vallabhacharya Art Sanskrit 1921 495 pgs sanskritdocuments. Sanskrit. Sanskrit.. Sanskrit. Literature. Unknown... M. Unknown. 1971. Sanskrit. Sanskrit. Anekaathara~tilaka. Nithyananda Parvathiya. Sanskrit. Haragovinda Sastri. Pandith Haragovinda Sastri. 1947..... Anandasundari. S K De. Mahiipa. Unknown. Sanskrit. Literature. Anthya Karmadeepika. Amrau Shatakam.. Unknown. Sanskrit. 1866. 70 pgs. An Introdution To The Grammar Of The Sanskrith Language... Jaganadha Rao. Sanskrit. 1961.. Sanskrit. Amarkosh Namalingaanusasana. 168 pgs.. Unknown. An Indian In Western Europe.. An Anthology Of The Epics And Puranas. 524 pgs. 1979... Unknown... 358 pgs. Amarakoshah. Sanskrit.. 1984. Shriimuraarimishra Mahaakavii.. Biography. Sanskrit.. Sanskrit. 2000. 0. Madhukar Mangesh Patkar. 1969. Chandra Sekhara Sharma.. Language.. Unknown... 358 pgs. Dr V Raghavan. 745 pgs. Unknown. Sanskrit. -.. Ttd. 1947. pgs. Sanskrit.... Ogale Gurunaathaprabhakara.. 1993.. V.… 6/167 .. Narayan Bhatt... Anandashram Sanskrith Granthavali Trishtlisethu. Amarakosa of Amarasimha. Sanskrit. 258 pgs... Literature. Unknown. Sanskrit.. 1932.kale. Anara~gharaaghavama~ Trxtiiyo San'skarand-ama~.. Linguistics. Amarakosah Dwithiya Khandah. 314 pgs... Viswanath Bhatt. Unknown. 1986.s. 168 pgs. 138 pgs. 1998.. Ananda Ramayana. 1984. Unknown. 1983. Anandh Samastha Granthavali.. Jean Paul Lanly.. Unknown. Anekaara~thatilaka. An Anthology Of Subhashitas Part Two. Anandasramsanskritgradhavali. 468 pgs.. Mahiipa. 1999. 194 pgs. A N Upadhye. Amarkosha Of Amarsingh. 1990.. Language. Literature. History. Anandashramasanskruthagranthavalihi. 1952. Anekartha Tilaka Of Mahipa. 300 pgs. Arjunavarmadeva. Amarkosh Pratham Kandam. sri amar singh. 388 pgs.. Theology. Anandanandini. V Raghavan. 571 pgs. Religion.. Sanskrit. Amelioration Genetique Des Arbres Forestiers Forets 20. Unknown. Amerika Bhaaga Pahilaa. Sanskrit.. Prof.org/…/SanskritIIIT. Unknown. 268 pgs. Sanskrit. Annanda Sramasamskrutha Grandavali. 1981. Sanskrit.snankarsastri marulkar.. Unknown.. Unknown. 1936. Sambu Prasad. Ancient Indian Economic Thoughts. 130 pgs.. 375 pgs. 136 pgs.tirupati.. 1970. H H Wilson. Sanskrit. Mr. Annamacharya And Surdas. Sanskrit. 336 pgs. Sanskrit. Sanskrit. Kuttakarshiromani. Literature. Mamchala. 236 pgs. Sanskrit. Unknown..

pgs. 1950. Ganapati Sastri. 473 pgs. 444 pgs.. 1931. Unknown. Sanskrit.. 0.. R Shama Sastry. Dr Bali Ram Shukla..… 7/167 . 0.. 1924. 459 pgs. Sanskrit. -. Sanskrit. Unknown. Theology. Aprakaashitaa Upanishhadah. Unknown... Sanskrit.... Astadhyayisutrapatha.. 469 pgs. Unknown. 330 pgs. .. Sanskrit. Ara~thashaastrapadasuuchii Prathamo Bhaaga.. 0. 157 pgs. Unknown. Sanskrit.. Ramachandra Sharma. 1955. Arthasatra Of Kautilya Vol Ii. Theology.. Arthasastra Of Kautilya. 346 pgs. Sanskrit. Sanskrit. Swamy Pramodgiri Vedanthkishore. Unknown.. Unknown. Sanskrit. Apasthamba Sulba Sutra. 720 pgs. 122 pgs. Sanskrit. Anuvaada Kalaa Athavaa Vaga~vyavaharadara~sha... Shaastrii Shaamaa. 1950. Arya Salistambe Sotra. Unknown. Social Sciences... 1950. Unknown. Anustana Prakasaha Mahanibandhaha...org/…/SanskritIIIT. Ardh srimadbagavathardha dharsan vol 1. 0. Shaastri Shamaa. Arthavedatdhasamhitha. Vethanamanom. Social Sciences. Astadasasmrtayah.. Sanskrit.. 1998... -. Sanskrit. Sanskrit. 1923. 1955. 280 pgs. 1927.. Aryavidya Sudhakara. Sanskrit. 0. Apastambagrihya Sutra. Vidwan Shivasri.. 2000. Sanskrit. N Aiyaswami Sastri. Unknown. A Chinna Swami Shastrulu. Aparajitaprccha Of Bhuvanadeva... 865 pgs. Sanskrit. Anusuchi. Sanskrit. Religion. Sanskrit. 0.. Sanskrit. Unknown. Sanskrit. Unknown. 72 pgs.. Ved Prakash Shastri. Unknown. 552 pgs. Maharshi Panini. Asalayina Gruhasutram. 1955.. Kunj-chanaraaja Chi Dakt'ara~.. 986 pgs. Sanskrit.. Sanskrit.... Apabhran'shakaavyatrayii. Dhamodar. Philosophy. 289 pgs. 492 pgs. 1925.2/14/2011 A list of scanned Sanskrit books at III… Anumana Pramana. Pandith A Chinnaswami Sastri. Srinivasa Murti.... Unknown. History. 1924. 1940. Sanskrit. 472 pgs. 277 pgs. 0.. Unknown. Sanskrit.. Sripad Damodar Satvalekar. 158 pgs. . Ara~tha Shaastra Padasuuchii Dditiiyo Bhaaga.. . Ashvinao Devtaki Bhoomika.. Literature. 1064 pgs.. 1924. Somraj Krishna Das.. 248 pgs... Artha Sastra Of Koutilya. Apaharvarma Charita. sanskritdocuments. History.. 1989. Jindaattasuurii.. Language.. 896 pgs. Ramchandra Sharmane. 1948. Sanskrit. prasanna kumar acharya. Architecture Of Manasara. 1951.. 458 pgs. Unknown.. Ardh Srimadbagavathardha Dharsan. Linguistics. Ara~tha Shaastra Padasuuchii Prathamo Bhaaga.. J Jolly. D Srinivasacharya. 1986. Sanskrit. Popatbhai Ambashankar Mankad. Ashtanga Samgraha. Sanskrit. Sanskrit. Psychology. Sanskrit. Religion.. 367 pgs. 346 pgs. 0. 262 pgs. Shaastri Shamaa... 588 pgs. Arya Salistamba Sutra. Sanskrit.t. Social Sciences.. Unknown. 1924. Religion. 1924. 1928. 762 pgs. Sanskrit. Yajneswara Cimana Bhatta. Apastambasrautasutra Dhurtasvamibhasya.. 247 pgs. Shaastrii Shriichaarudevashaastii. 540 pgs. Anuvrath Vidhya Trishati. Unknown. Theology.. Unknown. 1976.. Sanskrit. Ashtadyayi Sutrapaat.. 469 pgs. Unknown. Arthvaved Sanhita. Unknown..

. 1955. Unknown. . Gulab Chand. 106 pgs. 0.. Sanskrit. Atha Tatpurusha Prakaranam... Dr.... Ath Sriskand Mahapurane Brahmkhande Sethumahatmay Vol I I I. Religion. Sanskrit. 0.. Ityupaadhidhaarind-aa Ema O Ela. . Religion.. 594 pgs. . Unknown. Shiva Sharma. Religion. 1951.... Theology. 234 pgs. Religion. Sanskrit. Asvalayaand-a Graha Suutraa Vol I. Sanskrit. 100 pgs. 668 pgs. 1920. 1916. Sanskrit. 1955. Sanskrit. Atma Praboda. Asvasastram. 1996.2/14/2011 A list of scanned Sanskrit books at III… Astam.Vivaram-vranam. pgs. . Religion. 340 pgs. 474 pgs. Theology. Athagreya Mahapuranam. Tira~tha Svaami Ravi. Unknown. Rama Chandra Sharma. Theology. Unknown.. Theology. Shri Anand Van Aagadi. -. Unknown. Sanskrit. Unknown..... . 0. Sanskrit. saayand-aachara~ya... Sanskrit.. Ath Koormmahapuranam Prarabhyate. Somraj Krishna Das. 867 pgs.. Baladevaprasaada. 310 pgs.. Unknown.. Religion. 436 pgs. Unknown. 1824 pgs.. 0. Asvalayanagrhyasutra Bhasyam Of Devasvamin. 650 pgs. Religion. Sanskrit. 130 pgs.org/…/SanskritIIIT. Sanskrit. 1987.. 0. Sanskrit. 1956. Religion. Atha Tatpurusha Prakaranam.. 986 pgs. 0. Atma Purana With Hindi Commentary. 562 pgs. 214 pgs. Sanskrit. 1895.. Unknown. Ath Sriskande Mahapuranm Vaisnavkhande Venkatachalammahatmay Vol I I. sanskritdocuments. Sanskrit. 0.vishnuteertha. Asthadhyayisutrapaath.. Sanskrit. Atharva Vedha Samhitha. . Sanskrit.. 1644.. Unknown. Asya Vamasya Hymn. 666 pgs. 404 pgs. Bhagavadatta.. Atha Tatpurusha Prakaranam. Sanskrit. Linguistics Literature. Religion. Athara~va Pratishaakhyama~ Prathamogyan' Bhaaga. Ath Shuklayajurvedakavya Samhitha. 0... Theology... Sanskrit. Atharavaanaa Upanishhada Second Edition. Unknown. Sanskrit. 0. Ath Vishnudharmottar Mahapuranam.. Sanskrit. Shaastrii Raamagopaala. Athara~vavediiyaa brxhatsara~vaanukramand-ika.. Athara~vavedasan'hitaa Trxtiiyobhaagaa.. 1952. Athara~vedasan'hitaa Bhaaga 2. Theology. 288 pgs. Atharva Vedha Samhita Mulya Mantra Sayaye Bhashya Kshiks Kandah. 1944. Sanskrit.a.… 8/167 .. 362 pgs. Theology. Sanskrit. -.. Jacob G A.. Atha Gaayatrii Tantra. Sanskrit. 0.. Athavarvediiya Panj-chapat'aalikaa. 1928. Unknown.. Astanu Hrudayam.. Unknown.. . 555 pgs. Literature. 0. Theology. 1923. Unknown... Acharya Sri Sitaram Shastri. 73 pgs. 363 pgs. 1922.kumaraswamy.. Ath Srimaddwaramahapuranam. 0. Religion. Sanskrit. Atma Purana..Puspam.. Ath Sriskande Mahapurane Shanst Nagar Khand I I I.. Sanskrit.. 696 pgs. Sanskrit. Shri Anand Van Aagadi. Atmadarsanam. Sanskrit.. Ath Srimnmatsyamahapuranam Prarbhyate. Ath Sriskanandmahapuranam. 0. P. 263 pgs. 180 pgs. 1898. Sanskrit. Damodar Sathwalekar. Pandith K P Aithal.. . -. 1996. Saayand-aachara~yaa. 0. Literature.. 1955. 0. Sri Venkatesho Vijaytetram. Unknown.. 520 pgs. -..... Sanskrit. Sanskrit. 1037 pgs. -. Unknown. Dr. 547 pgs.v. Nakula.c. 257 pgs.kunhan Raja... Sanskrit... Sanskrit. Sanskrit. 266 pgs. Literature. -.. 483 pgs. Theology..

.a.k. 1899.. Unknown. Bhaamatii Prathamo Bhaaga. Psychology. Language.. Aya Srimadhnrumatrayam. 280 pgs.. Dr. History. 52 pgs.. Unknown.. 1933. Bhaashhyaara~tha Ratnamaalaa Grantha 75.. Sanskrit. Literature. Beauties From Kalidas. p sri ramachandrudu. Biography.. Sanskrit. 290 pgs. Philosophy. Bala Bharatam.. Sri Durga Prasad Divyvedaen. Linguistics. Sanskrit. kalluri ahobila rao. 1889. Subrahmand-ya. Bhaaminiivilaasa. Vaidhopahsriparushuramsharma. Religion.. K S Ramamurty. Sanskrit. 132 pgs. Sanskrit. Sanskrit. 1982. 146 pgs. 1939. Aund-aadikapadaand-ara~va Grantha 7.. Ayurvedhakandah. Language. 206 pgs. Sanskrit. Unknown. 191 pgs. Geography. Avachedakatvanirukti Of Sri Jagadisha Tarkalankara With Lakshmi Commentary. 1964..2/14/2011 A list of scanned Sanskrit books at III… Atmarpanastutih. Beejganitham Vol I I I. Swami Sri Dharmananda. Sanskrit. 1991.kunhan Raja... Religion.. Sanskrit. Psychology.. Chantaamand-i Ti Raa. Linguistics. 1924. 1054 pgs. Aunadikapadarnava.. 294 pgs.. 1935. Sanskrit.. Dr. Geography. Unknown... Ayodhyeche Nabaaba. Ratna Ketamkavi..org/…/SanskritIIIT. Religion. sri laxmiramaswami mahabhagavanamu. 1984. 346 pgs. Literature. Sanskrit. The Greatness Of Badari Kshetram Or Holy Place. Sanskrit. Baoudhagamarth Sangraha. Sanskrit. Literature. Sanskrit. 772 pgs. Vaachaspathimishraa. C. Language.. 401 pgs. Sanskrit. Shaaligraama Shan'karatukaaraama.... Paarasaniisa Dattatrayabalavan'ta. Balabharatham Of Agastya Pandita. Mahaakavii. Unknown.. Sanskrit. Balaramayana. S. 1956.. 0. 442 pgs.… Bhagavadgaiitaa Bhaaratiiyadashara~naani Cha Shaastrii Ananta Krxshhnd-a Religion Theology 9/167 . Sanskrit. Sanskrit. Biography.. 324 pgs. Sanskrit. 1941.. 126 pgs.. 674 pgs... 1983. 602 pgs. 1983. Religion. 1922.. 1933. Baismi Parinaya Champu. 1958.. Theology...k.s. Avadanacataka A Century Of Edifying Tales Vol I. G. Ayurvedabdhisara Part 1... Unknown.. 1965.. Bhaaratiistava Prathaman' Mudrand-ama~. 480 pgs. Shriimadatkhand-d'adeva. 1945.. 125 pgs. 1915. Pand-ashiikarasan'shodhitaa. 412 pgs. Philosophy. Baapuu Gokhale Yaan'chen' Charitra. 193 pgs. Baktha Mandram. Kapaaliishaastrii Ti Vi. Bhaaminiivilaasa. kaas'inaatha paanduranga paraba. 324 pgs. Avantisundariikathaa.h. Jaikrishndas. Chintaamand-ih Ti Raa. Bakthamala Ramramsikavali. 382 pgs. Sanskrit.bhatt. 432 pgs. 182 pgs. Unknown. Sanskrit.. 136 pgs. Theology. Literature. Sanskrit. Speyer. Ayurved Vigyanasar. Unknown.. Bhagavadajjukam. 1986.. 190 pgs. Padhye... -. sanskritdocuments. Sanskrit. Sanskrit.. Theology.. Veturi Prabhakara Shastry. Sanskrit. Theology. History. Unknown... Sanskrit. 1927. Unknown.. 51 pgs. 327 pgs. 1902. Sanskrit. Aund-aadikapadaara~nd-avah.. 1939. Bhaat't'adiipikaa Niviitaanto Bhaaga 1. Sanskrit.. 1989. Linguistics. Sanskrit. 1939. J.. Sri Sankaranarayana.. Unknown.ganga Sagar Rai. Literature. 1948.. Unknown. Unknown.. Literature. 1962. Unknown. Raramurthi.

1978. M. 165 pgs. Unknown... Panditraja A Subramanya Sastri. V. Literature. .. Theology. 1956. Dr.. Sri Laxmana Sastry. Unknown. S. Unknown. 1952. Unknown. Bharathiy Darshan Me Parivarthan Ka Swarup Vishestha Boudd Darshan Ke Sandarb Me. 1936. Bhasa's Pratima Part Ii Natakam.. Sanskrit. Religion. Bharata Natya Darsanam.. 1968. . 383 pgs. S.n. 1959. Bharatiyam Vrttam. V S Venkata Ragavacharya.. 111 pgs.. Sanskrit. 252 pgs. 1945. Sanskrit. n gopalapanicker. 519 pgs. Sanskrit. 589 pgs. Swetaranyam Narayana Sastriar. 442 pgs. Unknown... Unknown.. Matha. Janaswamy Subramanya Shasthri. Bhatruhari S Neetisataka... Literature... Bhakti Chan'drikaa. Bhatta Dipika(uttrasatka Part I) With The Prabhavali Of Sambhu Bhatta. Sanskrit. 316 pgs.. Unknown. Sanskrit. Naaraayand-atiira~tha.. . 1944. 1959. Venimadhav Sahastri Musalgonkar. Unknown.. 0.. pgs... Sanskrit. Bhasa Ki Sambhandi Thatha Natakiya Visheshathaye.. 860 pgs. 798 pgs. 954 pgs.. Bharadvajasiksa. Dikshit. Unknown. 306 pgs. Bhaismiparinayacampu. Bhagavatham With Curmikatika Vijayadwaja Tirtha Padaratnavali 1892. Sanskrit. 316 pgs. S R Sehgal. Sanskrit. Sanskrit. 0 pgs.. Sanskrit. 518 pgs. Unknown. Sanskrit. 172 pgs.. 1921.r. 1935..jd.. 291 pgs. 1985. Bhasa's Pratima Part Ii Natakam. Sanskrit. Literature. Vacant.org/…/SanskritIIIT. Sanskrit... Unknown. Sanskrit. 1985.. 1921. Bhatti Kavyam Canto 10.. Bhatta Dipika Uttarasatka Part I I. 1985.. 297 pgs. Unknown. Shaastrii Ananta Krxshhnd-a.… Bhatti Kavyam Canto 11 12 Saradaranjan Ray Vidya Vinoda Unknown Sanskrit 0 280 pgs 10/167 .ramachandra Dikshitar... 0.. Kumudranjan Ray. Bhaminivilasa. 1952.. 552 pgs. Sanskrit. 340 pgs. Religion. . Manju. 1887..surya Narayana. 1942. Bhasas Balcharitam. 512 pgs. Bharatarnava Of Nandikeswara. Har Dutt Sharma.. 120 pgs. Unknown. Bhagavata Tippani Chalari. General. Sanskrit. Unknown. Unknown. Dikshit Jd. Theology... 223 pgs..2/14/2011 A list of scanned Sanskrit books at III… Bhagavadgaiitaa Bhaaratiiyadashara~naani Cha. Bharata Kaumudi Part I. Bhas Kee Bhasa Sambandhee Tat(natakeeya Visheshtaem. Bhattalankara Tikayuta.. Bhagavantabhaskara Of Sri Nilakantha Bhatta Vol I. Sanskrit. Bhagavadgitha Anandatirtha. Sanskrit. Sanskrit. 304 pgs. Kumudranjan Ray. Bhatta Chintamani Tarkapada. Vachaspti Gairola.dasgupta. 1991. 1938. 712 pgs. 1335 pgs.r. Sanskrit. Saradaranjan Ray.. Sanskrit. Venimadhav Sahastri Musalgonkar.. Bharatarnava Of Nandikeshwar. Unknown. Dr Radha Kumud Mookherji... Sanskrit. K Vasudeva Sastri.. Bhattaldankartikaythu. Sanskrit.. Literature.. 510 pgs.... 0. 240 pgs. Eeshwar Singh. Unknown. sanskritdocuments. 1973... Sanskrit. Sanskrit. 1938. Unknown. 1983. Bhagavantabhaskara Of Sri Nilakantha Bhatta Vol I I. Unknown. Bhartiya Darshan Ka Itihas.. Bhamti Ekk Adhyayan. 1933. Sanskrit. Unknown. Sanskrit... Art. 0.. Ananta Deva.. . Bharathi Nirukth Vedh Swarup Darshan... Sanskrit. 1951. 1942. 112 pgs. Sanskrit. 1981. 174 pgs.. Sanskrit. S Subramnya Sastri.

0. Bhedojjivana Of Sri Vyasaraja.. 636 pgs. Sanskrit.rajendralal. Narayana. 640 pgs. 1959. M. Bhavya Bharatham. Vijnanabhikshu. 557 pgs. Bibliotheca Indica Volume 4. Sanskrit. Geography.. Kavikarnapura. Sanskrit. Sanskrit. C Lakshmi Kantaiah.. 1987. -. 1983. Sanskrit. M. 1945. Unknown. Literature. 1856. Sanskrit. Literature.. Bhoja Prabanda Of Ballala. Sanskrit. Unknown. Sri Govind Das.. E. Achyutaraaya. R Nagaraja Sarma. 90 pgs. Bhramara Sandesa. sanskritdocuments. Bibliotheca Indica Volume 3. Sanskrit.... 984 pgs. Geography. Bheda Vidya Vilasa. Bhuhgoghatharangani. Sanskrit. Unknown... Vijnana Bhikshu. 0. Bhelsanhita. Bibliotheca Indica Volume 31 1. Sri Girijadayalu Shukla. 280 pgs. Sanskrit.org/…/SanskritIIIT.rose. Sanskrit. Bibliotheca Indica Volume 71 4... sri ranga ramanujamuni.. Balvanth Singh.. Sanskrit. Literature. Philosophy. Bibliotheca Buddhica Vol Vii Nyayabindu..... Vacant. 830 pgs... 1981. 220 pgs. Sanskrit.. Bodhaikyasiddhi Prathamo Bhaaga..… 11/167 .. Geography. Geography. Y Mahalinga Sastri. Unknown.. Unknown.. 134 pgs. Late Vinayak Narayan Shastri Vasudev Laxman Shastri. Bhoja s Samaarangana Suutradhaara Vol I. Sanskrit.. M. Sanskrit. 50 pgs. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Bhatti Kavyam Canto 11 12. 968 pgs...rajendralala. Unknown. Literature. 580 pgs.. Sanskrit. 1933. Sanskrit. 320 pgs. M. Bhesajya Rathna Vathni. 1987. Maheshchandra... 134 pgs.. 1954. Bhava Prakasika. Ramakrishnamacharya K. Bhavprakashnidhantu. 301 pgs. Sanskrit. Unknown. Unknown.. 1959. Biblotheca Indica. -.. V.. 576 pgs. Dwaita Philosophy.rajendralal. Sanskrit. Sanskrit. 1991. Sanskrit. 388 pgs. Bibliotheca Indica Volume 45 1. 1962. Sanskrit. Unknown. Tirumala Charya.. Sanskrit. Venkataramana Reddy. Sanskrit. Unknown. Bibliotheca Indica Volume 27. 108 pgs. 1918. 1854.. Geography. 0.. 1951. Bibliotheca Buddhica V.. Bibliotheca Indica Volume 71 1.. 1980. Geography. Unknown.. 504 pgs.. Sanskrit. Bheddo Jevana Of Sri Vyasaraja. Sanskrit.. 580 pgs. Sanskrit. 1934. Language. Sanskrit. Geography. 0.. Bibliotheca Indica A Collection Of Oriental Works. 362 pgs. pandit sri bhramha shankara misra. Psychology.rose... Bheda Ratnam... Unknown. -. Bibliotheca Indica Volume 71 2. Unknown. V. 1995. 1987. 185 pgs. 1991.. Vacant.. Bhedojjeevanam. Bhavaprakasa Of Bhavamisra. Bhoja. Gopinath Kaviraja. Sanskrit.... 1949.. 1998. 135 pgs. Geography... Philosophy. 646 pgs. Sanskrit. 220 pgs. Prahladacharya. Sanskrit. Linguistics. 212 pgs.. 0. -. 422 pgs..rajendralala. 0. Geography.. 294 pgs.. Literature. 0. 1987. Bibliotheca Buddhica Vol Vi. E.. 540 pgs.. 66 pgs.. Sanskrit. Bhushanasara Samiksha Part Ii. 722 pgs.. Saradaranjan Ray Vidya Vinoda. 60 pgs.. Bibliotheca Indica Volume 71 5. Sri Vyasaraja Tirtha. Unknown. 122 pgs. Bhupala Mandanam Of Devasri Narada. 1992. 2003.rajendralal... Sanskrit. Unknown. Bibliotheca Buddhica Vol Vvxx. Bhattikavya Of Bhatti.. Unknown.. 1980. Sanskrit. 1980. M. Vasudeva Sharman. 434 pgs. 120 pgs.. 1903.

1904. Theology. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Bodhasara a treaties on Vedanta.. Sanskrit..... Sanskrit. 1992... Sanskrit. Laxman Shastri Pansikar. Unknown. Brahmasutrabhashya. Sri Vijayeendra Tirtha. Brahma Vaivartha Puranamu Vol 1.tatvaprakashka1.. 326 pgs. Sanskrit. Brahmasutravrtti Mitaksara Of Annambhatta. Religion. L. Unknown. Not Available.... Brahmasutra Bhashya Of Sri Madhvachrya. Sri Narahari with a Commentary by the Author's Pupil Pandit Divakar. 0.… 12/167 .. 779 pgs.. Brahdaranyakopanishath Vol-liv. J L Shastri. 1982.. 586 pgs. General. Sanskrit. R.. Physical Fitness.. Bodhicaryavatara. Brahaspatismrti. Sanskrit. 890 pgs. 372 pgs.. Brahama Sphuta Siddhanta Vol Iii. Unknown. . 486 pgs. I. K V Rangaswami Aiyangar.. 758 pgs. 584 pgs. Sanskrit. 462 pgs. Brahmasutra Bhasyamsahithayatham Thathvaprakasika. Sanskrit. Geography. R. 452 pgs.. 740 pgs. 1966.panchamukhi. Pandit V. 95 pgs. 0. Unknown.. 600 pgs. Khemraj Sri Krishnadass. Sanskrit.. 1979... Brahma Vaivarth Eak Pradyayan.. Acharya Mandanmisra. Dr. Brahmasutrabhasya Vol 1. Unknown.rama Sastri. 448 pgs. Ram Swarup Sharma. 762 pgs. Religion. Unknown. 1937. P L Vaidya... Religion. Sanskrit. Sanskrit. Sanskrit. Brahmasutra Bhasyamsahithayatham Thathvaprakasika. 1832.. Unknown. Unknown. Language. 0.... Sanskrit... 750 pgs. Brahmasutrashaariirabhashhyaara~tha Bhaaga tiisara. Unknown. 661 pgs.. Pandurangatmaj Kashinath Sharma.. 222 pgs. Sanskrit.. 1965. Sanskrit. P. Bhaapat'ashastrii Vishhnd-uvaamana. 0. sanskritdocuments. Sanskrit.s. 88 pgs.s. Linguistics. sathyanarayan tripati. Brahma Sphuta Siddhanta Vol 4. Sanskrit. G. Sanskrit. 286 pgs.. 1937... Unknown. 536 pgs.. 1966. 0. 1980.2. Unknown.. Sanskrit. 1950. Brahatstotraratnavali Vol I. Sanskrit. 0. 0. Sanskrit.sampurnananad. Unknown.. Sanskrit. 1966.s.. Brahmanda Puranam. Brahmasiddhi. Unknown..... 1944. Sanskrit. Archaryavara Rama Swarup Sharma. Unknown. Brahmanjali Nam Parameswararpitha Slokamalika. Literature. Sanskrit. 1941. Sanskrit.tekct.. Philosophy. 1953. 586 pgs.. 334 pgs... . Brahatkatha Manjari. 584 pgs. Sanskrit.. Bodhicharya Vatara Of Santideva. 18 pgs.. 1980.. 1966.2. 1911. Acharyavara Ram Swarup Sharma.. 168 pgs.. Unknown. Brahmasutra Bhashya. Unknown. 505 pgs. Sanskrit.. 402 pgs. Brahma Sutra Dwithiya Bagamu.panchamukhi.nene. Sanskrit. Sanskrit. Sanskrit. Shankar Shastry Venegavakar.org/…/SanskritIIIT. 200 pgs. Unknown. R Antoine. 1925. 1973. Brahmanda Purana Of Sage Krsna Dvaipayana Vyasa. Sri Madra Dwapayamuni. Unknown... Sanskrit.. Brahmasutras And Dasasloki. 0. Brahmachary Vishnu. Brahma Sutra Nyaya Sangraha. 336 pgs. Unknown.. Sanskrit. Unknown. Brahma Sphuta Siddantha Vol I. shri bramha gupta.s.. Arka Somayaji.. 1906. Unknown. Brahma Suutraand-i Grantha 67. Natural Sciences. Sanskrit. 708 pgs. Brahmasutras. Brahma Sphuta Siddhanta Vol 3.. 644 pgs... 1915.. 1927. . Somraj Krishna Das.srinivasacharya. Book Of Exercises Part I. Ram Swapup Sharma. Theology.ananthacharya. 1960. Brahma Sphuta Siddhanta Vol Ii. 329 pgs. Brahma Sphuta Siddhanta Vol. Bodhayana Grihya Sutram.

Brxhatii Prabhaakaramishraprand-iitama Da~tiiyo Bhaaga. Sanskrit. Unknown. Unknown. . 1992.... Brihat Sarvanukramnika Of The Atharva Veda.... Sri Krishnadas Aatmajain Ganga Vishnuna. Religion. Prabhaakaramishra.. Sanskrit.. Chaara~ya Matsureshvaraa. Aapat'e Vinaayaka Gand-esha.. 0. Unknown. Philosophy. Brhadaranyakopanishad Bhasyam. Srilnarayana Bhatta Goswami.. Prabhaakaramishra.Bhashya. Sanskrit. 753 pgs. Bruhaddevagnanaranganam. Sanskrit. Religion. Theology.. Sanskrit.... 268 pgs. 1994. 1953. Sanskrit.. Brahmavaivatara~purand-ama~ Ddvitiiyo Bhaaga Grantha 102... Sri muralidhar.books at III… Brahnni Ghantu Ratnakar Vol V I. 0.. 1935. Sanskrit. jyotirvdaya datta. 190 pgs. 351 pgs.. pg Brahmavaivara~tapuraand-ama~ Prathamo Bhaaga Grantha 102. Buddhapalita Mulamadhyamakavrtti.. Religion. Unknown. 110 pgs. 0.. 206 pgs. Sanskrit.. Religion. . 0. Braj Bakthi Vilas.. 1867. Sanskrit.… 13/167 . Buddhist Logic Vol 1. Bruhajjyothi Sarnava (mirra Skandha) Hari Krishna. Literature. Sanskrit.. 880 pgs. 616 pgs.. 1935. 503 pgs. Religion. Brxhatii Prabhaakaramishraprand-iitaa Prathamo Bhaaga.. 457 pgs.. 1937. 334 pgs. 1936. 614 pgs.. Aapat'e Vinayaka Gand-esha.. Linguistics. Theology.. Maraat'he Vaasudeva Shaastrii. Kenjiu Kasawara. Brihadaranyakopanishad Bhasya Part 1. Religion.. Sanskrit.. Sanskrit. Gand-esha Vinaayaka. General. Sanskrit. 1986... . 1953.. Brahmavaivarta Maha Puranam. Sanskrit. Psychology.. Brhajjatakam Bahotpala Tika. 914 pgs. . 1922. Buddhist Technical Terms. 1935. Unknown. Unknown. Sanskrit. Buddhist Hybrid Sanskrit Reader.. Max Walleser. Theology. Brahmavaivatar Puraand-ama~. 260 pgs. Theology. Sanskrit. T Veeraraghavacharya... Theology. Unknown. Sanskrit. . Sanskrit. Bruhanigantu Rathnakara Panchama Bagh. Brhadavanyaka Bhava Botha. Shaastrii Kashiinaatha. Religion.. sanskritdocuments. -. 1934.org/…/SanskritIIIT. Vira Raghavachaya. Bhat't'achaara~yaa Vidhu Shekharaa. 1885. Theology.. Somraj Krishna Das. 0. Theology. Philosophy. Brahmavaivarta Puranam. Unknown.. 216 pgs. 1886. 463 pgs. 0. 86 pgs. 580 pgs. Brihadaranyakopanishad . Buddhist'a T'eksat'a Ashokaa. 1980. Sanskrit. Bruhat Samudrika Sastramu.. Brxhadaarand-ya Kopanishhadabhaashhya Vaara~tikama~ Prathamo Bhaaga Grantha 16.. Buddhist Avadanas. Stcherbatsky... Sanskrit... A list of scanned Sanskrit. Pandit Ramgopal Shastri. 396 pgs. Dr. . Brxhadaarand-yakopanishata~..t. Sanskrit.. 1935. Theology. Religion. 1954. 1954. . Bruhadh Hodachakra vivaranamulu.. Unknown. Sri Krishna Das Satmaj Gangavishnu. Religion. Unknown. Religion. 0. 0. . Sanskrit.. Brahnnighantu Ratnakar Vol I. Sanskrit. 1992.. Brahmavaivara~tapurand-ama~ Dditiiyo Bhaaga Grantha 102.. 385 pgs. 503 pgs. 437 pgs. 926 pgs.. Franklin Edgerton. 225 pgs. . Unknown. Theology.. 600 pgs. Sri Krishnalal Thanaya Datt. Sanskrit. 282 pgs. 214 pgs. Sanskrit.2/14/2011 .. Sanskrit.. 0.. Upanishads. Theology..sharmistha Sharma. 457 pgs. Language. Sanskrit. Sanskrit. Sanskrit. 56 pgs. Sanskrit.

2/14/2011

A list of scanned Sanskrit books ,at III… y g

gy

,

1948. 73 pgs. Budhabhushhand-ama~... Shambhu Shriimada~, Philosophy. Psychology. Sanskrit, 1926. 132 pgs. Budhabhushhnd-ama~... Shriimachchhan'bhunrxpa, Philosophy. Psychology. Sanskrit, 1926. 132 pgs. Bugusamhita Mahashastra Palitha Kanda... , . Sanskrit, 0. 613 pgs. Bugusamhitargata Yogavali... Somraj Krishna Das, . Sanskrit, 0. 343 pgs. Calcutta Sanskrit Series... Pandit Amareswar Thakur, Unknown. Sanskrit, 1934. 830 pgs. Camatkarachandrika Of Visvesvarakavichandra... Dr P Sri Rama Murhy, Unknown. Sanskrit, 1969. 270 pgs. Canakya-caritam... Dr.thakur Prasad Mishra, Unknown. Sanskrit, 1981. 180 pgs. Candravyakarana Of Candragomi... K C Chatterji, Language. Linguistics. Literature. Sanskrit, 1953. 360 pgs. Carudattam Edition I I... C R Devadhar, Unknown. Sanskrit, 1943. 136 pgs. Catalogue Of Sanskrit Pali And Prakrit Books Vol-i... -, Unknown. Sanskrit, 1951. 354 pgs. Catalouge Of Sanskrit Parakrit Manuscripts Vol 3... Muniraja Sri Punyavijayajit, Unknown. Sanskrit, 1968. 368 pgs. Chaitanyachandroday Naam Natakam... Sri Rajendra Lal Mitrena, Unknown. Sanskrit, 0. 294 pgs. Chamatkaar... Dr Krishna Lal, Unknown. Sanskrit, 1985. 112 pgs. Chamatkara Chintamani... bhatta narayana, Unknown. Sanskrit, 1964. 550 pgs. Chanakyasuthram Part 1... Pandit Vijendermisra, Unknown. Sanskrit, 0. 48 pgs. Chandas Sastram... Sri Pingalacahrya, Unknown. Sanskrit, 2002. 321 pgs. Chandha Shastramu... Sri Pingali Nagh, Unknown. Sanskrit, 0. 326 pgs. Chandogya Panisad Bashyam Pradhama Bagamu... Sri Ranga Ramanuja Muni, Unknown. Sanskrit, 1952. 546 pgs. Chandogyopanishad... Sri Ranga Ramanuja Muni, Unknown. Sanskrit, 1952. 596 pgs. Chandologyopanishad... Venkata Subramanyam Sastri.m, Ayurveda. Sanskrit, 1924. 939 pgs. Chandrapeeda Katha... Pandit V Ananthacharya, Unknown. Sanskrit, 1946. 90 pgs. Chandraprabha Charithramu... P.amruthlal Jain, Unknown. Sanskrit, 1954. 34 pgs. Chandrika Sahitha Kuvalayananda... , Religion. Theology. Sanskrit, 0. 328 pgs. Charak Saheta Vol 3... Sri Narendrasen Gupt, Unknown. Sanskrit, 0. 664 pgs. Charaka 1... -, Unknown. Sanskrit, 0. 502 pgs. Charaka 5... -, Unknown. Sanskrit, 0. 626 pgs. Charaka Samhita 3... -, Unknown. Sanskrit, 0. 326 pgs. Charaka Samhita 6... -, Unknown. Sanskrit, 0. 534 pgs. Chaturdashalakshani With Didhiti,didhitiprakashka,vivarana... N.veejhinatha, Indian Logic. Sanskrit, 1997. 867 pgs. Chhaandogyopanishhata~... Upanishhata~, Religion. Theology. Sanskrit, 1952. 549 pgs. Chhaandogyopanishhata~ Grantha 14... Aapat'e Vinaayaka Gand-esha, Religion. Theology. Sanskrit, 1934. 539 pgs. Chhaandogyopanishhata~ Grantha 79... Nityaananda, Religion. Theology. Sanskrit, 1915. 223 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Chhanda Shaastrama~

Chaara~ya Pin'galaa Language Linguistics Literature Sanskrit 1950 272

14/167

2/14/2011

A list of scanned Sanskrit books at III… Chhanda Shaastrama ... Chaara ya Pin galaa, Language. Linguistics. Literature. Sanskrit, 1950. 272 pgs.

Chhatrapatisan'bhaajii Mahaaraaja... Rangand-ekara Keshavaman'gesha, Geography. Biography. History. Sanskrit, 1950. 86 pgs. Chidgagana Chandrika... Kalidas, Unknown. Sanskrit, 0. 208 pgs. Chitra Champu... sriram charan, Unknown. Sanskrit, 0. 146 pgs. Chitra Prabha... Bhagavata Hari Sastri, Unknown. Sanskrit, 1932. 480 pgs. Chitrasenapadmavati Charita... Mulraj Jain, Unknown. Sanskrit, 1942. 98 pgs. Chittavishuddiprakarand-a... Aara~yadeva~, Religion. Theology. Sanskrit, 1949. 147 pgs. Chrak Samhitha Part 2... -, Unknown. Sanskrit, 1950. 568 pgs. Chytanya Nandanam... Nistala Subramanyam, Unknown. Sanskrit, 1987. 170 pgs. Cikitsa Of Srinivasa... sri s venkatasubramanya sastri, Unknown. Sanskrit, 1953. 414 pgs. Cikshasamuccaya... Canti Deva, Unknown. Sanskrit, 1992. 494 pgs. Cola Campu Of Virupaksa... T Chandra Shekaran, Unknown. Sanskrit, 0. 90 pgs. Collected Papers Of Manavalli Ramakrishna Kavi... P S R Appa Rao, Unknown. Sanskrit, 1986. 340 pgs. Critical Study Of Vedarthasangraha... t v raghavacharyulu, Unknown. Sanskrit, 1989. 250 pgs. D'a Had'agevaara Charitra... Paalakara Naaraayand-ahari, Geography. Biography. History. Sanskrit, 1882. 538 pgs. Da Aara~ya Shatakama~... Shriimadappayyadiiqs-ita, Philosophy. Psychology. Sanskrit, 1944. 72 pgs. Da Ethimalojiisa~ Apha~ Yaska... Vara~maa Siddheshvara~vara~maa, Language. Linguistics. Literature. Sanskrit, 1953. 272 pgs. Da Jaataka Maalaa Prathama~ Bhaaga... Aara~ya Kuuraa, Philosophy. Psychology. Sanskrit, 1943. 279 pgs. Da Katuhsataka Dvitiya Bhaaga... Ara~yadeva~, Religion. Theology. Sanskrit, 1931. 344 pgs. Da Mahaabhaarata Sabhaapara~va... Vishhnd-u Esa~ Suktaankara~, Language. Linguistics. Literature. Sanskrit, 1943. 217 pgs. Da Saundarananda... Ashvaghosha, Philosophy. Psychology. Sanskrit, 1928. 200 pgs. Daa. Ketakara Vyaktti Aand-i Vichaara... Ketakara Shriidharavyan'kat'esh, Geography. Biography. History. Sanskrit, 1955. 216 pgs. Daivat Sanhita Vol-3... Sripad Damodar Saatvalekar, Unknown. Sanskrit, 1948. 284 pgs. Daivata San'hita Prathama Bhaaga... Shriipaada Daamodara Saatavad'ekara bhat't'aachara~ya, Religion. Theology. Sanskrit, 1941. 987 pgs. Daivata San'hitaa Bhaaga 2... Saatavalekara Sriipaada Vasan'ta, Religion. Theology. Sanskrit, 1943. 923 pgs. Dandanitiprakaranam... V S Bendrey, Unknown. Sanskrit, 1943. 144 pgs. Daqs-ind-achyaa Mdhyayugiina Itihaasachi sadhane Khan'd'a 2... khera~ Gand-eshaharii, Geography. Biography. History. Sanskrit, 1934. 119 pgs. Dara~sha Puura~nd-a Maasa Prakaasha Prathamo Bhaaga Grantha 93... Daad'ekaro Sarasvatii Bhushhand-a, Religion. Theology. Sanskrit, 1924. 652 pgs. Darsan Ka Prayojan... Bhagvan Das, The History Of Philosophy. Sanskrit, 1987. 312 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Das Gopatha Brahmana

Dieke Gaastra Unknown Sanskrit 1919 360 pgs

15/167

2/14/2011

A list of scanned Sanskrit books at III… Das Gopatha Brahmana... Dieke Gaastra, Unknown. Sanskrit, 1919. 360 pgs.

Das Purana Pancalaksana... Wllibald Kirfel, Unknown. Sanskrit, 1927. 664 pgs. Dasa Charitam... Sri Sailusuri, Unknown. Sanskrit, 1989. 232 pgs. Dasapadyunadivrtti No 81... Dr Mangal Deva Shastri, Unknown. Sanskrit, 1943. 578 pgs. Dashaa Kumaaraa Kathaa Saaraa... Appaayaamatya, General. Sanskrit, 1949. 39 pgs. Dashopanishhada Grantha 106... Maarulakara Shan'kara Shaastrii, Religion. Theology. Sanskrit, 1937. 227 pgs. Dasopanishadas Vol 1... C.kunhan Raja, Unknown. Sanskrit, 1935. 520 pgs. Dasopanishads Vol Ii... The Pandits Of The Adyar Library, Unknown. Sanskrit, 1936. 644 pgs. Dasopanishads Vol-1... C.kunhan Raja, Upanishads. Sanskrit, 1935. 519 pgs. Dasopanishads With The Commentary Of Sri Upanishad-brahma-yogin... C.kunham Raja, Upanishads. Sanskrit, 1936. 518 pgs. Dasopanishads With The Commentary Of Sri Upanishad-brahma-yogin... G. Achari, Art. Sanskrit, 1936. 518 pgs. Dathu Rathnakara... Sri Madwi Jayalavanya Soori, Unknown. Sanskrit, 0. 348 pgs. Dattakamiimaan'saa Grantha 116... Nanda Pand-d'ita, Religion. Theology. Sanskrit, 1954. 379 pgs. Dattapuranam... Swami Vasudevananda Saraswathi, Unknown. Sanskrit, 2004. 736 pgs. Descriptive Catalogue... K.s.ramamurthi, Upanishads. Sanskrit, 1993. 111 pgs. Descriptive Catalogue Of The Government Collections Of Manuscripts Jaina Literature And Philosophy Vol Xvii... Harilal Rasikdas Kapadia, Unknown. Sanskrit, 1954. 330 pgs. Descriptive Catalogue Vol I... Dr.k.s.ramamurthi, Religion. Sanskrit, 1993. 222 pgs. Deshabhakta Krxshhnd-aajii Prabhaakara Uura~pha Kaakaasaheba Khaad'ilakara Charitra... Khaad'ilakara Kaashinaathahari, Geography. Biography. History. Sanskrit, 1949. 428 pgs. Deshabhaktta Saahityasamraat'a Narasin'ha Chin'taamand-a Kelakara Yaan'chyaa Aat'havand-ii... Baapat'a Sa Vi, Geography. Biography. History. Sanskrit, 1945. 680 pgs. Deshii Naama Maalaa Dditiiya Khand-d'a... Hema Chandraa, Religion. Theology. Sanskrit, 1938. 523 pgs. Deshiinaamamaalaa... Hemaachandraa, Language. Linguistics. Literature. Sanskrit, 1938. 525 pgs. Devalaya Grama Mahatmyam... Balachandra Kavishvar, . Sanskrit, 1827. 277 pgs. Devanandamahakavya of Sri Meghavijayopadhyaya... Pandit Bechardas.j. Doshi, Unknown. Sanskrit, 1937. 102 pgs. Devatadhyaya Samhitipanisad Vamsa Brahmanas With Commentaries... Ballikoth Ramachandra Sharma, Unknown. Sanskrit, 1965. 270 pgs. Devatadhyaya Samhitopanisad Vamsa Brahmanas... B Ramachandra Sharma, Unknown. Sanskrit, 1965. 264 pgs. Devendra Mahakavyam... P.bhochardas Jeevraj Desi, Unknown. Sanskrit, 0. 114 pgs. Dhaara~mikavimara~shasamuchchaya... Bhaaratii Svaami Vidyashan'kara, Religion. Theology. Sanskrit, 1944. 237 pgs. Dhaatukoshaa... Shaastrii Baahuballabha, Language. Linguistics. Literature. Sanskrit, 1912. 288 pgs. Dhanyaalokaa... Chaara~ya Aanan'davaradhana, Language. Linguistics. Literature. Sanskrit, 1937. 149 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 16/167

. 1914. Theology.2/14/2011 A list of scanned Sanskrit books at III… Dhara~ma Bin'duu. 1952. Theology. Biography.v. Laxmansastri Joshi. Hari Bhadraa. Dr C Kunhan Raja Presentation Volume. 1937. Unknown.. 463 pgs. Unknown. 415 pgs.. 0. Theology. Dina Visheshha. 1942.bhagiratha Prasada Triputhi Vagisa Sastri. 120 pgs. 1977.. Unknown. Dhavnalokha. Educationas A School Social Factor. Unknown. 1949. 764 pgs. History.. Sanskrit. Dutadangand.. Dravya Gun Vignan Purvardhamu. 1955. Aapat'e Gand-osha Vinaayaka... Khem Raj Krishna Das.. Unknown. M L Jacks. 388 pgs... Sanskrit.. Dura~gaa Pushhpaanj-jali Grantha 22.sastri. Unknown. Unknown. Religion. laxman shastri joshi. Sanskrit. 1950... Vaidy Jadwaji Trikamaji Acharya. Sanskrit. Sanskrit. 232 pgs. Religion. Unknown. Dr Nagendhra. 1952. 1929.. Unknown. Dharmikvimarsamuchya Vol I I. Dhavnyaloksar. 424 pgs. 86 pgs.. Sanskrit. Unknown... Charandas Shastry. Unknown.. 76 pgs. Dhwanyalok Rahasyam Prashnouttari. Sanskrit.. Dr.... Unknown.. Draahmaayand-a Grxhma Suutravrxtti Grantha 74. Thakur Udaya Narayana Singh. Unknown. Sanskrit.. Sanskrit.. sanskritdocuments. Sanskrit. 1935. 109 pgs... 320 pgs. Pandith Marulkaropahvanar Hari Shastry. 552 pgs. Unknown. 145 pgs. Theology. Sanskrit. Sanskrit. Late Munichaturvijayaji. K. 216 pgs. N G Kalelkar. 1980.. Dhvani Vicara. Sri Purshoutam Sharma Chaturvedi. 117 pgs. 1941. Theology.. 1954. laxmanshastri joshi. 0. 528 pgs. Sanskrit. Dhara~matattvanind-ra~ya Parishishht'ama~ Bhaaga 2. 1954.org/…/SanskritIIIT. 1953. Unknown. Dharmakosa Upanisatkanda Vol 2 Part 2. Religion. Religion.. Sanskrit. 1937. 1950... Dharmakosa Vyavaharakhanda. Pandith Sri Shobhit Mishra.. Drahyana Grihya Sutra. Religion. Khemraj Shri Krishnadas. Sanskrit.. 294 pgs. 146 pgs.. 674 pgs... Sanskrit. Sanskrit. Sanskrit.. Dhathuratnakarah Shasthi Vibhagah. 860 pgs. pandit feroz phamaji.. Unknown. Lelegan'gadhara~ Vinaayaka~. 56 pgs. Gokhale.. 0.. Geography. Dhaturupa Manjari. 1950. 182 pgs. Docrichikitsarnava. Unknown. Sanskrit. Laxmana Shastri Joshi... Sanskrit. 0.. Sanskrit. 544 pgs. 167 pgs. Theology.. Dvadashan' Pushhpama~.… 17/167 .. Unknown. -. 1946. Dhara~matattvanind-ara~ya Prathamaa Bhaaga 1. Dura~daivii Mohare. 214 pgs. Geography. Biography. History.. Sanskrit.. 1940. 2001. Sanskrit. Sr Madananthram Shastry Vetalen. Ddivedii Dura~ga Prasaada. 211 pgs. 1935. 1872. Sanskrit. Dharma Kosah Vyavaharakanda Vyavaharamatrka Vol 1 Part 1. Dhaturoop Sangraha. Religion. 156 pgs.l..... 212 pgs.. Dvadasaranaya Chakra Of Sri Mallavadisuri Vol 1. Sanskrit. Sanskrit. Sanskrit.. Joshii Prahlaadanarahara. Shriivasudevaanan'da~. 166 pgs. 352 pgs.. 0. Dilkush Untasdi Gayaki Prathama Bhag. Dharmakosa Upanisatkanda Volume 2 Part 4. Unknown. Dharmasindhu. 0.. Unknown.. Sanskrit. Unknown. vadilal bapulal shah. Unknown. Aapat'e Gand-osha Vinaayaka. Sanskrit.. Dhatvarthavijnanam.. Sanskrit.

Unknown. 561 pgs. 1992. Garuda Maha Puranam Of Sri Vedavyasa Mahamuni.. 1968. 226 pgs. 702 pgs.. Sanskrit. Gandavyuhasutra. 2001.r... 1975. Gaud'ayaada. 1968. Language. -. Sanskrit. Sanskrit. Gand-adara~pand-a Shhashht'ha San'skarand-ama~.. Ganatiya Kosh. Sanskrit.. Language. mahadeva deshiah. Sanskrit. 100 pgs. Unknown. Gajasiksa. P L Vaidya. Geography.. Linguistics. Eethi Sriskande Mahapuranam Prabhaskhand.. 1987... Raamataarand-a. Unknown. -.padmanabhachrya Chitaguppa. Philosophy. 1975. Dr. Gadhy Padhy Mala Chaturth Kusumam Vol I. Sanskrit. 0. First Lesson In Sanskrit.. Unknown. Sanskrit. Gaekwad's Oriental Series.. Unknown.. S. E. Biography. 116 pgs.... 96 pgs. subrahmanya sastri k s. 1958. -. Unknown. Gaadadhari Vol Ii. sanskritdocuments. Unknown. 348 pgs. Narayana Dikshita. 1939. Gand-ikaa Vrxtta San'grah Khand-d'a 1 Grantha Maalaa 4. Sanskrit. 177 pgs..j. Ganesa Purana. Sanskrit. 82 pgs. Sternbach Ludwik. 1933. Unknown.. Sanskrit. . Unknown..r. History. Religion. Sanskrit... 78 pgs.. Unknown. Sree Krishna Sarma E. 1084 pgs... 490 pgs.. 1920.. 0. Gandhi Gita... Sanskrit. Sanskrit.. 1916. Sanskrit. 470 pgs. 707 pgs. Sanskrit. Gaja saastram of paalakapya muni.. 1954. Unknown. Bhattacharya. Language. Gajagrahana Prakasa...V I I I. 1960.brej Mohan.. Eeshopanishanthu.. 0. Unknown. 1981. 0. Pandit Kedaranatha Sastri. Dr.. Ekavali Of Vidhydahra.. 152 pgs. Sanskrit. Krishana Gi Parisharam Bide. 1953.. 542 pgs. 1937. Ganitatilaka. Esevyopanishad Bhashyam. 0. Somraj Krishna Das. 383 pgs. 94 pgs. Sanskrit. P. Sanskrit. Gangavaratana. Sanskrit. Dr..... Unknown. Unknown. Tantras.org/…/SanskritIIIT.sreekrishna sarma. 206 pgs.. 96 pgs. 1867.. Sanskrit. Gand-akaarikaa. 214 pgs. Linguistics. 2000... Gajasiksha..ballantyne. Sripati.n. 2004. Unknown. Sampurnanand. Bhasara~vajnaa Aacharaya~. Gajasiksa. Gautamiyamahatantram. 490 pgs. 90 pgs. Theology.. Sanskrit. T.2/14/2011 A list of scanned Sanskrit books at III… Eeshavasya Upanishad I. Sanskrit.… 18/167 .. Sanskrit.tadpatrikar.ramaji Malaviya.. . Gatagoshha~t'i Arathata~ maajhii Jiivana Yaatraa. Sanskrit. Sanskrit. Dr P Sriram Chandrudu. Linguistics. Literature. Unknown. Unknown. 106 pgs. 534 pgs.. Unknown. naradamuni.. Srimath Paramhans Parivrajakar Chary Brahmanisht Loksangrahi.. Gananeshwari. Unknown. Sanskrit. Exercises in sanskrit translation. 1949. Sanskrit. 253 pgs. Unknown. Theology.... 1801. 670 pgs. Literature. 0. Sanskrit. Kelakara Chin' Na. 1920. Sanskrit. Ganesh. 130 pgs. Sanskrit.. Gaud'apaadoyama~ Aagamashaastrama~.. 1975. Veeraragava Achariya. 1950. 140 pgs... Literature.r.k ramachandra aiyar. Psychology. 418 pgs... Unknown. Sanskrit. Religion. Garuda Puranam. Social Sciences. 360 pgs..

. Unknown. 1941. Golaadhyaaya Uttarara~dharupo Da~tiiyo Bhaaga. Sanskrit.. Dattatrey Venkateshwar Kettar.. . Gudhartha Dipika. Gopala Sahasranama Stotram.r. Gochar Aur Asthakavarga. 100 pgs. 219 pgs. Unknown. 1927.. S B Valankar.. 1971.. Unknown.. Nalinaksha Dutt. -. Gramegeya Ganamatk. Geetharthsangraharsha Geetabhashytathparyachandrikach. Sanskrit. Unknown.tatacharya. Unknown.. 1939. 1941. Sanskrit. 1990. Unknown. Gilgit Manuscripts Vol Iii Part Ii. Theology. 383 pgs. Bhaaskaraachara~yaa Shrii.. 1942. Unknown.. 244 pgs. 284 pgs. 0. 256 pgs. 1934. Gilgit Manuscripts Vol I. Dr Nalinaksha Dutt.. Goldavyaprashnavimarsh.. Sanskrit. Sanskrit... Sanskrit.. Geetageervanam. Krishna Yajurved.. Geethopadesa. 1983. Sanskrit. Sanskrit. Unknown.... 126 pgs. Sanskrit. Sanskrit. 1990. Sanskrit.. Unknown. 512 pgs. Gruha Vidhan.. 1935. Sanskrit.. Religion.. Unknown.org/…/SanskritIIIT.. 1934. 320 pgs. 1948. 890 pgs. Gudharthatattvaloka A Commemtary On Samanyanirukti Gadadiiari. K. 360 pgs. Aacharya baskaranand lohini.. Unknown. Sanskrit. 1943. 1941. 1972. Sanskrit. Mohan Lal. Gangadar Bapurao Kale.. 1942. Sharma.m.. 507 pgs. Gitagovinda Of Jayadeva. Gopath Brahmana Of Atharva Veda. 316 pgs. Sanskrit. Aara~muni Pand-d'ita~. Gilgit Manuscripts Vol Iii. Dr. 186 pgs. Rajendra lal Mithra. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Geeta Vignana . Religion. 1932.. Unknown.. Dhanapati Suri... Sanskrit.... Glimpses Of Buddhist Culture In India.. Unknown. Sanskrit. Unknown. V Subramaniam. Unknown.. Dr. Sanskrit. A. 66 pgs. Sanskrit. Sanskrit. Narayana Ram Acharya. Sanskrit. 452 pgs.n. 100 pgs... Unknown. 1952. 1924. Unknown. Religion. 1908. Sanskrit.aryendra Sharma.. Graganithadyaya.s... Anil Varan Roy. 200 pgs. Gilgit Manuscripts Vol Iii Part 3. 0.. Gitagovinda Mahakavyam. Sanskrit. Unknown.. 0. Goladyay Dwithiya Bagam. Sanskrit. 1943. Dr.. Sanskrit.. E R Sreekrishna Sarma.. Religion.. Theology. 338 pgs. 116 pgs. Gitagovinda Of Jayadeva With Commentary Of Laksmidara. 178 pgs.Bhashya..sampath Kumara Charya.. Gita Samiksa. Unknown. 532 pgs.nalinaksha Dutt. 246 pgs. 1969. Gommatasara Karma Kandah. Sanskrit. Grihya Sutras Of Varah.. Religion.. Unknown.… Religion Theology Sanskrit 0 1049 pgs 19/167 . Guruparampara Charita With Comm sanskritdocuments. Unknown. 1952. 1939.. Gomileeygruhakarmaprakashika. Sanskrit. k s ramamurty. Sanskrit. 186 pgs. 253 pgs.. 1946.. Religion. Religion. Giitaayogapradipaara~yyabhaashhya. Nalinaksha Dutt.s. Religion. Sanskrit. Geetha Dharm Chandogyaupanishad Vol Ii. Sanskrit. Gilgit Manuscripts Vol Ii. Sanskrit. Ramamurthi. Gitagovinda Kavyam. Gilgit Manuscripts Vol I I I Part I I I. Unknown.. 1985. 1972... Sanskrit. 322 pgs.. 132 pgs.l... Theology.. veerendrarai chandra shankar mehatha. Pandit S'ri Lakshminatha Tha. 184 pgs. 338 pgs. 322 pgs. Nalinaksha Dutt. Subhramanyamvidhusha. 247 pgs.. Sri Math Paramhans Parivrajakarchary Brahmanisht Lok Sangrahi. 0. Dr Nalinaksha Dutt. Narayan... 174 pgs.

.. Sanskrit.. Geography. Sanskrit. Harshacharita Sara.. Unknown. 1896. Bal Govind Jha.. Jaya Bharati. 0. 1960. Unknown. Theology. Hemaadra Uura~pha Hemaad'apan'ta Yaachen' Charitra. Sanskrit. Durgaprasada amp Kasinath Pandurang Parab. Hatopadesha.. Psychology. 67 pgs. Philosophy.. Geography. Religion.... Gyaariibaald'ii. 104 pgs.. Bodhendrasarasvati.. . R. Hashacharitha Sangraha. Piit'ara~sana~ Piit'ara~..y. Philosophy... 1954. 98 pgs.. Haridiiqs-itakrxtaa Brahmasutravrxtti. Shriijagadiishhvarabhat't'aachaara~ya. 0. Pandit V Ananthachary. 120 pgs. Religion. Theology. History. 743 pgs. Sanskrit..k. 199 pgs.. Hari Naaraayand-a Aapat'e Charitra Va Vaang-a~mayavivechana..m. Tryambaka Makhin. Sanskrit. Sanskrit. 0.. Unknown. Sanskrit. Biography. 115 pgs. 1922. 1994. Religion. 1957.sri. Sanskrit...dhorasamaiah. Sanskrit. 1939. Hariharaaddaitabhuushhand-ama~.. 254 pgs.. Ram Swaroop Sharma. 1948.. Jai Shankar Joshi. Sanskrit. Religion. 167 pgs.. Vopadeva. Sanskrit. Religion. Sanskrit... 1948. 0 pgs.. 0. Sanskrit. Unknown. Durgaprasada amp Kasinath Pandurang Parab. Psychology. 556 pgs. Hasya And Prahasana A Critical Study.. 93 pgs.. 96 pgs.. Sanskrit. 1964. Theology. Theology. Harshacharitha Sangraha. Sanskrit. Dr Suram Srinivasulu. Religion. Sanskrit. Theology. 113 pgs. Unknown. 249 pgs. 1920.. Literature. 763 pgs. 308 pgs.. Haasyaara~nd-avaprahasanama~. 1909... Haricharita. 1999. Jaya Shankar Joshi. Halayudh Kosha. 153 pgs. Sanskrit. 1948. 238 pgs.. Sanskrit. Sanskrit. 383 pgs. The Arts. Bi h Hi t S k it 1939 500 sanskritdocuments. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Guruparampara Charita With Comm. Guruvamsha Mahakavyam. Hara Naaraayand-a Aapat'e Yaan'chen' San'qsipta Charitra. Unknown. Subrahmanya Shastri. Sanskrit. Gulab Chand. C Sankara Rama Sastri.. 764 pgs.. Harshacharita Ek Samskrutika Adhyayana. Unknown.p. Haribhadra Suri Grantha Sangrahah.. Sanskrit. 1879. 1931. Gurvarthadipika. 1952. Haravijayam Of Rajanaka Ratnakara. Harmakutam Sundarakanda. Unknown. Kelakara Narasin'hachin'taamand-a. Haimsa phrama~ Da Rxgvedaa. Literature. Literature. Unknown. 590 pgs. 0. Unknown. Sanskrit. Biography. 1958.org/…/SanskritIIIT. Harsha Charitam. Krishnamacharya. Unknown. Sanskrit. Sanskrit. Geography.. Harivan'shaachii Bakhara..v Krishnamachariar. Sanskrit. Hanumannnatak. pgs.. Harshacharitha Sangraha. Hari Charitra. O.. Hariliilaa Nan' 3. 0 pgs. 305 pgs. Haricharita. Unknown. 1917. 419 pgs.. Theology. 1850..… 20/167 . History. Haricarita By Paramesvara Batta... Paramesvara Bhatta... Shri Dhanya Kumari.. 1945. 1989. 1049 pgs... Haricharita. Sanskrit.. Theology. Sanskrit. Mahadevaiah K. . Religion. Parameswara Bhatta. Sanskrit. 144 pgs. 261 pgs. Haridiiqs-ita. Religion. Aappaapaadydhye Keshava~.. 1982. 1948...... 146 pgs. 166 pgs. Halayudhkosh Abhidhanratnamala.. Sanskrit. Vaamanashaastriikhare Vasudeva. Sanskrit. Paanase Venubaaii. Religion. Aan'bekara baapujiimaara~tan'd'a.. Religion... Sanskrit. Vasudevasaran Agarwal. 1948. 139 pgs.. 1917.. The Arts. Harshacharita The Fifth Ucchhvasa. Sri vadiraja Tirtha. 1951.

Unknown. Unknown... Iishaavaasyopanishhada~. Sanskrit. Psychology. Unknown. Intermediat Patchabagh. Iishrvarapratyabhijnaavivrxtivimara~shinii Trxtiya Bhaaga. Ishvara Pratyabhijna Vimarshini Of Utpaladeva. -. Sanskrit. 168 pgs.. 1941. Deva Utpala. 457 pgs. Govinda Das. 1943. Sanskrit. 1921. Sanskrit... Religion. Sanskrit. Iishrvarapratyabhijnaavivrxtivimara~shini.. 120 pgs. Theology. Sanskrit. Religion.. Influence Of Kalidasa On Harshavardhana.. 1930. 1925. G V Devasthali. Arthasasthra Visarada. Index Verborum Part Iii. Pandit Sukhlaji Sanghavi. 354 pgs. Sanskrit. Theology. 1953. 1948. Theology. Unknown. Unknown.. 161 pgs.. Intermediate Sanskrith Selections. Sanskrit. Sanskrit. Hitopdesh. Unknown.. Hetubindutika Of Butta Arcata. 78 pgs... Sanskrit. Sanskrit... 100 pgs.. Theology. Introduction To Kayachikitsa... Iishaavaasyopanishhata~ Grantha 5. P V Kale. 0. 360 pgs. 2002. History. 354 pgs. 423 pgs. 1949. 1949. 632 pgs. Dr Jatindra Bimal Chaudhuri. Unknown. 1930.... Gupta Mada Abhinava. Theology. 1934.. 258 pgs.. Unknown. Unknown... Sanskrit. Kiranvalli. Sanskrit. Unknown. 0. Theology.. Sanskrit. Introduction To The Study Of Mudra Raksasa. Raghu Vira... Sanskrit. 1924. Unknown. 1949.. Hetubhindut'hiikaa... Religion. Sri Madhusudan Sharma. Iishvara Pratyabhi Nj-aavivrxti Vimara~shinii Prathamo Bhaaga Grantha 60. 1951. Intermediate Sanskrit First Year. 1921.... 192 pgs... 520 pgs. Unknown. 1939. 274 pgs. Sri Krishnavallabha Charya. Indian Scientific Nomenclature Of Birds Of India Burma And Ceylon Vol X X. Religion.. Theology. Unknown. 470 pgs.... Introduction To The Study Of Mrcchakatika. Unknown... Unknown. Gupta Abhinava. Dr R Shama Shastry. 500 pgs. Bhin'd'a Sadaashivashaastrii.. Index Verborum Part Ii. 1990. Theology.… 21/167 . Unknown. 1942. Sanskrit.. 1969. Religion. Sanskrit. Pt. H M Lambert. 132 pgs. 530 pgs. R Shama Shastri... Sanskrit. Religion. C Dwarakanatha. 1986.. N Padmavathy. sanskritdocuments.org/…/SanskritIIIT..hargovind Shastry. Sanskrit. 454 pgs. Bhat't'a Aara~ya. Theology.. Sanskrit.. G V Devasthali. Suniti Kumar Chatterji. 0. Index Verborum Part 1. Gupta Abhinava. Unknown. 1953. 1938. Indravijay. Shan'karaananda. Philosophy. Hinduism. 1953. i srinivasa rao... Unknown. 1938. Unknown.. Sanskrit.. 1918. Deva Utpala.. Sanskrit. 134 pgs. 323 pgs. Sanskrit. Religion.. Hymns From The Rgveda. Peterson Peter. Sanskrit. 176 pgs.. G V Devasthali.. 1986. Sanskrit. History Of The Duta Kavyas Of Bengal. 1925. Unknown. Sanskrit. 197 pgs. Iishvarapratyabhinj-aa Dditiiyo Bhaaga Grantha 33. Sanskrit. Sanskrit. Introduction To The Devanagari Script. 436 pgs. Unknown.. Religion. 290 pgs. Hitopdesh Suharbudedh. Sanskrit. 457 pgs..2/14/2011 A list of scanned Sanskrit books at III… Biography. Iishvara Pratyabhinj-aa Prathamo Bhaaga Grantha 22. 466 pgs. Indo Aryan And Hindi. 105 pgs. Sanskrit. 515 pgs. 90 pgs. 302 pgs. Mukunda Rama Shastri. Sanskrit. History Of Sanskrit Poetics.. 1973. Religion. Sanskrit.. Hitopdesh Mitrlabh.

Theology. 1950. Sanskrit.. 1980. Bellikoth Ramchandra Sharma. Unknown. Acahrya Jinvijay Muni. Sanskrit. Theology. 305 pgs.... V. 1952. 1922. Jagadruru Sri Sacchidananda Sivabhinava Nrisimhabarathi Vijayakavya. 1950. Literature. Sanskrit. 171 pgs... 1947. Linguistics. Literature... 0. Biography. 76 pgs. Sanskrit. Panditharinarayansharmami.... Geography. 0. Sharma. 1904. 1969. Itihasah Shaastra Va Tattvajnj-aana. Ramakrisha Kavi..r... 714 pgs.. Linguistics Literature. Jataka Parijata Adhyayas 11-15. Sanskrit. Sanskrit. 178 pgs. Sanskrit. Theology.. Javaahara~lala~ Neharu Aatmacharitra. Unknown. Religion. 1951.. Sanskrit.. Bhiqs-u Dhara~maraqs-ita. 1950. 248 pgs. Sanskrit.. Sanskrit. Jathaka Baranamu. Sanskrit. Geography... Gandesha~gore Naaraayand-a. Jaipur Ki Saskrith Sahitya Ko Daen. 0. Sanskrit. Sanskrit.. Muura~tii Vijaya. sanskritdocuments.. 524 pgs. Unknown. Unknown. Religion.. Tripitakacharya Bhikshu Dharma Rakshit. B. Sanskrit. Sanskrit. 170 pgs. Janasrayi. Vacant. Language. Jaminiya Arseya jaiminiya Upanishad Brahmanas. Devanandimunii. Dr Prabhakar Shastry. Jaiminiiya Braahmand-an' Dditiiye Kaand-d'e. Literature. 81 pgs. Theology. 0. 1956. 342 pgs. Unknown. Gupte Ke Esa~. Religion. Sanskrit. 0. 1920. . 146 pgs. Jathaka Bharanam.. Jambu Chariyam Number Xxxxiv. Acharya.. Jaathakadesha Margaha Chandrika.. Language. Jaiminiya Brahmana Of The Samaveda. Sanskrit. 145 pgs.. 446 pgs.. Religion. Sanskrit. Jainadara~shanasaara. Kalaan'da Vi. Lokeshachandrend-a. Dr B Ramaraju.. 1954. 1984. Linguistics. .. Jathaka Baranamu. 1934. Sanskrit. 406 pgs. 1951. Sanskrit. Sanskrit. Achyatananda.. 408 pgs. Bhikshu Dharm Rakshit. 0. 582 pgs. Linguistics. Theology..… 22/167 .. Pullagummi Venkatacharyulu.. 175 pgs. Daivajana Vaidyanatha.2/14/2011 A list of scanned Sanskrit books at III… Isvasyopanished Asyam. Mallinathana Si Esa. Jambhavati Parinayam... 247 pgs. Sanskrit. Jaatakapaarijaata. Unknown. Jainashiilaa Lekha San'grah Dditiiyo Bhaaga. Sanskrit.. Sanskrit. Unknown. 333 pgs..... 1933. 538 pgs. 344 pgs.org/…/SanskritIIIT. 442 pgs. Linguistics Literature. Jaimani Sutra Vritti Subhodini Namika. Raghuvira.m. 940 pgs. Unknown.. Unknown.. Astrology.. 296 pgs. Sanskrit.. 536 pgs. Unknown.r. Jaiminiya Arseya Jaiminiya Upanishad Brahmanas. gopesh kumar ahoja. Jaiminigrxhmasuutrama~. 0.. 1984. Language.. Subramanya Sastri. 414 pgs.. Jainendravyaakarand-ama~. Jatakattha Katha. Religion. 1982. V. Religion. Sanskrit. Unknown. Jaisinhakalpadrumah Dharmashstragranth 1. shambhunath tripathi. Unknown. History. Jaiminiya Brahmana of the Samaveda. Sanskrit. Theology. Sanskrit.. 568 pgs. Unknown. 455 pgs. Sri Vallabhacharya.. 0.. Jathakat'a~t'hakathaa Prathama Bhaaga. Unknown. Jatakatthakatha Vol I.. 105 pgs. Sanskrit.. Mahopadesaka S Rajavallabha Sastrigal. Biography.. Jagadish Anumitha Grandhah. Unknown.. Jainendra Mahavritti Of Shri Abhayanandi. Jalabheda.... brahmachari sarveswaranand. 1937. Raghu Veera. Sanskrit. 1944. Unknown... 1951.. 350 pgs.

Kaalidaasa. 1976. 576 pgs. Sanskrit. Pandit dayashanleareupadhyaya. Jinasahasranaama. Linguistics. Language.. Sanskrit. Hari Damodar Velankar. Kaasyapagnaanakandaha. 1936. Unknown. Jayasri Grandhavali... 1952. 0. Shriidhashaastrii Pan'd'ita.. Balasharma. 134 pgs. 142 pgs. Sanskrit. Kaarikaavalii Mukttaavaliida~vitiiyan' San'skarand-ama~.. 1951. Sanskrit. R.. 1975. Rajanadh Sarma. Sanskrit. Religion. Unknown. Literature. Sanskrit. M. Jnaneshwari. 216 pgs. Literature. Jeevandhara Champuh. 1131 pgs. Kaadambariikalyaand-an' Naat'akama~. Literature. Jyothishshamasangraha Jaathakbhag. shyam lal.b. Sanskrit. Chakravara~tii Chan'draa. Unknown. 1921.. Kaalidaasiiyama~ Rxtusan'haarand-ama~ Da~vitiiyo Granthaa. Theology.. Philosophy. Theology. Kaalamaadhava. -. Kaat'hakagrxhyasutrama~ Bhaashhyatrayasarasutama~. 304 pgs.. Sanskrit. 1076 pgs. Iishvara~ Proktama~. Linguistics.. 736 pgs.. 0. -. Unknown. 141 pgs. 488 pgs. Sanskrit.. 1867.. Kaashikaavivarand-apanj-jikaa Prathama Bhaaga... Jayapoorva Bhavamu. Unknown. Sanskrit. Unknown. 188 pgs. 0. Kaashi Kaa Vivarand-a Panj-jikaa Vol Ii Part I. Geography. Jnaanaara~nd-avatantrama~. 714 pgs.. 563 pgs.. Kaat'hakopanishhata~. Language. Jayadevacharitram. Religion. Religion. 643 pgs. 264 pgs.. Ram Chandra Narayan Velingkar. 1944... 694 pgs. 1929. 1947. G Laxmi Kantaiah. Jitante Stotram. Literature. Religion.. Language. Sanskrit.. Sanskrit. History.. Literature. Sanskrit. Linguistics... Religion...2/14/2011 A list of scanned Sanskrit books at III… History. Theology. 264 pgs. Linguistics. 1919.. 1954. 1934. Kavii Narasin'ha.. Unknown... Unknown. 1944.. 217 pgs. 1947. Jyaneswarinche Shabda Bhandar. 349 pgs. 64 pgs. 416 pgs. Sanskrit. 56 pgs..… 23/167 ... 545 pgs. Sanskrit. 88 pgs.. 408 pgs. Parthasarathy Battacharya. 772 pgs.. 623 pgs.. Shriibaand-abhaat't'aa Mahaakavii. Kaadambarii Shhashht'a Vrxtti. Sanskrit. Sanskrit. 0. Sanskrit. Sanskrit. 1995. Aashaadhara Pand-d'ita. Theology. 1913. 1925. Ramchandra Kesava Bhagwat.. Philosophy.. Miraashii Vaasudevavishhnd-u. Sanskrit.duraiswami Aiyangar.. Kaalidaasa.org/…/SanskritIIIT.. 314 pgs. Theology. Jeevanandanamu... Jotisha prasna phala ganana. Unknown.. Sanskrit. Language.. 1959..... Psychology. Sanskrit. Jivanandanam. Linguistics.. Buddhi Jinendra. Bhat't'aachaara~ya. Vilomakaaland-d'a Shriidakt'ara~. Religion. Jinaratnakosa Vol I. Sanskrit. Linguistics. Pandit Pannalal Jain Sahitya Charya. Literature. Sanskrit.. Unknown. Sanskrit. Kaashi Kaa Vivarand-a Panj-jikaa Khand-d'a 3.. Chaara~ya Maadhava. Linguistics. Biography.. Pandit Narayan Datta Vaidy. 0. Sarasvatihrdayalankara. Literature. Sanskrit. 1909. 0. Sanskrit. 247 pgs. Unknown. Journal Of Sri Venkateswara Orintal Institute Tiruoathi Vol 2. Language. Language. Jigyansadhikarnpoorvapaksh.. Language.. Literature. 1925. Buddhi Jinendra. K t'h k i hh t Ch t thi k tti V d Phil h P h l sanskritdocuments. 1948. 1954. Sanskrit. Sanskrit.

Sanskrit.. Kalidasa's Kumarasambhavam (cantos I-vii). Unknown. 175 pgs. 1972. Unknown. 1986. Linguistics.. 606 pgs.. 1932. Linguistics. Durgaprasada~ Pandita~. 160 pgs. 240 pgs.. 1926.. Dr M Srimannarayana Murti. Sanskrit. Unknown. Unknown. Kaavyamaalaa Da~tiiyao Guchchhaka. Kaavyaadara~sha.. 143 pgs. Sanskrit. Kalaamruthamu. Unknown. Sanskrit. Sri Paramanandaji. Theology. Literature... Madhava Charya.. Sanskrit. K S Rama Swami Sastri. 1938.... 1935. 0. Kadhambari Purvabaga Part 2. 0. Kaavya Prakaasha 15. Sanskrit..Purva Bagha. 389 pgs. Kasinatha Panduranga Parab. Kaavyamaalaa Saptamo Guchchhaka. 1939... Geography. Unknown.. Sanskrit.. Literature. 108 pgs. Philosophy.. 0.. Language. Linguistics. Linguistics. 300 pgs. 352 pgs. Raajashekhara Kaviraajaa.... Technology. 282 pgs.. Religion. Linguistics Literature.. 715 pgs. Sanskrit....org/…/SanskritIIIT. Linguistics. 1954.. Language. 1931... Kaavyaprakaashakhand-d'ana. 0. Sanskrit. Kabeer Manshur. Sanskrit. Kalidasa Sahitya Evam Vadana Kala. 1914..2/14/2011 A list of scanned Sanskrit books at III… Kaat'hakopanishhata~ Chatura~thiyamang-kanaavrxtti.r... Raajashekhara Kaviraajaa. Sanskrit.. S. Sanskrit... Psychology. Vyasadevena... 363 pgs. Sanskrit. Philosophy. Kakolutikeeyamu.. Literature. 377 pgs. Sanskrit. Durgaprasada~ Pandita~. Kaavyamiimaan'saa Prathama San'skarand-ama~. 1992. Linguistics Literature. Kalatattvakosa. Sanskrit. Sanskrit. Sanskrit. Kalidasa Vol Ii. 147 pgs. Linguistics.. 290 pgs. Sreemannarayanamurthy. Sin'h Satyavrata. 412 pgs. 126 pgs. Sanskrit.. 176 pgs. Language. 510 pgs. Sanskrit. 1936. Ara~hadhaasii.. 1955. Sanskrit.. Kalpa Kalkika. History. Dr Sushma Kulshreshtha. Unknown. 207 pgs. 1935.. Biography. 1993. History. History. 1959. Raajashekhara Kaviraaja. Unknown. Siddhichandragand-i. Kaavyamaalaa Shashht'ho Guchchhaka. Dand-d'i Aachaara~yaa. kapila vatsyayan..sehgal. 172 pgs. 1952. Kaat'hakopanishhata~ Grantha 7.. Geography.. Kala Madhav.. Kainkaryaratnavali Of Paravastu Krsnamacaharya. 1955. Technology. Sanskrit. Language. Geography. 114 pgs. Language. Unknown. Sanskrit. Literature. S Suryanarayan Shastry.. Kalapoornoday. Language. Kadambari . Kalpadrukosa Of Kesava Vol I Ramavatara Sarma Unknown Sanskrit 1928 564 pgs sanskritdocuments. Shriimaanatung-gaachaaraya. Sanskrit.... Kaavyaratnan. 1958. Sanskrit. 254 pgs.. Kaavyamiimaan'saa. Sanskrit. Psychology. Aapat'e Mahaadeva Chimand-a. 212 pgs. 1993. Unknown. 1934. 1937. Social Sciences. Harihara Kripala Dwivedi.… 24/167 . Literature. Sanskrit. 156 pgs. Kaavyamaalaa Dvadasho Guchchhaka. -. Sanskrit. Literature. 1954.. 1930. Biography. 376 pgs. Shaastrii Shriivasudeva. Sanskrit.. Kaayaparishuddhi. Parushuraamachin'chaalakara Dattatraya. 1953... Kainkaryaratnavali. 140 pgs. Kaavyamiimaan'saa Aalochanaa Nibandha. 1394 pgs. Literature. Sri Vishnu Sharma. Dura~gaaprasada~ Pand-d'ita.. -. Biography. Literature. 280 pgs. Kai Govin'dasuta Ura~fa Parushuraama Govin'da Chin'chaalakara. Sanskrit.

Unknown. Unknown... 674 pgs.. 0. Unknown. Karak Darshanamu.. Kalyan Sankhya-i. Sanskrit.. 176 pgs.patrusarthi Bhatta Charya.. 140 pgs. Unknown. 1937.2/14/2011 A list of scanned Sanskrit books at III… Kalpadrukosa Of Kesava Vol I. Kamalavilasabhana.. 0. R.... Kalyan Sanshikpt Skand Puranam. Sanskrit...b. Unknown. Bhattacharyen Sripad Sharmana Damodar Bhattsununa. 192 pgs. Sanskrit.. Kashyapgyaankanda.. Kamakunjalata. Sanskrit. Unknown. Kalpasutra(subhodhika Vyakya).. 148 pgs. 1932. 1175 pgs.. 306 pgs. Sanskrit. Krishna Das Gupta.. Sanskrit.. 231 pgs. -. 1976. Literature.. 234 pgs. 307 pgs. Sanskrit. Sri Kalanath Jha. 0. 558 pgs.. Karaka Mimamsa. 90 pgs. Sanskrit. Language. Sanskrit.. Kalyan.. 462 pgs. Unknown. Sanskrit. Unknown. 564 pgs. Panditraj Dhunddhiraja Sastri.. Sanskrit. Kaniviya Anthyashti Padhathi. Kalpadrukosha Da~vitiiya Bhaaga. Dr. Sanskrit. 1927.. Unknown. -. The Arts. Unknown. -. 0. Kanakaamara Munii. Srikanth Sharma. Kapphinabhyudaya. Unknown.org/…/SanskritIIIT.. 1915. Sanskrit. 1971. 906 pgs.. 1960. 1934. 1969. Kalyana Sancheka. 240 pgs. Badlikar Sriyeag Raghavrisurisununa. Sanskrit.. Kalyaanamaalla Anan'garan'gama~. Sanskrit.. Sanskrit. Sanskrit. Unknown. Indian Astrology. Sanskrit. Karanaprakasa.. 1948. Gauri Shankar. Sanskrit. sanskritdocuments. Unknown.. Bapuharshet Devalekar. Unknown. 412 pgs. Unknown... 268 pgs. Kashyagnanakandah. 216 pgs. Gunabhadracharya. Sanskrit. Unknown. Sanskrit. 395 pgs. 370 pgs. Sanskrit.. 30 pgs.. Unknown. Hanumanprasad Pohar... Karmakanda Karmavali. Sanskrit. Sanskrit.. Vamana. Kanva Sanhita. Language. 1928... 313 pgs. Sanskrit. Sanskrit. Narayana Kavi. Unknown. Kara~maviira Bhaauuraava Paat'iila Charitra Va Kara~ya. 1991. Kalpalataviveka By An Anonymous Author. 240 pgs. Religion... Geography.. Linguistics Literature. Kartika Masa Mahatmyam.. Murari Lal Nagar.. Linguistics. Hanuman Prasad. Sanskrit..... Unknown.. 112 pgs. Indian Astrology. 0. Motilal Joshi. Unknown. Linguistics. 207 pgs. Linguistics Literature.. Technology.. Hanuman Prasad Pothar.. Kesava. 1860. 294 pgs. History. 782 pgs. Kalyaanamaalla Mahaakavi.. Kalpadrukosa Of Kesava Vol I I... Pardha Saradhi Battacharya. 1915. Sanskrit. Sanskrit. . Biography. Sri Somashambhu. Karana Kutuhalam Of Sri Bhaskaracharya. Unknown. Kalyan Markandeya Puranam. 0. 760 pgs.. Sanskrit.satyendra Mishra. 1958.. 1942. 234 pgs.. Sanskrit. Sanskrit. Literature. Kashyapajnana Khandah. Unknown. Sanskrit. 100 pgs. 0. Kashyapa Mahaara~shhi. Sanskrit. 1967.. Kashika Part 3. 1926. Somasnambhu.. Unknown. Parthasaradhi Bhattarcharya.. 1947. 0.. 0.... 0. 1947. Ghorapad'e Ekanatha Keshavarava.. Kashyapashilpama~. Sanskrit.… 25/167 . 2001. Karakan'd'achariu. Madhava Shastri. 212 pgs. 302 pgs. Theology. 1932. Karmakanda Kramavali No Lxxiii. Unknown. Ramavatara Sarma. 1960. 0.. Kanya Sanhitha Of The Shukla Yajurveda. Unknown. 528 pgs.. Brahmadeva. Kanva Sanhitha.. Kasaya Pahudam Iii Thidi Vihatti. Karupuramanjari Edition Ii. Manomohan Ghosh. 1899. Kalyan Ank. 900 pgs..

Sanskrit. 1979. 1963. 1952. Sanskrit.. 1904. Unknown... Bhin'de Sadaashivashaastrii.. Literature. 1930.Jnan kanda. Kaumudi Mahotsava. 1987. 423 pgs. Unknown.srinivasa Tirtheeya Etc. Shriivopadevagosvaamii.. 1923. 342 pgs. 142 pgs. Unknown. Unknown. Sanskrit. Kasyapa Gnanakandaha. Unknown.. Linguistics... Kaut'iliiyama~ Ara~tha Shaastrama~ Dditiiyo Bhaaga. Katha Sarithsagara.. 58 pgs. 338 pgs.. Sanskrit.. 220 pgs.… 26/167 . Theology.. Rajachudamani Dikshita. Linguistics. Kavyadarsh. Religion. Sanskrit. Dr Gaya Charan Tripathi. Unknown.. 1954. Katakarajavamsavali Vol I.b. 1925.. 164 pgs. Unknown.p. Social Sciences. Har Dutt Sharma. Dr. 338 pgs. Unknown. Sanskrit. Katha Kagruha Suthra... 1923. F Keilhorn.manduka Vyasatirtheeya. Sanskrit. Kavikalapadruma Of Vopadeva. Sanskrit. Sakuntal Rao Sastri. -. T.. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Sanskrit. 230 pgs. 1924.. Unknown. 1951. M. 1960. 92 pgs. Kasyapa . 1959.. Sanskrit.. 1925. 1921. Sanskrit. Literature..... Jolli Je. Kathamruthamu. Sanskrit.. Unknown. 1924..willem Caland. Unknown. Gajanan Balkrishna Pa sule. Unknown. Dr Ram Gopal Mishra. Social Sciences.r. Kasyapa Samhita. K C Varadachari. Religion. 0. 172 pgs. Unknown. Kavikalpadruma Prathama San'skarand-ama~. Jolli Je. Linguistics Literature. Rambalak Shastri. Kasyapa Maharshi. Shaastrii Ra Shamaa. Kautilya Vol I.. Sanskrit. R... Sanskrit. 1969. Sanskrit.krishnacharya. Somadeva. 240 pgs.... R Ananta Krishna Sastry. Kat'hopaanishhada~ Aavrxtti Pahilii. Kavindracharya List. 1948. 1904.girdhar Sharma.nitya Nanda Parvatiya.. Kaushhiitakagrxhyasutraand-i. 330 pgs... Sanskrit. Unknown. 1998... Pt... 1919. 466 pgs... Sanskrit. 1944... Sanskrit. Social Sciences. Unknown. 0.. 260 pgs. Sanskrit.. 266 pgs.. 344 pgs. 1938. 348 pgs. 202 pgs. 1948.... 502 pgs.2/14/2011 y pgy p A list of scanned y Sanskrit books at III… pg Kasika Part 1. Kavyakotukadarsh. Unknown. 236 pgs. 62 pgs. 1965.vedeshiya Teeka. Kavindracandrodaya. Kavya Prakash.r. 624 pgs. Sanskrit. Language. Kasyapa Jnanakanda. Katiyeshti Dipaka. Vamana And Jayaditya. Kathaka Vyasatirtheeya Teeka. 1939. Kathasaritsagara Part 2. Social Sciences.. Rarthasarathi Bhattachar. Kavya Parisha. Theology. 1934. Language. Sanskrit. Sanskrit. Sanskrit.org/…/SanskritIIIT. 1924. Parthasarathy Battacharya. Kavyadeepika. Kathakagrhyasutram. Sri Parushuram Sharmana. 222 pgs. Sanskrit. Sanskrit... Rarthasarathi Bhattachar R. Jollii Je. Sanskrit. 114 pgs.. Kaut'iliiyan' Ara~tha Shaastrama~. Unknown. Pandith Rangacharya Raddi Shastry. Sanskrit. Religion... 211 pgs. Kaut'iliiyama~ Ara~tha Shaastrama~ Dditiiya Khand-d'a. 486 pgs.. 84 pgs.. 142 pgs... 339 pgs. William Caland. 122 pgs. 378 pgs. Unknown. S V Shastri. Sanskrit. 0. Literature.. sanskritdocuments... Sanskrit. Kathopanisad Bhasya. 1984.m. Chintaamand-i Ti Ra.. Pandith Sri Ram Govind Shukla. Unknown... Kavyadarpana Volume 1. Unknown. Unknown.. Unknown. Katyayana And Patanjali Edition Ii. Kaut'iliiyama~ Ara~tha Shaastrama~ Khand-d'a 1. 210 pgs.

Kasinath Panduranga Parab.. Sanskrit. Sanskrit. 1938. 1944. Sridhar Shastri. Sudhakar malaviya..madladevi Shastri. Sanskrit. 626 pgs.. Sanskrit. 1952. Sanskrit. Unknown. Theology.. 203 pgs. Kavyalamkarasutravritti Of Vamana. Sanskrit. Kavyalankara. Kavyamala Part 5. pg Kavyalaksana Of Dandin. Unknown.. 1992. Unknown. Sanskrit.. Kavyalankara. Sanskrit.. 1957... Kenopanishhata~ Shhashht'hiiya Khand-d'a Grantha 6... -.. 176 pgs. Pandit Durgaprasad.… 27/167 . Unknown. Literature.. 1927.d. 582 pgs.. Religion. Durgaprasad. Kavyanusasana. 1934. 1951.. Arka Somayaji... Unknown. 0. Kavyasamudaya. Pandit. Pandit Sivadatta.. Sri Harishankara Sarama. Kavyalankara. 1992. K. N..2/14/2011 y p A list. 1956. Sanskrit. Theology. Kavyamala. Unknown. 0. Dr.. 510 pgs.. 124 pgs. Poems. Kiirasandeshah. Unknown. Unknown. 70 pgs. 1889. Dr. 1916. Sanskrit. 327 pgs. Hari Narayan Aapte. Kiratharjuniyam... Banhatti. Pandit R.. Sanskrit. Linguistics. Sanskrit. Krishna Charitramu Peri Venkateswara Shastri Unknown Sanskrit 0 74 pgs sanskritdocuments... 1938..org/…/SanskritIIIT.. Pandit Durga Prasad. Kavyaprakasa of Acharya Mammata. Unknown. Kenopanishhata~.. 1919. 1929. Unknown.. 1951. Sanskrit.b. Religion. 646 pgs.. . 1962.. Sanskrit.. Kavyaprakash. 166 pgs. Sanskrit. Indian Logic. Kiratarjuniya 1889.ezhuthachan. 117 pgs.n. 1917.. 1919. 57 pgs. 112 pgs. Sanskrit. 356 pgs. Jivananda vidyasagar Bhattacharya. 174 pgs.... Unknown.. Kemopanished. Sanskrit. Kavyasangraha 3... Religion. Laqs-mikaantasyaa jii. 232 pgs. Srigowrinatha Shastri. Sanskrit. Kavyamala Part 1. 1166 pgs. 1925. 1961.. Mahamahopadhyaya Pandith Shivadatta. 191 pgs. Rajvaidya Jivaram Kalidas Shastri. Sri Venkataramanarya... 275 pgs. Sanskrit. 2002. 332 pgs. Sanskrit. 1929. Unknown.. Kavyalankara Sara Sangraha. Language.. Kiranavalirahasyam Of Mathuranatha Tarkavagisha. Sanskrit. Unknown. 1937. Unknown. ananthalal thakur. Machchhakad'araachaara~ya. 576 pgs. Koushetika Brahmanam Achara Vichara.. Sanskrit. 2003.. Sanskrit. Naaraayand-a. Sanskrit... Kramadiipikaa. Unknown. Narayana Daso Banahatti. 0. Sanskrit. Khanda Kadya Sahastrika. Khiladikara. Philosophy. Sanskrit.. Unknown. 114 pgs.. Sanskrit... Unknown. Kavyalankarasutrani Vol I V. Sanskrit. Poems. 108 pgs. 1938. 1934. Narayan Ram Acharya. of scanned Sanskrit books at III… . Pardha Saradhi Battacharya. 1997. 190 pgs. Unknown. Sanskrit. Krishna Charitam. 123 pgs. 1959. 449 pgs. Khilandhikara. Unknown. -. Sanskrit.. Sanskrit. Theology. 43 pgs. 334 pgs. Sanskrit. Nitiivara~ma Mahaakavi. Sanskrit. Kiichakavadhama~. Narayan Nathaji Kaulkarni. Psychology. Ganeshopadhyay... Unknown... Sanskrit..pathrusarthi Bhatta Charya. Kavyanusasana Vol I. 359 pgs.... The Arts.. 180 pgs. Kevalanavyiprakarnaam. 140 pgs. Kavyamala Part 13.. Unknown. 224 pgs.. Kavyamala Part I X. Kavyamrtam. Kishkindhakandah Of Srimad Ramayanam.. 538 pgs. 1916. Sreeramamurthy. 587 pgs.. Keinchuifantsan.. Bhat't'a Keshava. Keralodaya (a Historical Poem). 1981. Acharya Hemachandra.

Kriyaasaara Vol I. 446 pgs. Sanskrit.... K.. Sanskrit. Dr Surya Kanta. 1950. Religion. Religion. 478 pgs. Unknown. 592 pgs. 1929. Sanskrit. Suru Bhatta.. Unknown. 1954. 230 pgs. Unknown. Sanskrit.. Religion. Theology. 180 pgs. 1925. Shriiding-a~naaga Mahaakavii.. 234 pgs.. Sanskrit.xiv.ayendra Sharma. Shriimatsaayand-aachaara~yaa. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Krishna Charitramu. 290 pgs. 462 pgs.. Krtyakalpataru Of Bhatta Lakshmidhara Vol X. Sanskrit. Rama Murti. 1950.ramamurti. Theology. Shriimatsaayand-aachaarayaa.. Krtyaratnakara.. Sanskrit. Theology. Unknown. Unknown. 1967. C. Dr. Sanskrit. Religion. Theology. Theology.. 1890. 178 pgs.. Krtyakalpataru Of Bhatta Lakshmidhara Vol Iv... Krxshhnd-ayajura~vediiya Taittiriiyasan'hitaa Prathamo Bhaaga.. Sanskrit. k v rangaswami aiyangar. 74 pgs. 322 pgs. 1976. 1950.org/…/SanskritIIIT... 401 pgs. Sanskrit. Krtyakalpataru Of Bhatta Laksmidhara Vol 3 Niyatakala Kanda. Unknown. 1954. Dr. Theology. Krxshhnd-a Yajura~vedii. Sanskrit.. 681 pgs. Sanskrit. Theology. Sanskrit.k. 644 pgs. Unknown.v. Krxshhnd-a Yajura~vediiya Taittiriiya San'hitaa. Sanskrit. Dr. Unknown. 1945.v.… 28/167 . Sri Neelamanimukhopadhya. Religion. Sanskrit. Unknown. 1983.moksakanda. Language. Kriya Svara Laksanam Or Yohi Bhasyam.v.sudhakar Malaviya. Krtya Kalpataru Of Bhatta Laksmidhara Danakanda Vol 5. Krxshhnd-ayajura~vediiya Taittiriiyaarand-yakama~ Prathamo Bhaaga.. Sanskrit. Rangaswami Aiyangar. 1997.. 1848. Krxshhnd-a Yajura~vediiya Taittiriiya San'hitaa Panj-chamo Bhaaga. Thakkura. 658 pgs.. Sanskrit. Peri Venkateswara Shastri. 1940.. Kumparnapuranam.ramshankara Bhattacharya.. Shivaa Chara~yaa Niilakan't'ha. 1976. 0. Kurmapuranam. 372 pgs. Unknown. 1929.. Krishnajuvirdeeya Taitireeysanhitha..s. 258 pgs. Unknown.. Pandith Sripad Damodar Sathvalekar.. Unknown. Rangaswami Aiyangar. 777 pgs.. 414 pgs. sanskritdocuments.. Unknown. Krsnavilasa Of Punyakoti. Rangaswami Aiyangar. 436 pgs.. Sanskrit. 1948.. 1961. Shriimatsaayand-aachaara~yaa.s. 1950.. Religion.. 446 pgs. 580 pgs. Sanskrit.. 490 pgs.. Krishna Vilasa Of Punyakoti With Commentary.. Shriimatsaayand-achaara~yaa. Religion.. Religion. Rangaswami Aiyangar... Sanskrit.. 1942. Dr. Krithya Kalpataru. k. k. 349 pgs. k. 424 pgs. 1940. Unknown. Unknown. 1983. Kumarasambhavam Mahakavyam. Sanskrit. 1941. Ksemendra Studies. Rangaswami Aiyangar... Krxshhnd-ayajura~vediiya Taittiriiyopanishhata~ Pnj-chamiiyamang-kanaavrxtti.. 1946. Sanskrit.. Ksemendra Ladrukhayasangra. Vaamanashastrii Pand-d'ita. 1945. Sanskrit. 413 pgs.. Kundamaalaa. K V Ranga Swami Aiyangar. Krxshhnd-ayajura~vediiyataittiriiyasan'hitaa Da~viitiiyo Bhaaga. K V Rangaswami Aiyangar. Religion. 373 pgs. Krtyakalapataru Of Bhatta Laksmidhara.v. Sanskrit.. Unknown. K. Krtyakalapataru Of Bhatta Laksmidhara Vol.. Religion... Krtyakalapataru Of Bhatta Laksmidhara Vol 1. Literature. Sanskrit.. Sanskrit. Linguistics....

Krishnamacharya. 684 pgs. Religion. Sanskrit. Unknown. 1959. 1941. Munj-jalaachaara~ya... Saktisrm. Sanskrit. 174 pgs. Varadharajacharyapranith. 1280 pgs. Literature. 1917. Sanskrit. Theology. Sanskrit. Sanskrit.. Kulakara~nii. Acharya Krishan Mohan Shastry. 514 pgs. Sanskrit. 394 pgs. -.. Laghushabdendushekhara Napadaantasuutraanto Bhaaga. 0.. 456 pgs.. Lalitha Madhavam Gareth And Lynette. Sudarshanacharya Tripathi.. Biography.. 34 pgs. Laghu Shabdendu Shekar. 65 pgs. Unknown. 220 pgs. Sanskrit. 1954. Laghu Siddhanta Kaumudii Pura~vaara~dharuupa Prathamo Bhaaga. 1946.. Unknown. Venkatadhvari.. 496 pgs. Shriibhaaskaraachaara~ya. Sanskrit. 1999. Geography. Sri Varadharajacharya. Unknown. Sanskrit. N C S Venkatacharya. Unknown. 858 pgs. Prakash. 0. Religion. 372 pgs. History. Natural Sciences. Lakshmisahasra Vol Iv. 1977. Natural Sciences. Unknown.. 1938. Suryakanta. 134 pgs. 130 pgs. Latkamelakamu. Laghusidhantakoumudhi. Religion. 608 pgs. Sri Girishkumar Tagore. Ladhu Ramayanam.. 1993.. Unknown. 342 pgs. Sanskrit. Sanskrit.. 1988. Laghumaanasama~. Pandith Nandkishore Shastri Ayurvedacharya. Sanskrit.. Sanskrit. Language.. 1944.org/…/SanskritIIIT. Unknown. Unknown. Le Role Des Forets Dans Le Developpement Des Collectivites Locales Forets7.. 1931. 1974. Natural Sciences. Pandith V. Laghu Sabdendu Sekhara. 1940. Unknown.. 162 pgs.. Sanskrit. Unknown. Shriidevaraaja. 1951 314 sanskritdocuments.… 29/167 . 466 pgs. Unknown. Unknown..... Linguistics. 1867. Theology. Sanskrit.. P S Subramanya Sastri. 1944. Shriinaageshabhat't'a Mahamahopaadhyaaya. Laghu Kashika 1.2/14/2011 A list of scanned Sanskrit books at III… Kut't'aakaarishiromand-i. Sri Govindnath Guha. Unknown. Sanskrit. 314 pgs.. Unknown.. Ladhunibandha. Lagusidhantkomudhi. Laghu Sabdendu Sekhara Vol I. shri achyuthananda jha. Laghusiddhantkaumudi. Lavangee. Unknown.. Sanskrit. Kuttanirmatam Kavyam.. Tata Subbaraya Sastri.. 1904. Unknown.... Lakshmi Tantra A Pancaratra Agama. Sanskrit.. 1978. Peri Venkateswara Sastri. 290 pgs. Linguistics Literature.. J P George. Pandith Sri Narayana Dutt Shastrina. Sanskrit. Laghu Siddanta Kaumudi. 1936.. 1941. Laghuparashari Madhyaparashari.. Varadaraajaachaara~yaa. 0. Unknown. 1950. Sanskrit.. Raghunathaharya N c. 2000... Sanskrit. Kutuuhalavrxtti Prathamodhyaaya. 34 pgs. Literature... 296 pgs. 70 pgs... Sanskrit. Sanskrit. Dasharadhi. 46 pgs. Prakash... alfred lord tennyson.. Sanskrit.. Lakshmi Sahasram Part 1. Religion... Unknown. Madhusudan Kaul. Lectures On Patanjali S Mahabhasya Vol 2 Ahnikas 4 6. Sanskrit... Laghu Parasari And Madhya Parasari. 133 pgs. 298 pgs. Laghubhaaskariiyama~. 124 pgs.. Pandit Sri Achyutananda Jha. 328 pgs. Sanskrit. Theology. Linguistics. Sanskrit. 257 pgs... Laghurkatantrasamgraha And Samasaptalaksana. 0. 152 pgs.. Kuvalayaananda. Sanskrit. Shara~mand-aa Vaasudeva. 277 pgs. Sanskrit.. Diiqs-ita Vaasudeva... Sanskrit.. 1651. Lakshmisahara. 1993... 1983. Theology. Lagusidhanthkoumudhi. Sanskrit. Unknown.. 310 pgs. Lalleshwari Vyakyani.. 1998. 1952. Sanskrit. Laalaa Lajapatharaaya Yan'chen' Aatmacharitra Va Charitra.. Language. Sanskrit.. 1962. Unknown..

. Pandith Ravi Dutt. Maan'nd-d'ukyopanishhada~ Taittiriiyapanishhada~ Aavrxtti Pahilii. 448 pgs. Sanskrit. Sanskrit. 1953.. Leelavathi. 1930. 1953. 1948. Sanskrit. Leelavathi Uttarshorupo Dwithiyo Bhagah. History. 1931. Maanavii San'skrxtiicha Itiihaasa. Linganusasana Of Durgasimha. Unknown. 1928. Shaastrii Raamaakrxshhnd-a Hara~shaajii. Bid'e Sadhaashivashaastrii.. Psychology. 104 pgs. 268 pgs. Shriimadbhaskaraachaaryaa. Sanskrit. Geography. Linguistics... 1937. Shriinivaasaachara~yaa Laqs-miipurama~. 194 pgs.. Sanskrit. 677 pgs. Maalatiimaadhavan' Naamaprakarand-ama~.. Language. Sanskrit. Chaara~yaa Vyaakarand-a. Dattatrey Gangadhar Koparkar. Unknown. Literature. sri visvesvara bhatta. 277 pgs. 1812... Unknown. 1951. 314 pgs. Shriimadbhaskaraachaara~yaa. Linguistics. Sanskrit. 182 pgs. Maanavaa Grxhayasuutraa. Unknown.. Sanskrit. 0. Sanskrit. Madanpalnidhantu. Sanskrit. Sanskrit. 491 pgs. sanskritdocuments. Maalati Maadhava Sekand'a~ Ed'iishana~. Literature. Religion. Lectures On Patanjalis Mahabhasya Vol I I I. 1913. Language. Sanskrit. Literary Circle Of Mahamatya Vastupala And Its Contribution To Sanskrit Literatute.. P S Subrahmanya Sastri. Maalatiimaadhavama~. Sanskrit.. 146 pgs. Unknown. Natural Sciences. Biography. Linguistics. Literature. Geography. Religion. bhogilal. Geography. 150 pgs.... History. 178 pgs. Maajhii vilaayatachii Saphara~.. Maanameyaarahasyashlokavara~tikama~ Sakalashaastrasaarasan'graharupama~. Sanskrit.... Geography. Unknown. Linganusasana.. Sanskrit. Sanskrit. Tekumalla Achyuta Rao. vinayak ganesh apte. 474 pgs. Pandit Jagaddhar Zadoo Shastri. 374 pgs. 0. Maadhaviyaadhatuvarittii... 501 pgs. 270 pgs. Psychology. Philosophy. Kulakara~nd--ii Ran'ganaatha. Lokaprakasha Of Kshemendra. Unknown. 1937. 1924. 685 pgs. 1944.. Linguistics.. Sanskrit. Maajhaa Sn'giita Vyaasan'ga. Shriinivasaachaara~ya Laqs-miipurama~. 1926..org/…/SanskritIIIT.. Theology... Sanskrit. Literature. Unknown. 327 pgs. Kara~ve Chintaamand-agand-esha. Biography. 1947. T'en'be Govin'da.. Bhavabhuuti. 86 pgs.. Language.. Biography. 1946.. 1934. Korat'akara Vit't'alakeshavaraava. Harsavardhana. Geography. Ma. Devadhara. History.. History... Theology. Liilaavatii Pura~vara~dharupam Prathamo Bhaaga. Gaan'dhii dara~shana~...2/14/2011 A list of scanned Sanskrit books at III… 1951. Sanskrit. Maanameyarahasyashlokavara~tikama~.. Life of Pingali Suuranaarya. 187 pgs... Maara~ka T'a~vena..… Madhavanidan Vijayarakshita And Shri kanthadatta Unknown Sanskrit 1932 792 pgs 30/167 ... 0. Philosophy. 1935.. Sanskrit. Sanskrit.. 1925. Language. 266 pgs.. Unknown.. Biography. 1955. Sanskrit.. Liilaavatii Uttarara~dharupo Da~vitiiyo Bhaaga. History. 326 pgs. Sanskrit. 1952. 115 pgs. Shriibhavabhuutii Mahaakavii. Madanamaharnava.. Linguistics. 120 pgs. 1931. 314 pgs. Literature. Language. Natural Sciences. Vinayak Ganesh Aapte. 491 pgs.. Sanskrit. Aapat'e. Sanskrit. Biography.

Literature. 1932. Sanskrit.... 1931. Madhvatantramukhamara~danama~. Unknown..org/…/SanskritIIIT. Biography. 1924.. 1951. Sanskrit.. Sanskrit. Mahaaban'dho Pustaka~ 3. 520 pgs.. Linguistics. 741 pgs. Sanskrit. Manmukundamuni. Sanskrit. 0. 1956. Unknown. Sanskrit.. 180 pgs. khemraj Shri krishnadas.. Sanskrit. History. 0. Keshani Prasad Chaurashiya. 1912. 406 pgs. Linguistics. Psychology. Unknown. Philosophy. Kaand-e Pii Vii. Sanskrit. Pandith Sri Ramchandra Bhatt. Language. Language.. -.. Social Sciences. Unknown. 589 pgs... Literature. Unknown. Mahaabhaashhyama~ Prathama Grantha. 1969.. Sri Vrajwallabh Sharmana. 710 pgs. Madhavanidana.. Valle poussin. Theology. Sanskrit. Literature. Unknown. sri madhuvakar.. Pushhpadantaa Mahaakavii. 1953. Sanskrit. Sanskrit. Maenkavishwamithram. Literature. 170 pgs. The Arts. 1992. Madhyakaumudini Rahasyam Prashnottari.. 1919. 448 pgs. Theology. Mahaabhaaratama~ Prathama Bhaaga Viraat'apara~vama~. P... sanskritdocuments... Gaddangadevi.. Linguistics. 84 pgs. Unknown. Raghuviiraa. 596 pgs.. 1986.. Bhagavan'ta Bhad'aaraya Bhuudabali. Sanskrit.. Geography. 792 pgs. Sanskrit. 503 pgs... Mahaapuraand-ama~ Uttarapurand-aada~vitiiyaara~dhabhuutah Trxtiiya Khand-d'a. Mahaaban'dho Bhaaga 2. 1936.... 1953. Mahaabhaarata 13 Anushaakanapara~va.. 104 pgs. 444 pgs. History. 1931. Sanskrit.. 1983. Phool Chand Siddhanth Shastry. Psychology. Language.. Sanskrit. 832 pgs. Maha Bhashyam.chaudika prasad sharma. 1930. Language.2/14/2011 A list of scanned Sanskrit books at III… Madhavanidan. Ganga Devi. 198 pgs. Madhyama Kavatara Par Candrakirti. Vijayarakshita And Shri kanthadatta.... Language. Unknown. Maghas Sisupalavadham Canto I I Edition V I.. Madhavanidhan. 172 pgs. Geography. 1941.. 1940. Vasubhandu And Sthiramati. 176 pgs. 70 pgs.. Sanskrit.... madhakara. Sanskrit. Literature. Dr Hari Narayan Dixit. Bhuda~bali Bhagavan'ta~. Mahaanaarayand-a Upanishhada. 0. Vipushhpadantaa Mahaakavi. 1992. Shriimanniilakand-t'ha. Unknown.. Saradaranjan Ray Vidyavinodha. Madvanidhanamu. Pand'e Siitaaraama Vasudeva. 1984. Religion. Madhyakalin Hindi Sant Vichar Aur Sadhana. Mahaanaarayand-a. 590 pgs. Madhura Vijaya Or Virakamparaya Charita. Biography. Saatalekara Daamodara. Shriimadappayyadiiqs-ita.. Madhyanta Vibhanga.. Linguistics.. Sanskrit. Madvanidhan. Unknown. 1835.. Madhavnindanam.. Unknown. 0. Sanskrit. Sanskrit. Madhura Vijayam. Sanskrit. Literature. Mahaapurand-ama~ Da~tiiya Khand-d'a. Mahaabhaaratama~ Sat'iikama~ Chatura~to Bhaaga Drond-apara~va. Philosophy.. Mahaaraaja Shivaajii. Sanskrit. 1888. 162 pgs. 456 pgs. Mahaabhaaratapraveshikaa.. 385 pgs... Sanskrit. Maha Bandho Vol Iii Book Iv. Unknown. 1965. 1086 pgs. 601 pgs. Sanskrit. Unknown. Sanskrit. Sanskrit. Unknown. 1954. 92 pgs.… 31/167 . Sanskrit.... Sanskrit.. 408 pgs. Linguistics. Religion. 454 pgs.

. Unknown. Satavalekar... Geography. 765 pgs. Sanskrit. Sanskrit. Sanskrit. 285 pgs. The Arts.. 360 pgs.. 1969... Sanskrit. 232 pgs. Geography. Sri Anjani Nandan Sharan. 0. -. Unknown. Sanskrit.. -.. Swami Dwarikadas Shastri. Mahabharathtatvadeep. sanskritdocuments. Majjhi Manikaya Vol 1. Sanskrit. 1968. Mahabharathmarmagya Varnasi Subhramya Shastry.. 153 pgs. 1989. Sanskrit... Mahanirvana Tantra Vol Xiii with The Commentary Of Hariharananda Bharati. 422 pgs. Unknown. Unknown. Unknown. 1954. Anundoram Borooah. 315 pgs.. 1951. 290 pgs. 556 pgs. Sri Charudevshastryna. 1926.. G R Josyer. Pannalal Jain. Maharajas Sanskrit College Magzine. Sanskrit. Geography... Mahabharathamu. Malatimadhava. Bhaavabhuuti. Mahabharathvachanamruthm.. Sanskrit. Sanskrit. Mahaarashhatra Itihaasaman'jarii. -. 0. Mahartha Majari. Unknown. 1918. 503 pgs. Theology... Unknown. 370 pgs. Sanskrit. Aapat'e Dattaatrayavishhnd-u.. Unknown. Sanskrit. Unknown. Mahabhasyam. .. 0.. Sri Ramachandra Mishra. Malavikagnimitram. 0.. Bhuutabalibattaraka Bhagavan'ta~. 1986. 0. Mahabhasya Praskash. Gaan'dhiijii Mohana~daasa~karama~chanda~.. Mahabharata Tatparya Nirnaya With Comm Anandha Thirtha. 750 pgs. 670 pgs. Unknown. Theology. 0. Unknown. Sanskrit.. Mahakavi Bhasas Swapna Vasavdatta Natak.r. 537 pgs..… M h t Of Th M it i S kh R ki h H h ji S ti U k S k it 32/167 .. 597 pgs. Maitrayani Samhita. Sanskrit. Sanskrit. Mahaviracharita Of Bhavabhuti. Unknown. 1918... Biography.. Sanskrit.. 0. 744 pgs. Sanskrit. 166 pgs. 1931. Swami Dwarikadas Shastri. M. 1955. Sanskrit. History. Mahaatmaajiin'che Satyaache Prayoga Athavaa Aatmakathaa. 0. 1990. 790 pgs. History. Pandit Guru Prasad Shastri. -. 378 pgs.org/…/SanskritIIIT. 1949.... Shastri.. Biography.. 1993. 1951.. 420 pgs. Mahaban'dho Prathama Bhaaga. Spiritual Experience And Mysticism... 1951. Unknown. 502 pgs.. ramkumar rai.... Unknown... P.. . 1982. Sanskrit. 1929. Sanskrit. 269 pgs. Biography. Sanskrit. 1947. Sanskrit. Sanskrit.... Pandith Sri Ramchandra Mishra. 274 pgs. Acharya Sri Ramachandra Mishra. Sri Sheshraja Sharma Shastri. Manasa Piyush Sundara Khanda. Sanskrit. Aajagaan'vakara Jagannatha Raghunaatha.. Religion.2/14/2011 A list of scanned Sanskrit books at III… Mahaaraashht'a San'ta Kavayitri. Unknown. Sanskrit. Sanskrit. 1845. Unknown. 709 pgs.... Unknown. Shri Yogendra. 280 pgs.. 284 pgs. History. Mahavyutpatti. 1911. H Mhpohobs. Mahabharatha Kosha. Majjhi Manikaya Vol 2. Unknown. Sanskrit. 334 pgs. Unknown.. Malavikagnimitram. Sanskrit. 1941. Maharaja Bhojarajas Sringar Prakasha. Sanskrit.. Unknown. 486 pgs. . Religion.. Sanskrit... Unknown.. Mahaveera Charithramu. Mahaviirachacharitaa. 1998. Unknown. Mahabhashyam. Mahavira Charita Of Mahakavi Sri Bhavabhuti.. -. Malavikagnimitram A Play In Five Acts. 77 pgs.. Sanskrit. Mahapurana Vol Ii Uttar Purana. Vayu Purana. 164 pgs. Madhukanth. 354 pgs.

gagaavishhnd-a shriikruushhnd-adaasa. -. Unknown. Religion... 2002. Sanskrit. 0. 1902... Mudrarakshasam. Sri Shathragna Mishra. 184 pgs.. Sanskrit. Jaimini. 0.. Dr Ramashankar Tripathi. Mandaaramarandachampuh. Sanskrit. 1924. Shukadev Bihari Mishra. 114 pgs. Maunt'ast'uara~t'a Elfinst'ana Saaheba Yaan'chen' chariitra Pura~vaara~dha. Sanskrit.g.. Sanskrit. G.. 1982. Literature. Sanskrit. 220 pgs.. Miimaan'saadara~shanama~. Linguistics. 49 pgs. Muhatri Chintamani. History. 760 pgs. 318 pgs. -. Mrxgaang-kalekhaa Naatikaa. Shyam bihari Mishra. 94 pgs. Kavi Shriikrxshhnd-aa.. Sanskrit. Unknown. 0. 62 pgs. Ramakrishna Harshaji Sastri. Psychology.. Mishra bandhu vinod. Raajaa Kun'haana. 1944.. 1879.. Sanskrit.. Sanskrit. Unknown. Muhoorta Depika. 1918. Unknown. Literature. Mayuura Sandesha. Sanskrit. Deva~ Shriivishvanaatha. 203 pgs. 195 pgs. Language.. 372 pgs.. Sanskrit. 0. Unknown. Sanskrit. Meghadutam. Mruschakatika. Mudra Rakshasam. Unknown. 1911. Sanskrit. Mudraraksasa First Edition.raghavacharya. Sanskrit. -.. Mudraraaqs-asa Prathama San'skarand-ama~. Manusmruthi.. 583 pgs..v.. Unknown. 2001.. 333 pgs. Sanskrit. Literature... Kashmorey Dwij Sri Prannath Pandith. 235 pgs. Sanskrit... Manthrardha Deepika. 178 pgs. 1923. Literature. -. Literature.. Language. 1929. 306 pgs.. Megh Dootam. Saradaranjanray Vidyavinode....... 1944. 0. Mrcchakatika of Sudraka. Sri Haridas Siddhanta Vagosha Bhatta Charya. Biography. 1915. Shalaram Dwivedi. Mandukya Upanished. Vishaakhadatta. Sri Harish Shankar Sharmana. Psychology.. Sanskrit. 1948. 702 pgs. 1970. Mimamsabalaprakasha Of Sri Bhatta Shankara. Sanskrit.. 1926. Minorworks Of Ksemendra. Sri Mukunda Shastri. Sanskrit.. Marcandeya Purana.. Language.. Sanskrit. Unknown. Unknown. 0.. V. Upanishads. Sanskrit. Sanskrit. Geography. Meghaduta of Kalidasa Text With English Translation amp Notes... 174 pgs.. Manormaratnavivek Vol Iv. Unknown. 1961. Jaya Shankar Lal Tripathi. -. Unknown. 0. 1969. Sanskrit. Medhdutam.. 2002. Hira Lal Jain. Sanskrit.. Sanskrit. 1921. God'abole Krxshhndaajiiballaala. Unknown. Unknown...… 33/167 . 1962. Unknown.. Markandeya Samhita.. E. 200 pgs..2/14/2011 A list of scanned Sanskrit books at III… Manavagrhyasutra Of The Maitrayaniya Sakha. 690 pgs. Philosophy.. 1984. 374 pgs. Sanskrit. Unknown. Linguistics. Linguistics. Sanskrit. Sanskrit. Sanskrit.nandargikar. Mayadprajaichariu.org/…/SanskritIIIT. Sanskrit. 1937... Ganesh Bihari Mishra.. khemraj Shri krishnadas.. Language. Dr C Kunhan Raja. 335 pgs.. Unknown. sanskritdocuments. 330 pgs. Linguistics. 230 pgs.. Mayurasandesa. Sanskrit. 128 pgs. Meghavijayopadhyayas Digvijaya Mahakavya. Apte.r. Sri vidyanth Jha.. 632 pgs. Unknown.. Unknown. 302 pgs.. 185 pgs. Philosophy.v.. 308 pgs. Mudrarakshasa Or The Signet Ring A Sanskrit Drama In Seven Acts. Literature.. Unknown. Mimamsa Shastram. 274 pgs. Visakhadatta.. 540 pgs. Theology. 0.

Biography.. Chintaamand-i. Sanskrit.... Linguistics. 1927. Language.3.. Sanskrit. Sanskrit. 1934. Sanskrit. -.. Dr Devarshi Sanadhya Shastri. Naathamaadhava Trot'aka Charitra va Aat'havand-ii.. Unknown. Literature. 4-8. Unknown. Naisadhiyacaritam Of Mahakkavi Sriharsa. Religion.... 131 pgs. 0. Literature. 0. Sanskrit. Pada~mashrii.. P V Ramanuja Swami. 170 pgs. Sanskrit. 168 pgs.. Valle Poussin. Myths And Races Of The World. 4-6. 680 pgs.. Naat'a~yadara~pand-ama~ Prathamo Bhaaga.. Sanskrit. Unknown. Chand baradai. Sanskrit. Unknown.. Literature.. Nagari Pracharini Granthamala Series No. 4-10.. 1927. Dr Jagdamba Prasad Sinha. 0.. Mysticism And Symbolism In Aitareya And Taittiriya Aranyakas. Linguistics. 384 pgs. Theology. Unknown. Nalopakyanam Dwithiya Khandah. 206 pgs. 1906. Chand baradai. History. 92 pgs.. Sanskrit. Sanskrit. 162 pgs. Psychology.. Sanskrit.. Sanskrit. 194 pgs. 1953. Literature. 111 pgs. 1331 pgs. Naaraayand-aguro San'skrxtakrxtayaa.chakraberti. Sanskrit...... Baalakrxshhnd-akulakara~nd-ii Purushhottama~. 4-9. Naishaddhiya Charita. Dr. 674 pgs. Literature.. 358 pgs. Literature.dhawan. Sanskrit. 452 pgs. Sanskrit. 290 pgs. Naanaara~tha San'grah Grantha 10. 78 pgs. Sanskrit. 178 pgs. 1934.. 492 pgs. 1988. Unknown.. Naaraayand-aguro. Geography. 1937. 236 pgs. 135 pgs. 1987.. 210 pgs. Kaviatan Pandit Shiv Dutta. S k it 1984 554 sanskritdocuments.b. 0. Naagarasara~vasva Kaamashaastrakaa Apuura~va Gran'thaa. m m pandit sivadatta dadhimatha... 0.. History.. 1933. 1907. Language. Literature. 173 pgs. Mulamadhya Makakarikas... Linguistics. Dr. 1906.. Linguistics. 1962. 276 pgs. Technology. Sanskrit.. Unknown. 1933. Language. Naagapura praan'taacha Itihaasa..org/…/SanskritIIIT. 1929. Sanskrit. 567 pgs. Pushhpadanta Mahaakavii.. 1950. Sanskrit. Naagakumaaracharita.. Namalinganusasana Alias Amarakosa Of Amarasimha.. Maadhavakaale Yaadava. Literature. Literature.. Gunasaan'dra and Raamachandra. 132 pgs. Unknown.. Biography.. Chand baradai. Chand baradai. Bhat't'a Qs-irasvaami. Nagari Pracharini Granthamala Series No.. Jagdamba Prasad Sinha... 1926. 0. 790 pgs. 1985. 1992. Unknown.. Literature. Mund-d'akopanishhata~ Grantha 9. jyeshtarama mukandaji. Geography.2/14/2011 p g g A list of scanned Sanskrit books at III…gy g pg Muhurtha Chintamaani. Nagari Pracharini Granthamala Series No.. Sanskrit. C. Philosophy. Dhanj-jaya Mahaakavi... 1469 pgs.. Unknown. 67 pgs.devarshi Sandhya Shastry. Naamalid'agaanushaasanama~. Sanskrit. Nalopakhyanam. 1906. Sanskrit. Naamamaalaa. Unknown. Sanskrit. Nagari Pracharini Granthamala Series No. 1941. Chintaamand-i Ti Raa. Language. Sanskrit. 4-8. Naisadhiyacharitham Canto12 22 Uttarardha.… 34/167 .. Unknown..d. Natural Sciences. Pandith Sri Guru Prasad Shastry. My Prayers Vol. Nagananda Edition I I.. Linguistics. Sanskrit. Aapat'e Hari Naarayand-a.. Sanskrit. Nagananda Natakam. Sanskrit. Chand baradai. 1937. Language. Sanskrit. Unknown.. Naanaathara~ San'grah. Nagari Pracharini Granthamala Series No.

64 pgs...2/14/2011 A list of scanned Sanskrit books at III… Sanskrit. Language. 1961. Sanskrit. 1930. Religion. 1949. Sanskrit. T R Chintamani.. 144 pgs. Sanskrit. Anundoram Borooah. Literature. 1926. Sanskrit. Sanskrit.. 560 pgs. 1928. Narasinha Puranam. 146 pgs. Sanskrit. Shriimadhyaaskaachaaraya. Nareshvarapariksha.. Language. C. Sri Kamalakar Bhatt. 506 pgs.. Unknown. Abhinava Gupta Charya. 344 pgs.. 422 pgs..org/…/SanskritIIIT.saini. 420 pgs.. Dr. Sanskrit. Unknown. Sanskrit. 219 pgs. Unknown.abhinavabharati 1. 222 pgs. sanskritdocuments. Sri Madanthram Shastry.. 218 pgs. Niteshatakam. Sanskrit. Sri Prem Vallbh Tripatisha Thran. Dr. Literature. 1984. 1984. -. Natya Sastra Sangraha Vol Ii... 562 pgs. Sanskrit.s. Abhinavaguptacarya. Narayankruthvruthisametamashrav Layan Shauthsutram.nagar.. Literature. Naradh Puraye. 1949. Sanskrit. Language. Sanskrit. Unknown. Natyasastra Of Baratamuni... Theology. Unknown. 471 pgs. Pandith Shivduttsharma. Sanskrit. 366 pgs. Nispannayogavali. 230 pgs. Sanskrit. K Vasudeva Sastri. 1937. Natyasastra Of Bharatamuni Vol Iv.. Sanskrit. 1984.. 0. 764 pgs. 1983. Nilakanthavijaya. Ramakantha... Hari Narayan Aapte.. Sanskrit. 1953.. 1941. Nanarthasangraha Of Ajayapala.… Nitiprakashika Vaisampayana Unknown Sanskrit 1953 135 pgs 35/167 . Natya Sastra Of Bharatamuni 3. Social Sciences... Sanskrit. 1934. Abhinava Gupta Charya. Unknown. Sanskrit. Unknown. 129 pgs. Linguistics. Nirnaysindhu Vol Ii. 748 pgs. 204 pgs.. Sanskrit. Sanskrit.. Sri K Vasudeva Sastri.. Unknown...... 0. Unknown. Sanskrit.. Bhattacharya. Nanartha Samgraha. 772 pgs. 972 pgs.. Nanjarajayasobhusana Of Abhinava Kalidasa. 340 pgs. 162 pgs. 1986. Unknown.. Kulakara~nd-ii Ekanaatha Dattaatreya. Sanskrit. Narayaniya Of Narayana Bhatta. 446 pgs.ravishankar Nagar.. Literature.. Natyashasrta Of Bharathamuni Vol I I. Linguistics.. Sanskrit. embar krishnamacharya. Sanskrit. 1926. 0. 420 pgs. Unknown. Nighantusesa.. Namamalikaa Bhojaa. Sanskrit. Rama~lala~ Kanjilala~ Yama~ Hecha~.. Makara Bhad'aka. Sri Daivagyadunichandratmajapandit. Literature... Unknown.. 1994. Sundara Pandya. m ramakrishna kavi. Unknown... Unknown. Unknown.. Natyasastra With The Commentary Of Abhinavagupta Vol 3. 1942... Unknown. Linguistics.. 1955.. Niilamatapurand-ama~.. Unknown. K Sambhasiva Sastri. Sanskrit. Bhat't'a Kamalaakara.. Nitidvishashtika.. Niruktan' Dditiiyo Bhaaga.r. 1994.. Natya Sastra Sangraha Vol I. 0. 1917.. 1954. Sanskrit. Dr.... 1986. Unknown. 300 pgs.sankara Ramashastri. 556 pgs.r. Unknown. Niruktam. 1969.s.. Unknown. Natyashasrta Of Bharathamuni Vol Iii. Nirakttama Da~vitiiyo Bhaaga. 554 pgs. Linguistics. 0. 1968. Unknown. 392 pgs. Nira~nd-aya Sindhu. acharya hemachandrasuri s. Unknown. Unknown. Nishkarma Siddhi.. Sanskrit. Sanskrit. 474 pgs. Navaratnavidhapadhathi.. 1924. Language. 367 pgs. Sanskrit.

119 pgs. 1953. Nyayabhindu Of Dharmakirti. Philosophy. 971 pgs.. 58 pgs. .. Gustav Oppert. Sanskrit. vallabhacharya. 1933. Sanskrit.. Goswamy Damodar Shastry.. 1992.. Nyaya Lilavati V 5. 1985. Sanskrit. 1929. 1936. Philosophy. 115 pgs. Sanskrit.. 1932.. 872 pgs.. 1938.... Unknown.. Language. Nyayadarsana.. Nyaayabhaaskarakhand-d'anama~. Unknown. Philosophy. 102 pgs. Nyay Lalavati. Unknown.. vallabhacharya. 1919. Literature.. Nyaya Lilavati I 1. E. Psychology. Sanskrit. Sanskrit. vallabhacharya.. Shriimadudayaanaachaara~yaa.. . Theology. Nityotsava Vol Iii.. 608 pgs. Shukla Sri Raja Narayan Sastry. 1932. Sanskrit... Sanskrit. Language. Sri Ananda Bodha Battaraka Charya.. Sanskrit. Nyaya Lilavati Ii 2. Nyayadarshanamu. Unknown. E.… Nyayamrtatarangini 686 16383.. Nyaya Lilavati Viii .obermiller... Sanskrit. Aapat'e Gand-osha Vinaayaka. 666 pgs. Religion...org/…/SanskritIIIT.2/14/2011 A list of scanned Sanskrit books at III… Nitiprakashika. 1990. Dwaita Philosophy.. Nyayabhindu. Sanskrit.. Sanskrit. Sanskrit... Unknown. Sanskrit. Psychology. Sanskrit. 155 pgs. 249 pgs. 0. 1927. 849 pgs... 1909.. 118 pgs.... 328 pgs. Remella Suryaprakasa Shastri. Sanskrit. Sanskrit. Unknown.. 1941. 96 pgs. Unknown. 186 pgs.. Nyayamritakulya.. 184 pgs. Unknown. 236 pgs. Psychology. 1904. Vaisampayana. Sanskrit. 1907. Sanskrit. Nyaaya Kumuda Chandra Dditiiyo Bhaaga. Unknown. Nrsimhtyasya Prayoga Parijatasya Sodasa Samskara Kandam Pakasamstha kanda Samksepasla. Literature.. vallabhacharya. Sanskrit. Sanskrit. -. sanskritdocuments. Sanskrit. 110 pgs. Nitya Kamya Karma Mimamsa. Sanskrit. -. 388 pgs.. 355 pgs. 110 pgs. Sanskrit. 1955. Literature. Nyaayasudhaa. 1992. 1990.8. Shastrii Raamasubramand-yama~. Unknown.. 0. Nyasakalpalata. Vishwanathvritti. Nyaya Makarandaha.. Nyayamrithaha Sudha chandrika. Tukaram Javaji.. 112 pgs. 108 pgs. vallabhacharya.. .. Mahadeva Sastri. Unknown.. Padamunnur Sri Narayanacharya. 2000. Bhat't'asomeshvara. Nyaayasudhaa Faskikyulasa~9. Nyaayabindu. 102 pgs. Sanskrit. Nyayabhindutikatippani... Unknown. vallabhacharya. 41 pgs. 1932. 1992. 1938. Indian Logic.. 216 pgs. Mahendra Kumar Nyaya Shastry. 1916. Unknown. Sanskrit. Sanskrit. Unknown. Linguistics.... 1902. Psychology... Unknown.. 106 pgs. Linguistics. Unknown. Sanskrit. 1929. Remella Suryaprakasa Sastri. Sanskrit.. Philosophy.. Literature. Psychology. Theology. 216 pgs. Shriidhara~mottaraa Chaara~ya. Unknown. 1948.. Nyaayakusumaan'nj-jali. Nyaya Kumud Chandra Vol-i. Unknown.. Nrisinha Prasada Tritha Sara.obermiller... 1954. 1940. Nitiprakasika. Someshvara Bhat't'a. 243 pgs. Sanskrit.. 153 pgs. 332 pgs. 1927. Sanskrit. Sanskrit. 36/167 . 1909. Nitya Kamya Karma Mimamsaa. Vyallabhacharyya. 135 pgs.. Nyaya Lilavati Vi 6. Nyaya Lilavati Vii 7.. Kumaara Nyaayaachaara~ya Mahendra. Gopinath Kaviraj. Nrxsin'hapuuvauttarataa Paniiyopanishhata~.. Philosophy. Nyayabhindu Of Dharmakirti And The Nyayabindutika Of Dharmottara. Sanskrit. Religion. Unknown. 134 pgs.

Nyayasutra Of Goutama. Theology....b.2/14/2011 A list ofLinguistics. Sanskrit. . K. at III… 0. 157 pgs. Sanskrit. Nyayasudha Sesavakyartha Chandrika Chapter 1 Subunit 4.. Sanskrit. 1953. Aara~yend-a Subrahmand-ya. 252 pgs.. Dr K S Rama Murthy. Dr. Anantha Charyar. Philosophy. Unknown. Sanskrit. Unknown.. K Surya Narayanashastri. Padit Raj Jagannath Mahakavi. Padhamanjari Pradhama Bhagamu.. 1952. Sanskrit. Religion. Sanskrit. 89 pgs. 0. 254 pgs. 777 pgs.. Unknown.krishna Murthy. 1990. Sanskrit... 1971. Nyayamrtatarangini 686 16383. Unknown.. Panditaraaja Kaavyasangraha Complete Works of Panditaraja Jagannatha. Paashhara~dasuutrama~. Gajanana Shastri Musalagaonkar. Language. 667 pgs. Sri Haridatta Misra. Sanskrit. Pahile Mahaayudhda Bhaaga Tisaraa. Sanskrit. Literature. 1937.. Padakavya Ratnakara. Padhamanjari Dwithiya Bagamu. Padukapattabhisekam Of Narayanakavi. 1941.. 1958. .. Pan'chamapushhpama~ Kaavyadvayama~. Dr.. Sanskrit.. Unknown.. Unknown.. Unknown.ramaswami Sastri Siromani. 68 pgs.. 1953. 283 pgs. Unknown. Panchampushpam V.. History. 249 pgs.r. Sanskrit. scanned Sanskrit booksSanskrit. Pandit Ramgopala Shastri.. Unknown. Pancaratram.. Nyayasiddhanta Muktavali.. 132 pgs. 386 pgs. Padya Mala. Linguistics... 1953. Paand-inisutravyaakhyaa. Sanskrit. Sanskrit. Unknown.. Khaad'ilakara Shrii Krxshhnd-aajii Prabhaakara.. Sanskrit. Viiraraaghavaachaara~ya Mund-aluura~. Sanskrit.. 702 pgs. .. Sri P P Vasudevanand Saraswathi Tembeswami. Nyaysutravaidikvruthi. Nyayarakshsmani Of Srimad Appayya Deekshithendra.. Literature. 1941.org/…/SanskritIIIT. 1984. 210 pgs. Literature. 1953. Padyamrta Tarangini. 392 pgs. Sanskrit...... P. 274 pgs. 1973. 1927... Om Brihat Sarvanukramnika Of The Atharva Veda.. Geography. 1922. Shaunakamahaamuninaa Bhagavataa. Pandit S. 134 pgs. Sanskrit. Panchatantram Vol Ii. 1939. 434 pgs. 1951. Maniantha Misra. Sanskrit. Language. Sanskrit. Sanskrit. Shriimadamitagatyaachaara~ya. Padhyapushhpaanj-jali. P i ht k Utt dh P dith S i Y t d tt t ibhi U k S k it 0 380 sanskritdocuments. 1981. 1983. 0. Theology.. 1984. Theology... Pandit Bhanu Dattshastri. 230 pgs. 1957. Linguistics.… 37/167 . 392 pgs. gandanatha jha. 660 pgs. 422 pgs. Haribhaskara.gajanana Shastri Musalagaonkar. Unknown. Linguistics Literature. Unknown.. Sanskrit. 152 pgs.. 1940.. Sanskrit. 757 pgs. 1934. 1904. Sanskrit.. Sanskrit.. 1954.. Sanskrit... Palkuriki Somanatha... Religion. 554 pgs. Pan'chasan'graha. Unknown. 83 pgs... Pandith Devdutt Sharmana.s. 1981. Biography. Unknown... Unknown. Unknown. Religion. 311 pgs. 380 pgs. m ramakrishna kavi. Sri Jaya Tirtha. Sanskrit.. Sri Haridatta Misra. Nyayasiddantamuktavali Of Viswanathapancanana Bhattacarya. Dr Smt Mudigonda Uma Devi. Unknown... Nyayasastra With The Commentary Of Abhinavagupta. Nyayaratnamala Of Parthasarathimisra. Panditaraaja Jagannatha. Psychology. Unknown. 258 pgs. 534 pgs. Unknown. Sarasvatii Vaasudevaananda. C R Devadhar. Sanskrit. Language. Nyayaratna. Sanskrit.

Post Independence Sanskrit Literature. 1980.. Unknown. 334 pgs. Narendra Nath Choudari. 0. Unknown. Religion. Ganesh Shankar Shukla. Unknown. 506 pgs.. Sri Pindagala Charya. 164 sanskritdocuments. Unknown. 442 pgs. Language.. 1931. C Kunhan Raja. Sanskrit. 252 pgs.2/14/2011 A list of scanned Sanskrit books at III… Panineeyashtakam Uttaradharm.. 252 pgs... Unknown.. 188 pgs.. Unknown. Prabandaha Cintamani Of Merutungacharya Part I.. 334 pgs. Parama Samhitha.. 1934.. Shaastri Vaamana. 1954. Unknown. Persian Sanskrit Grammer. Pandita Viswanatha Shastri. 0. Unknown... Linguistics. -. Plane Trigonometry. Sanskrit. 497 pgs. Sanskrit. Sri Nagesh Bhatt... Unknown. Panini As A Variationist. k r joshi s m ayachit. 97 pgs..... 1952. 1935.. Language.. Parahita Samhita. Pandith Sri Kapileswar Shastrina. Unknown. Sanskrit. Sanskrit.. Pingala Acharya.. 247 pgs.. Language.. Paraamara~sha Khan'd'a 1. Sanskrit. 0. Paninisutra Vyakhya Vol 1 Purvardhamu. Valmiiki. Sanskrit... 1874. Sanskrit. 134 pgs.. 1938. 1933. Viraraghavacharya. Sanskrit. Religion. 1936. 0.. Paramaananda~. Linguistics. Unknown. Paniniya Shiqs-aa. Sanskrit.. Language. Sanskrit. Grammer. Aan'bekara Vishhnd-ubaapujii. Sanskrit. Sanskrit. Literature. Pandith Nityananda Panta Parvatiya. 1947. Linguistics. Sanskrit. Sanskrit. Sanskrit. 1923. Sanskrit. Sanskrit. Literature. Natural Sciences.. Poona Akhbars Vol Ii. Literature. Pindagalachand Suthram. Sanskrit. 112 pgs. 531 pgs..... Unknown. Unknown. Sanskrit. Praayashrvittendushekharah.. Valmiiki.. 454 pgs. Pandith Sri Yutagnaduttasastribhi.... Sanskrit. Sanskrit. Sanskrit.. 436 pgs.. Paqs-chimottarashaakhiiyama~ Vaalmiikiiya Raamaayand-ama~ Uttara kaand-d'ama~.. 172 pgs. Panj-chavin'shatisaahastrikaa Pranj-aapaaramitaa... 173 pgs. 1944.. 0.. pandit bapudeva sastri..org/…/SanskritIIIT.. 1990.. Unknown. Parameshwarpitha Slokamalika... 0. Paribashendu Sekhara. 175 pgs. 132 pgs. Natural Sciences.… 38/167 . Religion. Language. Parama Laghu Manjuaha Of Nagesh Bhatt. Unknown. 1938. Linguistics.. T. Sanskrit. Linguistics. 374 pgs.arkasomayaji. Unknown.. Philosophy. Jinavijaya Muni. Paramartha Prakasika. 1972.... Theology. Paribhashendushekar. Ghosha Manamohana. 322 pgs. Parijaat. Vaalmiikii. Unknown. Sanskrit. 1954. Sanskrit. Pilibhit ka Sahitiyik Itihaas. Paqs-chimottarashaakhiiyan' Vaalmikiiya Raamaayand-ama~ Kishhkindha Kaand-d'ama~. Unknown.. 1957. Pandith Sri Yutagnadutt Sastry. Sanskrit.. 172 pgs. Sanskrit. Sanskrit. 380 pgs. Paramaanandakaavyama~. 70 pgs. 1947. Viraraghavacharya siromani. Literature. Paqs-chimottarashaakhiiyan' Vaalmikiiya Raamaayand-ama~ Yuddha Kaand-d'ama~.. S Krishnaswami Aiyangar. Sanskrit. 323 pgs. Panineeyasthakam Poorvadharm. Pashvaalambhamiimaan'saa. Tadnujen Sri Manmadhusudansharma. Bhat't'a Naagojii. Philosophy Of Poetry. Unknown. Praakrxtashabdapradiipikaa. Theology. 200 pgs. srinatha pandita. Harinarayna Apte.. 181 pgs. 1959. 0. 1946. 624 pgs. D. Nrxsin'hashaastrii. Sanskrit. Sanskrit. 1940. Theology. 245 pgs. Datta Nalinaaqs-a. 1913.. S D Joshi.. 582 pgs. Paribhashedendushekar. 1940.. 1916. 694 pgs. Literature. Literature.

..c..Edition. Unknown. 441 pgs. Vijaya Jina.. Prajnaparamitasa~ Prathama Bhaaga Abhisamayaalad'a~kaaralokah. Appayya Diiqs-ita. Psychology. 924 pgs. Unknown. 186 pgs. 265 pgs..... 1994. 1954. Sanskrit.. 252 pgs.. Sanskrit.. 1932. Prabhodhanaachandrodayama~. Language. Sanskrit.. Unknown... Sanskrit. Prasnopanisad Bhasya I I. Sanskrit.. 1931. 1947. 722 pgs. K. 160 pgs.. Sanskrit.. Literature. Mishra Krxshhnd-a. 186 pgs... Jinavijaya Muni.. Pratima Natakam. 107 pgs. Unknown. Pandit. Linguistics. 1936. 1933.shantiraja Sastri. 1935.. 1947. Sanskrit. Mallikarjuna Shastri. Psychology. 142 pgs. Prabhanda Chinthamani Of Merutungacharya Part 1. Linguistics. Prabandhakosha Prathama Bhaaga. Pramaand-avaara~ttikama~ Svaara~thaanumaanaparichchheda. Ramaji Upadyaiah.. Unknown. Technology. 0. Sanskrit. Prameyaratnalankara. Prajna Paramitha Ratnaguna Samcaya Gatha. Punnasseri Nambi Neelakndha Sarma..… 39/167 . Philosophy.org/…/SanskritIIIT. Philosophy. Prabodhachandrodayama~.. Raghunatha Kavi.. Prashnopanishhata~ Grantha 8.... 1943. Sutra Dharamandana. Shriigovindaamrxbhagavaana~. 94 pgs.. Tantras. Sanskrit. Sanskrit. The Arts. Literature. Prabhaavakacharita Prathama Bhaaga Muula grantha. 252 pgs. 1992. 0. Sanskrit.. Sanskrit. E. Sanskrit. -. 1941. Religion. Prashanamka choodamani.. 20 pgs. Sanskrit.. Prasnamarga. 262 pgs. Unknown.. Prasadamandanam.. Sanskrit. Unknown. Unknown. Sanskrit.. 164 pgs... Religion. Panditaratnam A. Literature. Prakrxtamand-idiipa Prathamao Bhaaga. 0. Haribhadraa.. Unknown. Religion.. 1978.. 922 pgs. Theology. 77 pgs. 1948. Unknown. sanskritdocuments. Shriiprabhaachandraachara~yaa.. Linguistics. 1953. 261 pgs. Religion.. 1941. Prasaada Mand-d'anama~. Literature.. Religion. 134 pgs. 272 pgs. Sanskrit. 1948.. Prataha Smranmala. Linguistics. 128 pgs. Unknown. Sanskrit. 1941.. Unknown.. Shriinaaraayand-a Bhat't'aprand-iitan.. Sanskrit. 1951. P. Aanandagiri.. Theology. 1975. Unknown.varadhachari.. 1926. 239 pgs. 1955. Mahendrakumar Shastriyna. Sanskrit. Sri Ramachandra Mishra.. Theology.obermiller. Prakriyasarvasva Taddhita. Sanskrit.. Unknown.. Sanskrit. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… pgs. Prachina Sanskrit Natak. 484 pgs. 394 pgs.. Prapancha Sara Tantra Of Sankaracharya. Theology. 152 pgs. 346 pgs. Sanskrit. Shriimadabhinavachaarukiira~tipand-itaachaara~ya. Prasnopanishad Bhasya. Prakrta Prakasa. Prakrutananda. Prameyakamal Martand. gomi kara~nd-aka. Language. Theology. Language. Prakriyaasavara~svama~. Language. 176 pgs. Sri Harishanker Mishra. Prameykamlamartand Vol Ii. Atalananda Sarasvati. Shri Prabha Chandra. 676 pgs. 0.. Sanskrit. Sanskrit. 1981... Dr P L Vaidhya. 1932. Pandit sri seetaramanga Jotishaclarya.. Tallapally Muralidhara Gowd. Unknown. Sanskrit. Pradhama Padyamala. Sanskrit.. Sanskrit. 1935. 652 pgs.. Prameyaratnaalang-kaara. Unknown. Prabhu Lingaleela. 70 pgs. 1940. Narayana Bhatta. Sanskrit. Sutradhaaramand-d'ana.

.. 1989. 242 pgs. 1920. sanskritdocuments. Raamaayand-ama~ prathama khand-d'a. 1927.. Sanskrit. 226 pgs.. Proceedings And Transactions Of The All India Oriental Conference.. Da~vivedii Kapiladeva. Saradaranjanray Vidyavinode. Pratyakruttatvachintamani Vol I.shastry. Sri Krishnaiah Panth Sastriye. A. 536 pgs. 348 pgs.... Unknown... Lakshminarasimha. Unknown. Unknown. Sanskrit. Sanskrit. Sri Madramkrishnabhattsunuvishnubhatt. 1935. Unknown. Sanskrit.. Proceedings And Transactions Of The First Oriental Conference Poona Vol 1. Purva Kalaamrutamu.. Sri P. 1908.. Prayodhya Kavyam. Raasabihaarii Basuun'che Kraan'tijiivana....org/…/SanskritIIIT. 1985. Proceedings And Transactions Of The First Oriental Confirence Poona. 154 pgs.shrikrishnamani Tripathi. a s altekar.. 480 pgs. 611 pgs. 828 pgs. Unknown.gangaprasad. 176 pgs. Dr. Raashht'a~ra Giitaanj-jali. Religion.. Dr. 0. S.. Purana Vishya Samnukramayaka. Pt. Ranjit Sitaram Pandit. 82 pgs. Religion. Vaalmiiki.. Sanskrit. at III… pg Pratimaa Mana Laqs-and-ama~. G... Sanskrit. -. Sanskrit. Sanskrit.. 0... 0. 112 pgs. Bhagavad Datta... Vasudev Sharma. Haradaasa Baalashaastrii Saahityaachaara~ya.. Sanskrit. Language... Purushparthchintamani. Sanskrit. Kara~mara~kara~ Epi. Language. Sanskrit Religion... 1931.… Raghuvamsham. -. Purva Mimamsa.. scanned Sanskrit books ... Religion. Sanskrit. 163 pgs.. Ragatarangini. 1947. Sanskrit.. 1945. Sanskrit. Unknown. Raghuvamsam Canto V. 310 pgs. Literature. 246 pgs.. 730 pgs. 1979. Geography. Sanskrit. 1935. Sanskrit. Unknown. 0. Sanskrit. Bosa Phanin'draa Naatha. Unknown. 1875. Yashpal Tandon's... Sanskrit. 1950. Prem Pathanam. 302 pgs. Biography. Linguistics. Saradaranjay Ray.. Purvakhandatmika Bhaktiyogaparisha. Sanskrit. 286 pgs. Unknown. 1952. 0. 1985. Unknown. Linguistics. Sanskrit. Unknown. Sanskrit. Miimaan'saka Yudhishht'hira... Theology.. 40/167 . Unknown. Suryakanth Shastri... 1323 pgs. 1945.. Premarasayana.. Sanskrit.. 492 pgs. Visvanatha Pandita.a. Sanskrit. 118 pgs. Sanskrit. Raamaayana Of Vaalmiki Bala Kanda. 936 pgs. 1922. Raghuvamsam (canto vi). Unknown. Sanskrit.. Unknown. 1999. Pandit Sivadatta. Sanskrit. Purana Panchalaksana. Purva Mimansa Darsana... Puranika~ En'thalojy Puraand-a Kaavya Stotra Sudha. 1929.2/14/2011 A list of . Purascaryarnava. 451 pgs.. Social Sciences. Sanskrit. 370 pgs. 490 pgs. Proceeding And Transactions Of The Fifth Indian Oriental Conforence Vol I.. Sri Sadanand Vidvadwirichith. Unknown. 1926. History.. 369 pgs. Raghuvamsam.. 98 pgs. Unknown. 0. Unknown. 330 pgs. Theology. Unknown. 82 pgs. Purusharth Chintamani. 1928. Literature. History. Late. 826 pgs. Raghava Naishadhiya. Unknown... Sanskrit. Sanskrit. Unknown. Theology. G D Thukral.. 1993. Unknown.. Unknown. 1952. Ragavibodha. 0. 626 pgs.. Mahadeva Sastry. Qs-iira Ratagd'ind-ii.. 1930. Sanskrit. Sanskrit. Bharatwaj. Muralidhar jha.subrahmanya Sastri. Yagna Ramulu. 308 pgs. A. Sanskrit.

1917. Kalhana. Sanskrit. T.. Sanskrit.c. Ramayana Of Valmiki Vol Vii Yuddhakanda. Ramayana Of Valmiki Vol Vii Uttarakanda. Unknown. Unknown. 112 pgs. Unknown. Unknown. Ramas Later History Vol X X I. Sanskrit.. Raghuvan'shamahaakaavyama~.. Sanskrit. Ram Rasayan Ayodhyakand. 0. Unknown. Unknown.. Durgesh Singhal. 1935. 1983. Sanskrit. Sanskrit. Ramayana Of Valmiki Vol Iv Kishkindhakanda.. 845 pgs. Unknown.. -.... 612 pgs.. Satkari Mukhopadhyaya.. 1915. 1965. Temples. . 1983. Ramayana Of Valmiki Vol V Sundarakanda. 168 pgs... at 730 pgs.. Sri P Ramachandraghna Vyakaranacharyah.. sanskritdocuments. 0. 1992. Unknown. Dr. Sanskrit. .. Unknown. 1983. 795 pgs. 1950. Ras Gangadhara. Sanskrit. 1260 pgs.. Sanskrit.… Rasagadagdar Rahasyam Sri madanmohan Jha Unknown Sanskrit 0 60 pgs 41/167 . Psychology.. pgs. Satkari Mukhopadhyaya. Sanskrit.m. Ramayana Ramabirama. Unknown. Sanskrit. Ramayana With Three Commentry Tika. Sanskrit.. 0.. 1902.. 426 pgs. 454 pgs. Sanskrit. 164 pgs.ganapati Sastri. Satkari Mukhopadhyaya. Ramayana Vol 3. Vishva Bhndhu Shastri.. Rangayan Vol 34 Jan-june 2001. 700 pgs. 317 pgs. 369 pgs. 1985. Sanskrit. 234 pgs.. Sanskrit... Raghuviracharata. Kavignar . Ramayana Of Valmiki Vol Viii Index Of Verses.. Ramayana. Unknown.. .. Rangayan Vol 34.. Sanskrit. Unknown.. .. Ramayana Of Valmiki The Aranya Kanda. Ramalashiktha Jyothish. Mishra Brahmashan'kara. 460 pgs. Philosophy. 523 pgs. Unknown. Peeyush Darya. 1934.. Sanskrit. Sanskrit. Ramayana Of Valmiki India S National Epic. Jagannath Prasad Kayath.. 164 pgs. Sanskrit. Raghu Vira. Unknown.. Unknown. Satkari Mukhopadhyaya. 1955. Rangaayana. Ramayana Of Valmiki Vol Ii Ayodyakanda. Raja Tarangini. 605 pgs. Sanskrit. 1983. Rasa-jala-nidhi... Sanskrit. Sanskrit. 2002. Sanskrit. Raghuvamshamahakavyam.shrikrishnamani Tripathi. Pandit Sri Bhadarinath Jha. Unknown. 1983. 1944. 354 pgs.2/14/2011 A list of scanned Sanskrit books III… Raghuvamsham.... Shripad Krishna Belvalkar. 706 pgs.. Ram Swayamvaram. 481 pgs. 350 pgs... Sanskrit.. Bhagavad Datta.. Unknown... Unknown. Satkari Mukhopadhyaya... 1895. Ramayana Of Valmiki Vol Iii Aranyakanda. Unknown. Ramayan Valmikiye Aadikand... Bhudeb Mookerjee. Satkari Mukhopadhyaya. 1938... 588 pgs. 2001. 193 pgs. Unknown.... Unknown. Temples... Ramayana Of Valmiki Vol I Balakanda. 2002.. -.. Unknown.Vaarasree. 427 pgs. Di Valmici. Rajagopalachari. 1983. Literature. Sanskrit. Rangayan Vol 34 Jan-june 2001. 164 pgs.. 0. 638 pgs. Ramayana Of Valmiki Yudda Kanda. Sanskrit. Sanskrit. 1983.. 2001. Sanskrit. Sanskrit. Sanskrit. Satkari Mukhopadhyaya. Bagaiah . 330 pgs. 1983. Sanskrit. 192 pgs. .. Religion. 0. 0. Satkari Mukhopadhyaya.org/…/SanskritIIIT. . Religion. 681 pgs.

Unknown. Sanskrit. Sanskrit. Unknown. Vedas..v. Sanskrit. 1108 pgs. 60 pgs. 100 pgs. 1961. Gonda. Sanskrit.. 206 pgs.sastri.kapali Sastry. Sri Mathsainacharyavirchitbhasyasameta. Unknown.. Sanskrit. Ratnadiipikaa Ratnashaastrama~cha. 133 pgs. 134 pgs. Technology. Art.. Remarks On The Sanskrit Passive. 1951. 552 pgs. 1945. 1997.. Religion.lakshman Sarup.. Sanskrit. Sanskrit. Unknown.. 332 pgs. Sanskrit. Rasamanjari Of Bhanudatta. Sanskrit.. Rauravagama Volume I. 1927. Unknown. 1868. 0. 241 pgs. Sanskrit. Sanskrit... Sanskrit. Unknown.. Biography.l. Sanskrit. Sanskrit.. Rastrapala Pariprccha Sutra Du Mahayana. 354 pgs. Sanskrit. Sanskrit... Sanskrit. 500 pgs.2/14/2011 A list of scanned Sanskrit books at III… Rasagadagdar Rahasyam. Rigveda Samhita. Sanskrit. 1986. Rasahrxdayatantrama. Vidhydhar Johrapoorkar. 1946. Reader Ii..... Ravanarjuniyamu. Unknown. 129 pgs. Unknown. Sanskrit. 1074 pgs. 75 pgs. Late Dr. 1314 pgs. Rasamanj-jari faskikyuulasa~ 3.. 0.. Unknown. Unknown. P... Sanskrit. -. 1981. 964 pgs. Rg Bhasya Sangraha. 148 pgs. Allaraaja.. 152 pgs.l.l... Rashtriya Panchang. Unknown. 1951.. Sudarsanacharya.. 0. Rasagangadhara. Rgarthasara Vol I.. Sanskrit. Rgarthasara Of Dinakara Bhatta Vol 1. Unknown..org/…/SanskritIIIT. 266 pgs. 2001. Ravi-vichaar. Ramgovind Trivedi Vedanthshastry.. Unknown.. K. Rigved. Literature. Sanskrit. Unknown. Literature. Sanskrit.. 128 pgs.. Unknown. 100 pgs.. 403 pgs.. Sanskrit.. 0.. 84 pgs. Sayanacharya. Sanskrit. Sanskrit. Theology. Ramasastri. Unknown. V S Venkata Raghavacharya. Dinakara Bhatta. Regved Sanhita Vol.. Linguistics. Shriigovindabhagavatpaada. J Gonda. Aryendra Sharma. K. Reader I. 1956. 2001..sastri. 1152 pgs. 116 pgs. sri bhattabeem. Language.n. Linguistics.. -. Rigveda Samhita Vol Iv Ix X Mandalas.. Literature. 1987. Sayanas Comentary. Haughton G. Rgveda Samhita Vol-i.p. 82 pgs. 1951.. L Finot. Sanskrit. 1996. Dev Raj Chanana. 1988. Narayana Sharma.I.. Rigveda Samhita Vol Iii 6 8 Mandalas. 1955. Sanskrit.sastri... Ram Suresh Tripathi. Unknown... Rigveda Samhita. 188 pgs. K..v.. Sanskrit.s.. 1941.. Literature. 1204 pgs. 1961. Srinarayan Misra.. T.. Unknown. 1992. Unknown. Rediscovering India Manav Dharma Shastra Vol 30 I.v. 1959. Unknown. Philosarhy. Rgvedasamhita. 231 pgs. Sayanacharya. Language. Sanskrit.. Dr. Reader Iii. Geography. 1951. 1974. Sri Rama Sharma.. 0.. Rasaratnapradiipikaa Gran'thang-ka 8.. Sanskrit. Ratna Dipika And Ratna Satram.. 1959. Unknown. Sanskrit... Rgvedi Purva Proyoga. Theology..… 42/167 . Sanskrit..v. Religion.. Remarks Of Similes In Sanskrit Literature.. Srit. Sanskrit. Linguistics.k. 1949. N R Bhatt. 220 pgs. Unknown.v. Rgveda Samhita Vol 4. Sri madanmohan Jha. sanskritdocuments.. Bhaanubhat't'aa Shrii. 0.. Language. 594 pgs. Unknown. 1904. Budhdabhat't'a Chand-deshvara~ cha. 146 pgs. Rasaviveka of Kavya Darsa. 1965... 82 pgs. 94 pgs.c. Rasendra sarsangra. History.

. 1062 pgs. Unknown.... Rxgara~thadiipika Chatura~tho Bhaaga. 1929.. Theology. Vilsana~ Hecha~ Hecha~. 0... 1219 pgs.. . Sanskrit. 1940. Literature.. Sanskrit. Bhat't'ena Maadhava. 0. Religion. 176 pgs. Rxgaratna Bhaand-d'aara. Journals. Sanskrit. Language.r. 1929. Theology... 1986.. Sanskrit. Krishnacharya.. Santavalekara~ Shriipaada Daamodara~. Bijapurakara Vishnd-u Govinda. Sanskrit. 450 pgs. Sayanacharya. 1935. Theology. Sri Rama Sharma.. . Sanskrit. Sanskrit. Shaastri T'i Vi Kapaali. Sanskrit.. Rigveda. Rxgara~thadipika Bhaaga 2. Sanskrit. Unknown. 283 pgs. . Religion.. Pramodhini Panda. Religion. Rxgvedaa Vyakhyaa Maadhavakara~ta. 1929.. Sanskrit. 1823. Rudrasthadhyayi. Sanskrit. 1966.… 43/167 . Rxgveda San'hiita Shashht'o Bhaagaa.. Shriimatsaayand-aachara~ya.. Sanskrit. Sri Pandith Jwalaprasad. Rudraadhyaaya Grantha 2. Theology. 249 pgs.. Ritriratna Prakash. Religion.. Rxgara~thadiipikaa chatura~tho bhaaga. 362 pgs. Religion.. 1823. Rkbhasyam Tika. Religion. Language. 1932. Sri Balayajnavedesvara. Rxgveda San'hitaa Bhaaga 2. Rukminikalyana Mahakavya. Sanskrit.. 1928.. Raajaa Kunahaana. Riksan'graah Trxtiiya Khand-d'a. Sanskrit. 1058 pgs.. .. 374 pgs. Theology. 1058 pgs. 158 pgs.org/…/SanskritIIIT. Religion.. Linguistics. Rxgveda Sn'hitaa. 242 pgs. 454 pgs.. Ramanand Divvedina. Shriimadhavaa. Sanskrit. 429 pgs.. Unknown.. 502 pgs. 32 pgs. 1951. Kamakshi. Literature.r. Sanskrit. Unknown. Aapat'e Hari Naarayand-a.. Rukminishavijayahaha. Sanskrit. Theology. 200 pgs. 1951. Theology.. 1242 pgs.. Language. Sanskrit... Rudradasas Chandralekha.. Theology. Dr A N Upadhye. 1950. . Theology. Religion.. 0. Dharmasthala. Unknown. Religion. 2000. Krishnacharya. Rigvedasya Prathamamanadalasya Sayana Venkatamadhava Bhasyayos. Sanskrit. Shriimaadhavena Shriiven'kat'aara~yaatanudbhavena. 1955. Rigveda Samhita Vol-v Indices. 1931. 914 pgs.. Sanskrit. Theology... Kolan'gad'e Raamachan'dragovin'da... sanskritdocuments. 102 pgs.2/14/2011 A list of scanned Sanskrit books at III… Rigveda Samhita Vol-ii 2-5 Mandalas. Literature.t. Sanskrit. Rxgveda San'hitaa Trxtiiyo Bhaaga. Sayanacharya. 1986. 770 pgs. Religion... 1940. Unknown. Sanskrit.t. 352 pgs. Rkbhasyam Chalari. Theology.. 1936.. Rukminikalyana Mahakavya Of Rajacudamani Diksita.. Rxgveda San'hitaa Prathamo Bhaaga.. 1955. 641 pgs.. 170 pgs. Rubaiyat Of Omar Khaiyam. Sanskrit.. A Narayanadas.. . Shriipaadashara!~mand-aa Bhat't'aachayaind-a. Sanskrit.. Sanskrit. Sanskrit. Literature. 1950.. 1945. 1140 pgs. 1939. Roopdeepika. Shriimaadhavena Shriiven'kat'aara~yaatanudbhavena. Rxgvedaanukramand-ii Prathamo Bhaaga Grantha 2.. Theology. P. Religion. Sanskrit. 736 pgs.. 1208 pgs. Religion. Rksamhita. 0.. Linguistics. Rksamhita. Linguistics. 298 pgs. Sanskrit.

v. 359 pgs. Sanskrit. Sanskrit. 1939. Sanskrit.. Language. Rxgvedasan'hitaa Trxtiiyo Bhaaga. 1943.. Religion. 492 pgs.. 1940. 1072 pgs. 500 pgs. Shriikapaalishaastrii..a. Saamavediiya Jaiminiiya San'hitaa Bhaaga 3. 208 pgs..... Saarasvata Vyaakarand-ama~ Uttaraaddhara~ma~. Language. Unknown. Sanskrit. Sabda Sakti Prakasika. Sanskrit.v. Tippayya Parishkrit. 1151 pgs.oriental Journal Vol-4 Part 1 .. 160 pgs. 1950.. 1961.. Sanskrit. Theology. Pandit Dhundhiraj Sastri. Saayand-aachaara~yaa.. 189 pgs. Religion. Sanskrit.… Sabdakalpadruma Kanda Ii Radhakanthadev Religion Theology Sanskrit 1976 944 pgs 44/167 . 602 pgs. Matsaayand-aachaara~ya. Sanskrit.. 168 pgs.. Theology. Religion. Rxgvedasan'hitaa Prathamaashht akama~ Prathamo Bhaagaa. 1142 pgs. K. Svaruupaachaara~ya Anuubhuuti. Saksenaa Baaburaama. 547 pgs. Sanskrit. 1951. Rxgvedasan'hitaa Trxtiiyobhaaga. Language..u. Theology. Literature. Raamaanuja Jaiyasaragomat'han. Religion.. 1936.. Saathar Upanishhatsn'grah 4 Bhaaga. Sanskrit. 1913.. Rxgvedasan'hitaa Prathamaashht'akama~. Sanskrit. Religion. 1935. Chaara~ya Saayand-a. Saadaashivabhaashhyama~. shriimatsaayand-achaara~yaa. Saamavediiya Taand-d'yamahaabraahmand-ama~ Da~vitiiya Bhaaga.2/14/2011 . Saamaveda San'hitaa. 353 pgs. Sanskrit. Sanskrit. Theology. L Laxminarayan. Rxgvedavyaakyaa. Natural Sciences. Sont'ake Esa~ena~. Sanskrit. pg A list of scanned Sanskrit books at III… Rxgvedasan'hitaa Pdaadisuuchyaatmakah Panj-chamo Bhaaga. sanskritdocuments. Bhaagavata Hari Radhunaatha.. 387 pgs.... Linguistics. 1934. 1984. Sanskrit. Saaraswatham (vyakaranam). 1917. Sanskrit. Theology. 2002. Rxgvedasan'hitaa Prathamashht'akama~ Prathamo Bhaaga.. Unknown. Religion. Maadhavakara~ta. Literature. Sanskrit. Religion. 1941. Unknown.. Theology. Theology..2. Religion. Shara~maa Raamasvaruupa. 285 pgs.. 702 pgs. 1936. 1951.. Saamaanya Bhaashhaavijnj-aana... Purushottam. 370 pgs... Religion. Madhavaka~ra~ta. 77 pgs. 543 pgs. Rxgvedavyaakhyaaya Bhaaga 2 Ast'aka 1 Adhyaayaasa~ 5 Se 8. Religion. S. Raghuviira~ Achaara~ya. Indology. Religion. 949 pgs. Linguistics. Sabda Manjari. Religion. Rxgvedasan'hitaapadapaat'hah. Theology. 197 pgs. Sanskrit.. Sanskrit.. Sayanaachaara~yaa Shrii. Sanskrit. 1922. Shriikapaalishaastri. Theology... Sanskrit... Bhaagavata Hariraghunaatha. Shriikapaalishaastrii.t... Religion.. 1990. Saamavediiyataand-jyamahaabrahmand-ama~ prathama bhaaga. Theology.sastry.org/…/SanskritIIIT. Religion.l. Linguistics.. Religion. Sterling Publishers Private Limited New Delhi. 353 pgs. Theology. 1934.. Theology. 1938. Sanskrit. Saamavediiya Chandogyopanishhata~. Sabda Manjari. 126 pgs.. Saara~tha Upanishhatsan'graha Bhaaga Sahaava. 1922. Sanskrit. 1957.. Theology... 238 pgs. Virachita Nanj-jund-d'aaraadhya... Theology. Literature. Sanskrit. Theology. 1947. 1947.

1967. 0.. Salihotra Of Bhoja. Sanskrit... Sanskrit.narasimha Charya. Sachurnika Srimad Bhagavatam... 1917. Language. Bhuskut'e Vi Bha. 1924. Sabdartna With Bhairavi.. Sabdapasabdavivekahaccn0 946.. Sanskrit.. Religion.. 639 pgs. Sabdha Koustubha.. 1932. Sahiti Jagathi... 1973.. . Theology.. 1981... 266 pgs.. T. 1956.. 0. Not Available. 558 pgs. 814 pgs. Unknown. 1976.. Unknown.bhatt. Sahityasara.. Sanskrit Grammer. shivnath khanna.. 1979. M. Sanskrit.ramanatha Deekshithar. Sahithya Rathna Kosah Thruthiya Khandamu. Chaturveda Shastry. 1982.a. 944 pgs. Pushpa Srivatsan. History.. 1886 pgs. Sanskrit. Sahstra Deepika Of Partha Sarathi Misra. Unknown.. 1987. 450 pgs. P V Kane. Srotaranay Tarakavachaspati abhattacharya. 0. Sanskrit. Sanskrit.... Dr B R Shastry. Sanskrit.. Sagaud'a Paadiiya Kaarikaathara~va Vediiya Shhashht'hiya Khand-d'a Grantha 10. Sanskrit. Sri Haribhadrasiri. 1982. Sabhashyatatvarthadhigamsuthrah. Literature. 634 pgs. .. 188 pgs. 188 pgs.2/14/2011 A list of scanned Sanskrit books at III… Sabdakalpadruma Kanda Ii. Kaloori Hanumanthrao. Unknown. Sahasra Yogaha. Monier Williams. Sanskrit. Literature. Sahitya Darpanam. Unknown. Rama Krishana Misra.. 412 pgs.. 249 pgs.. Unknown. Sanskrit.. 420 pgs. Sanskrit. Biography.… Samanya Vedanta Upanishad Mahadevshatrin Religion Theology Sanskrit 1921 556 pgs 45/167 . Sabhasha Arthavedika Vishaysoochi.. Language. Theology. 494 pgs. Sri Durga Prasad Divyedaen. 1953. 485 pgs. Sahitya Vimarsa.r. Geography. Aomesvara Sharma. Sanskrit.. Samaarang-gand-asuutradhaara Prathama Bhaaga. Sanskrit.. Sakuntala. 84 pgs. Unknown. Sanskrit... 764 pgs. Unknown. 110 pgs. 1939. Unknown. Sanskrit. 394 pgs. 1802. Sanskrit. 1913. Unknown. 1974. Sanskrit. Shriibhojadeva Mahaaraajaadhiraaja. Sadaashivaraavabhaauu. Sanskrit.. Sacitra Prasuti Tantra. Sabdartha Ratnamu... Sahithya Darpan Of Vishvanatha Paricchedas I Ii X. Religion. 498 pgs.. Unknown. Unknown. Sama Veda Rahasya Ganam.. -.. Sanskrit.. 142 pgs. 94 pgs. Sanskrit. 498 pgs. Literature. Sanskrit. Sanskrit. Unknown.. 0. -... Sanskrit. 1945. Theology. Sahitya Sudhalehari. Sanskrit. Nalinaksha Dutt... 151 pgs. 1957. Sahityaratnakara Of Dharmasuri Part I I. Saddharmapundarika. Sanskrit.. Sanskrit. 1949. 292 pgs. Sanskrit.. Sabhashya Rathna Manjusha.radloff. 1936. Sahitya Darpan.. Unknown. 1994. Khubchandraji Siddhanthashasthri. Sabdanusasana. Stotras. Sanskrit. 88 pgs.. Literature. Saddarsanasamuchchaya.. Sanskrit. Unknown. Sadguru sri Tyaga Brahma Pushpanjali. 388 pgs. 1962. Sahitya Darpan (vimla).. Sahityaratnakara Of Dharmasuri Part I I I. sanskritdocuments. Hari Damoder Velankar. . Unknown.. 101 pgs... Unknown.. 348 pgs. Pandit Bhatta Yogi Dikshit. 1911. Religion.. Mayuram Sri M.. 1951. Unknown. Sanskrit. Linguistics. Bhagavata Shan'karaanan'da. Sanskrit.org/…/SanskritIIIT.. Pandith Bechardas J Doshi. 623 pgs. 174 pgs. Linguistics. W. Sri Madachutaraya. 1906. 408 pgs. ekanath dattatraya kulkarni. Sanskrit. The Arts. 272 pgs. 0. 1961. Unknown. 1981... Radhakanthadev. Dr P Sri Ramachandrudu... Unknown. Unknown.

Literature. Linguistics Literature. 0.. Samaskrit Basha Vibushanam.balasubramanyam. Sanskrit.. V. Sanskrit.. Samskruta Vyakarana Sastra Ka Ithihas Part . 1965. Satya Srinivasa Ayyangar. Language. 233 pgs. .. Sanskrit. Sanskrit. Literature. Sanskrit.org/…/SanskritIIIT. Linguistics. Language. Samaveda Samhita. Pandit M Suryanarayana Shastry. Samskruth Chittah Trutiya Bagh. 0. 266 pgs. . Sanskrit. 0.. Samkalpasuryadaya. sanskritdocuments. Language. 263 pgs. 0.. Literature.... Samgitaratnakara Vol I V Ashyaya 7. 556 pgs. 1937. 1990. Sanskrit.. Art. 84 pgs. C.. Samsara Chakram. 1983. .. Unknown. Samskrita Akshara Siksha. Unknown... Linguistics Literature. Samskruth Natakome Athi Prakruth Thatv. Sanskrit. Sanskrit.v. .. pandit s subramanya sastri. Religion. Samsara Chakram. Sanskrit.. 452 pgs.. 454 pgs. Sanskrit. Unknown. 1948. Krishnamacharya. 1943. Bhavavibhuti Bhattachary. 1992. Samskrutha Bhakthamala. Samskrita Swayam Sikshak Praba. Mahadevshatrin. 104 pgs. 384 pgs. 0. 436 pgs. Sanskrit. Subbrayudu.. 0. 1925. Sanskrit... Sridhar Bhaskar. Sanskrit. Linguistics.1..... Mulchandr Patak. Trutiya Kanda.. 364 pgs. Sanskrit. Samarrngara Sutradara Vasthu Sastram Mulamatram. 407 pgs.. Unknown. Samskrtu Vadumaya Kosa. Sanskrit. 0. Sri Gowrishankar Sastri. Gosvami Damodara Sastri.. Sanskrit. 144 pgs. . Shrikrishanamani. Samkalpa Suryodaya Of Venkatanatha Part 1. Literature. 1961. 226 pgs... Samskara Prakasika. 490 pgs. Jithendranath Shukla. Samskruta Sukthi Sagar. 288 pgs. Theology. 0.. Samarad'gand-asutradhaara Bhaaga 2. Shriibhojadeva.. Sanskrit. Samkalpasuryodaya Of Sri Venkatanatha. 98 pgs. Unknown. Sanskrit.... Linguistics. Samskrta Kavi Jivitam Part Ii. 0. Linguistics. Samavedasamhita. Sanskrit. Satyavarata Samasarami Bhattacharyyaa.. Sanskrit. Samskruth Sukthi Sagar. R. 0000.. 440 pgs. 0. Theology. Linguistics Literature. 568 pgs. Sanskrit. 1983. Theology.. 136 pgs.. Sanskrit. Sanskrit. 1965. Language. Unknown. 1921. 736 pgs. Sanskrit. Samskrit Baladarsa. V. Religion. 1935.. 422 pgs.krishnamacharya. 615 pgs.. 0. 634 pgs. Yudishtar Mimasak. -.. Unknown.. Vidyasagar k L V Sastri. Literature. 323 pgs. 1948. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Samanya Vedanta Upanishad. Sanskrit.... Literature.. Sambapuranam (upapuranam). V.. 587 pgs. . Samkhyayogadarsanam. Sanskrit. .… Samskrutha Sikshamajyarayaha Bhattacharya Sanskrit 1934 143 pgs 46/167 . 2000. Samskruta Vanmaye Chandrah. 0. 1982.. 0. 102 pgs.. -. Samaveda Samhita Volume Iv.. Unknown. Unknown. Samarangara Sutradara Vasthu Sastram Mulamatram. Pandith S Subrahmanya Sastri. Literature.. Samskaranrusimhaha. Unknown. Samgita Rathnakara Vol 1. Sanskrit. Samskruta Sahitya Silanam. Sanskrit.. 0. 95 pgs. 424 pgs. 103 pgs. Religion.. 557 pgs.. Pandit V... 166 pgs. Unknown... Literature. Ramji Upadhyaya.. 226 pgs.. ... Samskritha Prathibha Vol I. Sanskrit..krishnamacharya. Narayana Swamy. Sriramdeen Cheturrvedi. Sanskrit.. . 1948. Dr. -. Sanskrit. Linguistics Literature. Sanskrit.. Unknown. 0. 1963..

86 pgs. Shaastri Bhaaskara.. Sangita Chandra (a Trearise On Indian Dance).. Biography.. Language. Sanskrit.. Sanskrit. Gummaluura~yupanaamaka Sang-game Shrvarashaastrind-a. 1943. 1928. 0. Theology. Sanskrit.. Psychology. 1950... 1899. Art. Hajari Prasad Divyedi. Others . pandit s subramanya shastri. Chimnaajii Gand-esha. Mathura Prasad..... 406 pgs. 1941. 638 pgs.. Sanskrit. Atri Samhita. Biography. 180 pgs. Sanskrit... Samtanantarasiddhi Vol Xix. 822 pgs.. Unknown. Samurtar Chanadhikarana: Atri Samhita.. Unknown.. Sara~jnj-aatmamuni.. 1933. Samyasara Of The Nature Of The Self... Sangita Chandra. Sandhi Chandrika. Geography. Sanskrit. 603 pgs.. 173 pgs. 298 pgs. 176 pgs. Sanatsu Jatiya.33. Sangeetanjali. Art. 1934. 1953. Theology. San'qs-epashaariirakama~ Da~vitiiyo Bhaaga. San'skrxtapadyavali. Sanskrit. 1992.. Sanskrit. Pandit Omkarnath Thakur. Unknown.. 312 pgs. Atri Samhita. Samvedika Sri Subhodini Paddhati. Bhattacharya. Sanghameswara Krodam. 237 pgs. Samveda Vachaspathi. Suklapandita. Rigveda Samhita. Sanskrit. 1677. 1947. 1931.. 1960.… Sangitopanisat Saroddhara vacanacharya sudhakalasa Unknown Sanskrit 1961 198 pgs 47/167 .. V. Sanskrit.... Sri Kunda Kunda. Samyasara Of The Nature Of The Self. Natural Sciences. 0. Bhaand-d'aarakara~ Raamakrxshhnd-agopala. History.. 143 pgs. Linguistics. Poonam Niraula. Vaidaya Si Vi. Literature. Sanskrit.. 1899. Geography.. Religion... 455 pgs. Sanskrit. Unknown. Unknown. San'qs-ipta Vaalmikii Raamaayand-a Trxtiiyo Khand-d'a. Social Sciences. Sri Kunda Kunda. Unknown. Sanskrit. 1950. Sandesh Rasak. Sanskrit. San'skaara Paddhati Grantha 94. Sanskrit. 230 pgs. Aalatekara Maadhava daamodara. Sangitaratnakara Of Sarngadeva Vol 4 Adhyaya 7. 154 pgs. Suklapandita. Sara~vajnj-aatmamuni. 1913. 1987.33. Unknown. Sanskrit.. 560 pgs. Religion.. San'skaararatnamalaa Prathamo Bhaaga. Sanskrit... Bhat'a~t'agopiinaathadiiqs-ita. Unknown. San'skrxtavaachanapaat'hamaalaa Dvitiiya Khand-d'a.. 439 pgs. Sanskrit.org/…/SanskritIIIT.. 1921. 212 pgs. Vaamana Kaane Paan'd'uran'ga. San'skaararatnamaalaa Uttaraara~dama~ Bhaaga 2. Others . Gopinathadiiqs-ita Bhat't'a. Sanskrit. Literature.. 386 pgs. 72 pgs. sanskritdocuments. Sanskrit. 82 pgs. 267 pgs. 0000. Sanskrit. 331 pgs. 1934... Samtanantarasiddhitika. Sanskrit. 270 pgs.. 462 pgs. Sanskrit. 1982. Sandhi Samasa Manjusha.. Language. Philosophy. Psychology.. Sanskrit. 1955.. 405 pgs. Atri Maharshi. Sanathakumara Samhita.. 244 pgs. 1924. 1982. Theology. Religion. Linguistics. Sanadaapatraan'tiila Maahitii. San'skrxtamandiraantah Praveshikaa. 406 pgs. Unknown. Sanskrit. 1953. . Sanskrit. Pandit S. Natural Sciences.. Gand-eshaa Shaastrii Laqs-mand-a. Sanskrit. History... 1918. Sang-game Shrvarakrod'ama~. 1917. Sanskrit.. Sri Ramachandra Jha Vyakarnacharya... Sangitaratnakara Of Sarngadeva Vol I.. San'pura~nd-a Aagarakara Bhaaga 2..2/14/2011 A list of scanned Sanskrit books at III… Samskrutha Sikshamajyarayaha.. Philosophy. Sanskrit.krishnamacharya.. 80 pgs. 1918. San'qs-epashaariirakama~ prathamaadhyaayarupa Prathamo Bhaga.subrahmanya Sastri..

Sanskrit. Unknown.s. Sanskrit Saiva Kavyas Vol I. 1930.. -. Sansar Sagar Manthanam Vol Ii.. Ramashankara Bhattacharya. 1976. Language.. 0. Unknown.. Sanskrit Journal Sahrudaya Part 8.... G. 0. Sanskrit Drama Its Origin And Decline. 68 pgs. Sankya Darshan... 650 pgs.. 1953. Sanskrit. Sanskrit Gadhy Padhy Sangraha Vol I.. 0. 107 pgs. Sanskrit. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… Sangitopanisat Saroddhara. Language. 758 pgs.. Sanhit. Sanskrit. Vyasacala.. 131 pgs. Sangrahartha sangraha. Unknown.. Kanta Gupta. 284 pgs. 1945.... Unknown. 243 pgs.. History. Sanskrit... Sanskrit Syntax And The Grammar Of Case. Linguistics.. Unknown. Sanskrit. 0. Sanskrit Sopanam Vol Iv. Geography..hansraj Aggarwal. Sanskrit English Dictionary Vol 2. 0. Kurt F. 150 pgs.. Sankshepa Sarirakasya Adhyaya I. Sanskrit Manuscripts 2. Shri Brihaspati Shastri.ix. Sanskrit. Sanskrit. Acharya Udhayveer Shastri. Sanskrit. Sanskrit Manuscripts Vol. Sanskrit.p.. 1947.. Sanskrit Essentials of Grammar and Language. Sanskrit. Sanskrit Sahithyothihas Vol. -. 1994. 1960. 302 pgs. 266 pgs. 102 pgs. Leidecker. 1994.. Unknown. Linguistics Literature. Literature. Unknown. Sanskrit. Sanskrit. sanskritdocuments. Sanskrit. Sanskrit Journal on Sahrudaya.. 667 pgs. 50 pgs. 2002. 110 pgs. Sankara Bhashyalochanam. P K Gode. 62 pgs. Unknown. Sankaravijaya. 1980. Unknown. Unknown.... Sanskrit Gadya Padya Samgraha. Linguistics. 1987. Sanskrit Ratnakarmay Shigyandank. 1976. Gopala Bhatta. Sanskrit.. 0. Not available. Sanskrit Text Book For Detailed Study 1962.. -... Sanskrit. 2002.. Unknown. ... -. 198 pgs. Sanskrit. Pandith Rajesh Dixit. Sanskrit. Unknown. 1961. Unknown.. Religion. 1985.… 48/167 .. 1956. Sanskrit. .upadhaya.. Sankhyayana Grihya Sangraha.p. Sanskrit. Pandit Krishnama Charya. Unknown. Sankhya Darshan Pravachan Bhashya. Pandit Vruddhi Chandra Sharma Shastri. Sanskrit Bhashamahe. Sankskrutha Gantha Suchi.sriram Sharma Acharya.. Unknown.krishnamachariar. Brahmachari Surendra Kumar. 435 pgs. 456 pgs. Sanskrit Nibandhavali. Sanskrit. 1959. Unknown. 1948... Sri Brahaspati Shastry. Sanskrit. Theology.. 684 pgs. Sanskrit.. 164 pgs. Unknown.. Sri Vijnana Bhikshu. Sanskrit. 0. 467 pgs. S. Unknown. Unknown.. Sankhya Darshan Ka Ethihas. I Shekhar. Unknown. 254 pgs. Literature... 588 pgs.. P. Sanskrit Text Book For Detailed Study. Sanskrit. Surendra Kumar Gambhir. 146 pgs. Sanskrit. Biography. Thibaut.venkataramanan.. . 1976. 523 pgs.. 146 pgs.... Unknown. 1958.. 0. vacanacharya sudhakalasa. Sanskrit. Pt. Sanskrit Text Book For Detailed Study 1960. 1886...1. Sanskrit. 377 pgs. Sankhyadarsana. 352 pgs. Pro. Sanskrit.. 118 pgs. Hari Narayan Dikshit..org/…/SanskritIIIT.. 1963.. Sanskrit. 260 pgs. 1940. Literature. Sanskrit Bhasha Bhodhini Vol I I. 644 pgs. Unknown. 70 pgs. Sastri.. Unknown. Language. Sanskrit. 1954. K. Sanskrit. G. 207 pgs.. Sree Purushottam Lal Srivastav.. Unknown. Sri T K Tiruvenkatacharya. Sankalp Suryoday Vol I.. Unknown.. Narayanacharya. Krishnamachari. Unknown. 1947.. Sanskrit. Sanskrit. 435 pgs. 0.

prabhanjanacharya.. 70 pgs. History.. 404 pgs. Literature. Literature. 100 pgs.. Sri Guru Prasad Shastry... Sanskrit. Unknown. 420 pgs. -.. 1930. 58 pgs... 42 pgs. Unknown. 302 pgs. Biography.. Religion. Pandith Sripad Damodar Sathvalekar. Unknown. 44 pgs. Sanskrith Kathasagar. Lele Laqs-mand-agand-eshaastii... Sanskrit. 366 pgs.. Sanskrith Paath Mala Vol Ii.. Sri Vadirajathirtha.... Sanskrit. Sanskrit. Sanskrit. Sarasvata Vyakaranam. 1985. Janardana Pandeya.. Sanskrit. Acharya Paramanand Shastry. 1927. 1996. Sanskrit. Sri Naraharishastry. Unknown. Chaturya Lal... Pandith Jeevaram Upadhyay. Dr. Unknown. Sanskrit Text Book For Detailed Study 1967. Santati Shastra.. Sanskrith Paath Mala Vol Ix.. Unknown. 0. Sanskrit.. 1990. Linguistics... 1950. 1976. Unknown...... Unknown. V. 57 pgs.kapildev Devedi Acharya. Unknown. 300 pgs. Unknown. sanskritdocuments. Sanskrit. Sanskrit. -. Sanskrit. Sanskrita Sahitya Itihasa Khunjka.. Sanskrit... Babu Ayodhya Prasad. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit Text Book For Detailed Study 1963. 0. Sanskrit. Unknown. Sanskrit. Geography. Jagdish Kumar. Krishnagopal Goswami Sastri. Sanskrit. 1949.. Sanskrit. 60 pgs.. 174 pgs.. 418 pgs. Sanskrit. Sanskrit. Sanskrit.. Garikapati Laxmikanthaiah.… 49/167 . Unknown... Sanskrite Panchadevastotrani. Sanskrith Paath Mala Vol I V. Benfey T H. Sanskrit Vyakaranam. 116 pgs.. Sanskrita Shiksha 1. Sanskrith Sopanam Vol Ii. Unknown.. 84 pgs. -.. 1981. Sanskrit. Unknown. 1950. Sarasabharati Vilasa.. Sanskritkavicharcha. Religion. Pandith Rahul Sanskruthanen. Sanskrit. 0. Sarasvanth Vyakaranam Poorvadharma. Unknown. 0.. -. 1843. Unknown... Sanskrita Kavya Kanthah. Unknown. Ramchandra Sharma. . Sanskrit.. 315 pgs.... 0. 1942.kapildev Devedi Acharya. 146 pgs. 336 pgs. Sanskrit. Sarasabharathi Vilasa. 410 pgs. 0. 324 pgs.kapildev Devedi Acharya. Sri Rurthar M Mikanal. Sanskrit. Sanskrith Grammar. Dr. 1982.. Unknown. Sanskrit. 1868. Unknown. Sanskrit.. 0. Unknown. 70 pgs.. Mangesh Patkar. Sanskrxtavaachanapaat'hamaalaa Da~tiiya Khand-d'a. Language... Sanskrit. Unknown.. Saradiyakhya-namamala of Harsakirti. -. Unknown.. 62 pgs. 2002. Sanskrit. 1990. 122 pgs. Sanskrit Vyakaran Praveshika A Sanskrit Grammar For Students. 214 pgs. Sanskrita Shiksha 2. Sanskrit. 1955. 133 pgs. Saralaayurved Shiksha. Unknown. 48 pgs..m.. 475 pgs... Sarasvatibhavana Granthamala Volume X. Santi Prakasa. Pandit Ram chandra Jha. Sanskrit. Dr. 1951. 0. 1927.. Philosophy. 0.. Pandith Sripad Damodar Saatvalekar. 132 pgs. Unknown.. Sanskrit. Sanskrit.. 166 pgs. 110 pgs. 1982. Gopinatha Kaviraja. Surendra Kumar Gambhir. 1956.. Surendra Narayana Tripathi. Pandith Sripad Damodar Sathvalekar. Sanskrit Text Book For Detailed Study 1964. 40 pgs. Linguistics Literature. Sanskrit. Sapindya Kalpalatika. Sanskrita Shiksha 3. Unknown. 1928.. 133 pgs. 1973.org/…/SanskritIIIT. Sarasvata Home Of Kalidasa. -. Sanskrith Siksha Vatika Vol Iv. Sarasangrahah.. Sanskrith Paath Mala Vol X I I... 0. 0. Sanskrith Siksha Vol Ii. Unknown. 72 pgs.

Sanskrit. 431 pgs. Sastri Dipika. Geography. Sanskrit.... Philosophy. Sanskrit.cowell.. Sri Pradhacharya Vidwanandi.. Sanskrit. 164 pgs. E. Sanskrit. Saraswathi Suhama Vol 53 Mar Dec 1998-99. Sanskrit... Mangesh Patkar. Unknown... 0. Religion. Vaidya Shivacharan Dhyani. Pandit Rama Krishna Kishra.shama Sastry.org/…/SanskritIIIT.m.. sanskritdocuments. Chin'taamand-i Ti raa. 1973. 1937.. Literature. History. 214 pgs. Sarvasiddanthasara Vivechanam. Theology. History. Unknown. 162 pgs... Anundoram Barooah.. 1916. Language. Sanskrit.r. P. 539 pgs. bhatta vasudeva.. 0. Sarvedic Prasnothari. Biography. Sanskrit. Saraswati Vilasa (vyavahara).. 166 pgs... Sastra Dipika.sastri. 1951.r. 212 pgs.. Saraswathi Sushama Vol 37 (1-4). 431 pgs. 402 pgs. 0. 226 pgs. Sanskrit... Sanskrit. 1935... Linguistics. Chinnaswamy Sastri. pgs. Saraswari Kanthabharana. Unknown. 1995.. Unknown. 1951. Pandit Sri Vishveswara Jha. 1940. Sastra Siddhantha Lesa Sangraha. 1901. Sanskrit.. Philosophy. 206 pgs. Sanskrit. Unknown. 1935. 158 pgs.. Gopi Natha Kaviraja.shama Sastry. Saraswathi Sushama Vol 37 (1-4). Vageesha Sastry. 357 pgs. Sanskrit. . Sarvadarshana Sangraha. 80 pgs.. Satha Dushini.. Sastra Siddhantalesasangraha Volume I. Vedas. 1915. 1983.. Geography.. Unknown. Unknown.... pgs. Biography. . 1935.2/14/2011 A list of scanned Sanskrit books at III… Sarasvatii Kand-t'haabharand-ama~ Bhojaadevaa. Sastra Darpana. Sanskrit. 400 pgs. 1927.. 241 pgs.p. Sathyaashhaad'ha.. Philosophy. Geography. Sasthramuktavali. 1986. . Unknown. Sanskrit. Sanskrit. . S R Krishna Murthy Shastry.. 1927. Satha Dushini. 405 pgs.r.… Satikathraya Sri Valmiki Ramayanam Utthara Kandam Sanskrit 0 2090 pgs 50/167 .. Sri Sankaracharya. Sanskrit.. Sarth Jnaneswari. Sri Nanamaharaja Sakhare. Unknown.. Raobahadur Gangadhar Bapuraj Kate.m. Unknown.. Sanskrit... Unknown. Sanskrit.. Pandit Rama Krishna Misra. Biography.. Philosophy. 185 pgs. 694 pgs. Sarkara Srinivasavirachita Tatvaprakasika. Sarvavednta Siddhantasarasangraha.. 1927. History. Sanskrit... Vedanta Desika. Language.. Dr. Unknown. Unknown. Sanskrit. Saraswati Bhavana Texts Part Ii. Sanskrit.. 1969. Unknown. Anubhavananda Swamy. Sanskrit... pgs.. Shri Nanamaharaja Joshi Sakhre. Literature. Sardh Jnaneshwari. Philosophy.. 1927. 880 pgs. Saraswatha Vyakaranamu Purvardhamu. Dr. Unknown. Srimadvijayeendrateertha.. 182 pgs. Religion. Sathavarthmala Sampoorna. Theology. 544 pgs. 1986.. 1952. Sanskrit. Sanskrit. Unknown. Geography. 382 pgs. Sanskrit.s. Sanskrit. Sathya Shasan Pariksha.. 340 pgs... History. 456 pgs. Biography. 1967. 0... 0. Dr. 0.. 120 pgs. Sanskrit. Ramchandr Savath.. Sri Amalananda. Mangesh Patkar. Religion. Linguistics. Satapada Brahmanam. Sanskrit. 1950. Sarira Kriya Vijnaniyam.shama Sastry. 562 pgs. Literature. 1913.. Sanskrit. 1912. 233 pgs. Sathyaashhaad'havirachitamn' Shraotasutrama~ Shhashht'o Bhaaga. Sanskrit. Sarva Darsana Sangraha Of Madhavacarya. 1964. Sarva Siddhanta Sourabham. Saraswati Sushma Vol 37 1 4. Saraswathi Suhama Vol 53 Mar Dec 1998-99. 401 pgs.. . Sanskrit. 1957. Sanskrit.. Satha Dushini. 241 pgs..b.

Sanskrit. Select Sanskrit Inscriptions. 2090 pgs. 1987.. 1932. Religion. Satyaashhad'ha. Unknown. Religion.. Theology. 455 pgs. Prof. 0. Religion.... Satyaashhaad'havirachitan' Shraotasuutrama~.. Linguistics. N. 140 pgs... 400 pgs. Seleqs-ansa~ Phrama~ San'skrxta~ Insa~kripshhansa~ Para~t'a~ 1 Tekst'a~. Shaan'karapaadabhushand-ama~ Da~vitiiyo Bhaaga. 73 pgs. Unknown. Religion.… Shaan'karapaadabhushhand-ama~ Prathamo Bhaaga. 1932.. Vedas. 331 pgs.. Theology. Satyashhad'ha Virachitaman' Shraotasuutrama~ Navamo Bhaaga.. Satyaashhaad'a Shraotasutrama~ Trxtiiyo Bhaaga. Religion.. 1933. Sanskrit. Theology. Aapat'e Vinaayaka Gand-esha. 0. Theology.. Seethaharanam. Linguistics. Haraprasad Shastri.. Philosophy... Satyaashhad'ha. Sanskrit.. Sanskrit. 1908. Theology. Sanskrit. Unknown. 1907. Shan'karaa Chaara~yaa. Sanskrit. Saundarananda Kavya Of Arya Bhadanta Asvaghosa. 310 pgs. 367 pgs. 1925. 350 pgs.. Satyagrahodaya. Sanskrit. 166 pgs. 1907. Sanskrit. Sekoddesatika Of Nadapada Naropa. Sanskrit. Sanskrit. Satyaashhad'ha Shraotasuutrama Trxtiiyaa Bhaaga.. Sanskrit. Religion.. 1975. 165 pgs. Gaadi.. 406 pgs. Religion. Satyaashhad'havirachitaman' Shraotasuutrama~ Dashamo Bhaaga. 138 pgs.. Sanskrit. 1953.. Psychology. Sanskrit. Theology. 1930. Satyaashhad'ha. Satyaashhad'ha. 1927. Sanskrit. Swamy Ghanapathi. Aapat'e Vinaayaka Gand-esha. Theology. Philosophy. Diskaalkara~ Di Bii. sanskritdocuments. Satyaashhad'ha.. Satyaashhad'ha. Religion.. 1969... 125 pgs. Satyaashhad'ha. 359 pgs.. Theology... Dr B R Sastry. Religion. Satprati Pancha Grandhaha. Satyashhad'ha. Theology. Dr... Religion. 51/167 . Saundara~yalaharii Third Edition... . Religion. V...n.. Aapat'e Vinaayaka Gand-esha. Satyaashhad'havirachitan' Shraotasuutrama~ Navamo Bhaaga. Sanskrit. 1941. Religion.. Sanskrit.. Satyaashhad'havirachitan' Shraotasuutrama~ Saptamo Bhaaga. Vedas. Satyaashhad'ha Shraotasutrama~ Da~tiiya Bhaaga. Theology. Sanskrit.. 221 pgs. 144 pgs.. Jwalaprasad Goud. 1939. Literature. Satyaashhad'ha Shraotasutrama~ Da~tiiyo Bhaaga.org/…/SanskritIIIT. Sanskrit. Theology. 1930.. 71 pgs. 370 pgs. . Shriiraghunaathasuri. Sanskrit.. Literature. Sanskrit. Kalluri Hanumanth Rao. Unknown. W.shri Krishnamacharyswamy. 455 pgs. Theology. Sanskrit. 1922. 1908. 1940. Satyaashhaad'a... 212 pgs. Theology.. 1975.. Unknown..2/14/2011 A list of scanned Sanskrit books at III… Satikathraya Sri Valmiki Ramayanam Utthara Kandam. Shaad'a~khaayanaarand-yakama~ Grantha 90. 1929. Theology. 368 pgs. Sanskrit. Sattotravalivibhag. Sanskrit. 328 pgs. 1921. Satyaashhad'ha. Psychology. Mario E Carelli. Religion. Satyaashhad'ha Shraotasutrama~ Chatuura~to Bhaaga.. Sanskrit. Sanskrit. Language. Language.. Saudaryalahari. Saurapuraand-an' Vyaasakrxtama~ Grantha 18.. 169 pgs. 1908. Raghunaathasuuri. Satyaashhad'havirachitaman' Shraotasuutrama~ Ashht'amo Bhaaga. 158 pgs. Karambelkar. Religion..

Sanskrit. 1997. Literature. Sanskrit. 0.. Language. Literature. 524 pgs. Psychology. 1934. 1951. Shabda Kalpadrum Part I I I. Linguistics.. 0. . 0. Raja Radhakanta Deva. 245 pgs. Sanskrit.. Shambhohara Prakasha. Shabdakalpadruma Volume I. Sanskrit. Shabdh Deepika.. Sanskrit... Bhat't'aachaara~ya Gadhaadara. Sir Raja Radha Kanth Dev Bahadur. Sanskrit. 558 pgs. 485 pgs. 0. Shabdashattkiprakaashika. mahidhara sharma.. 2003. Shamakosh sabhayanuvadh.. 592 pgs. Philosophy.. 194 pgs. Language. Religion. Literature. Linguistics. 265 pgs. Sri Madhusudhan. Sanskrit. Sanskrit.. Sanskrit. 1933. Shabda Kalpadrum Dwithiya Bagam. Linguistics. Sanskrit. Linguistics.. Anandagiri. 0. Unknown. Pandith Madhusudhansharamamaithila. Shabda Kalpadrum Part 5. 1988.. 1961. Sharushan-sar-patrika. Unknown. Language.… 52/167 . Shabda Kalpadrum Part I V..org/…/SanskritIIIT. 244 pgs.. -. 1984. Sir Raja Radha Kanth Dev Bahadur. Shriibhara~trxhara Mahaakavii.. Religion. Sanskrit... Sanskrit. sanskritdocuments. . Shang Dhara Samhata. Unknown. Sanskrit. Sanskrit. Chara~yaa Shiva. Unknown. 1954. Shabdhakapadrumaha Thruthiyakandaha. Language.. Ramakanta Angiras. Sanskrit... 294 pgs. Shang-karavijaya. Theology. Vyaasaachala. Sanskrit.. 344 pgs. 0. 1929. 494 pgs. Sharirkvigyanam Vol I. 430 pgs.2/14/2011 A list ofBhaaga.. 438 pgs. Sanskrit. . -. Shabd Kalpa Druma Chaturthi Kandam. 1946. Sanskrit. 8798. Theology. Diiqs-ita Bhat't'o. Unknown.. Sanskrit. Linguistics.. 0. Unknown. 1950.. Language. Sanskrit. Language. Shabda Nirnaya Dipikahsampadanamu. 519 pgs. Raja Radha Kanta Deva.. Shaan karapaadabhushhand ama Prathamo Shriiraghunaathasuri. 170 pgs. Pandit Ramprasad Rajvaidy Patiyal. Tara~kalan'kaaraa Shriijagadiisha.. Shankara Bhashya Sametha. 116 pgs. Babu Zalim Shing. Shareerak Vignanamu Dwithiya Bagamu. 278 pgs. Sanskrit.. Sanskrit. Dr B R Shastry. Shaastratattvavinira~nd-aya. 345 pgs. Ramswaroop Sharma. Prabhakara Prasad. Shadkar Vijay. 1932. Literature. .. Linguistics. 945 pgs... 790 pgs.. -. Sanskrit.. Language.. Kantha Dev. Unknown. Shabdakalpadruma Volume V. raja radha kanta deva. scanned Sanskrit books at III… Philosophy. . Psychology. Unknown. Sanskrit. Sanskrit. Kaatare Sadaashiva Laqs-midhaaraa..... Unknown... 340 pgs. Shabd Kalpa Druma Padama Kanda. Sanskrit.... Sanskrit...r... Shakttivaada. Sanskrit. 1961.. Shabdhakapadrumaha Panchamakandaha. Theology. 0. 818 pgs. Literature.. Sanskrit. Sanskrit.. 802 pgs. Literature. 289 pgs. 0. Psychology. Theology. 147 pgs.. 1822. 1949. Shastavakru Geeta. 247 pgs. 340 pgs. Philosophy.. . Unknown. Shabda Kaustubha Prathamo Bhaaga. 573 pgs. Unknown. Unknown. Unknown. 324 pgs.. 1979.. Linguistics. 1961.. Shadgadhara Samhitha. 1927. Sanskrit.. 1822. Unknown... Literature.. Shabdhakapadrumaha Chaturthakanda.. 652 pgs.. Raja Radha Kanta Deva. Sanskrit. Sanskrit. 569 pgs. 557 pgs. 1909. Unknown. Religion. Vedas. 1949.. Bhat't'ojiidiiqs-ita. Shatakatratama~ Bhaaga 9.. Shabdakaustubhah Da~vitiiyo Bhaaga. Literature.. 1961... Shaiva Paribhaashha. Shanker Vedanta Ek Annusheelan. Religion.

Religion. 1951. Shivajataka. Religion.. Vishwanath Shastri.. 168 pgs.. 1940. Unknown. 1957. Sanskrit. Satyaashhad'ha. Unknown.. Viiraa Raghu. Shri Ramacharanpurikruth. 936 pgs... Unknown. 1854. Sanskrit.. Shivacharitra Saahitya Khan'da 3 Ra. Sanskrit.. 302 pgs. Sanskrit. Theology.. History. Sanskrit. 1927. Shriimachchhan'kaarachaara~ya. Shraotasutrama~ Chatura~tho Bhaaga. 105 pgs. Geography. Satyaashhaad'ha. 200 pgs.. Krishna Kaura Mishra.. Biography. Unknown.Brahmanam Part Ii.. Sanskrit. Satyaashhaada. 127 pgs... Shraota Suutrama~ Shhashht'ho Bhaaga Grantha 53. 608 pgs. Sanskrit.. Unknown. Unknown. Social Sciences. Sanskrit. Srimathi Urmila Devi Sharma.. 1928. Aapat'e Hari Naaraayand-a. Sanskrit. Theology. Sanskrit. Shradhamanjari.... Shivaraj Vijay. Theology. Sanskrit. 909 pgs. 84 pgs. 1893. Theology. 209 pgs. Unknown. 360 pgs. Shraadhdamanj-jarii. Sanskrit. Shilpa Shaastrama~. Geography.. Sanskrit.. Theology. Shatpath Brahman. Vaasudevananda Pa Pa. 1972. Shri Hari Swami.. Theology. 1919.... Sanskrit... 152 pgs. 1929.. Sanskrit. 1868. Shatpath . Joshii Shankara~naaraayand-a. 816 pgs. Narayana Ram Acharya. Theology. Shiva Samhita. 1907. 288 pgs. Theology. Shatpath Brahmanam Part V...... Theology. Religion. Shraotasutrama~ Prathama Bhaagah. Unknown. 438 pgs. Theology. 221 pgs. Biography. Religion. 1927. 893 pgs. Sri Narendraprasadji Maharaja Sri Ni. Pandit Sreemathru Prasadha Pandeya. Shatpath Brahmanamu Part Iii. 1908. Unknown. Sanskrit. 1940. Shiqs-aatrayama~. 52 pgs. Shraotasuutrama~ Panj-chamo Bhaaga. Shraotasutrama Bhaaga 2. 1940.. 1997.. Sanskrit... Sanskrit.. 1927. Religion. 360 pgs.. 1928. Shatpath Brahmanam..2/14/2011 A list of scanned Sanskrit books at III… 212 pgs. Sanskrit.. Shraotasuutrama~ Saptamabhaaga.. Sri Vasudeva Brahma Bhagwat. Aagesh Ithyupavedattatreyashastry.. Sanskrit. sanskritdocuments. Unknown. Religion. 337 pgs. Shraotasuutrama~ Ashht'ama Bhaaga.. Religion.. Sanskrit. 0.. 0. 135 pgs. 0. 1909. Sanskrit. 1930.. 400 pgs. Sanskrit... Shraotasuutrama~ Panj-chamo Bhaaga. 1908.. Religion..madannatkrishnshastrikrut. Vedas.org/…/SanskritIIIT. Satyaashhaad'ha.. Shraota Suutran' Dditiiyo Bhaaga Grantha 53. Shiksha Patri. Theology. Religion. Shatapatha Braahmand-ama~ Dditiiyo Bhaaga. Theology. Shri Anka Kavya. Shivacharitra Pradiipika. Shishupalvandh.. 1982. Aapaat'e Da Vii. Sanskrit. 404 pgs. Sanskrit.. 1907. 1935. Sri Guruprasad Shasrti. 317 pgs. Shatbhushni Vol-1. 404 pgs. Religion. History. 225 pgs. Sanskrit... Unknown. Satyaashhaad'ha. 160 pgs. 1847. 1939. Satyaashhaad'ha. 62 pgs. Satyaashhaad'ha. Sanskrit. Shatgidhara Samhitha. Shatashlokii Aavrxtti tiisarii. Sanskrit. Srimat Travibhashyakar Sayanacharya. Unknown. Religion. Satyaashhad'ha. 310 pgs. Sanskrit. Sanskrit.. Shrautapadarthanirvachanam... Religion. Religion. Shrimat Trayibhashyakar Sayanacharya. Bosa~ Phaniin'dranaatha~..… Shri Madbhagvadgeeta Vijay Chandra Varmanujya Unknown Sanskrit 0 340 pgs 53/167 . Theology. Theology. 315 pgs. 0.. Vedas.jetendriya Charya. 254 pgs. Sri.. P. Satyaashhaada. Sanskrit. Religion.

1874... Mahaakavii Shriishaktiibhadraa.. 373 pgs.. Shrii Paraatrin'shikaa Grantha 18. Sanskrit.… 54/167 . Language. Social Sciences.. -. Religion.. Psychology. 1918. Psychology. Paramadiishvaraa. Chaara~yand-a Shrii Krxshhnd-a Priyaa. 2001. 1851. Unknown. 611 pgs. Shriimanniilakand-t'haa. Linguistics. Literature. Language. Shriishang-khadhara. 1917. Philosophy. Psychology. Linguistics.. Philosophy. 1978. 219 pgs. Theology. Linguistics. Religion.. Sri Narayana Charya.. Religion. 0. Linguistics. Shrii Panj-charaatran. Shrii Puraand-a San'hitaa Grantha 89.2/14/2011 A list of scanned Sanskrit books at III… Shri Madbhagvadgeeta. Vijay Chandra Varmanujya.. Bhat't'a Shriinaagesha. 1644. Maarulakara Shan'kara Shaastri. Sanskrit. Shriibhaasa Mahaakavi. Literature.. 1237 pgs. Shrii Mada~ddaipaayanaprand-iita Brahmasuutraand-i Grantha 21.. Sanskrit. Language.. 0. 517 pgs. Theology. Sanskrit... 1927. 167 pgs. Sanskrit. 1951..... Shrii Madabhgavadagiitaa Grantha 44... 1932.. Literature. Social Sciences. Linguistics. Sanskrit. Religion. 82 pgs. Sanskrit.. Sanskrit.. 1933. Aapat'e Hari Naaraayand-a. Philosophy. Jayakrishna Misra. 1933. 473 pgs.. 1916.. Literature. Unknown. Shrii Bhaashyama~ Da~vitiiyo Bhaago Vivrxtyaatmaka. 1923. Shrii Manmahaabhaartama~ Shhashht'hobhaaga Anushhsanapara~va. Sanskrit. 294 pgs.. 161 pgs. 384 pgs.. Shrii Lat'akamelakama Trxtiiyo Bhaaga. Sanskrit. Shri Ram Charit Manas. Gautamamunii. Philosophy. Shrii Sang-gameshvarakrod'ama~. 1903. Sanskrit. Shri Manmahabharathamu Vol 3.. Shaastri Mukundaraama. Social Sciences. Shriihariishaastrii Pand-d'itavara. Language. 1947. 1934. Theology. Shrii Dara~shanodaya. 1846. Sanskrit. Shri Pacchadashi Pitambhari Bhashya. Theology... 278 pgs. 1933..... 642 pgs.. Sanskrit.. Sanskrit. 112 pgs. Sanskrit. Shrii Dayaananda Mahaavidhaalaya Vol 25. Raghunaathaprasaada~ Pand-d'ita~. 1922. Sang-gameshvarashaastrii Gummaluurii.. Sanskrit.. 680 pgs..... Shriimadramaanujaachara~yaa. Unknown. Shrii Madabhagavadagiitaayaa Prathama Dditiiyaadhyaayau. 1933. Sanskrit. Unknown. 808 pgs. Shrii Paribhaashhendushekhara. Theology. Shrii Aashchara~yachud'aamand-i.org/…/SanskritIIIT. Shrii Ashht'adashasmrxtayaa. Literature. Shrii Giitaamrxtataran'gind-ii. Sanskrit. Unknown. 378 pgs. Kara~nd-apura Kavii. Natural Sciences.. 239 pgs. Literature. Shrii Alang-kaarakaustubha Da~vitiiyo Bhaaga. 458 pgs. Sanskrit.. Aapat'e Vinayaka Gand-esha.. 340 pgs. Literature. Shriddisarah. 1938.. Religion. Shri Vidrananya Muni.. Language. Shriinivaasaachaara~ya Laqs-miipuran. Shrii Chitraprabhaa. Language. 612 pgs. Theology. Sanskrit. Linguistics. Sanskrit. Shrii Gautamamuniiprand-iitanyayasutrani. Sanskrit. Religion. 50 pgs. Mumbayyaan. Shri Raghavendra Vijayah. Sanskrit 1933 89 pgs sanskritdocuments. Sanskrit. Sanskrit. Vishvabandhu Shaastrind-a. Goswami Tulasidas... 357 pgs. Sanskrit. 326 pgs. Psychology. 1958. Shrii Madaara~yabhat'iiyama~... 131 pgs.

. Theology. 1927. 94 pgs. Sanskrit. 1921. 299 pgs. Psychology. 1929. 219 pgs. Shriivaasudevaanandasarasvatii Pa Pa. 1947. Religion. 168 pgs. Religion. 1921.. Shriimadabhagavadagiitaa Grantha 92... Sanskrit. Shrii Tantraaloka Shhashht'ho Bhaaga. 326 pgs. Shrii Svachchhandatantrama~ Grantha 31.. Psychology. 1952.. Shrii Madabhinavaguptachaara~ya. Religion.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit.. 344 pgs. 619 pgs. 1924. Psychology. Theology. Taad'apatriikara Shriinivaasa Naaraayand-a. Bhat't'aachaara~ya Gadaaghara.. Shriishriivallabhaachaara~yaa. Theology. Religion. Raamaanujaachaara~yaa Shrii. 215 pgs. Shriigurucharitama~ Da~visaahastrii.. Religion. 1951. Biography. Shriimadaachaara~yadand-d'ivirachita Kaavyaadara~sha. Shriimatsaayand-aachaara~ya. Shriikrxshhnd-ayajura~vediiyataittiriyasan'hitaa Ashht'am Bhaagah. 443 pgs. History. 42 pgs. Theology. 215 pgs. Shriimadaachaara~yadand-d'i. Shriimatsaayand-aachaara~yaa. Sanskrit. Sanskrit. Sanskrit. 1924. Theology. Sanskrit. Sanskrit. 1923... 297 pgs. Shrii Tantraaloka Bhaaga 7.. Sanskrit. 1933.. Sanskrit. Chaara~ya Madraamaanujaa. Religion.. Philosophy. Religion.. Theology. Psychology. Sanskrit.. Theology. Theology.. Sanskrit. Kaula Madhusuudana. Shriimatsaayand-aachaara~yaa. Shriikrxshhnd-ayajura~vediiyataittiriyasan'hitaa Trxtiiyo Bhaagah..… Shriimadand-ubhaashhyama~ Faskiikyuulasa~ 8 Shriishriivallabhaachara~yaa Philosophy 55/167 . 1930. Sanskrit. Religion. Niilakand-t'ha.. Religion. Shaastri Kaashiinaatha. Shriimadand-ubhaashhyama~ Faskiikyulasa~ 9. 330 pgs. 291 pgs. Vallabhaachaara~yaa Shriishrii... 1954. Natural Sciences. 1945.. 1933. Religion. Sanskrit. Shriimadagand-eshagiitaa Grantha 52. 288 pgs. Theology. Shriimadabhagavadagiitaa Grantha 112. 1943. Shrii Sara~vadara~shanasan'graha. Religion. Shrii Shaakttivaadah. Religion.. 1948.. 1919. Geography.. Shriikrxshhnd-ayajuravediiyataittiriiyasan'hitaa Panj-chamakaand-d'arupa Saptamo Bhaaga.. 111 pgs... Kand-t'ha Raajaanakaraama. 264 pgs. 1906. 112 pgs. Philosophy. 1924.. Theology. Shriikhachchhandatantrama~ Panj-chamo Bhaaga Grantha 53. Religion. Theology. Sanskrit.. Theology. Sanskrit. Sanskrit. 374 pgs. Religion. Religion.. Shriimadabhagavadagiitaa Dditiiya Khand-d'a Grantha 34. Shrii Svachchhaandatantrama~ Grantha 52. Shriimadand-ubhaashhyama~ Faskiikyulasa~ 13. Shriimadabhagavadagiitaa Grantha 64. Shrii Vedaara~thasan'graha. Religion. Sanskrit. Theology.. Sanskrit. Theology. Vaamanashaastrii Pand-d'ita.. Shriigand-eshaathara~vashiira~ra~shha Sabhaashhyama~. 89 pgs. 1906. 1927. Philosophy. 393 pgs. Qs-emaraaja. Shriishriivallabhaachaara~yaa. sanskritdocuments. Sanskrit. 761 pgs. Qs-emaraaja. Sanskrit. Shrii Svachchhandatantrama~ Chatura~tha Bhaaga Grantha 47. Religion.. Shriimadand-ubhaashhyama Faskiikyulasa~ 8... Theology.. Theology. Sanskrit. Philosophy. 110 pgs.. Sanskrit. Qs-emaraaja. Shriimanmadhvaachaara~yaa. 1906. Abhinavaguptaa. Theology.... 348 pgs..org/…/SanskritIIIT.. Sanskrit.. 1939...

Shriimadbhagavadgiitaabhaashhyaara~tha.. 1906. Baapat'ashaastrii Vishhnd-uvaamana. Kalanda~ Viillemena~. Shriishang-karaachara~yaa. 29 pgs. Qs-emaraaja~. Shriipurshhasukttama~. 1906. Sanskrit.. Shriishriivallabhaachaara~yaa. sanskritdocuments.. Religion. Philosophy. 1921.. Religion.. Shriimaddevii Bhaagavatama~ Mahaapuraand-ama~. Psychology. Paand-d'eyena Raamateja. Shriimadand-ubhaashhyama~ Faskikyulasa~ 14. Shriimadbhagavadadgiitaa. 639 pgs. 112 pgs. Philosophy. Upaadhyaaya Shrii Baladeva.. Paramaananda.. Religion. Geography. Sanskrit. Sanskrit. Sanskrit. Shriishriivallabhaachaara~yaa. 1931.. Shriishan'karabhagavatpaadaachaara~yaa. Literature. Sanskrit.. Social Sciences..org/…/SanskritIIIT.. 350 pgs. Govindaachaara~ya. Shriisayaajiigauravagran'tha. Theology. Religion. Sanskrit. Shriiqs-emaraaja.. Paramaananda Kaviindra. Theology. Shriimadand-ubhaashhyama~ Faskikyulasa~ 6. 1952. Shriimadbhagavadagiitaa Trxtiiye Khand-d'a Grantha 34. Sanskrit. Sanskrit. Linguistics. Sanskrit. Qs-emaraaja. 1905. Language. 1926. 1906. 1953. Shriisvachchhandatantrama~ Bhaaga 5...... 1939. Shriisvachchhandatantrama~. 112 pgs. Literature. Theology. Religion. Religion. Philosophy. 1875... Aapat'e Hari Naaraayand-a.. Shriimadand-ubhashhyama~ Da~tiiyo Bhaaga Baalabodhinii. 483 pgs. Psychology. Shriishriivallabhaachaara~ya. Shriishivabhaarata. 110 pgs.. Sanskrit. Philosophy. Shriimadand-ubhaashhyama~ Faskikyulasa~ 12. Shriishuklayajura~vede Shatapathabraahmand-ama~ Bhaaga 2. Shriipaarameshrvarasan'hitaa. Sanskrit.. Psychology. 324 pgs. 874 pgs.. Psychology. 165 pgs. 110 pgs. Sanskrit.. Shriimadgand-oshagiita.. Psychology. 1906. 110 pgs. Vallabhaachaara~yaa Shriishrii. Shriimadand-ubhaashhyama~ Faskikyulasa~ 10. Religion.... Biography. 110 pgs. Language. 1936.. 1963.. Sanskrit. Sanskrit.. Theology. Shriimada~vallabhaachaara~yaa. Shriisvachchhandatantrama~ Dditiiyo Bhaaga Grantha 38. Religion. Philosophy. Psychology.… Sh ii h hh d t t G th 31 A h M h h h R li i Th l 56/167 . Theology. Religion. Sanskrit.. Linguistics.. 1935.2/14/2011 A list of scanned Sanskrit books at III… Shriimadand ubhaashhyama Faskiikyuulasa 8. 1923. Shriishivabhaarayama~.. Shriimadand-ubhaashhyama~ faskikyulasa~ 5. 1953. 102 pgs. 1905. Theology. 212 pgs.. Shaastrii Pi Pi Subrahmand-ya. Aapat'e Vinaayaka Gand-esha. 297 pgs. 851 pgs. 1933.. 395 pgs.. Sanskrit. 1368 pgs. 1906. Shriimadand-ubhaashhyama~ faskikyulasa~ 4. Shriimanmahaabhaaratama~ Prathamo Bhaaga. Philosophy. Philosophy.. Theology. Shriiraamaayand-ama~ Prathama Khand-d'a Baalakaand-d'ama~. 626 pgs. 138 pgs. Theology. Sanskrit. Sanskrit... Philosophy. Psychology.. Sanskrit. Sanskrit. Shriivaalmiikimahaamuni Aadikavi. Religion. 110 pgs. Sanskrit. Vallabhaachaara~yaa Shriishrii.. 1933. Shriimatsaayand-aachaara~yaa.. History. Vaad'hdivasa. 1849.. Theology. Psychology. Sanskrit. Theology.. Religion. Theology... 517 pgs. 377 pgs. 1906. Philosophy. 700 pgs. 1926. Sanskrit. Shriishriivallabhaachara yaa. Theology. Psychology... Religion. 1930. Sanskrit.. Shriishriivallabhaachaara~yaa. Sanskrit.

Unknown. 1938. Shrxn'gaaraa Prakaasha Prathamo Bhaaga Grantha 1. 78 pgs.. Sanskrit. Linguistics.... 279 pgs. Religion. 1922. Sanskrit. 1935.. 548 pgs. Unknown. 1940. Theology. Shriivaasishht'adhara~mashaastrama~... 321 pgs. 844 pgs.. Shriman Mahabharatam Part 4 7 Dronaparvan. 177 pgs. Theology. 1910. Shrxng-gaaratilakama~ Da~vitiiya Vrxtti. Theology.2/14/2011 A list of scanned Sanskrit books at III… Shriisvachchhandatantrama~ Grantha 31.. Sanskrit. Sanskrit. Religion. Shriitantralokah Navamo Bhaaga. Sanskrit. 1930. Theology.. Gupta Abhinava. Gupta Abhinava. Gupta Abhinava. 111 pgs.. Sanskrit. Chaara~ya Madaabhinava. 237 pgs.. Religion. 1984.. 340 pgs. 287 pgs. Sanskrit... 1922. 1936. Sanskrit. Sanskrit.. Shriitantraloka Saptamo Bhaaga. Sanskrit. Religion. Dr Abhaya Nath Mishra. Gupta Abhinava. Pandit Ramachandra Shastri Kinjawadekar. Sanskrit. 1936. 351 pgs. 1921. Sanskrit. 1921. Shriitantraaloka Navamo Bhaaga. Sanskrit. Qs-emaaraaja Shrii. Sanskrit. sanskritdocuments. Theology. Aloiisa~ Ant'ona~ fuha~rera~.. Religion. Geography.. Sanskrit.. 1927. K. Shrimad Bhagvad Geeta. Shrutisaarasamuddharand-ama~. Aachara~ya Maaheshvara.. 262 pgs. Sanskrit.. Aachara~ya Maaheshvaraa. Religion. Shriisvachchhandatantrama~ Shhashht'ho Bhaaga. Theology. Raaghavana Vi. Shriitantraaloka....... 93 pgs.. Religion. 1921.... Sanskrit. History. Ram Prasad... Philosophy. 1926. Ant'ona~fuha~rera~. 594 pgs. Language. Shrutikalpalata. Religion. Sanskrit. 301 pgs.org/…/SanskritIIIT.. 342 pgs. Sanskrit.. Shriisvachchhandatantrama~ Grantha 48. Shriiraamabhadradiiqs-itaa. Shrotriyas Of Mithila.. 2001. 1975. Gupta Abhinava. Sanskrit. 1946. Shriitantraalokah Shhashht'ho Bhaaga. Abhinavaaguptaa. 1922. 370 pgs. Theology. Religion. Shriramanageetha.. Shriitantraaloka Ashht'amo Bhaaga Grantha 47. Shubh Santhathi Yogaprakasha. 1924. Theology. Shriitantraalokah Chatura~tho Bhaaga. Jeevanrama Lallurama.. Religion. Religion. 1922. Religion.. 1926. 287 pgs. Religion. Religion.. Psychology.. 1930. Shriitantraalokah Bhaaga 2. Theology.. Sanskrit. 300 pgs. Sanskrit. Guptaa Abhinava. Gupta Abhinava. 1930. Theology. Shriitantralokah Panj-chamo Bhaaga. Religion. Theology. Mulkaraj Sharma. Shrimad Bhagawatam. Shriitantraloka Dvadasho Bhaaga. Niranjananda Swamy. 1938. Shriitantraalokah Ashht'amo Bhaaga. 161 pgs. Gupta Abhinava. 1926. Shriisvachchhandatantrama~ Trxtiiyo Bhaaga Grantha 44. Biography. Theology. Unknown. Religion. Sanskrit. Gupta Abhinava. Sanskrit. Literature. Shastri. Sanskrit. Sanskrit. 105 pgs.. Theology... Shrii Mumbayyaam. Sanskrit. Theology. Philosophy.. Unknown.. 290 pgs.. Philosophy. Unknown... 304 pgs. 280 pgs.. 1912.. Shriivaasishht'hadhara~mashaastrama~.. Unknown. 1931. 282 pgs.. Theology. Theology. Religion. 93 pgs... Srimadvaman Pandith Virchita. 1956. 185 pgs.. 232 pgs. Religion. Theology. Chara~yaa Tot'akaa..… Shukla Yajura~vediiya Kaand-va San'hitaa Saantabalekara Vasantashriipaada Religion Theology 57/167 . Theology. 262 pgs. Sanskrit. Shukasaptati. Aachara~ya Mahaamaaheshvara. Shriitantraaloka Chatura~tha Bhaaga. Sanskrit.

. 1938. 434 pgs. 1942. 317 pgs. Vedanta. Sidhdaantamuktaavalii.. Shukraniiti. Geography.. Shulkayaju Praatishaakhyama~ Dditiiya San'skarand-a. 534 pgs. Sri Vallabhacharya. Jagannatha Shastri.kesavarao Musalgaonkara. Sanskrit... 134 pgs. Linguistics.. .. Jagannatha Shastri. 40 pgs. Siddanta Muktavali Dinakari Ramarudra. Sanskrit.venkata Rao. Saantabalekara Vasantashriipaada. Siddhanta Tatva Viveka Of Sri Kamalakara Bhatta. ... Sanskrit. 166 pgs. Philosophy. 1916. 1937. Sanskrit.. Bahadur Simhaji Sindi. Unknown. Indian Astrology. 0.. Linguistics.g. Unknown. Siddhitrayi And Prthyabhijna Karika Vritti. . 1980... Sanskrit. Unknown. Philosophy. 416 pgs. History. 0. 1929. A C Subbukrishna Srowthy.. Siddhanta Kaumudi Vol 3 Part 1. Dr D Arkasomayaji. Unknown. Unknown. Literature. 112 pgs. Sanskrit. Diiqs-ita Bhat't'o. Anantha Charya. Siddhaantalesha San'graha Bhaaga 2. Siddhanta Kaumudi. Sanskrit.. Yudishtara Mimamsak.h.. 235 pgs. Literature. 1925. Bhat't'oji Diksita. 565 pgs. Diqs-ita Appayya. 235 pgs.. Sanskrit Grammer. Siddhanta Kaumudii Bhaaga 2.. Dr. 404 pgs. Siddhanta Kaumudi Or Bhattoji Dikshit S Vritti On Paninis Vyakarana Sutras. Sindhi Jaina Granthamala. Siddhanta Siddhanjana. Sanskrit.. 1949... kumudranjan ray. Sanskrit. 932 pgs. Sanskrit. 1877.. Sanskrit. Theology. Literature. Sanskrit. Chandra Sekhara. Literature. 234 pgs.. 2002.. M. 474 pgs... Language.. Shvetashvataropanishad. . 1862. Sanskrit. Philosophy. Siddhanth Kaumudhi. Sanskrit. Sanskrit. 360 pgs.s. 0. 0. 1998. Sanskrit. Sanskrit.. Shukla Ysjuhu Shskeysksrams kanda Pradeepa. Diiqs-ita Shriibhat't'oji. Msk Shasthri.. 2002.. Language.. Biography. 215 pgs. Siksha Sutrani.. Pt. Language. Linguistics. Philosophy. Sanskrit. Siddhaantakaumudii. 0. Sanskrit. Sidghnithryam.. Sanskrit.5. 142 pgs. 1959. 1005 pgs. Unknown.... Sanskrit.. sanskritdocuments. Language. Unknown. 679 pgs. Sinjiniyam. Sanskrit. Linguistics. M. 1906. Siddantakaumadyam. Philosophy. Siddhivinishchayatika.. 1962.2/14/2011 A list of scanned Sanskrit books at III… Shukla Yajura vediiya Kaand va San hitaa.. 1499 pgs. Sanskrit. 1990.. 1910.. 249 pgs.. 142 pgs. G.. 1893.. 1960. 1921.sri Sudhakara Dvivedi. Religion. 130 pgs. Sanskrit. Siddanta Siromani Of Bhaskaracharya. Sibrasutra Nrubhatrayam. Unknown. Philosophy.. Pan'chaananabhat't'aachaara~ya Shriivishvanaatha. Linguistics.. Sanskrit. Language. 1937. Siddantha Sidda Gnanam.shastri.. Siddhaanta Kaumudii Trxtiiyo Bhaaga Grantha Maalaa 136. T. 155 pgs. 690 pgs.. Shukraachaara~yaa Shriimada~... Sanskrit. Sri Anantaviryacharya. Siddhanta Rahasyam. Sanskrit. Sidhanthkalpavalli. Psychology.. 1997. 942 pgs.. 1219 pgs. 325 pgs.. Sanskrit. 1916. Sanskrit.. Literature ...… 58/167 . Religion. Technology. Siddanta Chandrika. Theology. -.. Unknown. Sri Chandiprasadshuklashastrina. Unknown. 96 pgs...org/…/SanskritIIIT. Sanskrit. wasudev laxman sastri pansikar. Sisupalavadham. 580 pgs... Literature. Bhat't'aachaara~yaa Jiivaananda Vidhaasaagara.. Sri Ramasram. 1991. Sanskrit. 1929.bhatt.

L. Pandith Sri Ramchandra Jha. 1978.. Skanda Purana Part Ii. Sanskrit. L... Smrxti Chandrikaa Khand-d'a 3 Dditiiyaa Bhaaga. Smritichandrika Iii Vyavahara Kanda Part I. Skanda Puranam Brahma Khanda.g. Literature.. Aapat'e Hari Naaraayand-a. Skanda Purana Volume 1 Index. Religion. Narasimhachar.. Skanda Purana Avantya Kanda Vol7. Sreenivasacharya.. Gand-apatin' Naathaadigurutrayan. Sanskrit. 1875.. 1905.. Religion. Sanskrit.. Skanda Mahapuranam Vol Iii. Philosophy. Language. Unknown. 232 pgs. 252 pgs. 170 pgs. Religion.. 412 pgs. Unknown. Smrxtyara~thasaara Grantha 70. 1959. 119 pgs. 502 pgs.. 122 pgs. R. .. Sanskrit. 179 pgs. Bhat't'aa Devand-a. 1952.. 1982. 1918. Language. Dharaachaara~ya. Unknown. Sanskrit... 1912. Smrityartha Sarah. 102 pgs. Art.. 1916. 1965. krishna Das. Linguistics.. 486 pgs. Bhat't'opaadyayaa Shriiyaajnikadevand-a~. Theology. 944 pgs. Philosophy.. Linguistics. 1899. L. 198 pgs.. Srimadananda Theertha.. Hari Narayana.… 59/167 . Sanskrit.padhya. Skanda Mahapuranam Nagara Kanda. 262 pgs.. Smrutyartha Sagara. 379 pgs. Sanskrit.... Smritichandrika. Sanskrit. Sanskrit. devana bhatta. 470 pgs. Religion. Skanda Purana Kasi Kanda. 474 pgs. 1949. Bhat't'aa Devaanaa. Social Sciences. 410 pgs. . Smrxtiinaan' Samychchaya Grantha 48. Skanda Purana.k. A Ramachandra Ratnaparakhi. 661 pgs. Sotara Siddhanth Kaumudi Prayogsoochi Vol Iii. Smrxti Chandrikaa Prathama Bhaaga. 301 pgs. . Smrxti Chandrikaa.2/14/2011 A list of scanned Sanskrit books at III… Sita Ravana Samvada Jhare. 480 pgs. Unknown.. 1965. Religion.. . Sanskrit.k. Philosophy... Unknown.. 1914. Theology. 328 pgs. Sanskrit.. Somraj Krishna Das. 0. Linguistics. 0. Sanskrit... Linguistics. Smrxti Chandrikaa Shraaddha Kaand-d'a. Sanskrit. Sitaramaviharakavyam Of Orient Laksmanadhvari. Philosophy. Appayya Diksita.. Sanskrit. Sreenivasacharya.. Sanskrit. 1914. krishna Das... .. 0. A B L Awasthi.. 1962. Smritichandrika Ahnika Kanda. Sanskrit. Smruthi Chandrika. Sanskrit. Language. Theology. 1921. Religion... Sanskrit. Smriti Chandrika Sraddhakanda. 334 pgs. Sanskrit. Theology. Sanskrit. 437 pgs. Unknown. Unknown.. 1966. . 1914.. Literature. 423 pgs. Sanskrit. 156 pgs.. Sanskrit. Bhat't'aa Devaanaa.. Sanskrit. Devana Bhatta. Skanda Mahapuranam Vaishnava Khanda. Religion. devana bhatta. 673 pgs. Sanskrit.org/…/SanskritIIIT. Unknown. 336 pgs...srinivasacharya.. 787 pgs. Religion. Smrxtichandrikaa Samskaarakaand-d'ah Prathamah. Smritichandrika Part Ii. 375 pgs. Theology.. 0... sanskritdocuments. 144 pgs.. 478 pgs. Sanskrit. . Theology.. Somraj Krishna Das. . 1966.. . Smrxti Sandara~bha Trxtiiyo Bhaaga. D. Bhat't'a Devand-a. Sanskrit. Smritichandrika. Language. Sanskrit. Smavadamala... Sanskrit. Theology... 1918.. Nag Sharan Singh. Sanskrit.... 1916. Sanskrit. 1914. 1912. 1929.. Sanskrit. Literature. Literature. Sivadvaita Nirnaya. 1914. 1916.

Linguistics. Sanskrit.. 214 pgs. Unknown. V Krishnamacharya. Pandith Sri Ramchandra Jha.. Soundarya Lahari. Sanskrit. Unknown. 126 pgs. Sri Anubhashyam. 1946. Raghunatha Patak. 580 pgs. Sree Skande Mahapurane Panchama Avanthyakhandye.. Unknown. Sanskrit. Sphot'avaada. Unknown.. Sanskrit. 0. 0... 270 pgs. Sree Madbhagavathgeetha.. pgs. 1948. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Sothara Prashnavali Dwithiya Kandamu. 0. Unknown. Unknown. 0. Unknown. Sri Ramachandra Jha. 341 pgs. Sri Bashyam. Linguistics. A Ramulu. 1933. Unknown. Literature. Unknown.. Linguistics Literature. Unknown. Sanskrit. Sanskrit. 258 pgs. Philosophy. 46 pgs... 166 pgs. . 188 pgs. Unknown.. Spota Darsana.. 0. 1946. Sanskrit. Naageshabhat't'a. Sanskrit.. 0... 1956. 1927... Sanskrit. Sanskrit... 682 pgs. Sri Krishna Das. 234 pgs. 194 pgs. 1946. Language. 416 pgs. Sr Madradbagavathgeetha. Southara Pradhama Prasnavali. Sanskrit.. . Sradha Martanda.. 490 pgs.. Sphot'asiddhi Grantha 6. Sri Sundaracharya... Ramayanam. 1930.. 163 pgs. 0. Unknown... Unknown. 158 pgs. Sri Bashya Vimarsana Pariksha.. Sri Acaranga Sutram Part3.. 0.. Vallabhacharya.. Sanskrit... 108 pgs.. . 1931. 1949. 1989. Sakthism.. Sri Ascharyachudamani.. Sanskrit. Govindacharya. Srauta Prayascitta Vidhi.. Sphotavada Of Nagesa Bhatta.. 1992. Krishnananda Natha. 1956. Unknown. Sanskrit. Muni Ratna Prabha Vijaya. Unknown. . Unknown.. 372 pgs. Unknown. Mishra Aachara~ya Mand-d'ana.. Swamy Vishnu Thirdha. 1917. Krishnamacharya. Literature. 130 pgs.. Madhusudan Kaul. 110 pgs.. 1919. -. Sril Narayan Bhattagoswami. 110 pgs. -. Psychology. 1997. Spanda Sandoha Of Kshemaraja. 374 pgs. Unknown. Vedanta... 1907. Sri Bagavathgeetha. Madhusudanacharya. . Southara Prasnavali. Sanskrit. Sradda Viveka. Sanskrit. Swamy Sri Krishnavallabha Charya. 1927. Unknown. Sri Bashya Vimarsana Pariksha. S Levi... Sramana Bhagavan Mahavira Vol 1 Part 1. Mahamahopadhyaya Pandit Mukunda Rama Shastri. Unknown. Linguistics Literature. 0. Language. 598 pgs. 1065 pgs. Literature. Sanskrit. 0. Sanskrit. Literature. Krishna Datta Shastrin... Sotthara Prashnavali Vol I. Soundarnand Mahakavy. 136 pgs. 220 pgs. Sri Bashya Vartikam. Ramdin.. Sanskrit. Sri Ramachandr Jha. 244 pgs. 0.. 46 pgs.org/…/SanskritIIIT. Sphutartha Abhidarmakovyakhya.. 1956. 40 pgs.. Linguistics Literature. Sanskrit. Sri Bajothsav Chandrika. 0... Sanskrit.. Unknown.. Sanskrit Mimansa. 1927.. sanskritdocuments. Sanskrit.. 701 pgs. 439 pgs. 225 pgs. g somayaji. Sanskrit.. Sanskrit.. Sanskrit. 392 pgs. Sri Bashya Vimarsana Pariksha. Sri Ath Madhvanidaanvishayanukramnika.. Sphotavada. Sree Lakshminarayan Samhitha... Sanskrit. Sanskrit. Sree Mrgendra Tantram. Sanskrit. 1952. Sanskrit. Sanskrit.... Unknown. Sraddha Marthandam. Sree Subhodhini. 0. Linguistics. Language... . Sanskrit.. 0. V.… 60/167 .. Sanskrit. S Kuppuswami Sastri. Sanskrit. 1887. 142 pgs. Sanskrit. Sanskrit.

1954. Khem Raj Krishna das. Sanskrit. Geography. Sri Bhasya Mahapuranam. 243 pgs.. Religion. 1993.. Sri Hikmath Prakasha. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Sri Bashyam. 22 pgs.. 202 pgs. Unknown. .. Ramanatha Nanda Sarma. 538 pgs... Literature. Sri Bhavishya Mahapurana. Grammer.. 294 pgs. 1953. Venkat Rao Raysam..ranganadhacharya. Language. 128 pgs. Sri Durga Saptasati.. Unknown.. 0. 1958. 0.. 70 pgs. Sri Mahadev. Philosophy. 242 pgs. Sanskrit... Sri Bhasya Sariraka Mimamsa Bhasya Vol I. 624 pgs. Unknown. 569 pgs.. Sri Vasudeva Nandasaraswathi Tembeswami... 1941. Unknown. 1962. Sanskrit. 580 pgs. Sanskrit.... Khem Raj Krishnadas . Sri Datta Puranamu. 290 pgs. Unknown.. Unknown... 886 pgs..ityanen. Sri Fakkikartanmanjusha Vol I. 1954. 1910. Srikanth Sharma. 312 pgs.org/…/SanskritIIIT... 1938. Sri Gurucharitam Vol 2. 362 pgs. Pandit V. Sanskrit.. Sri Chaitanayalilamratsar.. Sri Dommraj Narsinghraj. Sri Bhasya Or Bhramasutrabhasya Vol 3. Sri Bhava Prakasa.. Linguistics.… 61/167 .. Acharya V R. 1939... Sanskrit. Pandith Sri Sudama Mishra. Unknown. Pandith Duttram. Sanskrit. Sanskrit. 0. Linguistics Literature. 1935. Sanskrit.ananthacharya. Sanskrit. Unknown. Sri Bhavaprakasa Of Bhavamisra. 504 pgs. 532 pgs.. 1237 pgs. Sanskrit. Sri Gurugovind Singh Bhagvat Padh Jeevnetivratham. Bhavamisra. Sri Brahnidhanturatnakar Vol Iv. Sanskrit. Chakravarthy Acharya Swamy U V P M.. 1950.... Sanskrit. Sanskrit. History. Sanskrit. 588 pgs. . Unknown. Sanskrit. Sanskrit. Unknown. Sri Devipuja Kalpa. 228 pgs. Linguistics Literature. Sanskrit. 506 pgs. 1930. Sri Harithsanhita. Srivasudevanandsaraswathikruthm. Sanskrit. 1966. 0. Sri Gurusanhita. Unknown. Sri Jayapura Raja Vamsyavali.ananthchary. Sri Devi Poojakalp. Unknown.. 1867... Unknown. 1955. 1938... Sanskrit.. Sanskrit.. Unknown. Sanskrit. Unknown. Sri Bhattikavyam... Sanskrit. 252 pgs. Sri Geetha Jnanmarg. Sanskrit. Swami Jagadisvarananda. Unknown. Sri Brahmasutrani. Sri Brahma Sutriya Vedanta Vrtti. Unknown.. 1935. Vasudeva Vidyabhushan. Somraj Krishna Das. 694 pgs. Unknown. 2000. 334 pgs. Unknown... Sri Jathi Bhaskar.. 268 pgs. Philosophy. Sanskrit.. Sri Brajotsava Chandrika.. Unknown.. Theology. 473 pgs. 408 pgs. Sri Ramanuja. 1970.. Sri Geethardha Prabodh... Swami Sri Raghuvaracharya. Sri Bhasya Or Brahmasutrabhasya Vol Ii. Sri Yashodanandanayen. Badhiri Das. Pandith Sri Kankalalasharma Thakur. Sanskrit. 536 pgs... 1954. Sri Vasudevanandsarawathiswamikrutha. 1960. 569 pgs. Shes Raj Sharma.. 1947. 616 pgs. . Sanskrit.. M. 154 pgs.. Sri Bhagavata Dashamaskandha part. Biography. sribhavamisra. Sanskrit.. 1240 pgs. Sanskrit... 128 pgs. Sri Bhasya Vol I. Sri Brahtstotraratnakar. sanskritdocuments. Sri Bhrthurisubhashitam Vairagya Shatak. 1917.. 2000. Sanskrit. V. -. 1953. Sanskrit. Sri Ranga Ramanuja Charya. Pandith Jwala Prasadji Mishra.. 1943. Unknown. 1942. Sanskrit. Unknown.. Sanskrit. Sri Daandeepika. Narayana Bhatta Goswamy. 0.

.sankaranarayanan. 468 pgs.. 422 pgs. Dr. Language. sanskritdocuments. 362 pgs. 0. 1963. Abhinava Gupta. 0... 0. G Laxmikanthaiah. Sanskrit. 0.. 262 pgs. Unknown.. 1971. .org/…/SanskritIIIT.. 1953. Sanskrit.. . Sanskrit. . Unknown. Sri Madbhagavathe Akadhasaskandhaha. Language. Sanskrit. Sri Madbhagavathy Thiruthiya Skandhaha. Sanskrit. Sanskrit. Sri Kavyardash. Sri Laghushabdendulkala. Unknown. Sanskrit. Srimannarayanramanujjeeyswamini. Sri Laghu Bhasyamu. Sri Madhevibhagavatam Mahapuranam. Literature. .. Literature. Sanskrit. 546 pgs.. Sri Madbhagavathe Prathamaskandhaha. Somraj Krishna Das... Jona Raja... Sanskrit. Sanskrit. Sri Ramanujbhasyen. 1957. Sanskrit. 0. Sanskrit. Swami Vireshwarananda.b. ... 352 pgs.. Sanskrit. Unknown. 578 pgs. 1985.. 1976. Sanskrit. 784 pgs. . 306 pgs. Sanskrit. 1976. 1972.... 802 pgs.. Sri Laxminarayana Samhitha Of Sri Svetayana Vyasa Vol 1 Part 2. Unknown. Sanskrit. 855 pgs. Sri Mad Bhagavatam.. Sri Chidirematiyeveerchandrasharma. Sri Mad Bagavadgeeta Sri Mahabharath Antargath.. Sanskrit. 0. Swami Srikrsnavalla Bhacarya Shastri. Sri Laghu Siddhanth Kaumudi.. 283 pgs. . Unknown. 1921. Sanskrit. Unknown. 415 pgs. 1567 pgs.1. Sanskrit.. Sri Madbhagavatam Pradama To Dvadasakandaha Full With Sanskrit. Sri Madbhagavad Gita Sri Mahabharathantargath. Linguistics. . 0. Pandit Ramtejpandeyan. Pandith Sri Shobhakanth Jha... Sri Mad Bhagavatam Trutiya Kandam. Sanskrit. S Vshwanathan. 1956. -. Mahakavi Sridhara Acharya Virchit. Language. 246 pgs. Sanskrit. 192 pgs. Theology.. 746 pgs... Unknown.. 122 pgs.. 0. Unknown. Language... Sri Madbhagvathgeethaya Vigyanbhashyam.. 0. Sanskrit. 384 pgs.. 1971. Sanskrit. ..I V. Sri Laksminarayanasamhita Vol. Unknown. 0. .. Sanskrit. 1976.. Unknown. 1957. Sri Madbhagavatham Vol 7. Sri Lalthasahasranama. 1164 pgs.… 62/167 . Chintamani Gangadhar Bhanu. Dr. .. 145 pgs. 383 pgs.. 252 pgs.. Sri Laghu Bhasyam. 466 pgs. . 792 pgs. Sanskrit. Sri Madhusudhan Sharma Maithli. Sanskrit.. Sanskrit. Unknown. Literature. Sri Madhandra Maha Bhagawatakathah. 0.. Sri Madbhagavatham Vol 5. Sanskrit.. Literature. 0. 1985. Unknown.. Sri Madbagavath Sridaritika. Shivnarayan Shastrina.. Linguistics.. Sri Mad Bhagavad Gita.. Unknown. Unknown. Sanskrit. 0.. Sri Karbhashyam Vol.. Sri Madbhagavadgita Gitarthasangraha Of Abhinava Gupta. Sri Mad Bhagvadgeeta. Linguistics. . Sri Madbhagavathy Panchama Scanda. . Literature. Khemraj Krishnadas. Sri Maaliniivijaya Varttikam. 0. 1956. 1976.. 854 pgs. Unknown. 1956. 412 pgs. 0.2/14/2011 A list of scanned Sanskrit books at III… Sri Kanta Charitam Of Munkhaka... 1957. 278 pgs. Sanskrit.. Religion. 393 pgs. Sri Madbhagvadgeeta. 515 pgs... Unknown. Ganga Vishnu Sri Krishna das. Sri Raghunath. Unknown. Sanskrit. Swami Srikrisna Vallabhacharya Shastri. Sri Kavyadarsa Of Dandin Edition Iii.. Sri Krishna Janmaskanda.. Sri Ramanuj Bhasyen. 353 pgs.. . . Sri Mad Bhagavatam Ashtamaskanda. Linguistics.. Sanskrit..s.. Unknown. Unknown.raghunathacharya. 151 pgs... 845 pgs. Sanskrit.

Unknown... Sanskrit. 534 pgs. Sanskrit. Sri Mani Charithamruth. 0.. Sri Malinivijayottara Tantram Vol Xxxvii. 1968. Literature. Anandtheertha Bhagavatpadacharya.. 0... 1921. 1944. Sanskrit. Sanskrit. Sri Rajnarayan Shastry. Sanskrit. Sanskrit. 130 pgs. Dr Malladi Gopal Krishna Sharma.. Sri Mahabharatham Ashravmedhikparv Vol X V I I I.. 1922. Sri Nyayamrutha Kaladharaha. Language. 1948. Language. Religion. T R Krishnacharaya. Sri Madvalmiki Ramayanam Vol.. Sanskrit. Sanskrit. Sanskrit. Unknown.. Unknown. Language. Pandit Madhusudan Kaul Shastri. Sri Markandeyapuranam. ... Sanskrit.. 1366 pgs.. Religion.. 334 pgs. Nalachakravarthy K. 0. Sri Mahabharatha Tathparyyanirnaya Satikas.. 1907. 572 pgs. sanskritdocuments.r.. . . 82 pgs. Unknown. Sri Madvalmikiramayaname Sundharakandam. 288 pgs.. Vedavyasachar. Religion.2/14/2011 A list of scanned Sanskrit books at III… Sri Madhragra Sanhitha. Dattavathari Sri Manik Prabhu Yanche. Literature... Sri Madhvacharya Brahmasutra Bhasya Vol Iii. Sanskrit. 1935. 780 pgs.… 63/167 . 1922. Sri Madhvas Tattva Vada.. 1950.. Sri Madvalmiki Ramayan Vol I.. Unknown.. Unknown. 1985.. Sanskrit. Sanskrit. Sanskrit. Sri Madramayanmimamsa.. T Srinivasacharya. Sri Manmaharaj Sanskrit Mahapatashala Patrika.. K Ramachandra Shastri. Sanskrit. Sri Nirnaysindhu. Sri Nilakanta Bashyam. 665 pgs. Sanskrit. Unknown. 148 pgs. Religion Theology. Sanskrit. Sanskrit.... Religion. 240 pgs. Sanskrit. 0. Unknown. 1987. 1948. Unknown.. 1940. Sri Manmanas Namavandana. . Hariprasad Bhagirathi Ityesham. Sanskrit. . Sri Maha Bhagavatam. Linguistics. 540 pgs.. Sri Manoramashabdaratn Prashnouttarwali Vol I. Theology. Ganga Vishnu Sri Krishna Das.. . 368 pgs...org/…/SanskritIIIT. Unknown. Sri Malavikagnimitra Of Kalidasa. .. Sri Man Mahabharatam. Religion. 370 pgs. 1043 pgs. Unknown.I I I.. Sanskrit.. Sri Madwasiddantasarasangraha. T.. Sanskrit. Literature. Sanskrit. Literature. 259 pgs. Jai Krishna Das Haridas Gupt. 0. Language.. Sri Madhwa Mantrartha Manjari Of Vaishwanathi Narayanacharya.. 402 pgs. Linguistics.. Unknown. Sri Madvalmiki Ramayanam Vol. 939 pgs. Pandut Madhusudan Kaul Shastri.. Sanskrit. 1867. Sanskrit. 1992. Unknown. 498 pgs. 956 pgs. 1994. Ganagavishnu Sri Krishnadas. Unknown. 94 pgs. 0... Sanskrit. Unknown. Sri Malinivijaya Varttikam... Sri Mannyayasudha Prarambha. Sanskrit. P P S Sastri.. Pandit V Ananta Charya. Sri Natakatha Sangraha Abridge Stories Of Sanskrit Dramas. 1322 pgs. Yoganarasimha. . Unknown.. Unknown. 1992. Ganaga Vishnu Sri Krishnadas.. Sanskrit. 1995. 900 pgs. 0. 0.. Unknown. Sri Nimbarkvrathnirnay. 328 pgs. Sri Nilakanta Bagavathpada. 98 pgs.I. 459 pgs. Linguistics. 0. 226 pgs...krishnacharya.. Sri Thulasi Das. 0..... 816 pgs. Pandith Shivdutten. Sri Manoramashshabdartan Prashnouttarvali Part I I. Sri Mahabharatham Shanthi Parvan.. 43 pgs. 0.. 215 pgs. Sanskrit. C Sankara Rama Sastri. Linguistics. 1955. Sanskrit.

. Sri Rama Sahasra Namastotram Sri Tyagaraja Nama Stotram And Namavali.. V. 533 pgs. 0.. 81 pgs. 47 pgs. Unknown. Sanskrit. Sri Parasara Bhatta's Sri Ranagarajasta . Linguistics. . 500 pgs. 1958. Language. Literature.. Literature. Sanskrit.. Ram Balak Shastri. Sri Paramahamsah. Sri Sankara Grandhavali Upanishadvani. Sanskrit. Biography. Sri Satika Threemuthrrasagara Nam.. Unknown. Sri Paribhashendu Shekar.. 1952... Language... 724 pgs. 242 pgs. Sri Sandhichandrika. 1965. Sri Sanskrithalok Vol I I. Sri Nyayasudhatipani Srinivasathirthavirachita Prarambyathe... Sri Pithrakarm Nirnay. -. K. Sri Ramanujas Theory Of Knowledge.. Linguistics. Sanskrit. Sanskrit. Sanskrit. Prabhakara Rao M. Pandith Surya Narayan Shukla. Unknown. Sri Sankara Grandhavali . M. Subramania Sastri. Unknown.. Sanskrit. Unknown. 230 pgs.. K Srikrishna Das. 232 pgs. Sanskrit... Unknown. 378 pgs. Unknown. Pandit Sri Mayaram Sangrahit. 570 pgs.. Vijayeendrateertha. Rambalashastri. Sri Saaraswatham. 1054 pgs. Philosophy. Sanskrit. Sri Sankara Vijaya Makaranda. 394 pgs. Literature... 86 pgs. Sri Sukhanandnathen.. 1661.. Sanskrit. 1661. Sanskrit. Tirumazisai Alwar.. Theology. 52 pgs. Teekadutt Dhikal. 635 pgs. Geography. Sri Sahityanushasanam. Sharma V A. Madhvacharya Gangur.. Sri Raghuvamsam Pakyanam.. 88 pgs. Sanskrit.. .. Sanskrit.. Sanskrit. Sanskrit. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Sri Nyayasudhatipani. Sri Ramanuja Campu.. Sri Raga Ratnakar Tatha. Sanskrit. Sanskrit. Pandith Sri Ramchandrabhakt. 0. 1987. 1920. 1933... 0. 0.. 416 pgs. Narasimha Charya A. Not Available. Unknown.. sanskritdocuments. Sri Sarvamoola Granthah Of Sri Anandatirtha Bhagavatpadacharya I. 1976.. Literature.Vol 2... 656 pgs... Sanskrit.… 64/167 . Sanskrit.. P Srirama Chandrudu. Sanskrit. Sri Rasayoga Satakam Part Ii. 1980. 0.Upanishadvani. Unknown. 600 pgs. Sri Valmiki Mahamuni. 1956. Sri Sareeraka Meemansa Bashya... Unknown. 1949. Unknown. Unknown. Sri Paninivyakarne Vadartanam Vol I. Sanskrit. 1954. Dvaita Philosophy. Unknown. Sri Sathpurush Charitra Prakash. Sri Sarvasiddhantasarasara Vivechanam. 558 pgs. Acharya Pandit Sri Sotharam Chaturvedhi. Sri Paribhasendushekhara. 2000. Sanskrit.. Religion. Religion. Sri Ramayan Valmikiye Ayodhyakand.. 160 pgs. Sanskrit. History.c. 0... 0. Sri Madnubhutiswarupacharyapranitham. 1999.. Sanskrit.. Sanskrit. Sanskrit. Unknown.. 1988. 0. 1942. Theology.org/…/SanskritIIIT.. 0.. Sri Shabdharthchintamani Kosh I Vol I I I.. 70 pgs. Vedanta. 1998. 1978. Pandith Sri Ramchandra Jha. Dhinanathasharma.. Sanskrit. Sri. Sri Sanatana Dharma Lokaha Part Iv... -. Literature. 605 pgs. 1954.. 0. Sri Ramayanamu Pradhama Khandamu Balakhandamu. Sanskrit.. 235 pgs. 592 pgs. Literature. 2001. Sanskrit... Sri Sanskruthalok Vol I I I. Krishnamacharya V. 210 pgs. Unknown. Sanskrit. 128 pgs. 818 pgs.. Literature. Unknown. Unknown. . Linguistics. Sanskrit. Language.. 382 pgs. pgs. 100 pgs. .. P Sri Rama Chandrudu.varadachari.

. 262 pgs. Sreemuralidhar. Sri Srimad Alankara Koasthubha Accn0 589... 0. Sri Valmiki Ramayanam Mahabyas.. Sri Vaikhansagruhasutram Vol Ii.. -. Sri Srinivasamkhivedanth Deshike.. 1973.. 672 pgs. 0. Sanskrit. 108 pgs. Sanskrit. 545 pgs. Sri Vallabhacharya And His Doctrines. 184 pgs. Sri Shivamahapuranam Vol Ii. Theology. Sri Sri Chantayan Chandramurthy. Sri Skandamahapuranam Saptmaprabasakandam Prarambyathe... Language.. Sri Shaligramoshdhshabdh Sagar. 1947. Unknown.. 1889.. sanskritdocuments. 1940... Sanskrit. Sri Srinivas Makhi Vedanth Deshike. Sri Valmiki Ramayanam Sundara Kandam. 696 pgs. Sri Sri Gandhi Katha.. 0. Unknown.. Late Prof. Sri Subodhini. Unknown. Sri Valmiki Ramayanam Ramabiramatikayitham. Language. 1064 pgs. Kulkarni G V. 1889. Sri Vayustuti. 673 pgs.. 402 pgs. Unknown. Literature. Unknown. 1966. Laxman Ranchandra Pangarkar. Sanskrit. Sri Vaikhansagruhasutram. Unknown. Dr Parama Hamsa Mishra. Sanskrit. Tiruvenkatacharyana. Sanskrit... Sri Sivagitabhashyam. 1939... 0. Sri Siva Samhita. Sri Sita Ramayanam.. Unknown. Shri Madhava Charya. Goswamy Sri Krishnaiah Chautan. 728 pgs. Sanskrit. Sri Svathsvrutham Vol I. Sanskrit. Linguistics. 374 pgs. Sanskrit. 82 pgs. 0. G Sri Yadunathaji Maharaj. 0. Sri Sudarshana Shathakam. Sanskrit.. 192 pgs. 148 pgs.. . Sanskrit.. 660 pgs. 355 pgs. 418 pgs.. Vedas.. Sanskrit.. Sanskrit. 1979.. G H Bhatt.. 1952. 0.. Sanskrit.. Garikpati Laxmikanth. Acharya D V N... Sanskrit. 0. 1985. 1960. Pandith Ramchandra Sharma. Bellankondopnamkaramaraykavindren.. Unknown. 236 pgs. 216 pgs.. Literature. Sanskrit. Philosophy. Unknown. Sri Srinivas Vilas Samskruth Kavyam. Unknown. Sri Shankatrashdarbhashyvimarsh. Chandraji Goswami Mahodayan. Sri Munilal Gupta. Unknown.. 1985. Sanskrit. 1867.. Sri Suryacharit Mahakavyam. Unknown. 1998. Literature. 1830 pgs. 218 pgs..2/14/2011 A list of scanned Sanskrit books at III… Sri Shagdhara Pragadvitha. 0. Tantras. Sanskrit. Pandit Taradatta Panth. Sanskrit. Linguistics. Sanskrit. Khem Raj Krishna Dasane. Chilukuri Ramabhadra Shastri. 1980. 1953. 108 pgs.. . Sri Srishukadooth Mahakavyam. Sanskrit. K Krishna Das. Sri Vallabhadigvijaya. 0. Sri Veerkrishnavijay Mahakavyam. Unknown.… 65/167 ... Sri Tukaram Charitra. 804 pgs. Sanskrit. Sanskrit. 1993. 78 pgs.. Sri Srigandgiri Sri Jagadgur Charitra Sangraha. 423 pgs. Dr Palle Poorna Pragnya Charya.. Sri Siddhhemchandrashabdanushasanam. Religion.. 72 pgs. 210 pgs. 1959. Sanskrit.. Sanskrit.. Lanka Sita Ramanshastrin... Religion. Unknown. Dvaita Philosophy... Sanskrit. 610 pgs. Sri Vaikhanasa Paitrumedhika Prayogaha. 255 pgs. . Unknown. Sanskrit.. Unknown.org/…/SanskritIIIT. Sanskrit.. Ganga Vishnu Sri Krishna das. Literature. Sri Tantraloka Vi.. 406 pgs. A S Mahaskar. Unknown. Sanskrit.. 1996. Nrusimha Bharathi. Sanskrit.. Unknown... Haridas Shastri. Sri Sri Vishnu Purana. Unknown. 0.. . 112 pgs. Maheshwar Shastry. . Sanskrit. 1963.. Unknown.. 0. Sanskrit... 1116 pgs..

org/…/SanskritIIIT. Srikrsnavallabhacarya Sastri.. Sri Viswanatha Shamran. 202 pgs.jayaseeta Rama Sastry. Sanskrit. 559 pgs. Unknown. 1000 pgs. Unknown. Sri Venkatachalammahatmayam Vol-i. Sri Venkatachalam Mahatyam Vol I. 578 pgs.. 1867. Sriharshas Naishadha Darshanaparamsha. Srimadvallabhacharya. Religion. Sri Venkatachala Mahathyam Pradhama Bagam. Sri Venkatachalam Mahatmayam Vol I.. 1944.. Tatacharya D T.. Srikhaudar Khanda Granth.. 500 pgs. 1960. Sri Yogvashista Bhasha Vol I I. 0. 1959. 606 pgs. Sanskrit. Sanskrit. 1915. Sanskrit.. Sri Venkatachalamahatyam. Sri Vishnu Dharmottara Mahapuranam. Sri Parashar Rammaharshi. Somraj Krishna Das. Tippal Samalad. 1953. Unknown.. 1959.. 0.. Ramlagna Pandey.. Sanskrit. . Sanskrit... Sanskrit. 208 pgs. Philosophy.. 280 pgs. 1941. Sanskrit... Unknown. Sanskrit. 340 pgs. 1959. 1959. 0. Srimad Bhagavad Gita... 0. 360 pgs. Srimad Almiki Ramayanamu Thruthiya Bagamu. Sri Vyasa Panini Bhavanirnaya. Unknown.. Sanskrit. Sanskrit. Sanskrit. Sri Vishnu Puranamu. Sanskrit. Unknown. Sanskrit. 441 pgs.. Srimath Srinivasay Parasmay Brahmane.. Sri Krishna Das Sathmaj Gangavishnu. 1973.. Sri Vichara Dipika. Unknown. 1954. Srimath Srinivasay Parasmay Brahmaney... Sri Venkatachala Mahathyamu. 105 pgs. Sanskrit. Sanskrit.. Sanskrit. Unknown. 584 pgs. Sanskrit. Sri Venkatachalam Mahatyam Vol.. Sri Vidvadwibhooti..... Unknown. Unknown. Madhusudhanacharya. Unknown.. 250 pgs. 846 pgs. Srimad Bagavad Geetha. Unknown. Sri Venkatesa Kavya Kalpaha. sanskritdocuments.I I. Sanskrit.. Sanskrit. Sri Ram Chandra Jha.. 349 pgs. Srimath Srinivasay Parasmay Brahman.. 498 pgs..... Unknown. Sanskrit.. 416 pgs. 582 pgs.. Unknown. Unknown. 123 pgs. Sanskrit.. Sanskrit. Srilakshminaryanasamhita Of Sri Svetayana Vyasa Vol Iii... Sanskrit.. Unknown. Unknown. 510 pgs.m. Dr. 1963. Literature. 1987. Sri Yogtarangini. 1959. Sri Venakatachala Mahatyam. 714 pgs. Swami Bramahananda. Unknown. Religion. Sanskrit. -. 1974.. Sanskrit. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Sri Vemageeta Prathama Sahasram Part Ii.. 584 pgs... 1960... Sanskrit.. 1943. Belvalkar S K. Sri Vrath Raja... 552 pgs. 294 pgs. 276 pgs. Bhagavadgita. S Sethumadhavacharya. 1982. Religion.. Sri Prayoga Dasji. 1961. -. Unknown. 460 pgs. 1244 pgs.. Unknown. Sri Venkatachala Mahathyam Dwithiya Bagam.. Shri Math Srinivasa Parasmay Brahman. Sanskrit. 1960.… 66/167 . P. -... Gandham Sri Rama Murthy. Unknown. 1930. 0. 584 pgs. Sri Vrindaranya Kshetramahatyam. -. 1972. M Ranganadhacharya. Srimad Bagavathgeetha. 1959.. Srima Brahmasutra Bashyam Part 3 2 Pada.. Unknown. Unknown. 448 pgs. Sri Venkatachalam Mahatmay Vol I. -. Sanskrit. 1993. Srimath Srinivasay Parasmay.vargranth Bhattacharya. Sanskrit. 130 pgs. Sri Venkatachalam Mahatmay Vol Ii... Sanskrit. Someswara Sharma Y. Sri Vimanacharya Kalpaha. Dinker Vishnu Gokhale. 1926.

. 1980. 1961. Sanskrit. Ramayanam.. 0... . 1875. 370 pgs.. Religion. 276 pgs. Mahadeva Gangadhar Bakre. 650 pgs. sanskritdocuments. 1961. Sanskrit. K Hanumanth Rao.. 1913. ... 0. Sanskrit. 286 pgs.. Bhagavadgita.. Sanskrit. 291 pgs. 1006 pgs. 341 pgs..... Theology. Srimadvallabhacharya. Religion.. Sanskrit.… Srimadbhivishgarvgadadhartanyavadgnasen Vidhusha Virchitaha Khemraj Sri Krishna Das Srehthina 67/167 . Srimadbhagavatam Ekadasaskanda. Unknown.. Srimadbhagavatam Pradamaskanda. Srimad Brahmasutra Bashyam Part 3 1 Pada. 1969. Srimad Valmiki Ramayanam... Sanskrit. 92 pgs. Srimad Vijayindratirtha.. Srimad Valmiki Ramayanam Balakandam Ayodhya kandam.. Srimad Brahmasutra Bashyam Part 3 4 Pada.. Wasudev Laxman Shastri Pansikar. Unknown..2/14/2011 g A list of Sanskrit books at III… g scanned g pg Srimad Bhagavadgeeta. 428 pgs. P Radha Krishna Sarma.. 1980.. Sanskrit... Srimad Vallabhacharya.. Brahucharya. Religion. Maganlal Ganpatiram Shastri. Srimad Brahmasutranu Bhasya Of Srimad Vallabhacharya. Bhagavadgeeta. Unknown. 1982.. Sanskrit.. Sanskrit. 1270 pgs. Dr N C V Narasimhacharya. 0. Srimad Brahmasutra Bashyam Part 1 1 Pada. Religion.. . 744 pgs. 355 pgs. Unknown. .. Srimadvallabhacharya. 358 pgs. Anandtheertha Bhagavatpadacharya. Sanskrit.. Srimad Valmiki Ramayanam: Aranyakandamu Kishkinda Kandamu. Religion.. 1961. Sanskrit. Srimad Bhagavata Mahapuranam Of Maharsi Vedavyasa Vol 1 Skanda 1. 291 pgs. 308 pgs. .. 605 pgs. 292 pgs. Maganlal Ganapatiram Shastri. Religion. Brahucharya... -. Srimad Jayatirthas Tattvasankhyanatika. Unknown. Srimad Valmiki Ramayanam Part 2. K Hanumantha Rao. 1983. Sanskrit. 1998. 720 pgs. -. Religion. 426 pgs. 242 pgs. Sanskrit. 1984. Srimad Valmiki Ramayana Part 2. Theology. 148 pgs. Srimadvallabhacharya.. Sanskrit.. 956 pgs. 1936. Sanskrit. Religion. Sanskrit. 126 pgs. 1989. Sanskrit. 1987. Srimadbhagavatam Shashtamaskanda. 1982. Unknown. Sanskrit.... 327 pgs.. Srimad Brahmasutrani Part Ii. 1997.org/…/SanskritIIIT.. Srimadbhagavatam Astamaskanda. Sanskrit. Art. Srimad Bhagavath Dashamaskanda Subhodini. . Religion. Sanskrit.. 1997... Srimadbhagavatam Navamaskanda. 75 pgs. Srimad Valmiki Ramayanam Saralagadyatmakam. Sanskrit. Srimad Brahmasutra Bashyam Part 2 2 Pada. Srimadvallabhacharya. Hanumantha Rao K. Sanskrit. Srimad Brahmasutra Bhashyam Vol I Part Iii. . Sanskrit. 1992. D Harishankar Mishra. Bhagavadgeeta. Srimad Brahmasutranubhasya Of Srimad Vallabhacharya. 1997. Sanskrit. Brahucharya. Sanskrit.. Unknown. Srimad Bhagvad Geetha. Srimad Bhagavata Mahapuranam Vol I. A V N Acharya.. Srimadbhagvata Aur Tulsi Sahitya Tulnatmaka Anushilana. 1954. Hanumantha Rao K... Srimad Bhagavadgita. Sanskrit. 1997. 1985. Prof. Jwalaprasad Misra. Bhagavad Gita. 120 pgs. Sanskrit.. 212 pgs... 1911..

8. 1982. 1981. pgs. 1982.1. Philosophy... 171 pgs. Sanskrit. 186 pgs. Sriman Nyaya Sudha Vol I.. 1982.. 166 pgs.. Philosophy. 160 pgs.. 1998. Sriman Nyaya Sudha Vol Ix.. Philosophy. 1984.. Philosophy.. Linguistics Literature. Sanskrit. 184 pgs. Sriman Nyaya Sudha Vol ... Philosophy. 186 pgs...1. 0. 1983.. Unknown.8. 1981. Sanskrit... Philosophy. 1981. . Sriman Nyaya Sudha Vol . 167 pgs.. . 171 pgs. Sanskrit. Sanskrit.. . G Laxmikanthaiah... 1982. 1982. Jayatheertha.. Philosophy. 1156 pgs. 164 pgs. Srimath Vedantadesika Granthamala. Sanskrit. 1983. Gadi Srikrishnmacharyaswami. Sriman Nyaya Sudha Vol . 1981. Sanskrit. 384 pgs. 1941.2/14/2011 A list of scanned Sanskrit books at III… Srimadbhivishgarvgadadhartanyavadgnasen Vidhusha Virchitaha... . 1981. 1983.. Sriman Nyadudha Vol ..9. Philosophy. 723 pgs. Literature. ...arka Somayaji. Sanskrit.9. Srimahedantdesika Grantha Malaya. 183 pgs. 160 pgs. .… 68/167 .d. 1983. 1980. 1983. Sriman Nyaya Sudha Vol ... Philosophy.. 1982. Sri Kanchi P B Annangaradharyar. Sanskrit.9. sanskritdocuments. 1918.2... Sanskrit. 336 pgs. 163 pgs. Sriman Nyaya Sudha Vol . Sriman Nyaya Sudha Vol . Philosophy.. . Sanskrit. Sanskrit. 1983. Philosophy. pgs.. . 171 pgs. 164 pgs. Philosophy. Sanskrit. Sanskrit. Sriman Nyadudha Vol .. Philosophy.... Sriman Nyaya Sudha Vol . Philosophy. Philosophy. pgs. Venkata Reddy K. pgs. Sriman Nyadudha Vol . Sanskrit. Srimadhandra Mahabharatha Kathah. Unknown. Sriman Nyadudha Vol .. Sanskrit. 160 pgs. Philosophy.3. Venkata Reddy K. pgs. .2. 166 pgs. 266 pgs. Sanskrit. Sanskrit. Sanskrit. 1983. 1982. Sanskrit. Sriman Nyaya Sudha Vol X. Unknown. Ramayanam. Sanskrit. Sriman Nyaya Sudha Vol . Sriman Nyaya Sudha Vol . . Unknown. Vayu Purana.. 1868. Srimat Tatparya Chandrika Volume Iii. Sanskrit. 130 pgs. Sanskrit.. 1983... 1983. Philosophy. Sriman Nyaya Sudha Vol . . . .. Sanskrit. 1983. 1997. Philosophy. Sriman Nyaya Sudha Vol . Sanskrit. . 1982. Sriman Nyadudha Vol V. Sriman Nyadudha Vol Iii. Sanskrit. P P S Shastri. Philosophy. ... Sanskrit. Khemraj Sri Krishna Das Srehthina.... Language. B N K Sharma. Philosophy. Philosophy. Unknown. Sriman Nyaya Sudha Vol Viii. Linguistics. Sriman Nyadudha Vol I.. . 198 pgs. 1983... Jayatheertha.. Srimadhya Mahapuranam. Sanskrit.1. Sriman Nyadudha Vol Ii. Sanskrit. Linguistics Literature. Dr. 1110 pgs.guru Venkatacharya. .8.5. Sriman Nyayasudha part 1... Jayatheertha. 1983.. 1983. pgs. 842 pgs. Philosophy. 1061 pgs. Sriman Nyaya Sudha Vol Ii. Srimat Sitaramajaneyam.10. Philosophy. .. Sriman Mahabharathamu Aranyaparvan..... .. Philosophy. Sanskrit.. Sanskrit..org/…/SanskritIIIT.. Sriman Nyayasudha part Ii. . 1933..10. 167 pgs. Sanskrit. G.. Sanskrit.. 163 pgs.2. 316 pgs. Sanskrit. Philosophy. .. Sanskrit.. Sriman Nyaya Sudha Vol . Venkata Reddy K.

2/14/2011

A list of scanned Sanskrit books at III…

Sriramakirti Mahakavyam... satya vrat shastri, Unknown. Sanskrit, 1990. 582 pgs. Sriramyansar Kanya Tilakam... B.ramraj, Unknown. Sanskrit, 1972. 243 pgs. Sritattvacintamani... Chintamani Bhattacharya, Tantras. Sanskrit, 1937. 123 pgs. Srngara Sekhra Bhana... Dr B Rama Raju, Unknown. Sanskrit, 1969. 76 pgs. Srngaraprakasa... P P Subrahmanya Sastri, Language. Linguistics. Literature. Sanskrit, 1939. 100 pgs. Srngaraprakasa Part I... Maharajadhiraja Sri Bhoja Deva, Art. Sanskrit, 1939. 101 pgs. Stava Chintamani... Bhatt Narayana, Art. Sanskrit, 1918. 165 pgs. Sthotramala... K Prathivaadi Bhayankar, Art. Sanskrit, 1942. 112 pgs. Stotraadisan'grah... T'embe Shriivaasudevaa Nanda Sarasvatii, Religion. Theology. Sanskrit, 1952. 474 pgs. Stotrasamuccaya... Dr.v.raghavan, Unknown. Sanskrit, 1969. 332 pgs. Studies In Buddhism And Sikhism... Harcharan Singh Sobti, Unknown. Sanskrit, 1986. 116 pgs. Studies In Skanda Purana Part 3 Vol 1... A B L Awasthi, Unknown. Sanskrit, 1983. 182 pgs. Subhaashhitaratnabhand-d'aagaarama~ Parivara~dhitamashhtaman' San'skarand-ama~... Raama Naaraayand-a, Language. Linguistics. Literature. Sanskrit, 1952. 528 pgs. Subhashitasudha Ratna Bhandagaram Or Treasures Of Sanskrit Poetry... pandit shivadatta kavirathna, Unknown. Sanskrit, 0. 876 pgs. Subhasita Ratna Bhandagara... Narayan Ram Acharya, Kavyas. Sanskrit, 1952. 525 pgs. Suddhadvaitamartanda... Ratna Gopala Bhatta, Kavyas. Sanskrit, 1954. 116 pgs. Suddhadwita Pushtimaargiya Samskut Vagnmaya Part I... Prof Kantamani Sastry, Religion. Theology. Sanskrit, 0. 268 pgs. Sudhasharachhandhramu... Chilakamurthy Laxmi Narasimham, . Sanskrit, 1927. 180 pgs. Suklyajurveda Samhitha... Wasudev Laxman Sastri Pansikar, Unknown. Sanskrit, 1929. 658 pgs. Sulabasutram... P Venkataramaiah, Kavyas. Sanskrit, 1984. 74 pgs. Sulabasutram... Niccolao Manucci, Kavyas. Sanskrit, 1984. pgs. Sulabasutram Katyana... P Venkataramaiah, Kavyas. Sanskrit, 1984. 70 pgs. Sulabasutram Katyana... Niccolao Manucci, Kavyas. Sanskrit, 1984. pgs. Sulbhavykaranamu Part I... kambamupathi gopalakrishnamurthy, Unknown. Sanskrit, 1959. 46 pgs. Sundari Meghasamdesa Or Dakshinatya Meghasandesa... Veluri Subbarao, Unknown. Sanskrit, 1999. 122 pgs. Sundarkandam... Dr.chandra Prabha, Unknown. Sanskrit, 1981. 284 pgs. Supplement To Purana Vol Ii No 2... Dr Ganga Sagar Rai, Religion. Theology. Sanskrit, 1963. 40 pgs. Surjan Charita Mahakavyam... Sri Chandrashekhar, Unknown. Sanskrit, 1952. 264 pgs. Surya Dandaka... Mayura Kavi, Unknown. Sanskrit, 1989. 46 pgs. Surya Siddhanth... -, Religion. Theology. Sanskrit, 0. 358 pgs. Sushruta San'hitaa Muulamaatraa... Sushruta, The Arts. Sanskrit, 1945. 1261 pgs. Sushrutasamhita Of Sushruta... Jadavi Trikumji Acharya, Unknown. Sanskrit, 1915. 778 pgs. Sutrarthamrta Lahari... Dr. R. Nagaraja Sarma, Unknown. Sanskrit, 1951. 112 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Sutrutham

Sri Jovanand Vidhyasagar Bhattacharya Unknown Sanskrit 1983 908 pgs

69/167

2/14/2011

A list of scanned Sanskrit books at III… Sutrutham... Sri Jovanand Vidhyasagar Bhattacharya, Unknown. Sanskrit, 1983. 908 pgs.

Suuktimuktaavalii... Harihara~, Technology. Sanskrit, 1949. 186 pgs. Suuta San'hitaa Dditiiya Khand-d'a Grantha 25... Chaara~ya Maadhava, Religion. Theology. Sanskrit, 1950. 441 pgs. Suutasan'hitaa Grantha 25... Aapat'e Vinayaka Gand-esha, Religion. Theology. Sanskrit, 1924. 374 pgs. Suutasan'hitaa Trxtiiya Khand-d'a... Aapat'e Hari Naaraayand-a, Religion. Theology. Sanskrit, 1929. 380 pgs. Suutasn'hitaa Bhaaga 3... Aapat'e Gand-osha Vinaayaka, Religion. Theology. Sanskrit, 1929. 390 pgs. Suvarnaprabhasa... C.e.marobz, Unknown. Sanskrit, 1992. 758 pgs. Suvarnaprabhasa Das Goldglanz Sutra... W Redloff, Unknown. Sanskrit, 1992. 270 pgs. Svabhaava Chitren' Prathamaavrxtti... Divekara Dinakaravaasudeva, Philosophy. Psychology. Sanskrit, 1934. 180 pgs. Svacchanda Tantram... Kshema Raja, Literature. Sanskrit, 1923. 345 pgs. Svachchhan'da Tan'trama~ Vol V... Shaastrii Madhusudhana Kaula, Religion. Theology. Sanskrit, 1930. 297 pgs. Svachchhandatantrama Bhaaga 2... Qs-emaraaja, Religion. Theology. Sanskrit, 1923. 348 pgs. Svapnavasavadattam... C R Devadhar, Language. Linguistics. Literature. Sanskrit, 1946. 169 pgs. Svara~nd-a Kirana~... Shrii Sumitraanan'dana Pan'ta, Philosophy. Psychology. Sanskrit, 1947. 197 pgs. Svetasvaradyupanishad Purushasuktha Bashya Part 1... Veera Raghavacharya T, Upanishad. Sanskrit, 1955. 445 pgs. Svetasvataradyu Panishad Purushasukta Bhasya Part 1... T Veeraraghavacharya, Unknown. Sanskrit, 1955. 448 pgs. Svetasvataradyupanishad Purushasukta Bhasya... T Veera Raghavacharya, Unknown. Sanskrit, 1955. 446 pgs. Swapravasavadatta... Haradayalu Singh, Art. Sanskrit, 2003. 47 pgs. Swetha Swatharaghupanishatpurushasukthabhashyam Prathama Bhagah... Sri ranga rananuja murthy, Unknown. Sanskrit, 1944. 448 pgs. Taan'trika T'eksat'a Khand-d'a 11... Raavaa Bhaaskara, Religion. Theology. Sanskrit, 1922. 117 pgs. Taittiriiya Praatishaakhyama~ Grantha 10... Maahishheya, Religion. Theology. Sanskrit, 1930. 262 pgs. Taittiriiyaarand-yakama~ Bhaaga 2... Krxshhnd-ayajura~vediiyan, Religion. Theology. Sanskrit, 1927. 471 pgs. Taittiriiyaarand-yakama~ Dditiiyo Bhaaga Grantha 36... Aapat'e Vinaayaka Gand-esha, Religion. Theology. Sanskrit, 1927. 479 pgs. Taittiriiyabraahmand-ama~ Dditiiye Khand-d'a Grantha 37... Krxshhnd-ayajara~vediiye, Religion. Theology. Sanskrit, 1937. 570 pgs. Tajika Neelakanti... , Language. Linguistics. Literature. Sanskrit, 0. 280 pgs. Tamara Parinayam... , . Sanskrit, 0. 448 pgs. Tandyamahabrahmana... Pandit A Chinnaswami sstri, Unknown. Sanskrit, 1935. 510 pgs. Tantra Sara Sangraha... M Duraiswamy Aiyangar, Indology. Sanskrit, 1950. 566 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Tantra Trutiya Samputam

Sri bhagavad ramanuj Unknown Sanskrit 1951 380 pgs

70/167

2/14/2011

A list of scanned Sanskrit books at III… Tantra Trutiya Samputam... Sri bhagavad ramanuj, Unknown. Sanskrit, 1951. 380 pgs.

Tantraaloka 57... Abhinavagupta, Religion. Theology. Sanskrit, 1936. 374 pgs. Tantraaloka Dashamo Bhaaga Grantha 52... Gupta Madabhinava, Religion. Theology. Sanskrit, 1933. 400 pgs. Tantraaloka Ekaadasho Bhaaga Grantha 57... Gupta Madabhinava, Religion. Theology. Sanskrit, 1936. 377 pgs. Tantraaloka Grantha 30... Madhusudana, Religion. Theology. Sanskrit, 1921. 314 pgs. Tantrasara... , . Sanskrit, 0. 495 pgs. Tantrik Tests... Swamy Trivikrama Tirtha, The Four Vedas. Sanskrit, 1937. 132 pgs. Tarad'aga... Saagarikaa, Philosophy. Psychology. Sanskrit, 1940. 132 pgs. Taranatha's... Albert Grunwedel, Unknown. Sanskrit, 1914. 222 pgs. Tara~kataand-d'avama~ Chatura~tho San'put'ama~... Vyaasathiira~tha Shrii, Philosophy. Psychology. Sanskrit, 1943. 409 pgs. Tara~kataand-d'avama~ Da~vitiiyan' San'put'ama~... Vyaasatiira~tha Shrii, Philosophy. Psychology. Sanskrit, 1935. 417 pgs. Tara~kataand-d'avama~ Prathamasamput'ama... Shriivyaasatiira~ta, Philosophy. Psychology. Sanskrit, 1932. 564 pgs. Tarka Tandavam Vol I... D.srinivasacharya, Indology. Sanskrit, 1932. 557 pgs. Tarka sangraha... Acharya kedharnadh tripati, Religion. Theology. Sanskrit, 1974. 204 pgs. Tarkabhasa Of Moksakara Gupta... Embar Krishnamacharya, Unknown. Sanskrit, 1942. 140 pgs. Tarkabhasha And Vedasthana Of Mokshakaragupta And Jitaripada... H.r. Rangaswami Iyengar, Religion. Theology. Sanskrit, 1944. 144 pgs. Tarkasamgrahah... Shri Guru prasada shasthri, Unknown. Sanskrit, 1939. 308 pgs. Tarkasan'graha... Annambhat't'a, Philosophy. Psychology. Sanskrit, 1930. 225 pgs. Tarkatandava... , . Sanskrit, 0. 331 pgs. Tarkatandavam Of Sri vyasa Tirtha Ii... V Madahvachar, Dvaita Philosophy. Sanskrit, 1935. 407 pgs. Tarkatandavam Of Sri vyasa Tirtha Iv... V Madahvachar, Dvaita Philosophy. Sanskrit, 1943. 402 pgs. Tarkatandavam Of Sri vyasa Tirtha,3... V Madahvachar, Dvaita Philosophy. Sanskrit, 1938. 373 pgs. Tathava Teeka... Mahadesika, Geography. Biography. History. Sanskrit, 1934. 538 pgs. Tathvaprakasika Chapter1... , Language. Linguistics. Literature. Sanskrit, 0. 451 pgs. Tatparya Chandrika Part 2... Krishnacharya,t.r, . Sanskrit, 1913. 2011 pgs. Tatparya Chandrika Vol Ii Part Ii Iii Iv... Sri Vyasateertha, . Sanskrit, 1982. 213 pgs. Tatparya Chandrika Volume I... Sri Vyasateertha, Unknown. Sanskrit, 1981. 182 pgs. Tatparya Chandrika Volume Ii... Vyasateertha, Geography Biography History. Sanskrit, 1981. 211 pgs. Tatra Pratham Samputam Vedratha Geetabhasya Gadyatrey... Sri Mannarayanramanujayteendranamagya, Unknown. Sanskrit, 1980. 292 pgs. Tattva Pradipika With Citsukha Commentry... , . Sanskrit, 0. 294 pgs. Tattva Samkhyanam... Ramamurthy Sharma R, Philosophy. Sanskrit, 1980. 77 pgs. Tattva-kaustubha-kulisa... Dr.rnaga Raja Sarma, Unknown. Sanskrit, 1956. 324 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Tattvaara~thasuutrama~

Svamii Umaa Religion Theology Sanskrit 1944 324 pgs

71/167

152 pgs... Vedaantaachaara~ya Shrii.. The Abhijnana Sakuntala Of Kalidasa. Language... Literature. Sanskrit. A B Gajendragadkar. 692 pgs. Sanskrit... Sanskrit. 1940. The Abhijnana Sakuntala of Kalidasa. Tatva Prakasika Bhavadipa Volume I to Ii. Raghava Bhatta. Sanskrit.t. Sanskrit. Veng-kat'anaatha. Tattvamukttakalaapa Trxtiiyasamput'ama~. Thaithariya Brahmanamu Dwithiya Bagamu. Veeraraghavacharya.. Svamii Umaa. .. sanskritdocuments. Biography.. Pandit Girijaprasad Dvivedi. Sanskrit. Vdaantaachaara~yaa. Linguistics Literature. Linguistics... Sanskrit. 0... 554 pgs.. Wasudev Laxman Sastri Pansikar. Unknown. 22 pgs. 602 pgs. 1954. bhattamalla. Unknown. D Sreenivasachar. Sanskrit. . 1933. Vidya Manyatirth Swami. The Amarakosha. Philosophy.. Anantarama Sastri Vetal. Sanskrit. Unknown. Krishnacharya. . Tattvamukttaakalaapa Da~vitiiyasan'put'ama~. Unknown. Philosophy.. 1938. Tharkasangraha. Religion. Tatvaprakasika Bhavdiya.. 1981. Theology. Sanskrit. . Language. 1936.. Sri Jayatirtha. Sanskrit. Tatvamukttaakalaapa Prathamasanput'ama~. Sanskrit. 754 pgs. Sanskrit.. 314 pgs... Sanskrit... 1944.. Sanskrit. Tatva Marchand Vimarja. 375 pgs.2/14/2011 A list of scanned Sanskrit books at III… Tattvaara thasuutrama . . 1940. 1934. 106 pgs. ludwik sternbach. Unknown. 811 pgs... 0. Unknown.. 117 pgs.. Texts On Courtezans In Classical Sanskrit. Sanskrit. 198 pgs. Sanskrit. Tatuabodhini Uttaraidha Gnanendra Saraswathi. The Abhidhana Sangraha. Tattvaara~thavaara~tika Bhaaga 1... 110 pgs. 72 pgs. Sanskrit...r. ... Sanskrit. R S Panchamukhi. 1954. 0. Sri Madhvacarya. .. Linguistics Literature. Ramanuja. The Alanka Asa Vasva Of Rajanaka Ruyyaka. 157 pgs.. Unknown. 461 pgs. Theology. 289 pgs. Sanskrit. History. 382 pgs. 99 pgs.. Tattvatika. Unknown. 329 pgs. Unknown. 347 pgs. 1953. 1948.org/…/SanskritIIIT. Religion. 554 pgs. Telugu-savara Dictionary.. 0. Mahendra Kumar Jain. Sanskrit.. Linguistic. 0. Unknown. 1927. Psychology. G V Ramamurti. Tattvaraya Rahasyam. 1938. Tattvamuktakalpa. Sanskrit. Prof.. 367 pgs.... 1914. Sanskrit.. 0.. 1980.. Philosophy.. Tattvamukttakalaapa Da~vitiiya San'put'ama~. -. 406 pgs. Sanskrit.. Sanskrit. 1964.. Sanskrit... Philosophy. 1936. 551 pgs. . Philosophy... 538 pgs.. Nigamaantadeshika~. 1953. Tatvodyota. Literature. Geography.. 0. 1940. Sanskrit. The Alankaramasekhara. 1303 pgs.. -. 342 pgs. Tattvasamkhyanam. Unknown. 324 pgs. Unknown.. Sanskrit. 462 pgs. Psychology. kalan'kadeva Bhat't'aa.. Technical Terms And Technique Of Sanskrit Grammer Part 1. Tatvapradipika Nyaya Prasakdika Vyakyanamu.. Geography Biography History.. Geography Biography History. Sanskrit. Literature. Tattvasankhyanam. 1939. 1953. 748 pgs. 1999. kshitish chandra chatterji. 528 pgs. Mahadesika.. Psychology. Tattvatika. Sanskrit. . 1980.. Linguistics. Sanskrit. 1943. The Akhyata Chandrika.… 72/167 . Thathvaprakasika Kavyankya Sharkara.. Tattvarthavartik Of Shri Akalank Deva. Sanskrit.

Literature. pgs. Unknown. 1967. 1930. Literature. Sanskrit. 423 pgs. 1963. The Arthasastra Of Kautilya. 1984. The Anargharaghava Of Murari Edition V.. 1940. 1943. 1920. Unknown. Sanskrit. 630 pgs. Unknown. 1943. 350 pgs. .. 162 pgs. The Art Of Sanskrit Translation Or A Mirror To Sanskrit Usage... The Atmatattv Aviveka. Bhagavadgita.. Sanskrit. Aryabhatacharya. Sanskrit. 260 pgs. Kasinath Pandurang Parab.… 73/167 .. 216 pgs. Unknown. Unknown. Pt. Sanskrit..... Sanskrit. Dhundiraja Sastry. 442 pgs... Ramakantha. Wasudev Laxman Sastri Pansikar. Raghavendracharya. Unknown. Sujitkumar Mukhopadhyaya. 433 pgs.. Unknown.2/14/2011 A list of scanned Sanskrit books at III… The Amarakosha. Sanskrit..org/…/SanskritIIIT. Sanskrit. The Brahmasutra Bhashya Vol-3. Sanskrit.. 466 pgs. Sanskrit. 1931.. Sanskrit. Literature. 550 pgs. 0. 560 pgs. The Balamartandavijaya.. The Balamartandavijaya. 494 pgs. R... Sanskrit. Sanskrit. Unknown. 1930.. Sanskrit. P. Unknown. 1922. Dr Jatindra Bimal Chaudhri. 76 pgs. 1928. The Bhrngasandesa Of Vasudeva.anant Shastri Phandke Vyakaranacharya. Linguistics Literature. Sanskrit.c. 1938. Unknown.. The Antagonist In Sanskrit Drama. Abhay Mithra. Theology. 1943.. 1984. Sanskrit.. 96 pgs. The Asokavadhana. Unknown. The Bhagavad Geeta Vol Lxiv. Sri Madhwacharya. Sanskrit. Govinda Shankara Shastri Bapata.. Linguistics Literature.. Bhagavadgita. Literature. 1940... 1933... 1963.. The Andhra Pradesh Pension Code 1960. The Brahmavada Sangraha And Suddhadvaitapariskara.. The Bhaskarodhyam The Rising Sun. 644 pgs. Sanskrit. 139 pgs. Unknown. Sanskrit. 1960... Sanskrit..... 1949. Sanskrit.. Religion. Sanskrit... Unknown. 1937. Sambasiva Shastri K.. Jiva Natha Jhi. Sanskrit.. 1956. The Aryabhatiya. 648 pgs. The Bhakti Candrika.. G Rghavendracharya. Vishnu S Sukthankar. 394 pgs. 1937. k m vaidya. Pandit Durga Prasad. The Ashtanga Hridaya Kosha With The Hridaya Prakasha. 290 pgs. Sanskrit.. Brahmasutras... Diavanji. Indology. Unknown. 1961. Sanskrit. Sanskrit. 183 pgs. K. 534 pgs. 1922. Sambasiva Shastri. pgs. The Brahmasutra Bhashya Volume Iv. Harihara Sastri. Charudeva Shastri.. Sanskrit. Unknown. The Bhagavadgita.. The Bhagavadgita.. Unknown. Ramakantha.. The Aranyaparvan Part 2.. Sri Narayancharya Atreya.. Ramakantha R. Language. Unknown.. The Brahmavada Sangraha. Sanskrit. 440 pgs... Unknown. Sanskrit. Sanskrit. The Boudhayana Dharmasutra. 538 pgs..... 243 pgs. 1940. The Bijaganita Elements Of Algebra Of Bhaskrachrya. 1887. Philosophy.. Sanskrit. The Arthsastra Of Kautilyavol I. 160 pgs. 400 pgs. 1936. The Atmatattvaviveka Of Sri Udayanacharya. 674 pgs. T Ganapathi Sastri. Unknown. The Bhaminivilasa Of Jagannath Pandit. Pandit Harisankara Sastru Vedabta Visarada. Rajanaka Ramakantha. 1934. 521 pgs. The Bhagavadgita...I I I. The Brahmasutra Bhashya Volume I. G Raghavendracharya. K Smba Siva Sastry. Unknown.. Bhagavadgita Sanskrit 1928 140 pgs sanskritdocuments.. Linguistics. 1943. 162 pgs. 1942. T Ganapati Sastry. Sanskrit... Govinda Swami. 396 pgs. The Brahmasutra Bhashya Volume Iv. The Aranyakanda Vol. The Bhattikavyam Of Bhatti.

P Sathyavrata Samashrami. Sanskrit.. Unknown. Sanskrit. Unknown. Manmatha Nath Dutt. Ganganath Jha.. Ganapati Sastri. 680 pgs. M M Sri Mukunda Jha Bakshi.. Unknown. 426 pgs. 1519 pgs. The Danadipika With Tha Bhavabodhini Hindi Commentary. Dr.. The Elements Of Darsanas Of Shriharshas Naishadha.. 1938. The Harasastra.k. The Dipakalika.. T. 1949. 1936.. 1932. The Dasrupaka of Dhanamjaya.. Sanskrit. 1900. Sanskrit.. Unknown. Sanskrit. Pt.. Unknown.. Sastri.. Unknown. 30 pgs. The Ganitha Kaumudi. The Dhatuvritti Vol I Part I. Sanskrit. 68 pgs.rocher. Unknown. suryakanta. Unknown. The Catapatha-brahmana. The Gospel Of Advaita. Sanskrit. Sanskrit. 1941. 0. Giuseppe Tucci. 1936.. Sanskrit. 344 pgs. The Charaka Samhita Volume 1. Literature.. The Danadipika. 340 pgs.k. 332 pgs.. Pandit Sri Sudama Misra. Yugalakishora Vyasa. Religion.... Sanskrit. Social Sciences.. Sanskrit. The Dharma Sastra Vol I. Sanskrit. The Ganita Kaumudi Part 1. The Charaka Samhita Volume 4. 1987. Sastri. 436 pgs. 1953. Unknown. 426 pgs. 1112 pgs... 1942. The Elements Of Darsanas Of Sriharshas Naishadha.. The Collection of Sikshas by Yagna Valkya and Others. Duncan Greenless. Pandit.. pgs. 1928. 1942.. T. 4008. The Gospel Of Advaita. Unknown.. The Grihaya Sutras Of Gobhil. sulapani. 1987.. Sanskrit... 264 pgs. Albrecht Weber.. Sanskrit. Narayana Pandita.. 1986. Sanskrit. The Charanavyuha Sutra Of Saunaka.. 140 pgs..... Sri Gagabhatta. The Ganitha Koumudi Part Ii..venkata Charya. Sanskrit. Unknown..kanakalal Sarma.. Unknown.. Sanskrit... Sanskrit. 4008. Sanskrit.. 1176 pgs. 394 pgs. pgs. Unknown.. Sanskrit.... Sanskrit... Unknown. 296 pgs. Pandit Sri Sudama Misra. Unknown. 1936.. 140 pgs. 1953.. 1934. sanskritdocuments. Sanskrit.s. Kasinath Panduranga Parab. The Chhandogya Upanishad Vol Iii.. 56 pgs. 283 pgs. 516 pgs. The Chandraloka Of Shri Jayadeva. 1936. 1924. The Dharmasindhu By Kasinath Upadhyaya.. 160 pgs. 1949. The Gobhilagrhyasutra. 1889. Unknown. Unknown. Sanskrit. 400 pgs.2/14/2011 A list of scanned Sanskrit books at III… Bhagavadgita. Sanskrit. 661 pgs.org/…/SanskritIIIT. Sanskrit. The Dhatupatha Of Panini. Unknown. The Charaka Samhita Volume 5.. Sahib Kaul. 184 pgs. Unknown. Unknown. Unknown. The Commentaries On The Prajnaparamitas Vol 1. Sanskrit. 1890. 170 pgs. Sanskrit. 1942. L.. A Mahadeva Sastri. Unknown. 1949. Sanskrit.. Sanskrit. 1969. Duncan Greenless. Upanishads. The Durghatavrtti Of Saranadeva. Unknown. Sanskrit. 1908. Pandit Anantaram Dogara Sastri. 1000 pgs. 252 pgs. 668 pgs. sage agnivesa. Sanskrit.. 1969. 1938. Dr M Jaya Seetha Rama Sastry. The Harasastra. padmakara dvivedi jyautishacharya. Unknown... The Ganapatha Ascribed To Panini. The Dasarupaka Of Dhananjaya.. sage agnivesa. Sanskrit. 126 pgs..s. 430 pgs. sage agnivesa. 1939. Sanskrit. M... Unknown.. Mangal Deva Shastri. The Devinamavilasa. Unknown.jayaseeta Rama Shasthry.… The Harasastra Sastri K S Unknown Sanskrit 4008 394 pgs 74/167 .. 1942. 296 pgs. Literature. Literature.

1933. Sanskrit. 195 pgs. Unknown. Pandit Sri Nanda Kishore Sharma. Mahamahopadhyaya. 1918. 1944. 1941. 1023 pgs. Gopal Raghunath Nandargikar. Abhinavagupta. Sanskrit. 538 pgs.. 1867.. 413 pgs. The Kashi Sanskrit Series. Sanskrit. 1943. The Jaiminiya Or Talavakara Upanishad Brahmana. Sanskrit. The Kasyapa Samhita. The Isvarapratyabhijna Vivritivimarsini. The Kadambari Kathasara Of Trivikrama.. Unknown. The Journal Of Oriental Research Madras.... Unknown. B. 1941. 0. The Harililamrtam. Vrdddha Jivaka. sanskritdocuments. Gudharthatattvaioka.. Raghu Vira. Abinava Gupta.. Spiritual Experience And Uysticism. The Kamsavadha Of Sesakrisna Edition I I I. 307 pgs. Sanskrit. Unknown..s.. Unknown.pandya. 1943. 626 pgs. Spiritual Experience And Uysticism. The Kama Kala Vilas Of Punya Nanda. vrddha jivaka. Unknown... Sastri K S. 70 pgs. Unknown. Unknown.. The Kasika Vivarana Paniyaka.j. The Isvarapratyabhijna Vivritivimartni. 94 pgs.. Unknown. The Isvarapratyabhijna Vivriti Vimarsini By Abhinava Gupta. Sanskrit. Sanskrit. The Karna Sundari Of Bilhana. 422 pgs. The Ishvarra Pratyabhijna Vimarshini of Utpaladeva.. 1907. The Janakiharanam Of Kumaradasa I X.. K Dakshina Murthy. The Jayantavijaya Of Abhayadeva. Sanskrit..c. Sanskrit. The Jataka Mala. 1953. Sastri. The Kalatattvavivechana.. Benerjee. Upanishad.. 4008. 1957. Unknown. 1940. Abhinava Gupta.. The Harsha Charita First Uchhvasa.. Unknown. 349 pgs. pandit bhavadatta shastri. Sanskrit. 396 pgs. 446 pgs. Upanishad. . Spiritual Experience And Uysticism.. Unknown. Sanskrit. Srish Chandra Chakravarti.. General. Sanskrit. The Kasyapa Samhita. 1918. Sanskrit.. 1935. 130 pgs.. Sanskrit.. 1957.. Literature.. 160 pgs. 1938. 1934. General. 281 pgs. Pandit Durga Prasad. The Isvarapratyabijna Vivritivimarshini. Sanskrit. 1941. Unknown. 90 pgs. Rama Deva. 394 pgs...k.. The Kadambari Kathasara Abhinanda. The Ishvara Pratvabhijna Vimarshini Vol I. 1925. J. pgs.. Sanskrit. Sanskrit. The Kalatattvavivechana. 446 pgs.. 178 pgs. B C Benerjee. Pandit Durgaprasada. Sanskrit. The Isvarapratyabhijna Vivritvimarsini Vol Iii. The Journal Of Vedic Studies Volume 1 No 1.. The Harasastra.org/…/SanskritIIIT.… 75/167 . 1930. Sanskrit. Sanskrit. Dr Hendrik Kern.. Mukunda Rama Shastri. Unknown.. Unknown. The Isvarapratyabhijna Vivritivimarstni Vol Ii. Sanskrit. 195 pgs.. Sanskrit. Not Available.2/14/2011 A list of scanned Sanskrit books at III… The Harasastra. 446 pgs. 186 pgs. 539 pgs.. 280 pgs. Abhinavagupta. The Holi Gita. 4008.. Pandit. Pandit Madhusudan Kaul Shastri.. Sanskrit. Pandit Durga Prasada. 312 pgs... 190 pgs.. 1933. 638 pgs. Unknown. Sanskrit. Unknown. 1902. Unknown. Sanskrit. 1932. 1933. 64 pgs. 394 pgs... 1921. 1943. Sanskrit. Unknown... Sanskrit.. 1925..... The Kadambarikathasara Of Trivikrama. Unknown. Sri Bopadeva. Sanskrit. Sanskrit.. Sanskrit.. 1918. 349 pgs.... Unknown.. Dakshina Murthy K. Abhinava Gupta. Unknown. Madhusudhan Kaul Shastri... Sanskrit...

. Sanskrit.. 1936.s. Sanskrit. 1935. T R Chintamani. Sanskrit. Unknown. 268 pgs. 822 pgs... Sanskrit. Sanskrit. 96 pgs. Unknown.… 76/167 . The Celebrated Vedavyasa Rishi. 362 pgs. Sanskrit.. 587 pgs. 676 pgs. 442 pgs. Unknown. Unknown.... 388 pgs. Literature. Gopal Sastri Nane.. 1934. Unknown.. 1918. Unknown. 1917.. The Mahabharata Vol 10 Drona Parvan Part 2.. The Kavya Mimamsa. Unknown. 1939. 1961. Unknown. The Kausitaka Grhyasutras. Unknown.mahadeva Sastri.. 154 pgs. 106 pgs.. Unknown.. 1960.. 390 pgs. 1931. P. Unknown. 676 pgs.. Unknown. Vaidya.. The Kavyalankara Sangraha Of Udaha Bhatta. The Kautiliya Arthasastra Part 1. Sanskrit.. The Kavyarathna Of Arhaddasa. 0. Sanskrit. The Mahanaya Prakasha Of Rajanaka Shiti Kantha... 184 pgs. Unknown. 1100 pgs. Sanskrit. 1934. Sanskrit.. 1953.. Pandit Mukunda Rama Shastri.. 1918. 1968. Surendra Nath Shastri. Sanskrit. 1931. Literature. 318 pgs.. Sanskrit. E B Cowell. Mangesh Ramakrishna Telang. K Sambasiva Sastri. 1936. 1934. Vidan N. The Kausitaki Brahmana Upanisad. Sanskrit. Unknown. The Kavyakalpalata Vrtti.. The Celebrated Vedavyasa Rishi. Unknown. P P S Sastri. 1935... Misra V. Unknown. 210 pgs. 1936.ramashastri. 1918. The Mahabharata An Epic Poems. Unknown.Revised By T Srinivas Venkatarama. The Mahabharata Vol 9 Salya Sauptika And Stri Parvans. Sanskrit.l. sanskritdocuments. Sanskrit.. 1935. 696 pgs.-2. Sanskrit.. The Mahabharata Santi Parvan Vol Xviii Part I.. 186 pgs... Unknown... Unknown. The Madhvamukhalankara.. P P S Shastri.. 974 pgs. Sanskrit. 557 pgs. P P S Shastri. Sanskrit. 1954. Pratap Singh. 444 pgs.. Literature. 1935.2/14/2011 A list of scanned Sanskrit books at III… The Katyayan Srauta Sutra Part Ii. 728 pgs. A. r p kangle. Sanskrit. 154 pgs. 640 pgs. P P S Sastri. 152 pgs. 154 pgs. Mangesh Ramakrishna Telang. Sanskrit. The Krityasaravol 1. Amara Chandra Yati. 1935. Unknown. The Kirtatarjuniya of Bharavi... The Madhaviyadhatuvritti Of Sayanacharya. 0. The Mahabharata Vol Viii Bhisma Parvan. Sanskrit.. Sanskrit. Unknown. P P S Shastri. 1915... 486 pgs. The Mahabharata An Epic Poem Vol 3. Sri Gangadhara Misra. Sanskrit. The Krityasara Samuchchaya Of M M Pandit Sri Amritanatha Jha. Sanskrit. The Mahapurana of Puspadanta Vol. The Khadira Grihyasutra.. Sanskrit.. The Mahanaya Pkasha O Rajanaka Shiti Kanta. The Mahanaya Prakasha Of Rajanaka Shiti Kantha. The Mahabharatha Santi Parvan Vol X V Part I I I. The Mahabharata An Epic Poem Vol 4. 1944. Sanskrit. Unknown. Unknown. Unknown.. 114 pgs. The Malavikagnimitra Of Kalidasa Edition V I I I..org/…/SanskritIIIT. 1913... Sanskrit. 609 pgs. The Celebrated Vedavyasa Rishi.. Sanskrit. Unknown. Literature. Kashinath Pandurang Parab. Sanskrit... Pandurga Parad . 0. Unknown. Vidhyasagara Vidhyavachaspati. 1940. Pandit Ananta Sastri. The Laws And Practice Of Sanskrit Drama Vol X I V Vol I. Pandit Mukunda Rama Shastri. The Malatimadhava Of Bhavabhuti....... Rajashekhara.. 298 pgs.. The Mahabharata Vol 9 Drona Parvan Part 1. Sanskrit.

0... 126 pgs.. Dipak Bhattarcharya. The Nyaya Darsana. Sanskrit. 310 pgs. 212 pgs. Unknown. Unknown.... Pandit. .. Literature... 0. Language. 1966. 80 pgs. Franklin Edgerton. Sanskrit. 1930. 142 pgs. K Sambasiva Sastri. Unknown. Unknown. The Nyayavarttikat Paryatika Of Vachaspati Misra Vol Xiii. 471 pgs. 60 pgs. A. Chinnaswamy Sastri. 1953.. The Nirnayasindhu. Kamalakar Bhatt. Unknown. T Ganapat Sastri. 1924. Unknown.. The Nirsinha Prasada. Sanskrit.. 297 pgs..... 1925. The Megha Duta Of Kalidasa Edition I I.. Sanskrit. Jaimini Sutras. -. Unknown. Gopi Natha Kaviraja. 529 pgs. 1942... The Nirnaya Sindhu. 1982. 1921. P R Subrhmanya Sarma... The Nirsinha Prasada Tirtha Sara.. Mukund Jha Bakshi. The Namalinganusasana Amarakosa Of Amarasimha. 135 pgs. The Mimasa Kaustubha. 1912.. Dr V Raghavan. sri kamalakar bhatta. Sanskrit. The Panchatantra 1 To 5.. Sanskrit.. G A Jacob. Sanskrit. 416 pgs. Sanskrit. Ambadas Sastry.. 194 pgs. Unknown. 475 pgs. Sanskrit. Sanskrit. Sanskrit.. Pandit Sri Hariram Shukla. The Niruktam Of Yaska Muni. Sanskrit. 1957. The Pancharatra Of Bhasa. 1017 pgs. Literature. Linguistics. The Nareshvaraperiksha. 1903. The Nidhipradipa Of Sri Siddha Srikanthasambhu. Unknown. Sanskrit. Sanskrit. Sanskrit. The Mimamsa Slokavartika. Sambasiva Sastri. Literature. 676 pgs. Unknown. 484 pgs. 1981. The Memorial Verses Of Appaya Dikshita's Kuvalayananda. Sanskrit. 1930. Sanskrit. Unknown.. The Minimum Wages Central Rules 1950. 128 pgs.. 1984. Unknown. 1925. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… The Mandaramaranda Champu Of Sri Krishna Kavi. 1898. 380 pgs. Sanskrit.... 906 pgs. 1957. 200 pgs. 1916.. The Naiskarmya Siddhi. Sanskrit.… The Parama Laghu Manjusha Pandith Nityananda Panta Parvatiya Unknown Sanskrit 1946 133 77/167 .. sanskritdocuments.. Sanskrit. Johannes Hertel. 1926. Dalapati Raja. The Nirukta Of Yaska Part Ii.. The Nyayaa Lilavati.. 1917. 0. 1934. Linguistics. Ramakantha. Unknown. Unknown. 1913. M Ranga Acharya. Sushil Kumar De. 342 pgs. Pandit Harihara Sastry. 297 pgs. 780 pgs. Literature. The Paippalada Samhita Of The Atharvaveda. The Padyacudamani Of Buddhaghosacarya. Sanskrit... 138 pgs.. 66 pgs... The Mirichchhakatika Of Sudraka. 1924.. 1933. 1954.... Shovona Devi.. Unknown. Sanskrit. 195 pgs..... R G Bhadkamkar. 1936. Pandit Kedarnatha. 542 pgs. Sanskrit. Unknown.. Linguistics.. Literature. 158 pgs. The Manidarpana. Mahamahopadhyaya Gangdhare Sasatri Tailanga. 1940. Late M R Kale.. The Nareshvaraperiksha. Sanskrit. 1926. The Mathuri Panchalakshani. Unknown. . 331 pgs.. krishnaji govind oka. The Panchatantra Text Of Purnabhadra. T Ganapati Sastri. The Orient Pearls Indian Folklore. 134 pgs. Sanskrit. Language. Unknown. Sanskrit. The Megha Duta Of Kalidasa. 52 pgs. Ramakantha.. Unknown. narayana ram charya. Unknown.. Language... Unknown. The Muhurtachintamani. Sanskrit. Unknown. Sanskrit... Religion Theology.. Sanskrit. Sanskrit.org/…/SanskritIIIT.

Kavi Ratna Pandith Shiv Dutta.. Pandith Ramacharitra Tripathi... Unknown. The Phakkikaratna Manjusa.. Unknown. maithil pandit sri kanakalal sarma..h. 1935. 1950. Sanskrit. 1923.. 1926. Sanskrit. Bhana Bhatta. E B Cowell. Pandit Shiva Datta. Unknown. The Ramayana Of Valmiki Ayodya Khanda.. 560 pgs.. The Ratnagotravibhaga Mahayanottaratantrasastra. The Rgvedabhasya Of Skandavamin.. 94 pgs. Sanskrit. Unknown. The Purvamimamsa Darsana With Khandevas Bhatta Dipika Vol I I.... sanskritdocuments. Philosophy. Vasudeva Laxman Shastri Paniskar. The Rig Veda. Philosophy. The Parvati Parinaya. Unknown.. 1931. The Rajaniti Ratnakara. 118 pgs. The Queset Of Enlightenment. The Pranjnaparijata Kavyam. 154 pgs. The Pratyabhijna Hridaya. The Philosophy Of Vallabha. Unknown. Dr Juan Miguel De Mora.. The Practical Sanskrit English Dictionary Volume First. Literature.. Sanskrit.. Sanskrit. 100 pgs. Sanskrit. 1911. Sanskrit.. 64 pgs. 1950. Unknown.. 660 pgs. 855 pgs.. E. Geography. 1962.. 580 pgs. Sesha Srikrishna. Sanskrit. 1946. The Queset Of Enlightenment. Sanskrit. pgs. 264 pgs. 321 pgs. Unknown... 259 pgs. Dr. Sanskrit. 136 pgs.. The Rekhaganita Or Geometry Sanskrit. The Ram Charitha Of Bhatti. Sanskrit. 100 pgs. Sanskrit. The Parijataharanachampu Of Sesha Srisrishna. Unknown.. Unknown. The Patanjali Charita Of Rambhadra Dikshit. Johnston D Litt. Unknown.2/14/2011 A list of scanned Sanskrit books at III… The Parama Laghu Manjusha. The Rasopanisat... 260 pgs. Unknown. Sanskrit. 150 pgs. Kamalasankara Pranasankara Trivedi. Unknown. vaman shivaram apte. 133 pgs. Biography.. Sanskrit. Bhattoji Dikshit. Sanskrit. 54 pgs. Sanskrit.. E J Thomas.. The Prasannaraghava Of Jayadeva Edition I I I.. Pandith Nityananda Panta Parvatiya. Sanskrit.. 1936. T Venkatacharya. Sanskrit. Sanskrit. 565 pgs. Rao Bahadur M.. The Prakrta Prakasa Or The Prakrt Grammar Of Vararuchi. Dharmasthala.rasik Vihari Joshi. 1960. Sanskrit. Unknown.… 78/167 . Unknown.. 94 pgs. Sanskrit. Kshemaraja. Unknown.. 1928. Sanskrit. 1889.... The Prakriya Prayoga Suchi. Kamalashankar Prana Sankhar Trivedi. 1911. The Sabda Kaustubha.. 1982. 1934. 1936..j. Sanskrit.. 1986. 1926. A Mahadeva Sastri.. Kunhan Raja C. Sanskrit.. 518 pgs.. 1950... 274 pgs.. 1902. sri nagendra narayana misra.org/…/SanskritIIIT. Sanskrit. Sanskrit. 395 pgs. K Sambha Shiva Shastri. Sanskrit. Mahamahopadhyaya Pandit durgaprasada. 1922. The Rupavatara Of Dharmakirti Part I I. 1938. 1928.. 1980. 1929.. Pandit Ram Labhaya. Vishva Bandhu Shastri. 1935. 1950.. Unknown. 545 pgs. The Parijataharana Champu. 122 pgs. Sanskrit. The Prakriya Kaumudhi of Ramachandra Vol iii... The Rasarnavasudhakara Of Simhabhupala. Unknown. E.. Unknown. 150 pgs.. 553 pgs.. Chandeswara. Unknown. 1928. Linguistics Literature.. Unknown. The Phakkika Saralartha. 1979. Unknown. Sanskrit. History.. Unknown.. Unknown. Sanskrit. 108 pgs. Thomas. Radharani Sukhawal. 72 pgs.... The Principle Of Opposites In Sanskrit Texts.

. Sanskrit. Literature. Religion. The Samgraha Cuda Mani. Sanskrit. Venkata Kavi. The Samnyasa Upanishads.. The Saiva Paribhasa. 1948. 300 pgs. 1934. 241 pgs. 1947. Literature. The Sahitya Darpana..... Sanskrit.. Sanskrit.chintamani Dikshit. 270 pgs. Unknown. Sanskrit... 159 pgs. 510 pgs. 1921. 1950. Unknown. Shripad Krishna Belvalkar.. 2002... Unknown. 2002.. T. The Satapathabrahmana.. 1929. The Santiparvan Part Ii Apaddharma And Concordance. Sanskrit.. Mahadeva Shastri. 438 pgs.d. 88 pgs.. 1925. Sanskrit. 64 pgs. The Samkhya Karika. Pandit A Mahadeva Shastri. Theology.. Sanskrit... The Samskara Dipika Part 2. Pandit Sri Krishna Mohan Thakur. The Sajjanendra Prayogakalpadruma. 1954.r. Sanskrit.. Pandit A.subrahmanya Sastri. Dhundhiraja Sastri.. Sanskrit. Unknown. 1938. 903 pgs. Pandit Durgaprasad. P S Sundaram Aiyar. Sanskrit. Unknown. The Samanya Vedanta Upanishads.. 1950.. 1940. 1929.... . Linguistics. 546 pgs. Unknown.. The Saiva Upanisads. The Sangita Sudha.. 1929.. 410 pgs. A.. Mahadeva Sastri. 1243 pgs. The Sacred Books Of The Hindus Vol Viii. Unknown. 1951. Sanskrit. 132 pgs. Sanskrit. 1960. The Samskara Ganapathi. 1930. Unknown. 216 pgs. 1933. Sanskrit. Unknown.. Mahadeva Sastry A. 1936.chintamani Dikshit. Linguistics Literature. Gopala Sastry N. The Saiva Paribhasa.. 1938. 894 pgs. Unknown.2/14/2011 A list of scanned Sanskrit books at III… The Sabdha Kausthuba. 400 pgs. 1929. Sanskrit... Unknown..rangaswamy Iyengar. Sanskrit. The Sarasvata Vyakaranam... Unknown.. The Samskara Dipika Part 3. 334 pgs. Sanskrit. Unknown. The Samnyasa Upanishads Vol Xii.… Th S t th b h A di T Th M dh di R i U k S k it 0 694 79/167 .r.. Unknown. The Sahridayananda Of Krishnanada. T. Sanskrit. m m sri gadhadara bhattaocharya. The Samanya Vedanta Upanishads. Pandith Nava Kishore Kara Sarma. 1930. 880 pgs. Durgaprasa. 1950. Sanskrit. . Rangaswamy Iyengar H R. 1950. Pandit A. 348 pgs. Art.. 1935.basu. 265 pgs. Sanskrit. Sanskrit.. Sanskrit. S. Unknown. Vidtasudhrakara Dr Har Dutt Sharma. 366 pgs. 90 pgs. 1935. The Samayamatrika.. The Sarasvata Vyakarana Part Ii. 146 pgs. 1950.mahadeva Sastri. The Saktivada.. pandit nityananda panta parvatiya. Shripad Krishna Belvalkar.. Unknown. Sanskrit. The Samgraha Chuda Mani. Sanskrit. Sanskrit.. The Samanyanirukti. 1921. The Satapathabrahamana.. The Sandilya Samhita Bhaktikhanda. Sri H.. Sanskrit. Unknown. Upanishads.. The Sakta Upanisads.. dhareshvara bhojadeva..r. The Saraswathi Kanthabharana. Sanskrit. 315 pgs. 268 pgs.. Pandith Anantharam Sastri Vetal.. Sanskrit. 272 pgs. Gopinath Kaviraj.. Unknown. T R Krishnacharya. Upanishads.... Sanskrit. Upanishads. Sayanacarya.. Sanskrit. sanskritdocuments. 1954. 1933. Pandith Nava Kishore Kara Sarma.. Unknown... Language.. Sanskrit. 1938. The Sanskrit Third Reader. 288 pgs. Sanskrit. Unknown.. 563 pgs. Upanishads. 376 pgs. 1938. Major B. 554 pgs.. pandit nityananda panta parvatiya. The Saktivada. 671 pgs. Sanskrit. Sayanacarya. The Saiva Upanisads With The Commentary Of Sri Upanisad Brahma Yogini... Unknown. Unknown. The Santiparvan Part 3. 558 pgs. 524 pgs.org/…/SanskritIIIT..

848 pgs. Unknown.. Sanskrit. Chatterji J C. 1944. Kshemaraja. 1934... Philosophy. 412 pgs. Unknown. 480 pgs... Sanskrit. The Sraddhaviveka. The Sree Narayana Vijayam. M M Sri Rudradhara. Unknown. 1944. Sanskrit. 182 pgs. The Sidhant Shiromany. Unknown. 282 pgs. The Shantakuti Vedic Series Vol X I I I... Sanskrit. Sanskrit. The Srauta Sutra Of Apastamba. 1937. Pandit Kedarnath... Unknown. Sanskrit. 98 pgs.. 694 pgs. 1965. The Sri Bhramara Gita.. Unknown. Sanskrit. 385 pgs. Sanskrit. Philosophy. M M Shri Gangeshopadhyaya. 260 pgs.s. Narasimhachari. 201 pgs. 1909. 1931... K Balarama Panicker.. 1910... Pandit Udai Narayan Singh. 1983. 1944. Sanskrit. 156 pgs. -. The Satapathabrahmana According To The Madhyandina Recension Vol V. The Spanda Karikas With The Vivriti Of Ramakantha. Sanskrit. Social Sciences. Narasimhachari. The Srautasutra Of Apastamba. The Spandakarikas Of Vasugupta With The Nirnaya. Unknown. 1962.. Philosophy. Viswabhandu. Utpaladeva. Pandit Durga Prasada. 1940. 1950. Sanskrit. The Srauta Sutra Of Apastamba... 64 pgs sanskritdocuments. T.. Unknown. Philosophy. 240 pgs. 1933. 1901. The Smriti Kaustubha Of Anantadeva.. 963 pgs.. 1971. The Siddhantalesasangraha Of Appayya Dikshita.. Vishva Bhandhu. Vishva Baandhu. Unknown. Sanskrit. Sanskrit... Unknown. 440 pgs. 1921. The Shantakuti Vedic Series Vol V I I I. Sanskrit. 652 pgs. Kavyas.. Sanskrit. Sanskrit. Pandit Madhusudan Kaul Shastri... 1930.. Unknown.. 622 pgs...org/…/SanskritIIIT. S S Surya Narayana Sastry. 240 pgs. A Mahadeva Sastri. pgs.. Unknown.. Viswabhandu. 1913. Sanskrit.. Sanskrit. Sanskrit. Sanskrit. Sanskrit. 139 pgs.. The Sri Mrgendra Tantram.. Gita Devi Joshi. The Srinivasavilasa Champu Of Venkatesa Kavi Edition Iii.. . The Siva Sutra Vartika Vol Iv And V. 1929. 1958. Unknown. The Shantakuti Vedic Series Vol Xv. The Sivadristi Of Srisomanandanatha With The Vritti. Sanskrit. The Siddanta Kaumudi Of Bhattoji Deekshit. The Siddhanta Kaumudi With The Tattvabodhini Commentary. Unknown.2/14/2011 A list of scanned Sanskrit books at III… The Satapathabrahmana According To The Madhyandina Recension..... Unknown. Wasudev Laxman Sastri Pansikar. The Satapathaprahmana. 324 pgs. J C Chatarji Vidhyavaridhi. 206 pgs. 809 pgs. Narasimhachar. The Sriharicarita Mahakavya Of Srihari Padmanabhas Astrin.. 2002. 0. 352 pgs. Sanskrit. 360 pgs. 1916. The Srungara Tilaka Bhana Of Amabhadra Deekshita. Jayakrishna... The Silparatna Of Sri Kumara. -... pandit sivadatta shastri.. 1948. Unknown. 1937.. Sanskrit. Sanskrit... 1972. Sanskrit. 809 pgs. 884 pgs.… 80/167 .. Sanskrit. Sanskrit. Unknown. Sanskrit. Unknown. Unknown.. Unknown. Unknown. 182 pgs. The Shiva Upanisads. 0. 830 pgs. K Sambasiva Sastri.. The Siddhitrayi And The Pratyabhijna Karika Vritti Of Rajanaka Utpala Deva. Pandit Madhusudan Kaul Shastri..venkatacharya... Sayanacarya. 1963.. Unknown.. Social Sciences.. 780 pgs. The Savyabhichar Prakaranam. The Shantikuti Vedic Series Vol X I V. 1925. Sanskrit.

The Tantraloka Of Abhinava Gupta.. 1963. Mangal Deva Shastri. Religion.. 392 pgs.. Philosophy. The Udayavarma Charita. The Unadi Sutras In Various Recensions 2. 306 pgs. Sanskrit.. The Svacchandatantra With Uddyota Of Ksemaraja Vol I.. Madhusudan Kaul Shastri. The Tattvatraya. Religion. Sanskrit. 1936. Pandit Bhavadatta Sastri.. 253 pgs.. 1936. Mahadeva Shastri A. Sri Ramachandra Panasikara Sastri. Sanskrit. Unknown.annambhatta... The Taittiriya Brahmana Part Ii. 1921. Sanskrit.. 368 pgs. 136 pgs. The Tantraloka Of Abhinava Gupta Vol I. 1928. Vaman Shivaram Apte. 1986. Unknown. The Tarka Sangraha Of M. The Trantraloka Of Abhinava Gupta Vol 3. 142 pgs. The Trikanda Cesha. 1986. Madhusudan Kaul Sastri. 788 pgs. The Sushrutasamhita Of Sushruta. Sanskrit. Unknown... The Tautatitamatatilaka Part I. 502 pgs. Rajanaka Jayaratha. A. 508 pgs. 1936. Unknown... 441 pgs. . 170 pgs. The Students Sanskrit English Dictionary. Unknown. 630 pgs. Sanskrit.... 232 pgs sanskritdocuments... Sanskrit. 142 pgs. Chinnaswami Sastri A. 1939... 913 pgs. 1938. Sanskrit.m. Sanskrit. Madhusudan Kaul Sastri..... Unknown. 1932. Jayaratha R. 695 pgs. 1933. 678 pgs. 1918. 412 pgs. Sree Mukunda Bala Sastry. Sanskrit. The Tripurah Rashya. 363 pgs. The Structure Of The Ashtadhyayi.. Sanskrit. Pt. Sanskrit. 1936.… 81/167 . Sanskrit. Jayaratha R.. Sanskrit. 1986. 266 pgs.. Philosophy. Seelakkhadha Maha Thera. Sanskrit. The Students Guide to Sankrit Composition.. 48 pgs.. Unknown. Kshem Raju. Sanskrit. Linguistic. Pandit Mukund Ram Shastri. Unknown.... Sanskrit. Sanskrit... The Ujjwalanilamani Vol 2. 1950.. Sanskrit.. 2002.. 1916.guruprasad Shastri. 1921. T R Chintamani. Madhusudan Kaul Sastri. 1942.rajanaka. 242 pgs. Unknown. A list of scanned Sanskrit books at III… The Stapathabrhmana. Sanskrit.. 1918. The Svacchandatantra With Uddyota Of Ksemaraja Vol Iv. Unknown. Sanskrit. Sanskrit. 1913. vaman shivram apte. Sanskrit.. K Sambasiva Sastri.. Unknown.2/14/2011 pgs. 1986.. 624 pgs. The Unadi Sutras. Jagaratha. 566 pgs. A Collection Of Sanskrit Nouns. 356 pgs. Religion. 0.. Unknown. Jadavji Trikumji Acharya... The Tattvartha Deepa-nibandana. The Tantraloka Of Abhinava Gupta Vol X. The Tilaka Manjari Of Dhanapala. Unknown. The Tantraloka. Unknown. 1881. 1992. Unknown.. Unknown.. Shri Rupagoswami.. Unknown.. Philosophy... Sanskrit. Sanskrit. Harishankar Onkarji Shastri. The Tantraloka of Abhinava-gupta vol Xii. Sayanacarya. 265 pgs. Sanskrit.. 350 pgs. Unknown. 327 pgs. Sanskrit. Unknown... Sanskrit. The Svacchandatantra With Uddyota Of Ksemaraja Vol Iii. 366 pgs. Sanskrit. 1928.. Unknown. The Stava Chintamani Of Bhattacharya. Sanskrit. 1938. Rajanaka Jayaratha. 0... The Tautatitamatatilaka Part Ii.. The Tantraloka of Abhinava vol Ii.. Unknown.. 1943. Chinnaswami Sastri.. I S Pawate. Madhusudan Kaul Sastri. The Tandyamahabrahmana Part-ii. 1932. 444 pgs.org/…/SanskritIIIT. Sanskrit.. The Tantraloka Of Abhinava-gupta Vol 5. 694 pgs. Madhusudhan Kaul. The Svacchandatantra With Uddyota Of Ksemaraja Vol Ii.

Language.. Hari Raghunath Bhagavath. Sanskrit..I I Part. Unknown. Unknown. The Vishnu Bhakti Kalpalata Of Purushottama. 122 pgs.. The Unadi Sutras. Sanskrit. Unknown. Upanishads. Unknown... The Veda Bhasya Bhumika Samagraha. Language. Literature. 472 pgs. Pandit Shankar Pandurang.. Arthur Venis... 244 pgs. ganganatha jha. 244 pgs. Dr Albrecht Weber. Sanskrit. 1972. T R Chintamani. 1917. Unknown. 1942. Pandit Mukunda Rama Shastri. The Vikramorvasiyam A Sanskrit Play Edition Iii.. Vaidyasastranipunah. 1959.. S B Athalye. Acharya Baladeva Upadyaya. Unknown.. H D Velankar. Unknown... Unknown. 1980. 1918. Literature. 279 pgs.. 1901... Sanskrit. 1096 pgs.. 64 pgs. A list of scanned Sanskrit books at III… The Unadisutras In Various Recensions. 307 pgs. 1942. T R Chintamani. pgs. 1928. Unknown.. Upanishadas. The Unadisutras In Various Recensions Vi. The Varaha Mahapurana. The Vrishabhanuja Natika Of Mathuradasa Edition Ii. 587 pgs. 91 pgs. Sanskrit. 1985....l. The Varshakrityadipika With Kalanirnaya And Vratodyapan. The Vivadachintamani Of Vachaspati Mishra. Sanskrit. Linguistics Literature. 338 pgs. The Vikramorvasiyam Of Kalidasa Edition I. 1968. Hari Raghunath Bhagavat.. The Vidyaparinayana of Anandarya Makhi... Unknown. 560 pgs. 1927.. Sanskrit. 388 pgs. Sanskrit. Language. Sanskrit. B. Unknown.. Anand Swarup Gupta. Sanskrit. Sanskrit. 1932. 642 pgs.. 58 pgs. Unknown. Prof. 285 pgs. 1961. 1993. 1933. H H Wilson. 307 pgs.. The Vikramorvasiya Of Kalidasa. 1992. Sanskrit. Linguistics.... The Vidusaka. 414 pgs. The Vajasaneyi Samihita. Sanskrit. 474 pgs. Sanskrit.... 104 pgs.. 1932.. Pandit Kedharinath Sarma. 1933. 1927. 1891..atreya. Pandit Sivadatta. Art. The Upanishadbhashya Vol. Svetavanavasin. Linguistics. Sanskrit.. 236 pgs. The Vishnu Purana A System Of Hindu Mythology And Tradition. Sanskrit. Sanskrit. The Unadisutras In Various Recensions 1 Of Svetavanavasin.. 764 pgs. Unknown.. 1927. Sanskrit. Sanskrit. The Vasistha Darshanam. 296 pgs.… 82/167 . 400 pgs. Sir Ganganatha Jah.I I. 1893. The Unadisutras In Various Recensions.... The Vivadhachintamani Of Vachaspati Mishra. Sanskrit. Sanskrit. Pandit Sivadatta.. The Vikramorvasiyam Of Kalidasa. 400 pgs. Unknown. Unknown.. 1942. Linguistics. G K Bhat.. Unknown. The Vrishabhanuja Natika Of Mathuradasa.. Sanskrit..org/…/SanskritIIIT. Sanskrit. Pandit Surendra Nath Shastri. 66 pgs sanskritdocuments. Sanskrit.... Sanskrit. Unknown. 374 pgs. Madhusudhan Kaul.2/14/2011 pgs. 1984. Literature. 1989. The Vakyapadiya.. 1942. The Upanishad Bashya Vol Ii Part I. Linguistics Literature. Pandit Sivadatta. The Vatulanatha Sutras. 1923. The Vizianagram Sanskrit Series Volume Ii Part I.. Sanskrit. The Vijnana Bhairava. The Vamana Purana. Unknown... pandit nityananda panta parvatiya. Sanskrit. Unknown. T R Chintamani.. Sanskrit. K V Sarma.

. sanskritdocuments.. 234 pgs.. Geography Biography History. . 1948.. Tiloya Pand-nd-attii Dditiiyo Bhaaga. Tisastvustik. Sanskrit. 700 pgs. W Redloff.. Chaara~ya Yativrxshhabhaa. Sanskrit. T. 190 pgs. Sanskrit. . Tirthacintamani.. 1936.... Unknown. Unknown.. Literature. Linguistics. Unknown. 524 pgs. Tirthacinthamani Vol 1. Sanskrit. Sanskrit. Linguistics. Art. 1944. The Yatra Prabhanda.. T T Srinivasa Gopalachar. Kamalakrishna Smrititirtha. 305 pgs. 654 pgs. History. The Works of Sri Sankaracharya. Sanskrit.. The Works Of Sri Sankaracharya Volume Iv. Tinantarnavatarani. Sanskrit. Sanskrit. Sanskrit. Tirthacinthamani Vol Ii. A C Woolner.. Vishrug.. 99 pgs. Unknown. Literature... Sanskrit. 1983.. Sanskrit. 202 pgs. History. Sanskrit. 1948.. Religion. 622 pgs. 1951. Shriidanapaala. 474 pgs. Bhagavat Patanjali. History. Linguistics. Literature. Sanskrit. 350 pgs. Sanskrit. 116 pgs.org/…/SanskritIIIT. T T Srinivasa Gopalachar. Geography. 516 pgs. Unknown. Sanskrit. Samarapungava Dikshita. Thomas Hardy.. Unknown. 1910.. Sanskrit... 1952. The Yadavabhayudaya Of Sri Vedantacharya. Thorale Shaahu Maharaaja Yaan'chen' Charitra Aavrxtti Da~vitiiyaa.. Brahmadattaji Jigyasu. Unknown. Geography Biography History. Geography.. Sanskrit. 1944. Tilakamanj-jarii Da~vitiiyaavrxtti. Tirthacinthamani Vol Iii... Language. Tiloya . 634 pgs. Chit'and-iisa Malhaararaamaarava. 68 pgs. Dr P L Vaidya. 1938. 426 pgs. Sanskrit. Unknown. The Yoga Upanishads. 162 pgs. Sanskrit. 126 pgs. 639 pgs. The Unadi Sutras... Sanskrit. Language.. 0. Burke A Hinsdale.... Biography. A list of scanned Sanskrit books at III… The Vyakarana Mahabhasya Part 1. Thrastadyayi Bhashya Vol I. Bhagavat Patanjali. The Works of Sri Sankaracharya Vol Xvi... 1961. pgs... 1911.. Unknown.. Philosophy.. 252 pgs. Thruhan Sutr. 1815. Mahamahopadhyaya Pandit Sivadatta. Thirteen Trivandrum Plays Attributed To Bhasa Vol Ii. Sanskrit. Kamalakrishna Smrititirtha. 1920. 1912.. The Yudhishthiravijaya Of Vasudeva. Theravada Buddhism In Burma. 1965... Sanskrit. 100 pgs.. Biography.r. Mahdeva Sastri. Sanskrit. Sanskrit.. Archicture. Language.. 0. 327 pgs..chintamani. Pandith Ramchandra Jha.2/14/2011 pgs. 272 pgs. 451 pgs. The Yadavabhyudaya Of Sri Vedantacarya. Kamalakrishna Smrititirtha. 1911. 1993. 0. 1950. Biography.. 98 pgs. The Unadi Sutras. Art.Pannatti Part Ii.. Subrahmanyakavi S... Tittriyopanishat Atharaiyopanipancha. Sanskrit.. 0. 1931. Unknown.… 83/167 . Geography. Pandith A.. Unknown. 1930.. The Works of Sri Sankaracharya.srinivasagopalachar. The Yadhavabyudaya Of Sri Vedanthacharya.. 1883. 602 pgs. Sanskrit. Sanskrit. The Vyakarana Mahabhasya Part 2. 1994. S C Sen Gupta. Theology. Thrikalavachedhikavadhaha. The Unadi Sutras. T. 1931. Sanskrit. Niharranjan Ray.. 305 pgs. Unknown..

... The Arts. Krishnaswamy Iyer. 1946. Unknown... Two Vajrayana Works... K. Sri Sankaracharya. Und-aadi Suutraand-i Grantha 7. Sanskrit.. Simhavira Dura~ga. Sanskrit. C. 1953. 122 pgs. 1933.. Unknown. Linguistics. Language. Sanskrit. 1941... Unknown. 302 pgs. 233 pgs. Religion.. Religion.. Linguistics. Sanskrit. 1925. Und-aadisutraand-i Prathamo Bhaaga. Agama Prabhakara Muni Punyavijaya. Und-aadisuutraand-i Bhojiiyaani Shhashht'ho Bhaaga Grantha 7. Theology. Unknown.. Ukttivyaktiprakarand-a. Literature. Upadesha Sahasri. V Krishnamacharya. Sanskrit. Dr.. 1952. Unknown. Two Plays Of Bhasa. Sanskrit.. Unknown.. Chintaamand-inaa. Language. Udararachavam of Kavimalla Mallacharya. A. 720 pgs..sudhakar Malaviya. rajendra swarup gupta... Literature. Jagadgurvo Vijaynante Taramah.… 84/167 . Umas Mirror.. Upanishhada~vaakyamahaakosha Uttaraara~dhaha~. Upanishads.m. Unknown. 62 pgs. Literature. Linguistics. Unknown. 283 pgs. 237 pgs. Sanskrit. Art. 316 pgs. 508 pgs.. 1929. Sanskrit... Sanskrit. Naaraayand-a Dand-d'anaatha. Triddnimathvibhodhini. 1953. 256 pgs. Language.. 238 pgs. Literature. Unknown. Sanskrit. Toegyehak Libery Part I Vol 4. Sanskrit. Pandith Sri Durgadutta Tripathi. 1936. 1984. Theology. Sanskrit. 675 pgs. Religion. Itaruka. Chintaamand-inaa Ti Raa. Damodhara Pand-d'itavara. Udaya Vadantha Granthamala. Unknown. Theology. 1933. 1933. 147 pgs. Sanskrit. Theology. Sanskrit. 1995. 158 pgs. Vasudeva Lakshmana Sastri. shastri gajanan shambhu sadhale. Unpublished Upanishads. pgs. 330 pgs. 665 pgs. Religion. Sanskrit. Linguistics. Und-aadi Suutraand-ii Bhojiiyaani Shhashht'ho Bhaaga. Dinakar Krishna Gokhle. Linguistics Literature. 284 pgs. Chintaamand-ii Ti Ra... 314 pgs.. Benoytosh Bhattacharyya. 52 pgs.. 1923. 97 pgs.. Religion. Chintaamand-inaa. 1959. Sanskrit. 308 pgs.. 1933.2/14/2011 A list of scanned Sanskrit books at III… Toegyehak Libery Part I Vol 4.. Und-aadisuutraand-i. Art. 544 pgs. Unknown.. Linguistics. 638 pgs.. Literature. 94 pgs.. 1934. 1925. Tripurabhaaratiilaghustava granthaan'ka 1. Upanishhadaan' Samuchchaya Da~vitiiyoyamang-kanaavrxtti. Philosophy. 1929. Theology. Upanishhada Samuchchaya. K M Munshi. Sanskrit. Theology.. Sanskrit... 403 pgs. 60 pgs. 1929.. sanskritdocuments... 532 pgs. Somatilakasuuri.. Sanskrit. Theology. P. Sanskrit.. Language. Upanisad Vakya Maha Kosa Vol 1.org/…/SanskritIIIT.. Gajanana~ Shambu Sadhale Shastrii. 1966. Sanskrit. Language. Sanskrit. Trikonamithi. Veeraraagaya. Und-aadi Suutraand-i Ditiiyo Bhaaga Grantha 7.. Translation Of Siddhanta Bindu. Religion. 1937. Upadeshasahasri. Sanskrit. 1940.. Shriinaarayand-ashan'karaananda.. 1929. Aapat'e Hari Naaraayand-a. Unmattaraghava.. Sanskrit. 194 pgs. 1961... Trin'shachchha~lokii Grantha 104. Unknown.. 0.. Sanskrit. Upakarma Paddhathi. Sanskrit.. 201 pgs. 1934. Sanskrit. Psychology. Shaastri Shan'kara. Religion.. 210 pgs. Ullagharaghava Nataka. Sanskrit.. Sanskrit. Sanskrit.. A S P Ayyar. 1933. 1941. 1982.modi... Sanskrit... Kumham Raja... Theology. 1952. Naaraayand-a. Upadeshasahasri Part I. Tristhaliisetu 78. Religion.

.. Vaidik Avem Vedottar Bharatiy Sanskruthi. Sanskrit.... 375 pgs...2/14/2011 A list of scanned Sanskrit books at III… Upanishhadbhashhyama~ Dvitiya Bhaaga Dvitiya San'skarand-ama~.. Religion.. Vaidyakiyasubhasitasahityam. Unknown. 1925. Sanskrit. Upanishhaddaakya Mahaakosha Prathama Khand-d'a.. Literature. Sanskrit. Sanskrit. 44 pgs. Sri Somadev Suri. Vidwan Satyadhyanacharya.. 1987.. Unknown. 1921. Sanskrit. Vaidik Sathya Prakasha. 0. 1931... Vaidik Sahitya Ka Itihas. 2001. Sanskrit.Srautasutram.. Sanskrit. Pandarinathacharya. 355 pgs. Dr Ram Murthy Sharma. Theology.. W. Sanskrit.... Unknown. 1928. Religion Theology. 296 pgs. 408 pgs. 200 pgs. Tirunoymozhi. 1949.. 1940. Sanskrit... Advaitam. Sanskrit.. Balakrishna Misra. 1997. 1912. M M Pandit Deviprasada Ravichakravarti. 1932. Sanskrit. Narayan Ram Acharya. 576 pgs.. Unknown.. Philosophy. Sanskrit.. 693 pgs.. Unknown. Unknown.. Vaakyaara~tharatnama~. 766 pgs. Bhid'e Sadaashivashaastrii.caland. Vaaraahagrxhma Suutra Bhaaga Xviii. Vedas. Sanskrit. Bhid'e Sadaashivashaastrii. Shriimadahobalasuuri. Dr Gaurishnakar Mishra. 1997. Unknown.. Religion.. Bhishkakavi Sri Rashachandra. Sanskrit. Unknown. Vaajasaneyipraatishaakhyama~ Kaatyaayanaprand-itama~. Pandith Madhava Sastri Bhandari. Unknown.. 66 pgs. 450 pgs. 1949. Sanskrit. 1934. Srinivasamakhi Vedantadesika... Gruhya Sutras. Sanskrit. 541 pgs. Vaidika Padanukramakosa Vol 2 Part 1. Unknown.. Sanskrit. Srinivasamakhi Vedantadesika. Sanskrit. Psychology. Upanishhadratnaprakaasha Ratna Chhaandogyopanishhada~... Visva Bhandu Sastri. 659 pgs. Paridath Kalarama Shastri.. Pandit Pannalal Jain.. Sanskrit.. Sanskrit. Sanskrit. Appayya Dikshita. S Subramanya Sastri. Vag Vallabha Of Sriduhkhabhanjanakavi. 605 pgs. Philosophy. 1933. Psychology. Theology. 1943. Bhagva Dutt.... 376 pgs. Vaikhamsa Gruhya Sutram vol Ii.. Sanskrit. sanskritdocuments. Sanskrit. Uttara Purana Of Acharya Gunabhadra.. Subramanyamu V. 391 pgs.. Religion. Philosophy. Unknown.. Vaishmavism. C R Devadhar. Sanskrit. 1933.. Vaidik Vadgamya Ka Itihas Vol I I. Upasakadyayan. Vaijayanthi Kosa Volume Ii. Sanskrit. 309 pgs.. 1976. Gajaanana Shambhuputro. 1945. Sanskrit. Shriishan'karaachaara~ya. Vaalmiikii. 420 pgs.. Sanskrit. 516 pgs. Religion. 64 pgs. Shaastri Shamaa. Sanskrit. 348 pgs. 1954. 1954. 161 pgs.. 1930.. Unknown. Vaalmiikiiya Raamaayand-ama~ Baala Kand-d'ama~ Paqs-chimottarashaakhiiyama~. Vadanakshatramala. Vaiiyakarana Siddhant Laghumanjusha... Uttararamacharitra.… 85/167 . Subramanyamu V. Vaikhanasa Gruhya Sutram vol 1. 672 pgs. Psychology. 444 pgs. 172 pgs. 1932. Natural Sciences. 1981. 106 pgs. Vada Varidhi. Sanskrit. 1940. Theology. Veng-kat'araamashara~maand-an. Vaikhanasa ... Sanskrit. 1941. 210 pgs. 639 pgs.. 1971. 1943. Usaniruddha. 1935. Upanishhadratnaprakaasha Ratna Chhaandogyopanishhada~. Utsarjano Pakarmapaddhatih. Sanskrit. 142 pgs.org/…/SanskritIIIT. Vaidhyachandrodaya Vol Ii. 411 pgs.. Unknown. Sanskrit. Vadavali.. Theology.. Urubhangam Breaking Of Thighs..

Pandith Sri Sitaram Sastri. Varaang-gacharitama~ Prathama San'skarand-ama~.. Sanskrit.. Unknown. 1928. Sanskrit. Kand-ada Mahara~shhi. Muni Sri Jambuvijayaji. Unknown. 1961... Sri Achyuta Krishnananda Tirtha. Sri Achyuta Krishnananda Tirtha. Sri Nagesa Bhatta. Vanshabhaskar. venkatrao rayasam. 1927.. Unknown... Sanskrit.. Sanskrit.. Vakrokti Jivita Of Raja Rathnakara.... 376 pgs. Linguistics..... 1925. Sanskrit. Sanskrit. Sanskrit.. Vaiyakarana Siddhanta Laghu Manjusha No 192. Sanskrit. Vaiyakarana Siddhanta Laghumanjusha No 213.. Pandith Sri Sitaram Sastri. Sanskrit. Sri Nagesa Bhatta. Unknown. 96 pgs... Vamana Suktam. 88 pgs. Unknown. 1913. Shriijat'aasin'hanandi. Sri Nagesa Bhatta. 110 pgs. 106 pgs. Vanamala. Vaisheshhika Dara~shana. 292 pgs.. 104 pgs. Philosophy. Valmiki Ramayana Volume One... Psychology. Language.. Unknown. 2002. Literature. 104 pgs.. Sanskrit. Sanskrit. Theology. Literature. 1924. Unknown. Sri Nagesa Bhatta. Literature. Vaishampaayana. Vamanapurana. Vaiyakarana Siddhant Laghumanjusha.. Sri Parameswardin Pandey. Literature.. 1993... Pandith Madhava Shastri. 108 pgs. 360 pgs.. Unknown. 110 pgs. Religion. Sanskrit.. Sri Nagesa Bhatta. 314 pgs. 106 pgs.. 0. Sanskrit. 190 pgs. Sanskrit. 112 pgs.... 508 pgs.. Vaiyakarana Siddhanta Laghu Manjusha No 237. 1953. Sri Nagesa Bhatta. 1929. 1172 pgs. Sanskrit. Unknown. Vaiyakarana Siddhanth Laghumanjusha. 1974. Language. 1961. Vaiyakarana Siddhanta Laghu Manjusha No 228. Religion. Unknown. The Arts.. Krishna Singh ji. Sanskrit. Unknown. 104 pgs... Sanskrit. Pandari Krishnacharya. Unknown. 0.. Sanskrit. Unknown. . Sanskrit. Sanskrit. Vanamala A Commentatory On The Taittiriyopanishad Bhashya. 106 pgs. Unknown. 0. 1929. Vaishampaayananiitiprakaashikaa. Sanskrit. Linguistics. 1924. Vaiyakarana Siddhanta Laghu Manjusha No 238. 1960. 1954.. Sanskrit. 1984. 114 pgs. Sanskrit. Language. Sri Ananta Sastri.... sanskritdocuments. Dr Dhanurdhara Jha. 354 pgs. ... 1929. Vaiyakarana Siddhanta Laghu Manjusha No 214. Vaiyakarana Siddhanta Laghu Manjusha No 211. Vaisakha Mahathyam. Sri Nagesa Bhatta. 1929.. Vaiyakarana Siddhanta Laghu Manjusha No 191. 144 pgs. Vaiyakarana Siddhanta Laghu Manjusha No 328. Vaiyakarana Siddhanta Laghu Manjusha No 212. 1929.. Sri Nagesa Bhatta.. 227 pgs. Sanskrit. Vakyartha Vivechanam.. Vaiyakarana Siddhanta Laghu Manjusha No 253... 1938.… V h h L Li i ti Lit t S k it 0 502 86/167 . 1925.. Sanskrit. Linguistics. Vaiyakarana Siddhanta Laghu Manjusha No 227. Sanskrit. The Arts. govindlal hargovind bhatta. 326 pgs. 186 pgs. Sanskrit. Vaisesikasutra Of Kanada. 414 pgs. Sanskrit. 102 pgs. Unknown. 0.. Literature.. Unknown. Sri Nagesa Bhatta. Vyakarnopadhyaya And Sahitya Tirthac.. 1928. 222 pgs.2/14/2011 A list of scanned Sanskrit books at III… Vairagy Shatak. 1913. Indian Logic. Unknown.org/…/SanskritIIIT.

.. 340 pgs. Vedaantasutramukttaavali. Sarasvatii Bramhaananda.. 0. Sri Yudishtara Mimansa. Shriivaradaacharayaa.. 1973.. Sanskrit. Theology. 1942. 504 pgs. 502 pgs. Philosophy. Sanskrit. Subramanya Sastri S. Philosophy.. Vedaantaparibhaashaa. 1953. 1986. Sanskrit. Sanskrit... Vedanta Prakasa. Varahi(bruhat) Samhita. 1971. 1270 pgs.n. Veda Bhasya Bhumika Samgraha. 0. Unknown.. Vararuchi Avam Hemachandra Virachitha Prakrutha Vakarna 2739. S S Suryanarayana Sastri. 440 pgs. Sanskrit. Sanskrit. Unknown. Unknown. 456 pgs. 0. 1872. 190 pgs.. Psychology. Sanskrit. Vaydyak Sabdasindhu. Religion... Sanskrit. Vasantatilakabhaand-a.. R K Prapannacharya. Sanskrit.... 1911.. Vasunandi Shravakachara. Vedantanayabhushanam. 106 pgs. Psychology... 1991. 1952...pandey.. Kaviraj Nagendra Nath Sen.sree Krishna Sarma... 92 pgs. Chenna Reddy. 1838. 1986. Vedakhasarodhar. 62 pgs. Dr B Rama Raju.. Veda Pravachana. Biography.. 1967. 236 pgs. 249 pgs. Sanskrit. 425 pgs.. Sanskrit... Vedanta. Psychology. Shivasahaaya. 215 pgs. 292 pgs.… 87/167 . Literature.2/14/2011 A list of scanned Sanskrit books at III… Varahamahapuranam. Unknown. Vedaanta Tattva Viveka. Ramananda Saraswati Swami. Sanskrit. Sanskrit.. A. Unknown. Unknown. 363 pgs. Vasu Caritram. 460 pgs. Vedantakaustubhaprabha Accn0 478. Religion.. Unknown.. Sanskrit. Narayana. Vedandak.. Vedanta Darsana. Veda Samiksa.. 238 pgs. Sanskrit. Unknown. Namitha Garg. 1998. Pandit Harilal Jain..n. 1942. Sanskrit.. Baladeva Prasad. Unknown. Unknown. Unknown.. Vedaantasaara.. Shriinrxsin'hashrami. Sanskrit. Narayana A... Vedas. Sanskrit. 1984.. 872 pgs. Ganga Prasad Upadhyay. Vedanta Sara Cintamani.. 1986.venkatesacharya. Vedaanta Raamaayand-a Bhaashhaat'ikaa Sahita.. Sanskrit. 130 pgs. Linguistics. Dr.. 2000. 2004... . Sanskrit. Language. Unknown. Philosophy.. Varivasya Rahasya Accn0 1281. Kaat'adare Maadhavakeshava. 2000. Sanskrit... Unknown. Dr. . Sanskrit.. Sanskrit. Language. Sri Giridhar Sharma Chaturved. Sanskrit Samhitas. Sanskrit. 1976. B. 1955. Geography. Vedanta Sutramu Mdravali. 413 pgs. 80 pgs. 237 pgs.. 1969. 272 pgs. Mishra B N... 1948.. Vedakalija Narisiksha. Unknown. 1965. Sanskrit. Vedanga Prkasa.. Aadhvrina~ Dhara~maraaja. 81 pgs. Varahamihira Horasastram. Shri Brajnath Sharma. 101 pgs. Philosophy.srinivasaraghava Aiyangar.... Sanskrit. Sanskrit.a.j.. Sanskrit. 1992... Vaishmavism. Philosophy. Kaviraj Nagendra Nath Sen. Linguistics. Sanskrit. 1915. Literature. Pramodini Pandu. 193 pgs.org/…/SanskritIIIT. 1984. 1998. Psychology. Veda Praveshah. Ganga Prasad Upadhyay. Unknown. pgs.. Religion. 81 pgs. 234 pgs. 82 pgs.e. Unknown... Sanskrit. 1951. Bhagavadraamaanujama. Vararuchasangraha. History. Sanskrit. Sanskrit. Vararuchasanghrahar. Sociology.. 548 pgs.. Sanskrit.r. Vedanta Sutramu Mdravali. Vedanta Sutramu Mdravali. Vatsaraaja Udayand-a. Unknown. sanskritdocuments. 1964. 522 pgs.

Vedic Hymns. 846 pgs. Sanskrit. 1969. Veershaivendru Shaker. Sanskrit. Srimath Paramahamsa Parivrajakacharya.. Jambhaladatta. 150 pgs. 1959... Sanskrit.. 240 pgs. Unknown... 1945. Sanskrit... vishva bhandu. Unknown.. 292 pgs. Vedic Padhanukrama Kosah Vol 5 Part 1. 209 pgs.. 362 pgs. 1992. 1958. Sanskrit. S N Srirama Desikan. 115 pgs. 1975.. Philosophy. Venkatadvari Tatrkuthinam Adhyayanam. Literature. 1964. Unknown.. Language. vishva bandhu. Sanskrit.. Unknown. Unknown.. Somraj Krishna Das. Sanskrit. 500 pgs. Unknown. 2001. Veeramithrodaya. 366 pgs.… V t l P h Vi h tih S N Sh ti U k S k it 1949 66 88/167 .. Sanskrit. Sanskrit... Sanskrit.. Visva Bandhu Sastri. Vedantha Paribashaa. Unknown. Venkatasuris Nauka Charitram In Sanskrit. Sanskrit. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Vedantaparibhasa Accn0 583.. Brahmanadha Saraswathi. 1988.. Unknown. 1961... Unknown. Sanskrit. Sanskrit. Sanskrit. visva bandhuu sastri. 892 pgs. Sanskrit. 1910. vishva bhandu. 1945. Dr Kunwar Lal. -. 290 pgs. 260 pgs. 644 pgs.. Unknown. Vedharya Sangrahah Geetha Bashya Gadyayatra. 1942.. 892 pgs. Sanskrit. Vedic Padhanukrama Kosah Part 1. Sanskrit. Sanskrit. Vaman Bhattacharya. Unknown. 758 pgs. 1979.. Sanskrit.. Vedhantha Paribhasha. 806 pgs. 1992. Unknown.k.. Pandit Mitra Misra.. 998 pgs. Vedic Hymns.. 1939. 1955. S.krishna Swamy Aiyar. Vetaalapanj-chavin'shati. Pandit Shada Shiv Sharma. Sanskrit. Krishnamurthysahastryvarya. 500 pgs. Philosophy.. Sanskrit.. Srimithra Mishra.. Vedastuti Volume Iii. 1984. Sanskrit. T.krishnamurthy Shasthry. 1864. Vedic Padhanukrama Kosah Vol 4. Krishnamurthysahastryvarya. 362 pgs.. Unknown. 700 pgs. Unknown. Unknown.. Veeramitrodaya.. Vedanthanamaratnasahasram. 1970. 290 pgs. Sanskrit.. 666 pgs.. 55 pgs. 1988. Unknown. Unknown.. Sanskrit. Vishva Bhandu. P Bhagaddatta amp Hamsaraj. Sanskrit. 1971. Unknown. 1959. 117 pgs... Unknown. Vemanapadyamulu In Sanskrit Slokas. Vedic Kosha..r. sanskritdocuments. Venkateswari Thatkruthinam Adhyayanamu. Vede Ashvinau Asvins In The Vedas. Panchanana Bhattacharya Sastry. Philosophy. P Sambamoorthy.. Dr G Swaminath Charyulu. Art. Sanskrit. 261 pgs. Vedic Padhanukram Kosah Vol 1. 1989.org/…/SanskritIIIT. 704 pgs. 201 pgs. Sanskrit... Unknown. 1998. 1867.. 520 pgs. Vedic Padhanukrama Kosah Part 2. 1952. 1962. Linguistics.. G Swaminadhacharyulu.. Vedic Padhanukram Kosah.. S S Suryanarayana Sastri... 258 pgs.. Wasudev Laxman Sastri Pansikar.. Literature. 390 pgs. Vedantnamaratnasahasram. Vedanthasindantha Mukthavali. Vedic Padhanukrama Kosah Vol 1 Part 2.. 1969. 338 pgs.. Vedavyasaparampara. vishva bandhu. Linguistics. Vedhaththa Suthra Mukthavali. Sanskrit. . 1947.. Literature... Sanskrit. 238 pgs. Unknown. 1945. 0. . Visva Bandhu. Vedic Padhanukrama Kosah Vol 3 Part 2. Sanskrit.. visva bandhu sastri. Sanskrit. Language.... Vemabhupala Charitram. Sanskrit. Vedic Padhanukrama Kosah Part 3... 1969.. Vedardhasamgraha Geetha Bhashya.. Vamana Bhatta Bana.. Prakasanamba. Vema Bhupala Charitam. Sanskrit. 76 pgs. Venkatachala Ithihasamala Anantarya.

1925... 67 pgs. 202 pgs. 400 pgs. Vimarshamruthamu. Vibhaktyarthanirnaya Iv. 0. Sanskrit. Virodha Varuthini.. Vidhi Rasyana. . 677 pgs. Unknown. R Shama Sastry. Unknown. Sanskrit. Unknown. Sanskrit.. Unknown. Vibhaktyarthanirnaya Iii. Pandit Madhava Prasad Vyasa. Dr B R Shastry. Sanskrit. 1987.. Sanskrit. Sanskrit. Venkat Ramana Reddy. 382 pgs. 106 pgs.. 168 pgs. Sanskrit. 1997. Vidhura Nithi.... Sanskrit. Vidyamadhaviyam Of Vidya Madhava. Shriikaalidasa~. -. 1986.. Giridhara Upadhy.. 1978. Unknown. Sanskrit. 1949.. . Pandit Mukunda Shastri. Giridhara Upadhy.. Somraj Krishna Das. Vichara Ratnakara Kirtivijana.. Sanskrit.. Theology... 1966. Vidhaanamaalaa Grantha 86. 428 pgs.. Sanskrit. Geography. Vishnu Prasad. 66 pgs. 230 pgs. Sanskrit. Literature... Sri Giridhara Bhattacharya. 110 pgs. 1901.. Sanskrit.... 257 pgs. 124 pgs.. 94 pgs. 1966. Jagannath Sastri Hosinga. Sanskrit. Vishnu Prasad Sharma. History.. 108 pgs. Sanskrit. Vikramorvasiyam Of Kalidasa.. Natural Sciences. Vishampadh Vakya Vritti. V. 194 pgs. Unknown. Vidhyaamaadhaviiyama~ Trxtiiyasan'putama~ 11-15 Adhyaayaa. Sanskrit. 170 pgs. Religion. Sanskrit. 1867. Sanskrit... 172 pgs. Unknown. Visesavasyakabhasya With Srikotyaryavadiganis Vivarana Part Iii. 1916. Viramitrodaya Bhakti Prakasha Vol Xi.. Sanskrit. Literature. S N Shastri.. 106 pgs.org/…/SanskritIIIT. 304 pgs. 1901. Viramitrodaya Samaja Prakasha Vol X. Unknown. sanskritdocuments.... shriramavathara sharma. 123 pgs. 0. 364 pgs. Vishnu Prasad Sharma. Unknown.. Dalshuk Malvania... 58 pgs.. Jyotira~vichchhridayaanaatha. Sanskrit. Vidura-niti. Natural Sciences. Vidhyaamaadhava... Vibhaktyarthanirnaya V.. Unknown.dalsukh Malvania. 1901. Sanskrit. 1939. Giridhara Upadhy. Biography. Vikrantabharatam. Sanskrit.... Unknown. 240 pgs. 0. 1926. Sanskrit. 101 pgs. Literature. Theology. History.. Unknown. Somraj Krishna Das.. Bhat't'a Shriinrxsin'ha. Sanskrit. Vibhaktyartha Nirnaya.. Unknown. 390 pgs. 1926.. 290 pgs. R R Deshpande. 1964. Sanskrit. 0. 330 pgs. Sanskrit. Unknown. Visheshik Darshan. 0. Literature.. Sanskrit.. 1645. 419 pgs.. 334 pgs. 106 pgs.. Mahaprubhu Lal Goswami. 1987. Vishnupurana With 2 Commentry amp Tika Vishnucitta amp Sridhara. Unknown.. Sanskrit. V Venkataramana Reddy. Sanskrit. Viira Vinaayaka. Viramitrodaya Vol Xx.. Vimand-d'alavakravichaarah.. Deshapaan'd'e Ga Vi.... Biography. Vibhaktyarthanirnaya. Linguistics.… 89/167 .. 1986. 1901. Unknown. 0.2/14/2011 A list of scanned Sanskrit books at III… Vetala Pancha Vimshatih. 1954. Sanskrit. Vishnu Dhrmoattara Puranam... Unknown. Sanskrit. Shriidhara~madaasasuuri.. 156 pgs.. Sanskrit. . Unknown... 1923. Visakhadattas Mudraraksasa Edition I I. Unknown.. Sri Giridhara Bhattacharya. Vidhiviveka. Sri Paripurna Prakashnanda Bharathi Mahaswamin. Vikramarkandeva Charitram. 1920. Language. Pt. Vidagghamukhamand-d'anakavyama~.. Religion. Unknown. Visesavasayakabhasya Part 1. Sanskrit. Swamy Vivekananda.. 151 pgs. Shri Ram Sharma Acharya. Unknown. 1901. 1952. Virodha-varuthini. Sanskrit. Geography. Nanuji Bhatt. 1948. Vikramora~vashii trot'akama~ Chatura~tha San'skarand-ama~.

.org/…/SanskritIIIT.. Vrittaratnakara Edition Vi. Acharya Madhusudhan Shastry.. 538 pgs. Sri Rudradharajha... 1948. Somraj Krishna Das.. 168 pgs. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… 1967. Sanskrit. Vizianagaram Sanskrit Series. 0. 1957. 339 pgs.... Visvamitra Samhita.. 312 pgs. 1929. 1926.. Vivahapatlam Sarasamuchaya. 430 pgs. 1957. Ganga Vishnu Sri Krishnadas. Sanskrit.... 616 pgs. Sanskrit. Unknown. Vrataraja. Visukipuranam. Visnusmrti Ii. 1929. Vyakaranabhushanasara.. Unknown. 1948. Natural Sciences.shiv Dutt Mishra.. Mohamahapadyaya Kapisthalam Desikachariar. Vyakarana Koumudri.. 1969. Sanskrit. Sanskrit.. Unknown. Sanskrit. Sanskrit. Sanskrit.. 304 pgs... 1981. Sri Ramachandra Kavi Bharati. Vritharatnakaram. Unknown. Sanskrit. 1942. Swami Madhavananda. Literature. 1891. 146 pgs. 1914. Ramasastri Bhagavthacharya. Religion. 1991... Religion..… 90/167 . Vyayasasidhanta Marthandam. Sanskrit. Unknown. Visnuvilasa. 1954. 506 pgs.. 1921. Sanskrit. Literature. 1964.. 1934. Anant Ram Shastri. Unknown. 338 pgs. Unknown. 0. 1943... Vividha tiira~thakalpa. 228 pgs. Vyutpattivada. Viveka Chudamani Of Sankaracharya... Sri Giri Sharma Chathurved. .. Unknown. Vyavahaaramayuukha. sri vasudev dikshit. Vyakarana Siddhanta Kaumudi. Sanskrit. Unknown. Unknown. Sanskrit... 1940. Vyutpattivada Of Gadadhara Bhattacarya. Literrature.. . 1983. 1818.. Veng-kat'araamashara~maa Ve. 1994.. Unknown. Dr. 562 pgs. Psychology. Sanskrit. 0.narayana Pillai. Jinaprabhasuuri. Sanskrit. Sanskrit. 336 pgs. . Linguistics. Unknown. Sanskrit..krishnamacharya. 245 pgs. V Rangaswami And Krishna. 246 pgs. Sanskrit. Sanskrit.. 362 pgs. Sanskrit. 1993... Vyavahaaramaalaa. Vyakaran Maha Bhasyam.. Visuddhimaggo Prathama Bhaaga. Vyakaran Siddhanta Kaumudi Balmanorama Pradhamabagamu. Buddhaghosaachariya. 865 pgs.. Mahadev Chimanaji Apte. Sanskrit. Visnudharmottara Mahapuranam. Vyavahara Nirnaya Of Varadaraja. Religion. Vishyanukramanika.shiv Dutt Mishra. Sanskrit. . Unknown. Vyakarana Mahabhasyam Of Patanjali Muni. 909 pgs. Unknown... Vyutpattivaadah Lakaaraara~thavichaarah. 115 pgs.. Vrttaratnavali. 1942. 837 pgs. 605 pgs.. 610 pgs. 1954. 277 pgs. 1988.. Pt. Theology...aryendra Sharma. Vyasasidhanta Marthandam. 668 pgs. P. bhattoji dikshita. Religion. 284 pgs. 240 pgs. B V Narasimhacharya. Psychology. Sanskrit... 1935.... Theology. sanskritdocuments.. Unknown. Undemane Shankara Bhatta. 541 pgs. 234 pgs.. 1951. Philosophy. Sanskrit.. 1983.. Sanskrit. Sanskrit.. Bhat't'aachaara~ya Gadaaghara. 166 pgs.. Philosophy. Religion. Sanskrit. Theology. Language. Viwahsopangvidhi. 81 pgs. Vrttaratnakara. -. Somraj Krishna Das. 645 pgs. Eluu Eluu. Unknown. Pandit V. 535 pgs.. Sanskrit.. 624 pgs.. Shriibhagavatpatan'jala. P Gopalachandra Vedanthashasri. Sanskrit.k. Unknown.. Srinivas Ayyangar. Pt. Sanskrit. Sanskrit. . Vyaakarand-amahaabhaashyama~ Tatraang-gaghikaara Da~vitiiyo Bhaaga.

183 pgs.chinnaswami Sastri. 331 pgs. 2000. 0. 266 pgs. Yogachintamani Ki Anukramanika. Bhat't'a Daamodara. Sanskrit. 2003.. Yashodhara Mahakavyam.. 746 pgs. Umesh Chandra Pandey.… 91/167 . Linguistics. Language. 204 pgs. 196 pgs. Yagavasista Vuthu Paryay Prakasika Part 3. Sanskrit. Philosophy.. Unknown. Yathiraja Vijaya Natakam. Sanskrit.. Sanskrit. Sanskrit. 598 pgs. Unknown. 0.. Philosophy... Sanskrit.. Yajhu Shakiyasanthikanda Pradeepa. -. Sanskrit. Unknown. Sanskrit... 1980. 1949. Yajura~veda San'hitaa Dditiiya Vaaran.. Yekanki Saptakam. . 162 pgs.t. 124 pgs. Literature. Yajura~vediiya Maitraayand-ii San'hita. Maiva Ram Kattara Padka. Yajnavalkyasmrti.. Sripad Damodar Saatvalekar. 162 pgs. 360 pgs... Aapat'e Vinayaka Gand-esha. 1953. 132 pgs.v. . . Unknown. 1953. 1981. 1934... Yajurvedha Maithrayani Samhitha. 1930.. 0. Sanskrit.. Religion. Sanskrit. 89 pgs.. Yadnyavalkyasmriti Of Yogishvara Yadnyavalkya Fourth Edition. 716 pgs... Dhamodar.. Unknown. Wasudev Laxman Sastri Paniskar.. Sri Swami Sivanandh. Yagavasista Vuthu Paryay Prakasika Part 4. 1977. .. 0. Yoga Chikista. Sanskrit. Appayya Dikshita. Sanskrit.. Sanskrit.. Yoga Vedanta Dictionary. Yajurvediya Kataka Samhita. Saan'tavalekara. Shriinivasadaasa. Sanskrit. Sanskrit... Sudarsanacharya.. 529 pgs.. 119 pgs. Yagavasista Vuthu Paryay Prakasika Part 1. 1954. 101 pgs. Yatidhara~masan'grah Grantha 60. 0. 1936.org/…/SanskritIIIT. Paraaditya. 508 pgs. Philosophy... Yadavabhyudayam Sargas I To I V. 1998. 196 pgs. Philosophy-22. 186 pgs. Sanskrit. 635 pgs. Sanskrit. 1868.o.. . Girish Chandra Sharma. Theology. 439 pgs. Philosophy. Sanskrit.. Religion. 1864. Kesava Rao Sarma. 1164 pgs... Sanskrit. Mukunda Sharma.. Sanskrit. Parashuram Shastri. . 0... . Philosophy... . Sanskrit. Yajura~vediiya Kaat'haka San'hitaa. Sanskrit. 1927. Sanskrit.. Religion. . Sanskrit. 251 pgs. Narendra Nath Sharma. Yatinder Matdipika. 176 pgs. Psychology. 202 pgs. 246 pgs.. Unknown... Narayana Shastri Khiste.2/14/2011 A list of scanned Sanskrit books at III… Word Index To Taittriya Samhita. 1956.. . Yayathi Aakhyaan. 2000.... Yaanj-avalkya Smrxti Granth 46. Sanskrit. Sanskrit. Sanskrit. Yekankastakamu. .. 600 pgs. Philosophy.. 152 pgs.. Unknown. Yajna Tattva Prakasa. Taitriya Samhita. Yatiindramatadiipikaa. Saatavalekara~ vi esa~. Theology.. Theology. Sanskrit. Yajna Valky Smtuthi. Yekankavalih... 1904. Theology. 0. Literature.. 258 pgs. .. 1976. Sanskrit. Yagavasista Vuthu Paryay Prakasika Part 2... Philosophy.. Philosophy. 548 pgs. Sahibji Maharaj Sir Anand Sarup. Philosophy. Sanskrit. 0.. Unknown. Unknown. Damodar Bhattasununa. Pandit A. Sanskrit. Srinivasadasa. 506 pgs. Yajurvedasanhita Vol Iv. 1924. 1953. Theology. sanskritdocuments. 1945. Philosophy. Yathara Prakasa Part 1. 1951. Religion.k. Unknown. 748 pgs. Religion.... 136 pgs. Parikshit Sharma. Yajnavaikya Smrti. Yatindramatadipika. Sanskrit... Sanskrit. Acharaya Ram Kishore Misra.. 0. Yoga Karnika. 1950.. Sanskrit.

aadunika san'skrxta naat'aka nae tathya nayaa itihaasa bhaaga 1. aagamarahasyamu vaatulashuddhaaravyamu. 0.. 1987. edward delavan perry. Jaggu Venkatachari. a sanskrit reader. Sanskrit. 1961. Unknown. 0. Not available.. Yogavasishtu Dwithiya Bagamu. Shriibhoja Mahaaraaja~. Bannanje Govindacharya. Theology. 408 pgs. 142 pgs. Literature. Aathrideva Vidhyalanker. Literature. Language. 440 pgs. Sanskrit. 1500.. Philosophy. Sanskrit. Literature.. Sanskrit....m. Unknown. Unknown. 1979.. 370 pgs. Literature. Sanskrit. aanandaashramasn'skrxtagranthaavali gran'nthaang-ka 70. Social Sciences. 172 pgs.... aadipuraanama. Social Sciences. Literature. Theology. 1614 pgs.. Sri Madra Namikmaharshi. Yogavasisht Bhasha.. Yogi Nihrdayam. Linguistics. Sanskrit. Sanskrit... Yogini Jatakam. Kesav Srinivasulachari Kati.. LITERATURE.. Language. Literature. 98 pgs.m. 0... LINGUISTICS. 1917. Linguistics.. 0. Sanskrit. Linguistics. Language. Vasu Deva. Language. Literature. Sanskrit.. khemraj sri krishna das.org/…/SanskritIIIT. 526 pgs. 244 pgs. 1964. Language. 105 pgs. 1929. 1067 pgs. Gandhi. Sanskrit. Bhagavadgita. Language. aanandamaalaa.padmanaabha..k. Yuddhakandam Part Ii. Pandit Navya Chandidasa. Yudhishthira Vijaya... Philosophy.. 319 pgs. aachaarendu.. Sanskrit. Linguistics. Linguistics. Sanskrit. Literature. Linguistics. 1953. Linguistics.. sanskritdocuments. Shri Krishna Patna Shasthri. Sanskrit. Literature. 248 pgs. 220 pgs. 906 pgs. Language. . 392 pgs. Sanskrit. Yougachikithsa Indication Of Drugs. 1943. 268 pgs. pandit sarada prasad bidyabhushan.. miimaan'sakashriiniilakan't'habhat't'a. Unknown.. 1940. Literature. 0. Language. 740 pgs. 854 pgs. Sanskrit. Sanskrit.. 1089 pgs. 456 pgs. p. Sanskrit. Unknown. Linguistics. Sanskrit. aagamapraamaand-yamu. 1888. Linguistics. 1932. Sanskrit. shriidharaachaarya.. 40 pgs. Sanskrit. Sri Krishnupanthshakina. aabhaarapradashainamu.. 1983. a sanskrit primer. Art. Linguistics.. Yukttikalpataru. aachaaramayuukha dvitiiya. Sanskrit... 352 pgs. Linguistics.. Literature. Literature. raamajii upaadhyaaya. LANGUAGE. L.. Religion. Linguistics....... Ravi Varma. Sanskrit. Language. aagamashaastramu gaud'apaadiiyamu. Language. aadaitabrahmasid'i.. 321 pgs.. 1915. a sanskrit composition and translation manual. Sanskrit..a. Sanskrit.. Sanskrit.… 92/167 ... aagniveshyagrxhyasuutramn. Sri Pahvadatthareya Sastri. 0..m. gurucharana. bhat't'aachaaryend-a vidhushekharend-a. Yogavasista Vol 1. Sanskrit. Sanskrit. charles rockwell lanman..2. Unknown. Literature. 1950. Ganga Vishanu Sri Krishana Dasini. Language. appayyadiikshita. 0. Language.. aahnikapaddhati. Language. Philosophy. Religion. 183 pgs.. 172 pgs.. 1979. Sanskrit. 0.. 1909. yamunaachaarya svaami. 1970. 100 pgs. Gopinatha Kaviraja.. Pandit Dinanad. Youginithantr. Sanskrit. Sanskrit. a consolidated glossary of technical terms. Linguistics. 1908.2/14/2011 A list of scanned Sanskrit books at III… Yogavashishtahah Panchama Bhaga. 576 pgs. 1937. 346 pgs. 1932. Yukthi Mallika Guna Saurabham.. aanan'dalahari No. Philosophy. 288 pgs. 1912....

… aatma kathaa prathama khand-d'a mahaatmaa gaan'dhii General Sanskrit 0 421 pgs 93/167 .... Religion. 1893. Literature. Philosophy. 76 pgs. Pandith Sri Seetharam Bhakruth. Linguistics. aapastambashulbasuutramu.. 1973. Sanskrit.. 90 pgs. Sanskrit.. Language. 1898.. kapardisvaami... 270 pgs. aapastambaparibhaashaasuutramuu. Linguistics.. n. haradatta mishra..org/…/SanskritIIIT. Sanskrit. Sanskrit. Language. 130 pgs.. aaryemanju qs-imulakalpa prathamoo bhaaga. Literature. 742 pgs. S. Psychology. suryanarayana. Sri Bhavani Shankara Sharma. Linguistics. Linguistics. 513 pgs. Sanskrit. 228 pgs. Language. 1931. 340 pgs. 1932. Sanskrit. 472 pgs. 314 pgs. Literature. -. . Literature. 1953. Sanskrit. Language. Linguistics. Ganapathi Sastri. Literature. 307 pgs. Literature. Language. 236 pgs. Ganapathi Sastri.. 1922. Literature. 308 pgs.. 278 pgs. Sanskrit. Natural Sciences. Linguistics. Sanskrit. Sanskrit. 814 pgs. Theology.2/14/2011 A list of scanned Sanskrit books at III… aanandamathaadhikarand-amaaramya pradhaman' paadan. Sanskrit. aanandananandinii. Literature.... aapastambadharmasuutramanj-jarii. 1940. Sanskrit... 233 pgs. Linguistics. 1909.. 122 pgs. Sri Ganapathi Sastri. Yasneswara cimana Bhatta.. Sanskrit. Language. Linguistics. d srinivaasaacharya. Sanskrit.. e. aashvalaayanagrxhyasuutran' shriiharadattamishravirachita anaavilaakhyayaa vrxttyaa sametn. T.. aashvalaayanagrxhyasuutran. Sanskrit. Sri Ganapathi Sastri. 216 pgs. Sanskrit. Literature. Linguistics.. 177 pgs. Linguistics.. 1928. Ganapathi Sastri. aasechanakaraamaayand-amu. aatakam. aapastambhagrihyasuutra anakula tatparyadarshana. . Srinivasachar. Literature.. Sanskrit. not availabe.. aarogyachintaamand-ii.viswanatha Sarma. sanskritdocuments. Linguistics. T. Dr. aaryabhadt'iiyam'of Aryabhattacarya Part 1 gaanitapaada. . 0. Language... r. Linguistics. Literature. Linguistics. Science.. 0.. aaryemanju qs-imulakalpa tuutiyo bhaaga.. Linguistics. 1970. 318 pgs. Sanskrit... not availabe.. shriimanmuraarimishra. 0. Sanskrit.. 1923.. Literature. aaryemanju qs-imulakalpa ddhitiiya bhaaga. Language.. 1930. Linguistics. aapastambiiya dharmasuutramu. Sanskrit. n. 1920... 370 pgs. aashvalaayaniiyaguhaasutraand-aa suchiipatramu. Narasimhachar.mlampalli Chandra Sekhar Sarma.. Language.. 196 pgs. aaryaividhaasudhaakaran. 130 pgs. 1931. 402 pgs. Sanskrit. 1924. Sanskrit. aang-agatvanirukti naama prabandha etatpustakan. r. 0. aapastambiiya dharmasuutramu.. a n krishna aiyangar. Science.. Religion. Sanskrit. Linguistics. Language. Unknown. Theology. aapastambiiyam' shraotasuutram. Language. Language.... 1970. Language. Literature. Language. Sanskrit. aatha sankhya darshana bhashanuvaada. Literature. Literature. T.. Brahmasri Subrahmanya Suri.. 0. Sanskrit. 340 pgs. aapastambasulbasuutran' kapaaradibhaashhyend-a karavindi sundararajavyaakhyaabhyan' cha sahitan. 373 pgs. Sanskrit. suryanarayana. 1944. Language. 1933. Religion. aangiirasasmrxtii. Literature. aapastambadharmasuutramu. Language.. D. 1951. Bhattacharya. mahaadevashaastri.. aapastambadharmasuutramanj-jarii.. 1933.

abhiraajasahastrakamu. LINGUISTICS. adhikarand-asaaraalalin... Language. 0. adhikaara kaa prashna. 2000. achala meraa koii. Literature.. virachitayaa. abhijnaashaakuntala. 0. 1974. 1926. pan' ramaakaanta jhaa. abhilashhitaayrachintaamand-i. soomeishvara deva. 1950. 1948. ramanath jha. Psychology. abhinava san'skrta pravesha. 216 pgs. addvatatarand-i. 1973. 154 pgs... 238 pgs. Sanskrit. 92 pgs. 1926. 1926. 385 pgs. 161 pgs.... bhagavatiprasaada vaajapeiyi. Literature. Sanskrit. Theology.. 1984.. aatmatattvaviveka. Philosophy... adhikaarand-a saaraaval'i. 268 pgs. LANGUAGE.. vendaachanalaala.. 1926. abhaavavimarsha. ven'kat'a subramand-ya shaastri. Sri Udayana. Sanskrit. 438 pgs. Language. abhinana shakuntalam. abhidhaavrittimaatrika shabdavyaapaara vichaara.. Linguistics. ad'agatvanirukitan. Sanskrit. diipikaa ghosha. Not available.… adhikarand asaaraavali shriivand shat'hakopashriilaqs 94/167 .. Sanskrit. General. Literature. Language. Lakshmidhar.. Linguistics. aatmatattva vivekaa. Sri Ananta Krishna Sastri. 100 pgs. Literature. Sanskrit. 1916.. Literature. someshvaradeva. Language. Satya Nidhi Theertha. Sanskrit. Language. Sanskrit.. 131 pgs. Sanskrit... abhinava vikrutivignaana.. Linguistics. Literature.. Psychology. 136 pgs. 440 pgs. 1926. Sanskrit. Religion. Literature... Linguistics.. Sanskrit. sanskritdocuments. 498 pgs... abhinava chandrikaayaamu.. Sanskrit. Triveni Kavi. mahaatmaa gaan dhii.. aayurveidamahoodadhau annapaanavidhi. LITERATURE. Literature. Psychology.. kalidasa.. Sanskrit. Literature. Philosophy. pandit shri bellakonda ramaraya kavindra. Philosophy. R. shriigovadhainaachayai. 296 pgs. Sanskrit. 1875. Sanskrit.. Language. Unknown. Linguistics... 276 pgs. Technology. Literature. Linguistics. 1895. 1957. abhijnana sakuntalam of kalidasa. Linguistics. Language. LINGUISTICS. Sanskrit. 72 pgs. Language. aavyamimaan'saa. mukula bhatta.. 142 pgs. Theology. Sanskrit. 1973.. Linguistics.. Sanskrit. Language.. Language. 0. Sharma Sastri. Sanskrit.. 288 pgs.org/…/SanskritIIIT. 829 pgs. shrii kaasinaatha dviveidi. addvatamaatend-d'a. Sanskrit. 1969. Sanskrit. srimad vedaanta desikulu. Linguistics. 1934. addvataamakaranda.. 428 pgs. abhilashhitaartaaryaichintaamand-in. 1925. 174 pgs. 242 pgs. Sanskrit. 0. Sanskrit. Sanskrit. Language. Murari Mishra. Sanskrit.. Sanskrit. General. 62 pgs.. 336 pgs.. 0... 1942. 42 pgs..2/14/2011 A list of scanned Sanskrit books at III… aatma kathaa prathama khand d a. Kumaravedantacharya. 421 pgs. Sanskrit. 561 pgs. vaidha yaadavaji trikamaji aachaaryai. Literature. Philosophy. LANGUAGE. abhilaashhitaarthachintaamand-i prathamabhaaga aadita trxtiiyaprakarand-antamu.. aayaisaptashati. Literature. 440 pgs. Linguistics. 1630. LITERATURE.. Linguistics. Sanskrit. Sri Natesh.. Literature. LITERATURE. 1926. abhilekhamaalaa vishvavidhyaalayapariqs-aanirdhaarita abhilekhasan'graha raama hindiivyaakhyopetaa. Religion. ma shri deshapaan'd'e. 1972. Sanskrit. Rajasekhara... LANGUAGE.. adbud vijay. Psychology. Religion.. aatmoduugaara. LINGUISTICS.. 158 pgs. Literature. Technology.... 1944.

sanskritdocuments. Linguistics.. Philosophy. advatadipikaa. Sanskrit. Language. 195 pgs. 77 pgs. Sanskrit. Philosophy. Ganapathi Sastry. Linguistics. Sanskrit. Sanskrit. 1937... 1960. Literature. 118 pgs. 1962. Sanskrit. 0. Literature. 0. 1915. Literature. sri Paramahamsa perivrajaka Chandrikacharya. 396 pgs. advatatatvasudhaa prathamoo bhaaga. Linguistics. Sanskrit. shriimatparamahan'samadhusuudanasarasvatii.. advaitamanj-jarii brahmavidhyaabharand-amu. 1987. Sri Ganapathy Sastri. Literature. 891 pgs. 524 pgs. 491 pgs. shriimunisundarasuuri. Literature. Literature.. adhyaatmaraamaayand-amu. 617 pgs.. Sanskrit. Language.. Language.. Language. advaitasiddhi trxtiiyaasamput'amu. Literature. 252 pgs... Linguistics.. Not available. Literature.. Sanskrit. Sanskrit. Psychology.. 1997. Theology. Literature. Linguistics. advatacsiddddhaantagurucchandrikaa. Sanskrit.. 44 pgs. 1915.... advatasiddhaantasaarasam'grah. Pandit Anantha Krishna Sastri. 1927. advaitasiddhi. 1893.. advaitasiddhi guruchanddrikaasavyakhyaayasamalang-krxtaa dvitiiyasamput'amu. 678 pgs..2/14/2011 A list of scanned Sanskrit books at III… adhikarand-asaaraavali. Sanskrit. 0. Linguistics. Language. adhvaramiimaan'saa kutuuhalavrxtti. 1969.. Religion. Psychology. 0. Sanskrit. Philosophy. Sanskrit. Language... Sanskrit..... Psychology. Narayanasrama. Literature. 842 pgs... Linguistics. 660 pgs. advaitaamoda. Sanskrit. Sanskrit. Sanskrit. 0. Sanskrit.. Not available. vidvan s narayanaswami shastri.. advatatatvasudhaa dvitiiya bhaaga.. 99 pgs. Linguistics. Language. 445 pgs. 1933. Linguistics. Literature.… agamakoshaa dvadasho bhaagan S k ramachandra Rao History Sanskrit 1994 402 pgs 95/167 . Sanskrit.. Not available. Not available. shriivand-shat hakopashriilaqsmiinrxsin'vashat'hakopayatiindramahaadeshikaa. 1960. guruchandriikaa. advaitaaqs-aramaalikaa.. advaitibhraan'tiprakaasha.. 78 pgs. 0. Language. Not available. Linguistics. 362 pgs. Religion. Theology. Sanskrit. Literature.. 882 pgs. advatadipikaa tutiiyo bhaagan. vaasudevashaastrii. Language. Not available. 1940. advaitasiddhi mithyatvamithyaatvaanto bhaaga. Sanskrit. 487 pgs. Sanskrit.. Not available. Language..org/…/SanskritIIIT. Not available. Linguistics. Literature. Sanskrit.. Language. advaitasabhaasuvarnd-amahotsave. Literature. Sanskrit. adhyaatmapat'alamam. 0. Literature.. 302 pgs.. 204 pgs... Literature. Linguistics. 120 pgs. 386 pgs. Mahamahopadyaya Hariprasad Sastri.. Sanskrit. Language. advatadipikaa dhvitiyo bhaagan. d'aa bii gopaalared'd'ii. Religion. 1928. advaita siddi Vol. shriinivaasaachaari. Sanskrit. Narayana Sharma. Religion.. Linguistics.. Language. 120 pgs.. 1935. 92 pgs. 1946.. d'i.. Sanskrit. Language.. Language. Linguistics. Linguistics. 0. adhyaatmakalpadruma adhirohand-iit'ippand-isahita... Language. Religion. Linguistics. Art. Theology. Theology. Literature.. 1939. Not available. I. advaitaanyamatakhand-d'anamu. Social Sciences. advatatatvasudhaa prathamoo bhaaga. Sanskrit. 1984.. Narasimha Sarma. advayavajrasan'graha. adhikarand-asaraavali. Literature. advaitibhraan'tiprakaasha. advatamajjarii nyaayaraqs-aamand-in. 250 pgs. shiromand-ishriimadhusuudanasarasvatii. 1905. 0.. 373 pgs. Chintamani.. 92 pgs.. advaitadiipikaa dvitiiyobhaaga.

... anargharaaghavamuu. 1967. Linguistics. Sanskrit. Literature.ramachandra Rao. not available. Maharshi Vedavyas. LINGUISTICS. parakaalasan'yamiindrai.. Language. an'cdhaa yuga samiiqs-a.. Baba Sastri Padake. 1929. agnipuraand-amu vedikaa. yan. L.. 30 pgs. LINGUISTICS. Language.aar. Linguistics.... Literature. Sanskrit. aln'kaarakaustubhamuu.… 96/167 .. History. LANGUAGE. Sanskrit. Jinvijaya Muni. bhat't'a. Linguistics. aitareyabraahmand-a. Sanskrit.. Language.. Sanskrit. vinaayaka gand-esha aapat'e. 1956... alang-kaaramand-ihaara prathamo bhaaga. 302 pgs. 402 pgs. Sanskrit. 1921. 1921. Literature. 39 pgs. Linguistics. Religion. 1994. Linguistics.. 1923. Literature. Sanskrit. ambikaalaapa umaalaapa. Sri Mathsayana Aacharya. Sanskrit... Literature. 1937. amarakoshhan. shriikrxshhnd-abrahmatantraparakaalasan'yamiindrai. shriikrxshhnd-abrahmatantraparakaalasan'yamindai..ravi Varma. Linguistics.. 238 pgs. Sanskrit. LITERATURE. ajit' gaamaa Vol. Sanskrit. 1968. 321 pgs.. Sanskrit. Linguistics. vaamana shaastri. 550 pgs. Sanskrit... Sanskrit. 386 pgs. 0. agnihotrachandrikaa vaamana shaastri krxtaa. 236 pgs. LITERATURE. Sanskrit. Theology. yashapaala. Literature.. shiivadatta. 1921. Sanskrit.. Literature. aitareiya brahmanama. 1957. 1958. Linguistics. 540 pgs. Sanskrit. 104 pgs... Linguistics... pro laqs-mand-adata gautama. 100 pgs... akalanka grandhatrayamu. sanskritdocuments. 512 pgs. Language. 1942.. 1968. Literature. Sanskrit. Language. alang-kaaramand-ihaara chaturtho bhaaga. Language. Language. Language. Literature. 226 pgs. Language. History. Literature.. 222 pgs. ananthakrishna sharma. Literature. Language. 312 pgs. Language. amarkosh.. en' . jiivana.2/14/2011 A list of scanned Sanskrit books at III… agamakoshaa dvadasho bhaagan. Sanskrit.. Sanskrit. Sanskrit. LANGUAGE. d'urghaprasaada... Literature. Language... Not available. Literature. Language. Literature.. Literature. shriikrxshhnd-abrahmatantraparakaalasan'yamindai. 505 pgs. Linguistics. Literature. ananthabharathi. Not available. Linguistics. Language. aitareyabraahmand-amam. Sanskrit. aitareyaalochanan. LINGUISTICS. amitaa. Literature. 139 pgs.k. Language. 750 pgs. 1916. Not available. Linguistics. Language. 884 pgs. alang-kaaramand-ihaara trxtiiyobhaaga. Linguistics. Literature. Acharya Satyavrata Samasrami. 1906. Haragovinda Sastri. Language. Sanskrit. 0. aitareyabraahmand-a. 732 pgs. 0. 874 pgs. Language. alang-kaaramand-ihaara dvitiiyobhaaga.. The Arts. 358 pgs.. 1973.. 0.... 306 pgs.org/…/SanskritIIIT. 1977. 1898... 1937.. 1917. Sanskrit... aitareyaarand-yakan. agniveshyagruhaasutre. Sanskrit. Literature. Linguistics. Linguistics. 1898. Vishvanatha Balakrishna Sastri. 1940. r. dr. LANGUAGE.... Linguistics. 230 pgs. 443 pgs. Sanskrit. Sanskrit.. 1944. S. Literature. LITERATURE.. Sanskrit. anang-garang-ga kaamakalaa hindiivyaa gopaniiyama. mahaakavikalyaand-amalla. an'bigara chaud'ayyana vachanagal'u. Religion. banerji projesh. Linguistics. Sanskrit.a.ii. 54 pgs. amrxtavaand-i.. Linguistics. agnihotrachandrikaa.

. 1998. ashht'adashapuraand-a darpaind-a. Literature. . 88 pgs. Sanskrit. Language. asalii tejii mandii sat't'aa.. pandit r v krishnamaachaarya. 1985. Religion. aramelakalanidi. aparoqs-aanubhuuti savyaaravyaa. Linguistics.. ashht'aadashasmrxtaya ang-gira aadi 18 smrxtiyon' kaa san'graha.org/…/SanskritIIIT. Religion. Sanskrit... Literature. Sanskrit.. Sanskrit. A. Sanskrit. Language. Literature. 0.. Sanskrit. 1955. 400 pgs. 1929. 82 pgs. 182 pgs.. Religion. Chinnaswami Sastri. Literature. Not available. Theology. shri laugakshi bhaskara. 145 pgs. Language. Literature... Sanskrit. ashht'adhyaayii bhaashhya pradamaavuti. 0. anyottayullaasan. 1926. Sanskrit. Sanskrit. anubhuutiprakaasha. 1950. Sanskrit. 1932. 2002. H P Malledevaru.. charu deva shastry. 252 pgs. Linguistics. Athridev Gupta. Not available... and-ubhaashhyamu. Linguistics.. arthasamgraha. ashht'aaadashapuraand-aparichaya pauraand-ikaprabhaaparishiilanamu. 1915.. Literature. Language... ar^thashaastram' Part Iii... Social Sciences. george buhler dr. Religion.2/14/2011 A list of scanned Sanskrit books at III… 399 pgs. General. 274 pgs. shriimadvidhyaarand-ayasvaami. Literature. Athridev Gupta. 1964. Sanskrit. raajya jyootishhi pan' devaraaja jii. Religion. Sanskrit.. Theology. sanskritdocuments.. ashht'aan'gatddadayamu suutra shariira nidaana chikitsaa kalpa uttarasthaanavibhaktamu. Sri Laugakshibhaskara. 459 pgs. arya san'graha. apastamba s aphorisms. 139 pgs. Sanskrit. ashht'adashapuraand-aparichayan. 1912. 438 pgs. shriimadvallabhaachaarya. anekartha sangraha.. 194 pgs.. asatmatattvodhyotaprakarand-amu. anuvaad kala. Unknown. Religion. Language. Psychology. Psychology.. Ramaswami Aiyar.. 1980.. Sanskrit. 1983. Language. Sanskrit. Theology. varnasi ramamurty renu. vaachaspatii upaadyaaya.. .. Sanskrit. Language.. 1921. apastambagrxhyasuutran. 258 pgs.. Literature.... Philosophy. Sanskrit. 0.. 1935. Sanskrit. Sri Vidyaranya. Sanskrit. Language.. 1951. Sri Ganapathy Sastri.malledevaru. 1844. 0. Sanskrit. Sanskrit. andhradesiahasyakatha. 346 pgs.. Sanskrit. anubhaashya baalaboodinii bhaaga 2. Yudishtar Mimamasat. 254 pgs. 258 pgs. 1990. Sanskrit.. 292 pgs. Lakshminarayana. Sanskrit.. 291 pgs. Language. Religion. Linguistics.. Religion. Philosophy. Sanskrit. Linguistics.. arpand-a patrikaa. Literature.. Theology. Not available.. 0.. Linguistics. 448 pgs.. Language. 1928. Linguistics. H. Literature.. Religion. Literature. Literature. Sri Krishna Tripati.. Language. 224 pgs. 504 pgs. Literature. shriimadvaagbhat't'a. Sanskrit. 312 pgs.. Theology. ashht'adashashmutuyahan. Sanskrit. 1932. 138 pgs.. 1985. Linguistics.. Sanskrit.. ar^thasan'graha. acharya hema chandra. 0.. 92 pgs.... ashht'aadashapuraand-a darpand-a. Theology. 1931.. 871 pgs. 320 pgs. Linguistics. Religion. 143 pgs. suryanarayana shastri.… 97/167 . Sanskrit. 1964. archaavaatara vaibhavam.... 789 pgs. 432 pgs.. Literature. ashht'aad'asagrand'aha. Not available. 1925.p. andhra baghvath parimal. Linguistics. Linguistics. 672 pgs. Sanskrit. 142 pgs. anubhuutiprakaasha.. d'aa shriikrxshhnd-amanditripaat'hii.

Literature.. Sanskrit.… 98/167 . Religion. 1983. Sanskrit... Sanskrit. Sanskrit. atakam. Sanskrit. H. Sanskrit. 1960.. Literature. 267 pgs.a. Sanskrit. Treble.. atha dugaipaasanaakalpadgumaavishhayaanukramand-ikaa.. Literature. 379 pgs... Language. 311 pgs. 1892. 466 pgs. 1929. 0. Sanskrit.. Sanskrit. Religion. . Unknown. ... 638 pgs.. 1146 pgs. Literature. 177 pgs. 0... atha shriibhaavataat'appand-ii satyadhamayan'tikrutaadvadaso kandhan. atha jaatakaabharand-an' praarabyate.. 1867. . Religion. Sri Krishna Das. atha krumaimahaapurand-an. atha gurubhavaprakaashikaa rukminishaa vijayamu. Religion. Sanskrit. . Sanskrit. Sanskrit. Sanskrit. Theology. 195 pgs. Sanskrit. 621 pgs. Literature.. 1917. 474 pgs. 0. Sanskrit. 213 pgs. .. 0.m. 1929. Sanskrit. 1950. Linguistics. Literature. 0. Sri G Ramaswami Sastrigal... 800 pgs. 0. 342 pgs.. ashtan'daghadhyaayam. 0. vaagbhata. .. Sanskrit. atha bruhjjyaatishhaand-aivaishhashht'omishhrasakandhochakaavalisan'grahaa. 1867.2/14/2011 A list of scanned Sanskrit books at III… ashht'apraasashatakatrayamu.. 630 pgs. . Acharya Sri Pandith Laxmanlal. atha pradhamamudrand-akaalikiiprastaavanikaa. Somraj Krishna Das. Literature.. Literature. . Literature.. 810 pgs. Linguistics. Literature. atha shraamadbhagavataan't'oppand-ii chet'tityaakhyaa. atha shriikaashakhid'an' puvaathai. Somraj Krishna Das. Language. .... . Savanur. H. Sanskrit. 95 pgs... Sanskrit. 0. . Religion. 338 pgs. Theology. Sanskrit. Sanskrit. 46 pgs. Theology. 258 pgs.. 974 pgs. Language. 1936. 278 pgs.. Treble. Ramalingam. 1962. 279 pgs. Linguistics. asvasastram. atha kiiraanya keshoyammatrasamhitaa. Somraj Krishna Das.. Sanskrit. atha haayanarantapurvaihai. atha pramaand-apudvatan. . not Available. Not Available... atha shraamadbhagavataan't'oppand-ii man'danan'diniisaptaman' sn'kadhan. Linguistics.. 0. Treble. . sanskritdocuments. not available.. Sanskrit. Technology. atha shikqs-aadiveidaang-gachatushhuta praaran'bha... Linguistics. 1858. Linguistics. ... .g. atha kaasi khandaa dhvitiyo bhaagan. Language. 558 pgs. Sanskrit..r. Sanskrit.. atha saamaanyakakqs-and-aa prakarand-amu. atha shriibhaavataat'appand-ii satyadhamayan'tikrutaa. astaangahridaya. Language. Sanskrit. Ramachandra Savath. Sanskrit.a. -. Linguistics. Linguistics. 1939. atha govidrchanaa chandrikaa.. kaviraj shrii athrii dhev guru. 1948. 0. . . Theology. 146 pgs. atha maanasasaqs-aipaddatii.a. 196 pgs. Somraj Krishna Das... 254 pgs. ....org/…/SanskritIIIT. H.... ashtangahridaya. Literature. Sanskrit. atha shriikaalalokprakaasho ashht'avishatitaman. Language. 0.. 0. 1968.. Somraj Krishna Das. ashtajai bhashya pradamavruti. atha kalikaa puraand-amu. Language. 348 pgs.. dr p srinivaasarao... 0... atha pradhamaadi chaturdaishaadhyaayaanaan. Sanskrit.. asvaalayaana gruhama suutramu. 512 pgs.. . 156 pgs. vagbhatta. 602 pgs. Sanskrit. Theology. Literature. 0. Language. 1929.

258 pgs.. Literature. 197 pgs... athashriibhaagavatat'ippand-ii satsadhamaikrutaa. Surya Kantha. 1093 pgs. Shankar Panduranga Pandit.. Sanskrit.. 0. 0. 41 pgs. Savanur. saayand-aachaarya. atha tatpurushhaprakarand-amu... . 554 pgs. Treble. Sanskrit. 475 pgs. 0... Linguistics. atha shriimannyaayasudhaa. Sanskrit. athashriimadgagavatat'ippand-ii yadupativirachitaa chatuthai skadhan. atha shriimudgalpuraand-an. Sanskrit.. 0.. Sanskrit. H..g. Sanskrit. Linguistics. 0. Sanskrit. . not available. Treble. Theology. athaa hymaratanaa baalabhaadraa. Somraj Krishna Das. Sanskrit. 352 pgs. Linguistics. 1929. atharvaveda san'hitaa..a... 0. Literature. 1860. 342 pgs. 1898. athashriibhaagavatat'ippand-ii t'ikaa shriidharaa... 1929. Theology. . 1898.. athabadariimaahaatmya. saan'tabalekarakulajena daamodarabhat't'asuununaa shriipaadasharmand-aa...g.k. athashriibhagavathat'ippanii karmakat'ikaa vijayavaad'aa tirtaa trayodase kandan. Linguistics. . 203 pgs. . Literature. Sanskrit.a. 538 pgs.. 1957. Literature. . atharvaipraatishaakhayamu.. Linguistics. 1929... 370 pgs. . athamn'tramahodadhigranthasyasyaivashhayaanukramand-ikaa..r.. 0.. Literature. 398 pgs. athashriimadgagavatat'ippand-ii yadupativirachitaa ekadaso skadhan. Sanskrit. 64 pgs. Sanskrit.. athabrahaapuraand-asithatavishhayaanukramand-ikha. Sanskrit... 0.. . Sanskrit. atha shriimannyaayasudhaa. 484 pgs. Sanskrit.. 0... Language.. 1929. 190 pgs. atharvaveida san'hitaa rxshhyaadi savalitaa. Language. . . Treble. Religion. . 1939. Language. Savanur. Sanskrit. Sanskrit. 88 pgs. atha shriimannyaayasudhaa.. 327 pgs. 856 pgs. athabrahaasutrabhaashhyan.r. 1989. 0. Sanskrit. Sanskrit. 1858. ..g. Sanskrit. Sanskrit. atha shriimadhbagavataa vijayadavaaja ekaadasobhaagan. 549 pgs. Literature. 1959.. Literature.. 206 pgs. 342 pgs. athaaprabdhanoyaanamimaan'saa. 0. . Literature. athamn'tramahodadhit'okaanokaayan'trasahita.. Sanskrit. atharvaveida san'hita. Sanskrit. 565 pgs. Language.. . Sanskrit. sadaachaara. 1860.a.. atharvavedasan'hitaa bhaaga 3. sanskritdocuments... atha shriimadbhagavate ashht'amaskan'dhan. 1963. Language. atha shriimadhyaayasudhaat'ippand-i. 184 pgs.r. Sanskrit. saayand-aachaarya.. . Sanskrit. Literature. Linguistics.… 99/167 . Not available. 0. Theology.. H. athashriimadgagavatat'ippand-ii shriinivaasatiithaiyaa ekaadashan. 620 pgs. Not available. Literature. Sanskrit.. 0. Sanskrit.. Sanskrit. Savanur. H. Sanskrit. 0. 395 pgs. 353 pgs. Treble. 0. 600 pgs.. Religion. Literature. 0. . Sanskrit. Literature. Language. . saan'tabalekarakulajena daamodarabhat't'asuununaa shriipaadasharmand-aa. Literature... 390 pgs. Linguistics. Gangavishnu amp Khemaraj.. . 460 pgs... Literature. Language. 1858. . bhat't'aachaarya. Sanskrit.. Venkatachala Sastry.2/14/2011 A list of scanned Sanskrit books at III… atha shriimadbhagavadgiitaa. H. 579 pgs.. Religion.org/…/SanskritIIIT.. athaitareyopatishhatu.. Literature. atha shriimadvagavate dvadashaskan'dha. General. atharvaveda san'hitaa. .. Language. atharvaveidasan'hitaa bhaaga 4.a. Religion. 627 pgs.. Linguistics... krishna Das.

Literature. avmanjari. 298 pgs. avantisundarii. 0.joshi. 613 pgs. Language. Sanskrit. aumaapatamu. 1973. Religion. athavaivediiyaa poppalaada san'hitaa navii kaandaa.. tataachaarya siroomani. Sanskrit. 26 pgs. Psychology. K Vasudeva Sastri. Sanskrit. 1934.r.. 1989.t. 2000. Literature.. Sanskrit.org/…/SanskritIIIT. Jithendra Bajaj. athashriimatryaayaamutodhvitiyan'parichchhaidan. Sanskrit. baalaraamaayand-aannama.. Literature. 675 pgs. shriigang-geshopaadhyaaya.. 351 pgs. d. binod lall sen. 1996.. 1957. 0. baalabhaaratamu... Theology. . Linguistics. 1929. Sri Raghunathasiromani. RELIGION.. Sanskrit.. 2000.. ayurveda bhashym panch khandm. vaachaspati. Literature. Religion.. 122 pgs. 34 pgs.. . Language... athashriimadgagavatat'ippand-ii yadupativirachitaapanchamo skadhan.. Sanskrit.. Panduranga Pandit.. Religion. bhaamatii brahmasuutrabhaashya katusuutri. Religion.. Sanskrit. Sanskrit. Art. 351 pgs. Sanskrit. athavaiveda san'hitaa trutigo bhaagan. mahaamahoopaadhyaaya shriigadaadharabhat't'achaarya. . 0. avayava diidhityaa diidhitiprakaashikamu. 77 pgs. 122 pgs. Religion. Religion. Linguistics.. Literature. atran' bahu kurviita. Not Available. 1894. Sanskrit. Linguistics.. 323 pgs. 515 pgs. 2000. 171 pgs. Religion. 810 pgs. baalabodha san'graha.l. Linguistics.. Sanskrit. Sanskrit.l.. Sanskrit. Sanskrit.. athavaivedasan'hitaa dusara bhaagan. Linguistics... . Sanskrit. Sanskrit. Language. 639 pgs. Sanskrit.. Theology. Literature. Religion. Language. 727 pgs. aachaarya dand-d'i.joshi. 1869... 126 pgs.. Sanskrit. avadaanakalpalataayaa mand-ichuud'aavadaanan' naama trutiiya pallava.. shriiabhinavakaalidaasa. 1908. sanskritdocuments. Sanskrit. Sanskrit. Literature. Sanskrit. 0. Literature. Sanskrit.. 358 pgs. Not available. Sanskrit. Sanskrit. Religion. . P Beniram Sarama Gaup. Theology. THEOLOGY. athavaiveda san'hitaa. Language. K.. K.. Linguistics.. 447 pgs.. 1985. 1954... K... 1940. Sanskrit... 0.. 1936. 864 pgs. 590 pgs. Raghu Veera. 284 pgs. Linguistics. Religion.… 100/167 .. 170 pgs. 1977.. t... shrii machchhang-karaachaarya. Language.. avataaravaadaavalin' pradamo bhaagan. bahudarmaipuraand-amu..... Unknown.. ayurveda vijnanam. athavaivediiyaa poppalaada san'hitaa ek kaandaa. 2000. 856 pgs. 257 pgs. athavaiveda san'hitaa pehalaa bhaagan. 110 pgs. Philosophy. Sanskrit. Sanskrit. Literature. shriimadamarachandrasuri. athavaivedasan'hitaa tisaraa bhaagan.2/14/2011 A list of scanned Sanskrit books at III… athashriimadgagavatat'ippand-ii yadupativirachitaa trutiyo skadhan. Language. govindadeva. 1908. bhaagavatachampuu.. 1933. 1985. krishna Das.. Language. athashriimatsayapuraand-akramaand-ikaa. Linguistics.k. 1959. 26 pgs. Krishnacharya.. baadhan.l.. 0. 1916. Technology. -. Religion. 644 pgs. Sanskrit. 1901. Literature.. 672 pgs.joshi. Shankar Panduranga Pandit. Sanskrit. avachchhedakataaniruktti diidhityaasaha... Goswami. Acharya Mukunddevagya. athavaiveda san'hitaa. Technology. Raghu Veera. bhaamahiiya kaavyaalang-kaara udyaana vritti. 142 pgs.

Psychology. Language. Literature.. 144 pgs. Philosophy. Geography. 1998. bhagavadgiitaa. 0. shriijagatraaya.. -. 1914. bhaarata chaampuu.. Sanskrit.. LITERATURE. Linguistics. Literature. 0... bhaashhyaatheratnamaalaa. 1913. Sanskrit. 0... Social Sciences. u krxshhnd-ashaastrii. 0. Philosophy. 439 pgs. 1951... Sanskrit. Language.... sanskritdocuments. Sanskrit. Linguistics. Religion..2/14/2011 A list of scanned Sanskrit books at III… bhaamatiisamaaloochanamuu. Sanskrit. Literature. 1926. bhaarata ko janagananaa 1981. 90 pgs. Linguistics. 430 pgs. harinaaraayand-a. 1955. Psychology. 0.. Linguistics.. 1999... Language.padmanaabha.. bhadranyaka upanishad. vaasishht'a gand-apati. Dravida Rajesvar Sastri. 0. Literature. Linguistics. Literature. 584 pgs.. Sanskrit. p.. gaanjan chintaman deo. 82 pgs. 70 pgs... bhaarata ko janagananaa 1981 part Iii B. Literature. Literature. Sanskrit. bhaashhyaartharatnamaala.. Sri Subramanya. Sanskrit. 1280 pgs. 156 pgs. Language.. bhaaratiiya vana adhiniyam miimaan'sa. Sanskrit. LANGUAGE. 432 pgs. Language. Not available. Sanskrit. Philosophy. Psychology. bhagavadanudhaavananaamaa champuprabandha. Linguistics. Language. laqs-mand-a sin'ha khanna. Literature. Not Available. 156 pgs. Sanskrit.... bhaarata charitra pariikqs-aa.. mand-d'anamishra. p. anantakushhnd-a. Psychology. 1938. 194 pgs. 332 pgs. Language. bhagavadgiitaya luupanyaasagal'u eran'd'anaya bhaaga.. 0. Sanskrit. shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru.. Anantha Krishna Sastri. 1915.. N.s.padmanaabha. bhagavaan daasa. bhaarata ko janagananaa 1981. Language. 387 pgs. Theology. Not available. bhaat't'adiipikaa uttarashhat'ahamam. Sanskrit. 1894.. Sanskrit. 0. 230 pgs.. History.. 560 pgs. bhaashhyagaambhiiyothenind-eyamand-d'anaaraye grantha. Literature. bhaavaprakaasha bhaavabodhiniihindiivyaakhyaayopeta. Sanskrit. Literature. 1921. Linguistics. Psychology.. Sanskrit.. Literature. 206 pgs. Language. Language..padmanaabha. Linguistics.. Sanskrit. Linguistics. 1961. Linguistics. bhaashhyaayairatnamaalaa. Language... p. 300 pgs. Sanskrit.. bhaat't'adiipikaa shriimatkhand-d'adevaprand-iitaa.. Pachamukhi. 348 pgs. Sanskrit. 1936.. bhaavanaaviveka sat'iika. 902 pgs. 0. shrii gn-aanaanandendrasarasvatiisvaamii. Linguistics. niilakand-t'habhat't'asuunupand-d'ita. Sanskrit... Language. 146 pgs. Sanskrit. Literature. Philosophy.. Linguistics. 426 pgs. bhaaratiiya raajaniiti prakaasha.. bhaaminivilaasan. 0.. bhaat't'adiipikaa Part I.… 101/167 . Literature. Philosophy. Language. Sanskrit. 0.org/…/SanskritIIIT. 1921. Sanskrit. Literature. Linguistics.. Venkararaghavan Sastri. bhaaskarodayaa tarkasan'grahadiipikaa prakaashasya vyaakhyaa padavaakyapramaandapaaraavaariind-a. Embar Krishnamacharya. Sanskrit. Sanskrit. Biography. 624 pgs. bhaat't'amiimaan'sakaanaan' sarvasvamu shabdapramaand-asya vaishiptyamu. Language. Hari Narayan Apte. Language. 310 pgs. LINGUISTICS. 174 pgs. Literature. 0. 708 pgs. bhagadattajalhand-a virachitaa sukttimukttaavalii. Literature. Sanskrit... bhaaratiiyamu athaishaastramu. Literature. Linguistics. Linguistics.

.. shriimadbhat't'i.. bhat't'achintaamand-i. Linguistics. Not available... Linguistics. Not Available. Sanskrit.. 462 pgs. bhat't'achintaamand-estar^kapaada. Not available. mand-d'ikala raamashaastriind-a. 420 pgs... Philosophy. 84 pgs.. Krishhnd-akumaari. jayamangalayaa. Literature. venkat'asubrahmand-ya. Sri Tarkavagisa Bhatta Venidattacharya. 1952. Language... 1983. bharatabhasyam part 1 chapt 1 5... Language. 1904. Linguistics. LITERATURE. shriigovindadaasa. 2000. 1934.. Linguistics. Language. Literature. 1957. 1914... 120 pgs...t. Sanskrit.. shrii koliyaalamu svaamina:.. 0. Psychology. naanyabhupal.. Sanskrit.. bhamahas kavyalankara. Literature. Religion. tatachary siromani. 424 pgs. Sanskrit. Sanskrit. bhiimaparaakraman. bhakttisudhaataran'gand-ii.. bhat't'ikaavyamu. Linguistics. 1964. Sanskrit.. shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru. Mandana Misra.2/14/2011 A list of scanned Sanskrit books at III… bhagavadgiitaya luupanyaasagal'u on'danaya bhaaga. LINGUISTICS.. g k bhatt ed. 96 pgs. sanskritdocuments.. Language.. 661 pgs. 222 pgs. Linguistics. Literature. Religion. 322 pgs. Language. bhat't'ikaavyamu chandrakalaa vidyotinii san'skrxta hindii vyaakhyaadvayopetamu dvaadashaadi dvaabin'shatisarmaparyantamu. 1898. Sri Ranga Ramanuja Desikan.. Philosophy. Linguistics. 1169 pgs.. god'avarti shat'hakopaachaarya.. Linguistics. bhartrxharisubhaashhitamu. Philosophy. Philosophy. bhagavadgiyaanasopaanamu.. Literature. Language. Sanskrit. Sanskrit. shriivatsaangkamishra. Sanskrit. 1947. 138 pgs. 670 pgs. Language. 1942.. bharatamajjari. 282 pgs. Sanskrit. 260 pgs. 74 pgs. bhedojjiivana. bhagavadgund-adapand-aakhyamu shriivishhnd-usahastranaamabhaashhyamu. Literature. Language. Religion. Philosophy.… 102/167 . bhedadhikkaara upakaaramapaarkarma vyaakhyaayasahitamu. Literature. 580 pgs. 96 pgs.. Sanskrit. bhasasastrapravesini.. Sanskrit. 66 pgs. Language. shriimannrxsin'gaashramamuni.. 0. 1930. Language. Sanskrit. bhat't'ikaavyamuu. Sanskrit. bhavana viveka. Sanskrit. Sanskrit. bhatta bhasha prakash.. Literature. bhaishhajyaratnaavalii. Linguistics. Literature. 857 pgs. venkata ramana sastri. 1961. Psychology. Language. Literature.. -.. Language. Sanskrit. Linguistics. Sanskrit.. Linguistics. shriikshemendra. 1914. 0. Sanskrit. Philosophy. Literature. Psychology. bhasa svapnavasavadatta. 1999. Theology.. Linguistics. 188 pgs. The Arts. Linguistics. bhat't'akalpataru... 130 pgs. Sanskrit. Sri Rama Subramanya Sastri. 178 pgs. 1912..... Literature. bhagavadraamaanujavijaya gadhyaprabandha.. Religion. 1938. Language. Linguistics. Linguistics. Literature. bhedasaamraajyamu. 1954. bhedajayaqs-i. Language.. Literature. 294 pgs. Sanskrit. Sri Visvesvara Siddi.. Psychology. Psychology. bhedasaamrajyamuu vedaantabhaaga. 1952. Literature. 1934.. Theology. Language. d.. Sanskrit. Sanskrit. 0. 128 pgs. Psychology.. Sanskrit. 0. Sanskrit. 511 pgs. 252 pgs... shaataanandasunu. Linguistics. Theology. bhaimiiparind-ayannaama naat'akamu nalavijayaaparanaamakamu. Sanskrit. 71 pgs. Sanskrit. Language. khemaraaja shriikrxshhnd-adaasa. bhaktamaalaa raamarasikaavalii.. 1271 pgs. 1915.org/…/SanskritIIIT. Sanskrit. 1933. mahaakavishriibhat't'i.. 1900. Literature. LANGUAGE.

Theology. Literature. 357 pgs.. 1901. bijn'panaya. Dr Sureshchandra Mishra. brahaasuutrabhashhyamuu. Sri Nimbakacharya. brahaasuutrashaan'karabhaashhyamuu Part Iii With 9 Commentaries. 106 pgs. gopalan s tr. 1991. Wasudev Laxman Shastri Pansikar. Philosophy.. 1934. Language. Sanskrit. brahaasutrashaan'karabhaashhyamu dusaraa bhaagan. Literature. Linguistics. Sanskrit.. shaama shaastri. . bhuukailaasanaat'akamu.... boodhaayanaguhaya suutramu. Language. Sanskrit. 126 pgs. 73 pgs. 534 pgs.org/…/SanskritIIIT.. 80 pgs. Sanskrit. baskaraachaarya. 0. hech. 649 pgs. Linguistics. LANGUAGE. bhushanam. Geography. 994 pgs. 1977. Literature. brahaasuutrashaan'karabhaashhyamuu Part Iii With 5 Commentaries.. 0. Brahmasutras. 1908. Geography. Philosophy..subramanyasaastri. 1929. R. aar. 1932. Mahadeva Sastri Bakre. Sri Anantha Krishna Sastri. Language. Philosophy.. Linguistics. brahaasutrashaakarabhaashhyamu bhaamatiikalpataruparimalopetamu.… 103/167 . raghunaatha. Psychology.. Sri Anantha Krishna Sastri. shrii madhvaachaarya... Literature.. 42 pgs. Vaidya.. Biography.. 444 pgs. Philosophy. LITERATURE. Bhaskaracharya. Sanskrit. 1927. Linguistics.. Linguistics.. 1918.. Narayana. bhramasuutrabhaashya bhaaga 1.. Sanskrit. Literature. Psychology.. 708 pgs. Language.. Literature. 1949.. Philosophy. 1951. shriiballaala... bhramasuutrabhaashya bhaaga 1. Psychology. bhucvaneishalaukikanyaayasaahastrii. Sanskrit. Language.. 557 pgs. 494 pgs. History.2/14/2011 A list of scanned Sanskrit books at III… bhonsle vamsa charitra. brahaasuutrabhashhyamuu Text with Tippanis. Language. Language. brahaamanhikamuu. 1923. Language. Sanskrit. 1984. 355 pgs.. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Linguistics. 524 pgs. Sanskrit.. Philosophy. 1926. 90 pgs.. 646 pgs. brahaasutrabhaashhyamu. 269 pgs. Language.. Sanskrit. 100 pgs. t'haakuur. LINGUISTICS.. Literature. Sanskrit.s. Not available. 0. 650 pgs. 236 pgs. boddhi san'skruta grandaavalii 21. Sanskrit.. Religion. Sri Vasudeva Brahmendra Sarasvati Swamigal... brahaasureabhaashhyamu. bhuhajjaatakamu.d'i alan'kaar. 1920.panchamukhi. brahaasuutrashaan'karabhaashhyamuu With Commentaries of Shri Givindananda Vachaspati Anandagiri.. Sanskrit. bhuddhabhuushhana.l. Linguistics. Psychology. 1937.. 1984. Sanskrit. Sanskrit. Psychology.p.... Literature. Psychology.. Linguistics. Sanskrit. brahamiman'shatrishati. Literature. Sri Sankara Bhagavatpadacharya. 452 pgs. Sanskrit... Sanskrit. Literature. bhoojanakutuuhalamuu.. Literature. Religion. Sri Gnana Bikshu. Rangaswami. shrii madhvaachaarya. 1959. Psychology.. bodhaayaniiyagrxhyasuutra. brahaasuutrashaan'karabhaashhyamuu Vol I Chatussutri.. Philosophy. Linguistics. 1956. Psychology.. 1941.... Language. Sanskrit. Philosophy. Linguistics. Language. vi. gokarnd-a saan'badiiqs-ita. Psychology. 0. 441 pgs.. 354 pgs. Unknown. Sanskrit.. Sanskrit. 938 pgs.. bhoojaprabandha. 324 pgs.. Linguistics. Sanskrit. Sanskrit. brahamiimaan'saabhaashhyamuu. Sri Sankara Bhagavatpadacharya. Philosophy.. 0. 344 pgs. Sanskrit. 1933. 1955. 1989. brahadhogatarad'ugind-i asyaan' dhvitiyo bhaagan. Sri Subramanya Sastri. 306 pgs... sanskritdocuments.

Sanskrit. brahma suutraand-i. 510 pgs. Language.. Prof. 1983. brahmaand-d'apuraand-ettarabhaagiiyan' lalitaasahasranaama saubhaagyabhaaskaraaravyabhaashhyan.. Linguistics. Hari Narayana Apte. Literature. 2002. brahmamiimaan'saabhaashhyamu. 1933. shriimajjayatiirtha vyaasatiirtha. 1991. 441 pgs. 2000.. 315 pgs. Sanskrit. Literature.. Literature. Language. 1984. Literature. shriinimbaarkaachaarya. 340 pgs. Sanskrit. 278 pgs. Language.. 1984. Brahmasutras. Linguistics. Language. 461 pgs. Theology. brajavilaasa. Sanskrit. Religion. brahmasutrabhasya of sri madhvacharya vol 1. Sanskrit. 290 pgs. Sanskrit. 1894.. je. brahma sutra sariraka bhaaga 1.. brahmasutraa nimbaakaibhaashhyamu panchamo bhagan. hari naaraayand-a. brahmasuutrabhaashhyaalochanasya prathama chatu suutrii. brahmaasuutraand-i. brahmatatvaprakashika.. Yogeswara Dutta Sharma.yal. Philosophy. Language.prabanjanacharya..2/14/2011 g A list of scanned Sanskrit books at III… p y y gy pg brahasuutraanugund-yashiddhi. Literature.... 1967. brahmasutraa nimbaakaibhaashhyamu.. Sanskrit. sanskritdocuments. 246 pgs. 200 pgs.. Kuppuswami Sastri. 596 pgs. V. balagangadar tilak l.. Language. shriividhyaarand-ya. sri bhagavad ramaanuja. 1954... vidhyaabhaaskara shriimand-ishang-karo vasantaraamaatmaja upaadhyaaya. Linguistics. Sanskrit. Language. Religion. S. Brahmasutras. Sanskrit. Sanskrit. Not available. Theology. Religion. 0. Brahmasutras...org/…/SanskritIIIT. Sanskrit.. Chandrasekharan. 530 pgs. 1915. Vira Raghavachaya.. 266 pgs. Literature. Literature. brahmasutraa nimbaakaibhaashhyamu charma bhagan... 1937. V. Literature. brahmasutraavabhavamu vrittimit'aksaraa. 453 pgs. 1922. 1927. Venkataramana Reddy. gan'gaavishhnd-u shriikrxshhnd-adaasa.. 185 pgs.. Sanskrit. 203 pgs... Sanskrit. Literature. 2003. Psychology.. 0. Language. brahmasutraavabhavamu. 198 pgs. Not available. 30 pgs.. Sanskrit. Sanskrit. brahmasuutrashaan'karabhaashhyamuu. Psychology. 245 pgs. brahmasiddhi Of mand-namishra Vol 1 brahmakaandaa.. brhadaarand-yakopanishhatu. T. brahmasuutrabhaashhyamu prathamo bhaaga.. Linguistics. Sanskrit. 2000. Philosophy. 0. Philosophy. Sanskrit. Religion. bran'hmaan'd'a puraand-amu. Krishnasastri. 1957. Linguistics. Philosophy. brahmavidaashiirvaada. 340 pgs. vaasudevasharma. 416 pgs. 191 pgs.. 1923.. Sanskrit. 604 pgs. brahmasutraa nimbaakaibhaashhyamu. Linguistics.. Brahmasutras. Psychology.. Literature. Theology... Linguistics. Sanskrit. Language.. 1981. Literature. Language. Linguistics. Language. Sanskrit. shaastri. Theology.. Brahmasutras.. t'i gand-apati saastri. Madanmohan Agarwal.... Madanmohan Agarwal. Sanskrit. 102 pgs..t... 1963. brhamasuutra vrutti. Upanishads.… bh ti ti k i i L Li i ti Lit t S k it 1941 188 104/167 . Linguistics. brahmasuutrabhaashhyamuu samalang-krxtamu. 1909.. Sanskrit. Linguistics.. 1991. brahmasuutrashaang-karabhaashhyamu sat'ippanan' muulakaatramu. Sanskrit... Not available. 441 pgs. Sanskrit. Linguistics. 322 pgs. bhaaskararaaya. Sanskrit.

Sanskrit. Linguistics. Sanskrit. 0. champuuraamaayand-amu ayodhyaakaand-d'amu. brxhatii shaabarabhaashhyavyaakhyaa. Literature. Linguistics.. Language.. Sanskrit.. 1246 pgs. bhoja. THEOLOGY... Sanskrit.. 1946. trimallabhat't'a. Sanskrit.. narayana raam acharya. 560 pgs. 0.. 290 pgs. champuuraamaayand-amu yuddhakaand-d'amu vyakhyaaya sametamu. 1979.. Language.org/…/SanskritIIIT. 1901. 1979. Sanskrit. Sanskrit.. LITERATURE. Sanskrit. 1933. champuramayana.... brxhadhyogatarang-agind-ii dvitiiyobhaaga. 158 pgs. Sanskrit. buhadaarand-yakopanishhadushhyavaatokamuu.. Sanskrit.. Unknown. Sanskrit. 1891. Social Sciences. THEOLOGY. King Sambhu. Literature. 32 pgs. brxhadhdaan'turuupaavali..ma.. shriibhoojaraajasaarvabhauma.. brxhadaarand-yakopanishhatkhan'd'a. Language.sudhaakara diveidi. 132 pgs.. Language. Linguistics. Sanskrit. Sanskrit.. Literature. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… brhaspatismrti. Linguistics. 643 pgs. shriibhojaraajasaarvabhauma. Literature... v. budhabhuushhand-aman. Language. Language. LINGUISTICS. Language.. Sanskrit. Language. census of india 1981 series 1 part V A amp B. 0. Sanskrit.. champuramayana kiskindha kanda and sundara kanda. 1895. Linguistics. 664 pgs. ma. Literature. shriiraamachandra budheindra. 643 pgs. Language. buhadaarnd-yakopanishhanmitaaqs-araa.. bulletin of the goverment oriental manuscripts library madras. Literature.. Linguistics. Literature. Sanskrit. Philosophy. 295 pgs. prabhaakaramishra. Not available. Linguistics..viswanatha Nayak. Sanskrit.. brxhatakathaaman'jarii. Literature. Psychology. Linguistics. 82 pgs. t.. 0. qs-hemendra.. kaviraj shrii athrii dhev guru. Sanskrit. 1875. 122 pgs. Not available. RELIGION. census of india 1981 series 1 part Viii. LANGUAGE. 1941. Linguistics. 1326 pgs. Linguistics. Sanskrit. Literature. 1955. Not available. 0.. Art.padmanaabha. Language. p. Linguistics. chalaraashikalanama. Sanskrit.. 1941. RELIGION. Linguistics. brihadaranyakopanishhat'a khandarthaa. Jwalaprasad Misra. Language. chaand-akyashatakam. 34 pgs.… 105/167 ...padmanaabha. champubhaaratamu. 1914. Not available. 0. t'ii aara krxshhnd-aachaaryand-a. Religion... Sri Raghavendra Tirtha. Literature. Language. 480 pgs. Literature. 650 pgs... 1943. 330 pgs. Linguistics... Sanskrit. 256 pgs. Theology.. 256 pgs. 0. Sanskrit. Linguistics. chaalukyacharitamu. 110 pgs. chimand-aajii aapat'e. chandrashekhran... t'i aar krxshhnd-aachaarya. Literature. Language. Literature. 1926. Literature. rangaswami aiyangar. 0. budgat 1966-67 finance minister's speech part -a. Literature. 0. Language. P. sanskritdocuments. 460 pgs. Natural Sciences. Language... Language. bruhadhyaavanaajaathakama. 1924. p. 283 pgs.. 188 pgs.. Sanskrit.. Sanskrit.. hari naaraayand-a.. Sanskrit. 1843. Linguistics. champuuraamaayand-amu kalyaand-ii san'skrxta hindiivyaakhyaadvayopetamu. 290 pgs. Literature. brxhaddhaan'turuupaavali... 552 pgs. brxhatstotraratnaakara sachitra. k.

Not available. 322 pgs. Gopala Lala. 142 pgs. chaukhaambaa sahitya. 1843. chaukhambaa siiriija saahitya 1999 ii. Language. Linguistics. LITERATURE. 0. charudattam. Religion. chandra loka.. Not available. sanskritdocuments. Not available. Technology. 0. Linguistics. Literature. Literature. 0. LANGUAGE. 194 pgs. Sanskrit. Literature. bhat't'oojidiikqs-ita.. Language. devakiinandana. chaturvaand-ii... chatur^var^gachintaamand-e Part Ii. chandraprabha charita..t.. Linguistics... LITERATURE. LANGUAGE. Language. Literature... Linguistics.. Sanskrit. 1907. 1993. Not available. Literature. Linguistics.r. Language... viiranandii. Linguistics. chhaan'dogyavedeshiiyat'iikaa. LINGUISTICS. Language. Language.. Sanskrit. Sanskrit. Language.. Not available. 1904. Language.. Literature. Language. 0. Linguistics. 810 pgs. Literature. Literature.. chaturvin'shatiimatasan'graha.. Sanskrit. Social Sciences. Literature.. Linguistics.… chhaandogya braamhand-amu trxtiiyobhaaga.. Language. Literature. 1934. Sanskrit. 112 pgs. chandrakaantaa santati paan'chavaan' hissaa. Sanskrit. Literature. 88 pgs. Sanskrit.. 1941. chaturdandi prakaashika. Linguistics... chaukhambaa saahitya 1996 97.. Sanskrit. Language. chatushshlekii stotraratnanj-cha. Not Available. Language. Sanskrit... Not available. 1926. Linguistics.. 461 pgs. devakiinandana. Krishnacharya. Literature. chandrakalodaahaara. Language. Linguistics. chatur^thiikar^mapaddhati. Hemadri. shriimadyaamunamuni. Sanskrit. Language. 386 pgs. shriijayadevakavi.. chan'drikaaprakaashaprasara.. Not available. 0. Sanskrit. Language. 37 pgs. Linguistics. 190 pgs.. Sanskrit... chatun'shlokii. Linguistics. 1962. 156 pgs.. 0. Religion. 1937.. Social Sciences. 1912. LINGUISTICS. Literature. Not available.. Sanskrit. 127 pgs. Chakripanidatta. Sanskrit. 398 pgs. 672 pgs. charakasn'hitaa by agnivesha. Literature. 108 pgs. Theology.... 251 pgs. Language. Language.. Linguistics. Sanskrit.. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… Language. 0. Sanskrit. 0. Sanskrit. Sanskrit.. Sanskrit. Sanskrit... 106/167 .. .. 1960. shriimattaatparya. Theology... 0. 112 pgs. paurnamasi katha bhatta. 112 pgs. 1914. 1959. chhaan'dogyavedeshiiyat'iikaa. Linguistics. chhaan'dogyopanishhatkhan'd'aartha. Literature. Literature... 86 pgs. 342 pgs. 1962. chandrakaantaa santati saatavaan' hissaa. Linguistics. chaturvaand-ii.. Literature. 106 pgs. Unknown. chaukhambaa saahitya 1996 97. Language. champuuraamaayand-amuu baalakaand-d'amuu.. chandraaloka savimarsha prakaasha hindiivyaakhyaya panj-chamo mayuukha. 0. Linguistics. 1861. devadhar g r tr.. Language. 1843. Sanskrit.. Not available. Sanskrit. Linguistics. chaukhambaa saahitya. chan'drikaaprakaashaprasara. Language. 115 pgs. Linguistics. 526 pgs. Not available. Sanskrit.. subramanya shastri s. 112 pgs. Not available. Sri Vallabhacharya. 184 pgs. Sanskrit. Literature. 394 pgs. chandrasyasaarand-iiraashyaadi 321404. Sanskrit..org/…/SanskritIIIT. Sanskrit. shriibhoojaraaja. 0.. Not available. 1977. Linguistics. 142 pgs. Literature... Literature. 126 pgs. 1999. Sanskrit. Sanskrit. 230 pgs. Literature.

Sri Paramasivendra Saraswati. Linguistics. Linguistics Literature.. vord'ana d'ila.... Language. Language. Literature. 2002. 0. Linguistics.. bhiqs-u.sharma. ching-iyaaghara. chitraprabhaa. LANGUAGE. Sanskrit. 322 pgs. shrii durgaamoohanabhat't'aachaaryaind-a. 411 pgs. K. 90 pgs.. chhandovichitin.. 1964. Language. Literature. 1941. The Four Vedas.… 107/167 ... Sanskrit. Sanskrit. daasacharitamu. 1971. 1932.. shivadat't'a. Sanskrit. Linguistics. 1948. pan' harishang-kara sharmma.. Ayurveda. Religion.. Philosophy.. Literature.. 1937. Language. 282 pgs. Sanskrit.. 1965. Not available. The History Of Philosophy. 82 pgs.. Literature.. Psychology. Literature. subrahand-ya shaastrii. Sanskrit. Sanskrit. Sanskrit. daanachanddrikaa.. Sanskrit. shriimadappayadiiqs-ita. RELIGION. 579 pgs. 213 pgs. Language. Linguistics. Sanskrit. 628 pgs.. 80 pgs. Linguistics. Literature. Sanskrit. Language. 2001. Rangaswamy. 1932... shriitaaraanaathatakivaacha.. chhaandogyopanishhatuu. Psychology. 1873... daasakuut'a..t. Sanskrit. 1938.. Sanskrit. Linguistics. Banamali Biswal... kalidasa. 232 pgs. 1902. LITERATURE. Literature.. 326 pgs. Language. 127 pgs. chitramiimaan'saa. Linguistics. chhaandogyopanishhatuu saamaveidaa.. chitramiimaan'saakhand-d'anamu marmakaashena vimarshinyaa baalakriid'ayaa. chidagana chandrika sanskrit commentry and english translation... Theology. 0. sri pingalanaga. THEOLOGY. contribution of andhra to sanskrit literature. Bhabgavata Hari Sastri.. Literature. Religion. Literature. Sanskrit. Language. chhanda shaastramu mrxtasan'jiivanyaa vrxttii. Sanskrit. divaakara. shriijovaanandavidyasaagarabhat't'aachaaryaa.. 830 pgs. 218 pgs. 0.v... Sanskrit. chitraprabhaa. 645 pgs. 1943. Linguistics. Sanskrit... Sharma. shriiping-galaachaarya. Sanskrit.... Linguistics. Ananthanarayana.. The History Of Philosophy.. 470 pgs. 256 pgs. 530 pgs. 1989. Linguistics.. Sanskrit. 1956. Literature. LINGUISTICS. Language. chhandashaastramu.. chitranibandhaavalin. 120 pgs.. Sanskrit. chhaandoogyabraahmand-amuu. Sri Gopala Shastri Darsanakesari. 1962. yash dev shaalya. 1941. 366 pgs. Linguistics. Sanskrit. LINGUISTICS. Language. Language. d'anavaara kii ghaat'ii. Sanskrit..org/…/SanskritIIIT. mand-d'itaraaja shriijagannatha. Sanskrit.. 209 pgs. sanskritdocuments.. daanakaand-d'amu panchamo bhaagan. chitramiimaan'saa sudhaa vyaakhyaasamalang-krxtaa.. daarubrahaa. 160 pgs. daanakelichintaamand-in. 1980. Linguistics. LITERATURE. Technology.s. 125 pgs. 2000. chikitsaa saahitya. 1958. LANGUAGE. 1908. chhandas sastra. chhandobhyastaa. Literature. Literature. Linguistics. Sanskrit. Language. 459 pgs. 1980. shriiping-kalanaaga.. 244 pgs. Literature. raamaraaju b. Linguistics. Sanskrit. daarshaanik pancham varshik shanaak. Sanskrit. Language... 0. Literature.. Raghunath Sharma. Linguistics. B.. chidagaganachanddrikaa kramaprakaashikaavyaakhyaaya. Language.2/14/2011 A list of scanned Sanskrit books at III… chhaandogya braamhand amu trxtiiyobhaaga. Vacant. 162 pgs. Sanskrit...r. Sanskrit. 152 pgs. daharavidhyaaprakaashikaa. 1991. 208 pgs. 1938. Literature. 212 pgs. hari naaraayand-a aapat'e. Sanskrit.m.. Language. mahaakavikaalidaasa.

. dasha upanishhadan' pradamo bhaagan. shriiraama.. Sanskrit. 1933.shashibala Gouda.. B. Language. 1947. 1935. 1987.. 0. Sanskrit.. Dr. C. 1996. 1898.. Sanskrit. 631 pgs.. Sanskrit. 1926. 402 pgs. G.ramachandra Sharma. Theology. vinaayaka gand-esha aapat'e. lakshmipuram srinivasachar.. Religion. Sanskrit. 1924. 1936. 1954. 518 pgs... 101 pgs.kunham Raja. Philosophy. Sanskrit. Religion. Kashmir. pan'd'it chamaraajanagar shriikaan'ta shaastri. dashanind-aiyai.. darsanodaya. Language. deha prakriti vignyan. Sanskrit. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… dakikhanii kaa padha aura. 575 pgs. Literature. Sanskrit.. 519 pgs.org/…/SanskritIIIT.. 1878. Linguistics. Upanishads. devataadhyaaya san'hitopanishhadu van'sha braahamand-aani. dattakamimaan'saa 1976. 352 pgs... LINGUISTICS. vaad'iilaala.. Religion. 370 pgs. dhaaturatnaakara. dasha upanishhadan' dhvitiyo bhaagan. 0. 545 pgs. tryamn'baka raayamakhi... Literature. Language..kunhan Raja. Sanskrit. Manmatha Nath Dutt.. Linguistics. Venkatanathacharya. Language. Linguistics. dharma kuut'amu Vol. 520 pgs. 602 pgs.. Sanskrit. LITERATURE.. Sanskrit. 98 pgs. 202 pgs. Sanskrit.. Language. Language.. Language. devabhaashhaa. Sanskrit. 352 pgs. Theology. dhar^masaastraa Part Ii. 341 pgs. Literature.. The History Of Philosophy. 1934.. dharma shastra. Upanishads. Sanskrit. Sanskrit... 1895.. deshopadesha namaimaalaagrantho. Sanskrit. 120 pgs. dhananj-jaya. Psychology.. Linguistics. 1111 pgs. 0. maarulkarashaastri. shriikaakhanaayai. sanskritdocuments. dattaka chan'drika. Literature. 1909... Unknown. shriivaidikasaarvabhaumai. Theology. Not available. Kunham Raja. C. 1998. 0. 426 pgs. Language. C. dhamaupadeshaamaalaa vivarand-a.. Linguistics. 290 pgs. LANGUAGE. ke. dashainashaastrasyaitihaasan. Religion.. 0.. 126 pgs. LINGUISTICS. LANGUAGE. Sanskrit.… 108/167 . dharmaakuutamu 1 baalakaand-d'a. shrii upanishhadbrahmayogi. Sanskrit. Sanskrit. dharmaakuutamu 2 ayodhyaakaand-d'a prathamo bhaaga.. Language. dasharuupakamu kaavalokaaravya t'iikaa sahitamu.. Literature. Linguistics. 652 pgs.achari. Sanskrit. Linguistics Literature.. 1998. 1983.. Linguistics. Sanskrit. Sanskrit.. 24 pgs. Literature. Sanskrit. Religion.. kaviraja rakhaldaasa kavyaatiirtha.. dashaavataarastotramu. yashaavanth vaasudhev paatnkar. Iii Part Ii.. Sanskrit. Not available. Language. LITERATURE.. Literature. Literature.. Linguistics. Literature. darshapuurnd-amaasaprakaasha prathamo bhaaga. 1936. dasha upanishhada prathamabhaaga vyaakhyaayutaa. ddvaitokttiratnamaalaa. 1976. Literature... dasha upanishhadan' pradhamo bhaagan.. Language. Not available. Bhagavdgita. Theology... Theology. Philosophy. Sanskrit.. Social Sciences. dhaaturuupa prakaashikoopoodhghaata. 131 pgs. 1935. Linguistics. 1928. 1949. dashanirnd-ayii. Sanskrit. Sanskrit. Linguistics.. mahaadeiva chimand-aajii aapt'e. 254 pgs. dhanan'jayavijayan. Sri Jayasimha Suri. 363 pgs.. Literature.. 106 pgs. Sanskrit.. 976 pgs. 1924. 130 pgs. naabaadarsgabaoaranaachaaryya.. Art.

. dhvaivajnj-abharanamu. 855 pgs. Sanskrit.. 1955.. Linguistics. Linguistics. Literature.. Sanskrit. Sanskrit. 831 pgs.. . shrii badhiriinaatha sharma. dhvanyaalokasaara. 1922. Literature.. shriimadaanandavardhanaachaarya. Sanskrit. 214 pgs....org/…/SanskritIIIT. Literature. Linguistics. 1971. LANGUAGE. pan'd'ita durveika mishraa. Language. Sanskrit... 1969. kurugan't'i shriiraamashaastri. LITERATURE. laqs-mand-a shaastrii. Sanskrit. Literature. dharmakosha Vol I Part I. dhatu sagara tarani. 116 pgs. dhvanyaaloka baalapriyaadivyaanj-janaabhyaan' lochanena. Linguistics... dharmoottarapradiipa volume Ii. sanskritdocuments. 1933. Language. Not available. 1968. Sanskrit. 526 pgs... Linguistics. dharmatattvanirnd-ayaparishishht'amu.. Linguistics. LANGUAGE. Language. 107 pgs. Language.. dravyagund-asan'graha dravyagund-asan'grahat'iikaaravyakhyaaya trxtiiyavrxtti. Sanskrit. dhatu sagara tarani. Sanskrit. draahyayaand-agrxhyasuutravrxtti. dhvanyaalooka. Language. Sanskrit.. Linguistics. p. 1938. Linguistics. lakshminarayana. Language. Sanskrit. Theology.. Sanskrit. gautama. draahyaayand-agrxhyasuutramu rudraskandavrxttisahitamu. 504 pgs. shriikaashiinaathopaadhyaaya. Literature. Language. 1935. 114 pgs.. diinaarkaraajakukaarahemalekhamu. Sanskrit. Literature. 1914. 1954.. Literature. shriisubhat'a. Religion. Vacant. 250 pgs. 0...... 1940. Literature. Linguistics. Linguistics. 390 pgs. Sanskrit. 1832. Literature. Sanskrit. 373 pgs. Sanskrit. Sanskrit. 1050 pgs. Sanskrit. Sanskrit. Theology. dhvanyaa looka. Sanskrit. Linguistics. Literature. dharmakosha Vol I Part II. 120 pgs. Vacant... mahaakavishriiharichandra.. Linguistics. 601 pgs. mahaakavishriiseqs-apivara. 1937. 98 pgs. dharmasindhu dharmadiipiikaa vishaadahindiivyaakhyaaya sudhaat'iippand-ya. dharmakosha varnd-aashramadharmakaand-d'amu prathamo bhaaga kramaanka 5. Language.. 224 pgs. 20 pgs. Linguistics.. thakur udayanarayana singh. 162 pgs. 712 pgs.. Language.2/14/2011 A list of scanned Sanskrit books at III… dharmaishaastrasan'graha. Literature. Language.. Language. Sanskrit.… 109/167 . Language. Religion.. LINGUISTICS. Literature. 694 pgs. 640 pgs. Language. Sanskrit.. Literature. dutaangadamu. p. LITERATURE.. 1968. Linguistics.. 1954. Language. Linguistics. diipikaasarvasvamuu. Language. dharmasuutra. Literature. 200 pgs.. 270 pgs. laqs-mandashaastrii joshii. vaidhyamahaamahopaadhyaayashriichakrapaand-idatta.. Sanskrit. sripati sastry. Sanskrit. dharmasuutramu bhaashhya sahitamu. 1900. gautama. Language. 0. Ganesha Sastri Ghokle. Linguistics. LINGUISTICS. Linguistics.. Literature. dharmasharmaabhyudayamu. Language. 1968. shriipurushhottamasharma chaturveda... Literature. 1934. Literature.. ravisheikhara pan'd'ita badariinaatha sharma. diipikaasaahitamuu.. 0. sripati sastry.... laqs-mand-a shaastrii. Language. 1937. mahaamahopaadhyaaya vaasudevashaastrii. Linguistics. 1972.. Literature. 1988. 1056 pgs.

Language. Linguistics. Language. 0. Linguistics.. Linguistics.m. Language.. Sanskrit. omaprakaasha. ekaviiraa. 1929. Sanskrit. kavisaamraat'u vishvanaatha satyaanaaraayand-a.... 1978.pi vandeishvari. Religion. 1910. -. Sanskrit. 1908.. 1895.. 1915. 1912.. Sanskrit. Art. Literature..r.. RELIGION. dvisan'dhaanamu.. Literature. badarinaada. Sanskrit.raghuthamacharya. Sanskrit. Literature. ganesh siddi. Sanskrit.mathuranath Shastri. ekaagnikaand-d'a. 516 pgs. gadhatrayamuu. Language. Linguistics... gadaadharapadvatau aachaarasaara. sanskritdocuments. Sanskrit. gand-itaadhyaaya vyaakhyaaya samanvita. eitareya taamaraaparinayamu. 1942.. Psychology.. gadya bhaaratii. 228 pgs. 1983. yam. 1950. giita goovinda aur abhinaya. Theology. omaprakaasha. 1998.. 82 pgs.. Linguistics. 1881. dvatadhumand-in. c. Sri Aurobino. Language. Literature. 522 pgs. Literature... 108 pgs.. T. Linguistics. Linguistics. d. Language. Sanskrit. 1911.. 766 pgs. 0. Literature. 380 pgs.. Sanskrit. Linguistics. 240 pgs. 1944. Language.vindhyeswari Prasada Dvivedi. Sanskrit.. Sritaranath. B. chimand-aajii aapt'e. 168 pgs. 232 pgs. eitareya braamhand-aa. Literature.. Sanskrit. 1942. gathaa bhrxgvajirasaatmakasya atharvavedasya upasthaanaamake bhrxgukhand-d'e. 276 pgs. S... Literature. gadya bhaaratii. Literature... 240 pgs. Literature.. ti ve shriinivaasaashaastrind-aa. . Sanskrit. Language. Language. Sri Mad Ramanuja. Language. Literature. 149 pgs. Sanskrit.. Aurobindo. dvatasiddaantasaaran. 262 pgs.. Linguistics. Shadguru. 1950. Linguistics. Linguistics.. Linguistics. Munichaturvijay Pandit lalchandrsrva Bhagavan Sresthitanuj. Social Sciences. giita govinda rasikapriya rasamanjari. THEOLOGY. Gadadhara Rajaguru. shyamasastry r. gaadaadharii tattvachintaamand-yaa diidhityaa cha garbhitaa. 1969. 190 pgs. Literature. Religion. 680 pgs. Religion. Literature.. 1970. 120 pgs. 1978. Hulagi Sripathyacharya. Sanskrit. jotindra mohan chatterjee. 1875.. Sanskrit. Sanskrit. Sanskrit. dvijakanyaanamu vivaahakaalivimarsha.. Linguistics..krishnacharya. Sanskrit. eitareyaarand-yakamu. 0. 458 pgs. 1927. Philosophy. gaathaashaptashaatii. Sanskrit.. 1902. jayadeva. 446 pgs.2/14/2011 A list of scanned Sanskrit books at III… dvadashaaran' nayachakramu.. Sanskrit. Linguistics. Sanskrit.. Sanskrit... Language. Unknown. Literature. shriinivaasachaarya. Sanskrit. 432 pgs.yam. Sanskrit. Language. 72 pgs... gaayatriivyaakhayaa. Sanskrit. eclipse cult in veda's bible and koran... gand-akaarikaa.. Sathavahana. 298 pgs. Language. 240 pgs.. Religion. Linguistics.. Anantakrishna Sastri.. 134 pgs. Language. 202 pgs. 1940. Religion. Sanskrit. mitaddara. 770 pgs. Sanskrit... 1908. 1906.. shriigadaadharabhat't'aachaaryachakravartti.. 452 pgs. gaadaadharii.. Language. Sanskrit.org/…/SanskritIIIT. Pandith Gopeshkumar..r. Literature. Sanskrit.. eitareya braamhand-aa. M.… giitaagn aana prathama adhyaaya arjuna kaa vishhaada pan' diinaanaatha bhaargava dinesha 110/167 .. gaathaasaptashaatii. 554 pgs. Literature. K Vasudeva Sastri. dalal. gautamaprand-iita dharmasuutraand-ii. gadaadhaarii.. Religion.. epika Bhavaarth Bodhini. 1932. Religion. 666 pgs.. 149 pgs. 1920.

Literature. Not available. shriidevaboodha.. 422 pgs. 57 pgs. gramaand-avaatikabhaashhyamu pradhama puraand-amu. 45 pgs. 1956. LINGUISTICS. Sanskrit. 43 pgs.. gobhilagrxhyasuutran. Literature. Art.. Language. Linguistics. Sanskrit. Language. LITERATURE. kavisamraat'a vishvanaatha satyanaaraayand-a. Sanskrit. K. Sanskrit. 219 pgs.. Language. Not available.. Religion. guptapaashupatamu amrxtasharmishht'hamu. subrahand-ya vidushha. gn-aanadiipikaa mahaabhaarata bhiishhmaparva... Not available. 1815. 226 pgs. 390 pgs. Literature. sanskritdocuments. Language. Language.. Literature.. Language. Language. 1947. Literature. 170 pgs. goobhila graahya suutra.… 111/167 . Linguistics. Literature.. Sanskrit. Sanskrit... h Kalpmudram. Language. 1909. giitaasandesha. Sanskrit. Sanskrit. Not Available. Linguistics..org/…/SanskritIIIT... 1846. Literature. Linguistics... Language. giitaapadmavikaasa. giitaasamiqs-aa.s. 182 pgs.. Linguistics.. 228 pgs. Literature.. Language. Sanskrit. goomiliiyaguhakarmaprakaashikaa. Sanskrit. Linguistics. svaamii raamadaasajii kahaaraaja. 384 pgs. 1986.. 0.. guhyasamaajatantamuu. Tripitakacharya Mahapandita. 186 pgs. 34 pgs. gurushushruubaa san'vargavidhyopadeshashcha.... Sanskrit. 1952.. Literature. giitopadesha.. 256 pgs.. gitagovinda mahakavyam. 140 pgs. Sanskrit. Sanskrit. Language.. Sanskrit.. bhat't'akumaarilasvaami. Sri Mukunda Jha Bakshi. Marunda. Sanskrit. Literature. Language.. Social Sciences. Sanskrit. Literature. pan diinaanaatha bhaargava dinesha. gruhaasutra san'graha. Language. Language. 188 pgs.. Srinivasacharyulu. Literature. 1948. Literature. 1995. Aniruddha Bhatta. Sanskrit. Not available. 0. Language. han'sasan'desha.. Literature. Sanskrit. Sanskrit. guurvaarthadiipikaa dvitiiya pushhpamuu. gand-eshadaivagn-aani. Shambhusinghji Suthaliyadheeshkruth. 374 pgs.. 0. 1931. Theology.. Literature. Language.. Sanskrit. gopurasandesaa.. Linguistics. grxhyasuutramu grxhyaparishishht'amu grxhyakaarikaashcha. 1936. jayadeva.m. guurvarthadiipikaa prathamaadhyaaya. Linguistics... 1971.. Linguistics. 504 pgs. 62 pgs. Language.2/14/2011 A list of scanned Sanskrit books at III… giitaagn-aana prathama adhyaaya arjuna kaa vishhaada. Theology. Unknown. 0. grahalaadhavan' karand-amu t'iikaa. Sanskrit. Linguistics. Linguistics. 0. Sri Rama Sharmacharya. Bhagavadgita... Linguistics. giitaashaastraarthaviveka. Benoytosh Bhattacharyya. 288 pgs. 0. Literature. Literature. grantharatnamaalaa. 1936. 1936. Linguistics. Sanskrit... Religion. Bommakanti... Sanskrit. Linguistics. Sanskrit. Anil Varan Roy. gopeenauth pathuk.. Language.. 0. Linguistics.. shriimadaanandatiirthabhaagavatpaadaachaarya. Linguistics. 1869. LANGUAGE. 330 pgs. 514 pgs.. Literature. 257 pgs. 0. shuuranaad'uu krxnjanuu pilla. Religion. 1969... 1892. Linguistics. 38 pgs.. Sanskrit. chintaamaand-i bhat't'aa. 352 pgs. Linguistics. M. Sanskrit. Literature. Sanskrit. Literature. Language. Ramamurthi. ma daa khare. gootaavalii sat'iik. 266 pgs. Linguistics. gobhiliiyagrxhyasuutramuu. Sanskrit. haaralataa. goopikoonmaada.. 814 pgs.. 1955. 662 pgs. 0.. 1972.

Literature.. harikavi alias bhanubhatta. Theology. Language. Religion. heitriiyoopanishhadi shiqs-aavalli. Linguistics. 1938.. Theology.. 1897.. Sanskrit. Language. Linguistics. 1917... Sanskrit. Sanskrit. Hari Narayana Apte.. 96 pgs. 93 pgs. 0.. haridiiqs-itakrutaa brahaasuutravt'anti... shriidevimalagand-i. 372 pgs... Religion. 0.org/…/SanskritIIIT. Bhana Bhatta. Literature. Literature. Sanskrit. R. 1960. Language. hariharaadvatabhushhand-amu. higher sanskrit grammar. Sanskrit.. 0. 336 pgs. Language. Sanskrit.. Sanskrit. 102 sanskritdocuments. 476 pgs.. Sudarsana Sarma And Sahitya Siromani. 249 pgs. goodaavaramishra.. Sanskrit. bhanabatta. hat'hayogapradiipikaa dhvitiyo bhaagan. hastalikhitagrandhavivarand-apajjikaayaan. Literature. harameikhalaa maahukaviracchitaa sat'ikaa. harivaasamu. Sanskrit.samba Shiva Sastri. Theology. Literature. gode p k. Linguistics. 197 pgs. Literature. Hathayoga. Sanskrit. Theology. hayata.. 246 pgs.. hashhaicharitan. Sanskrit. Sanskrit. 934 pgs. Linguistics.. Language. Linguistics. 1933. 718 pgs. Vasudeva Agarwal. Literature. 238 pgs. 1967. hariharachaturang-gamuu. 0. Linguistics. Theology. 198 pgs.. Linguistics. shriivibhuutibhuushhand-aabhat't'aachaarya. Linguistics.. Sanskrit. 218 pgs.. 268 pgs.. Linguistics. Language. 97 pgs. ramaswami shastri. hashhaicharitan' eka saan'skrutika gradhyayana. shan'karakrutayaa san'ketaakhyayaa. 112 pgs. Philosophy.. shrii manimshradaamodarene.. harishrchandropaakhyaanama~. 1950.. Bhana Bhatta. 1791. Sanskrit. Sanskrit. Religion. 1900. hashhaicharitamu. shriikrxshhnd-adaasaa. 264 pgs. Sanskrit. Sanskrit.. Literature. 1954. Linguistics. hastalikhitagranthaanukramand-ikaa. Linguistics.. hariharadvaita bhusanam with karika.. 38 pgs.. Subramanya Sastry. bodhendrasarasvati.. ramchandra kale m. Sanskrit. harivamsa. 941 pgs. Literature. hanumannaat'akamuu.. Language. K. 336 pgs.. Literature.… 112/167 . Religion. Religion. Literature. 1934. Literature. Linguistics. Linguistics. 1946. Psychology. 1935. Literature. 190 pgs. Bodhendrasarasvati... 1850. Sanskrit... khare kulotpanna harisuunu gand-esha... Hari Narayan Apte.s. T P Upadhyaya. Literature... Sanskrit. hariharaadotabhushhand-amu.. 1772.. 1964. Linguistics Literature. hashhachaaratasan'grahan. Language. Language.. Not Available. hindhi patra lekhan. 1971. Sanskrit. haridiqs-atakrutaa buhaasutravutin. Bhana Bhatta.. Religion.. Linguistics. Sanskrit... harshcharitamu. Philosophy. Language. Language. Sanskrit. Literature. Literature. 1932.2/14/2011 A list of scanned Sanskrit books at III… hanumada rahasyamu hindiivyaakhyaaya vibhuushhitamu hanumatpuujaapaddhati. 262 pgs. Language.. 1960. 0. Sanskrit. 196 pgs. Linguistics Literature. parushuram lakshman vaidya. harisowbhaagyamu. 272 pgs. 900 pgs. hanumanatakam. Sanskrit. 1946. Sanskrit. 1822. hashhacharitasan'grahan. 414 pgs. Sanskrit. k.. 108 pgs. Sanskrit... Language. Linguistics Literature. Psychology. Language.. aachaarya pandd'ita shriishivadattamishrashaastrii.. 1933.. . 1954.. bodhendrasarasvati.

Sanskrit. vimuktaatma. Language. Theology. Literature. Sanskrit. Language. Sanskrit. Literature. paalakaapyamuni. 145 pgs. Language. 1917. 26 pgs. Sanskrit. 166 pgs. pand-d'ita baladeivapraasaada. sanskritdocuments. shriinaaraayand-apand-ita. hstyaayuveda book 1.. shrii naaraayand-a pan'nd-d'it'a. Sanskrit... Linguistics. Linguistics. Sanskrit. 1928. 574 pgs. Not available. Sanskrit. 1964. 138 pgs. 1916.. irishadi dashopanishada.. Literature... 0. 1981.. 42 pgs. 456 pgs. Language. 152 pgs. 1825.. shriimatparamahan'sabrahmaanan'dasvaaminaa. 0. Sanskrit. 238 pgs. indraprasthaprabandha.. i tsin'ga aura bhaarata yaatra. 335 pgs. hitopdesh.. iishaavaasyoopanishhada. Psychology. 163 pgs. Language. Language. Language. hitopadeshan. Sanskrit. hindi zou vacabulary. 1921. 192 pgs.. 1959. 382 pgs. Linguistics. 0. Literature. Literature.. Literature.. Not available. Sanskrit. shankar bhashya. Not Available.. Literature. 122 pgs. K .. 1908. Ganapathi Sastri. 62 pgs... 0. Sambasiva Sastri. Literature. iishvaraanumaanan.2/14/2011 A list of scanned Sanskrit books at III… pgs. 1935.. Sanskrit. ht'hayoogapradiipikaa. Language. Language. Technology.. iishaavaasyat'iikaaraghunaathariirthiiya. 231 pgs.. 1980. shriijaganaathapand-d'ita.. Linguistics. 55 pgs. Sanskrit... pandit narayanan. hitoopadeisha. 1931. ishaadidashopanishhada bhaashhya sametamu. dasharatha sharma. Language. 1932. 64 pgs. Sanskrit. Linguistics. khemaraaja shriikrxshhnd-adaasashreshht'inaa. Linguistics. Linguistics. 1894. hindusthaanakaa dand-d'asn'grah. 103 pgs. Sanskrit. 1933... Psychology.... Linguistics. Language. 1975. iishaavaasyopanishhatuu khan'd'aartha. hrxdayapriya of parameshvara. Literature. Linguistics. vasudevasharamand-aa. shrii shang-karaachaarya. iishaadhyaashht'ottarashatopanishhada aadhyantatattachchhaantiyuja. Theology.org/…/SanskritIIIT... Linguistics. 0. M. shriimadugadgasheipaadhpaadhhyaya. Sanskrit. Religion. T. pandashiikaropahvavidvadddaralaqs-kand-asharma. Literature. 42 pgs.. iishaadyashht'itarashtopanishhada aadyantatatachchhaantiyuj. Linguistics. Language. Sanskrit. Sanskrit. ishht'aasiddhi savivarand-aa. Language. Language. Literature. yashaavanth vaasudhev paatnkar. Literature. 1963. Philosophy. Sanskrit.… 113/167 . Philosophy.... hrxdayaamrxtamu. hoorabijnaanrahasyam jyotishkalpabriksha.. Language.. Psychology. Sanskrit. Not available. iishvaradarshanamu tachchaitatu.. Linguistics. Sanskrit. Philosophy. Linguistics. 0.. Literature. indrajaalavidyaasan'graha. 413 pgs. Linguistics. Religion... Hiriyanna. Literature. naarayanachandra jyotirbhushan bhattacharya. Sanskrit.. Theology. Sanskrit. Sanskrit.. 266 pgs. jayakaanta mishra. 1972. Linguistics. Sanskrit. 1933. 445 pgs. Religion. Linguistics... 306 pgs. hitopadeshan. 750 pgs. ishht'asiddhi. Language. iishvarapratipattiprakaasha qs-imadhusudanasarasvatiprand-ita.. Sanskrit. 1020 pgs. Language. 1915.. Linguistics.. Language. Technology. Vishnu Sarma.. Literature... Literature.. Literature. Linguistics. Sanskrit. Literature.

. Raghavendra Acharya.. Geography. Literature. Language. 1934. Sri Meethalal Himmatram Oojha. 1844. Sanskrit. Language.. 1973. subrahmanyashastri. ishvara pratyabhijna vimarshini vyaakyaayasahitamu bhaaga 2. 42 pgs. 428 pgs. Linguistics.. Not available. shrii shaantisuuriisvaraji.. Sanskrit. utpaladeva. Sanskrit. Sanskrit. 1996... krishnadevaraaya.. 1904. sa raajavallabha sastrigala. Literature. pundit ramanatha anda sarma.. Linguistics. Not Available. 288 pgs. Sanskrit. jayapura raja vamsyavali.. Psychology. 1969.. Literature.. 322 pgs.. Biography. Sanskrit.. jaiminiiyasuutraand-i subodhiniit'iikaasametaani prathamamadhyaayadvayan' sat'iikamagriman. v. Literature.. Sanskrit. Linguistics. 446 pgs. Language. Language. Theology. Linguistics Literature.. Sanskrit. 352 pgs. 1890. 52 pgs. 84 pgs. Language.. Sanskrit. Unknown. Sanskrit. Sanskrit. Madhvacharya. Literature. jaagadiishiivyadhikarand-amu. 357 pgs. Sanskrit. 178 pgs. Literature. Vacant. Religion. Sanskrit. jagadaguru shriisachchidaanandasivaabhinava nusin'habhaaratiivijayakaavyamu.. Linguistics. 1957. 0. Vacant. Venkataramaiah.. 0. jaiminiiyashrotasutravrutin. 242 pgs.. Sanskrit. A Collection Of Essays On 21 Temples Located In Tamil Nadu. 468 pgs. sanskritdocuments. Theology. pat't'abhiraama. Linguistics. 405 pgs.. 476 pgs.. jaatakapaarijaata adhyaaya 11 15. LINGUISTICS. R. History. Literature.. Language. 1969. Religion. jauminiiyanyaayamaalaa Part I... Sanskrit.. Linguistics. Sanskrit... jyotirgand-itamu. 428 pgs.. jiivasaj'jivijnaat'akamu. shriikaalidaasa. Literature. 1937... 1938. 178 pgs. Sanskrit. 133 pgs. 1921.. -. Sanskrit. 1966. jaatakaabharan. jiind-iidvarahavanapaddatin' san'praaqs-and-avidhitra. Religion. jaanakiiparind-ayanaat'akamu... jiivavichaara prakarand-amuu.... Linguistics. Philosophy. Linguistics. Sri Kasinatha Sastri. Religion. Sanskrit. 298 pgs.… 114/167 . Linguistics. Sanskrit. 160 pgs. 1918. -. jaa ta ka t'a ka thaa padamo bhaago. 434 pgs. Literature. 1873.. itihaasasamuchchaya. 296 pgs.2/14/2011 A list of scanned Sanskrit books at III… ishvara pratyabhijna vimarshini vyaakyaayasahitamu bhaaga 1. 0. 1891. Dr R Latcha Raman. ishwarapratyabhijnaa vimarshinii.. shriimadvachaasa. Sanskrit... LANGUAGE.... jyotirvidaabharand-aamu sukhabodhikaa. 380 pgs. jaambavati parinayam. aachaarya shrii pan' lashhand-alaala bhvaa. Sanskrit. Sanskrit. Literature. Language.. kai jyotishhaachaarya dvaarakaanaatha naaraayand-a raaje...org/…/SanskritIIIT. Sanskrit.. Ramakrishna Bhatt. 0. Linguistics. Linguistics. jaagadiishiisaamaanyaniruttki (manuscript). janmapatra vidhaanamu sodaaharand-a tattvaprabhaa hindiivyaakhyaaya. Raghu Veera. Theology. Language. LITERATURE.. Religion. 0. jiivandharachampun.. Language. Linguistics. Theology.. 295 pgs. jaiminiiyaarshheya jaiminiiyopanishhada braahmand-e. 397 pgs. Sanskrit. 365 pgs.. 1980. 290 pgs. iya Kunadali Vigyan. Pannalal Jain. 82 pgs. utpaladeva. 0. 0. 1921. maharshhi shriijaiminimuni.. Literature. 1992. utpaladeva. jaiminiiyanyaaya maalaavi. 1947. jaataka ratnaakara. Vacant. Literature. pn' . Sanskrit. be raamachanddrasharmand-aa. Philosophy. Language. Language.. Sanskrit. Language. Sanskrit.. Literature.. jaatakaabharan.

Linguistics.. Sanskrit. Literature.. 64 pgs. Literature. 1956... LINGUISTICS. kaarikaavalii. 596 pgs. Language. Sanskrit. kaarikaavali nyaayasiddhaantamuttkaavalii. Sanskrit.. kaalatattvavivechanamam' Part Ii. kaashiikhan'd'an' t'iikaa. kaalagn-aanamu bhaashhaat'iikaasametamu. Linguistics... 350 pgs.. 194 pgs... Sanskrit. Sanskrit. 1895. kaarikaavali siddhaantamukttaavali t'ippand-ii. Language.. rabhaasanan'di. Sanskrit. 344 pgs. Psychology. Literature. 1984. 1900. 0.. 286 pgs.. Literature. Theology. 108 pgs. kaarikaavali nyaayasiddhaantamuttkaavalii cha chitravali. kaashaakrxtsna dhaatuvyaakhyaanamu naat'akat'ikaa san'skrxtaruupaantaramu. 1933. Literature... Sanskrit. 0. 1951. Sanskrit. shriimanmahaamahopaadhyaayavidhyaanaathapanjchaananabhat't'aachaarya. Vishwanatha Panchanan Bhattacharya.. Linguistics. kaalidaasakaavyasaurabhamu. daralaalasharmand-a. Philosophy.. Literature. LANGUAGE. 1973. kaadambarii... shah. Linguistics. Sanskrit. 675 pgs.. Literature. 280 pgs. 338 pgs. Sanskrit. Literature.. Language. 1924. Sanskrit.. shrii chokkanaatha makhi.. 89 pgs. kaarikaavalii nyaayasiddhaantamuktaavali. Linguistics. 1803. 374 pgs. Literature.. 1903. Sanskrit. 1915. Literature. 98 pgs. Vishwanatha Panchanan Bhattacharya.. Sanskrit.. Language.. Not available.. Sanskrit. Not available. Language. 90 pgs. jyotishhatattvasudhaarnd-ava bhaashhaat'ikayaa..org/…/SanskritIIIT. Linguistics. Not available. Language.. 419 pgs. manubhai s. 0.. Language. 1932. vishvanaathapachaana. Social Sciences. kaashikaa. 0.. 306 pgs. 360 pgs. 0. Not available. 516 pgs. kaadambarii kalikaataaraajadhaanyaan. kaamandakiiyaniitisaara bhaashhaat'iikaasahita. Sanskrit. kaan'timati parind-ayamu. Raghunatha Bhatta. Linguistics. Social Sciences. 1848. Linguistics. Language. Sanskrit. Linguistics.. kaarikaavalii muktaavalii.. Linguistics. 560 pgs... Peterson. Sanskrit. Linguistics.. Language... Philosophy. Literature. 556 pgs. 392 pgs. Language. Sanskrit. 0.2/14/2011 A list of scanned Sanskrit books at III… 1988. 854 pgs. shriivaatsyaayanamuni. Raghunatha Bhatta. Sanskrit.. Religion.. shriivishvanaathapanj-jaananabhat't'aachaarya. 0. Natural Sciences. vidvaanu khan'd'avilli suuryanaaraayand-ashaastrii.. Sanskrit. Literature. kaarakasan'bandhodhyota.. Theology. vishvanaatha panchaanana bhatta. Mahadev Shivaram Apte. 1939. Linguistics. shriivishvanaathapanj-chaananabhat't'aachaarya.. Literature. 228 pgs. shriiraamaanan'dayativara. Linguistics. Literature. Linguistics. 0. 422 pgs. 218 pgs.. jyotishha shiromand-i bhaaga duusaraa drxshht'aan'ta vibhaaga 4625 janmakun'd'alike shaata nirayana chitraan'sha.… 115/167 .. kaamasuutramu.. shriichannaviirakavi. Language. 0. kaalatattvavivechanamam' Part I. kaalaamrxtei savyaakhyaanei. Language. 534 pgs. Language. Language. Literature. Language. 1965.. Sanskrit. Linguistics.. sanskritdocuments. Sanskrit. Not available. durgaaprasaada. Linguistics. 1889. kaarikaavali siddhanta muktavali. Sanskrit. kaamasuutramu t'ikayaa sametamu. Sanskrit. Psychology. Sanskrit. LITERATURE. Religion. Literature. Language. Literature.. kaadambarisaaraa.

. Not Available. 1953. Linguistics.. kaatyaayanashrautasuutramu bhaashhyasahitamu. Sanskrit. Linguistics. 122 pgs.iii. Literature.. Temples.. 1292 pgs.… 116/167 .. shriiratnaakara. Religion. Ranga Swamy. 82 pgs. Sanskrit. J. Linguistics. Linguistics. Linguistics. kaavyadapaind-an. 1970. Sanskrit. Language. Language.. Linguistics. kaashyapasan'hitaa. Sanskrit. Language.. Language.. 100 pgs. gulaabaraaya. Theology. 1941. pand-d'itavaravaamana. Linguistics. 712 pgs.. Language. -. Linguistics.. Sri Yathiraja Sampathkumaramuni... 1911.. 1915. Language. Language. Sanskrit.si. kaashikaand-d'a grantha. Linguistics.. Sanskrit. Literature. 1948. Linguistics. 484 pgs. Language. Language.. 1941. kaavyadarshanamulyam. 0. kaashikaa dvitiiya bhaaga. LINGUISTICS. Sanskrit.. kaashmiirasandhaanasamudyama.. Not available.. Literature. Not available. LANGUAGE. 214 pgs. durgaiprasaadena. S.. 220 pgs. chat'arjii. Linguistics. 70 pgs. . Sanskrit. Sanskrit. 238 pgs. Language. LITERATURE. Linguistics. Literature.. Linguistics.. Literature. Language. Literature. 1933. Sanskrit. 102 pgs. Sanskrit. Literature. 359 pgs. Narayana Iyyar.. je. Temples. Sanskrit. 1925. Language. Psychology. Sanskrit. Sanskrit.. Language.. Literature. 1924. Sanskrit. 327 pgs. Sanskrit. 69 pgs. kaavyad'aakinii... Language. 114 pgs.. S.. kaavyadiipikaa.. Linguistics. 0. kaasyapasan'hitaa. 216 pgs. Literature. 312 pgs. vaagbhat't'aa.. parameshvaraananda. Language. shriijagadiishachandra chat't'opaadhyaaya.. 176 pgs.. Sanskrit. kaavyamaalaa haravijayamu. 1908. Literature. Literature....2/14/2011 A list of scanned Sanskrit books at III… kaashikaa. Linguistics Literature. 1903. Linguistics. kaavya ke ruupa. 1948.. Literature. Sanskrit. Sanskrit. 1911. 1953. 400 pgs. 246 pgs. kaasmiiragranthaavali Vol. 174 pgs. Literature. 270 pgs. Literature. Sanskrit. 1958. 235 pgs. kaavyaavali ke ratnaapaanchaalikaa. Sanskrit. Literature. 624 pgs. 540 pgs. Linguistics. Literature. 1968.. 0. pand-d'itavaravaamana. kaashmiiragranthaavalii prathamakhand-d'amu. 1952.. LANGUAGE. kaashyapa san'hitaa. 905 pgs. aachaaryadand-d'i. Literature. 1938. 1891.. kaavyaalan'kaarasaarasan'grahan.. kaavyamaalaa dashamoguchchhakan. sanskritdocuments. Sanskrit. Philosophy. kaashyapajnaanakaand-d'an. kaavyaalan'kaarasuutrand-i svavrxttisamalan'krxtaani. LINGUISTICS. 1933. Linguistics. 1894..org/…/SanskritIIIT.. Econo Politics. Linguistics. Sanskrit. Sanskrit. Banhatti N d. Ranga Swamy. Not available. kaavyakalaapan. Language.. 160 pgs. kaavyaadarsha. Sanskrit.. Sanskrit. durgaiprasaadena.. 0. maithilashriigang-gaanandakavindra. LITERATURE. aaryeindhra sharma.. Sanskrit. Literature. Language.. kaavyamaalaa ashht'amoguchchhakan.singaraiyengar. Linguistics. 0. Narayana Daso Banhatti. kaavyamaalaa Part X. Language.. Sanskrit. Singabhupala..... kaavyaalan'kaarasuutrand-i svavrxttisamalan'krxtaani. 32 pgs. kaavyaalaa chatudaishoo gun'chchhakan... kaavyaanushaasanamuu. 1936.. mahaamahopaadhyaaya shriikarkaachaarya.. shivad'at't'a.

mammat'aachaarya. vinnakoot'a maadhava raavu.2/14/2011 A list of scanned Sanskrit books at III… kaavyamaalaa navamoguchchhakan. 1947. 280 pgs. suryanarayana sastri. kalaamaadhavaa. Literature. Rasikalal Chotalal Parikh. 244 pgs. 616 pgs. 372 pgs. 1913. Sanskrit. 39 pgs. Sanskrit. kaavyaprakaashakhand-d'ana. shriimammat'aachaarya. 1895. 608 pgs. Sanskrit.. naaraayand-aacharya. LANGUAGE. . topalli ven'kat'araamadaivagn-ena. Not available. Linguistics. Literature. Sanskrit. 268 pgs. Sanskrit. Sanskrit. 329 pgs.. Literature. 184 pgs. punyananda.. 296 pgs. Harishchandra Renupurakar.. 0. LITERATURE. keshava. Sanskrit. 1932. 1986. Language. Language. 280 pgs. 1967. Literature. 1893.. Language. 224 pgs. Chandrakanth.. Poems. Language. karand-aratnamu subodhinii samaakhyavyaakhyaaya.g.. kanakaavalii. Linguistics. Language. 477 pgs. kamaikaarad'akramaavalii. Linguistics.. Language. 165 pgs. narasimhakavi. Linguistics.. 0.. Linguistics.. kaing-karyaratnaavali... 143 pgs. Language.. 329 pgs. LANGUAGE. Not available. Sanskrit. Language. Linguistics. Somashambhu. kar^mapradiipa. LINGUISTICS.. 1968. Sanskrit. Language.org/…/SanskritIIIT. Literature. 0. kalyaand-apiiyuushhavyaakhyaasametaa pan'chadashii tattvavivekaprakarand-amu. Sanskrit.. kadhambari. Linguistics. Sanskrit... banabhatta. kadaliimanj-junaathamaahaatmyamuu. mahaamahopaadhyaayashriigovinda. Literature. 1932. K. 1936. shriibihand-a.. Sanskrit. 524 pgs. 60 pgs.. kaavyaprakaasha naageshvarii t'iikayaa samalang-krxta. Literature. 2002. kamakalavilas. Sanskrit. Linguistics. Religion... kaavyaprakaasha kaavyaprakaashavistaarakaaravyayaa vyaakhyaaya vibhuushhita.. Literature.. Natosa sastri. kalapurnodaya.. 1932.. 1918. -. Linguistics. Natural Sciences... Language. kaavyapradiipa.. Literature. Language. Sanskrit. Linguistics.. Literature. 1976. 631 pgs. sanskritdocuments. Sanskrit. Sanskrit. Linguistics.. Linguistics.. Literature. 1980. .. 0.. 1939. kaavyaprakaasha. 1918.. Literature. Sanskrit. 178 pgs. 1812. Language. 502 pgs.. Technology. . Literature. Literature. Sanskrit. 584 pgs. durgaiprasaadena. Sanskrit. Literature. kaavyaprakaasha naageshvarii t'iikayaa samalang-krxta.. Language. LITERATURE. kalpadrukosha Vol II. Language. 80 pgs. Linguistics. 0. Literature. Literature. 207 pgs. kaavyaprakaasha krxtayaa vivrxtti. 299 pgs.. kadambari.. Linguistics. Linguistics. Language... Sanskrit.. 770 pgs. kaavyasaarasan'graha. LINGUISTICS. Sanskrit. Sanskrit. Linguistics.. Sanskrit. t'i gand-apati saastri. 0. 166 pgs. kalapasuutramu. kanadasiddaantachandrika. kaavyashilpamu.. Sri Krupa Chanda.. Linguistics. Sanskrit. 68 pgs.. Literature. Sanskrit. Theology. 1967. kalyaand-avaartikamuusiddhaantaniddddaana.. Not Available.. Linguistics. 1838. Language. mammat'a. 0. Language. 311 pgs. 1963. bhaaradvaja. kaavyonmoshhan. Not Available. Sanskrit.. Sanskrit. Social Sciences.. Literature... Language. Language.. Linguistics.. Sanskrit.. Sanskrit. shriimammat'aachaarya.. 1993...… 117/167 . kand-aisundarii. paravastukrxshhnd-amaachaarya. kadambari kalyanam.

. 1913. Pt. Literature. 1885. 61 pgs. Literature. 174 pgs. Linguistics. Sanskrit. acharya hemachandra. Religion. 0.. Theology.... 396 pgs. Sanskrit. 1942. Sanskrit. 368 pgs. 1968. rudraskanda.. Religion. Language. kaviindraacharyasuchi patramu. Vasudeva Jnana Muni. 1895. Language. Dr. Theology. Language. Religion. kelikutuuhale prathamastarang-ga.. pandit durgaprasada ed. kavikalpalataa.. Unknown. Sanskrit. 1925. sankara rama sastry c. kaushhiitaki braahmand-opanishhatu diipikaa. kaumarabhrityam with navya balaroga. 1961.. Literature. kat'hakagrxhyasuutran' bhaashhyatrayasaarayutan. 133 pgs. 1956. Language.. mahaakavi shriideveshvara.. 217 pgs. siitaaraaamasuuri. Literature.. Literature. Language. 0. Linguistics. 0. 1955. Language... Sanskrit. kenopanishad bhashya. Sanskrit. Shriipat't'abhiramachara~ya. 158 pgs. rudraskanda. 1942.. Linguistics. 1913. Sarat Chandra Sastry.anann'ta krishhana saastri. kavalayananda. Sanskrit.. Literature. kathaka upanishad. 194 pgs. raghuveera prasad trivedi. Sanskrit. Literature. Language.. Linguistics. Sanskrit. Literature. Language. Linguistics.. khaadiragrxhyasuutramu vyaakhyaayasahitamu.... Literature. sanskritdocuments. 1911. kaumudiisharadaagamamu dvitiiya bhaagamu. 1925.. Language. Language. Literature. bhat't'a someshvara. Literature.. 106 pgs. 1950. Sanskrit. Sanskrit. 78 pgs. Language. swami satchidanandendra saraswathi. Sanskrit. karnd-aamrxta prapaa. ubhata. Technology. Linguistics.. Linguistics. Language. Literature. Sanskrit... 344 pgs... kavyaprakash Rahasyam. Sanskrit. Linguistics. Literature. 730 pgs. kavikalpalataa. 104 pgs. Sanskrit. t'i ara chintaamani.. Philosophy. vikrama deiva varma. Language. 1963. bilhana. Sanskrit. Sanskrit. Linguistics. 1978. keivalyaratnamuu. 1964.. Sanskrit. 1913.. Sanskrit. Sanskrit. 230 pgs. Linguistics. 512 pgs. kaun'shhiitakagrxhya suutraand-i. Literature. Linguistics. Literature.... 1944. Linguistics. 480 pgs. raamasharand-ashaastrii.… 118/167 . T. Theology. Sanskrit. 184 pgs. Linguistics. Linguistics. Language..... 140 pgs.. Sanskrit.org/…/SanskritIIIT. 54 pgs. Linguistics.. 57 pgs...... Psychology.seetharam Jayramjoshi. keshava saahitya mein' samaaja san'skrxti evn' darshan. d'aa en gn-aanappa naayud'u. 190 pgs. Language. Sanskrit. Literature. khaadiragrxhyasuutramu vyaakhyaayasahitamu. 1881. puraatattvaachaarya jinavijaya muni. Linguistics. kavyamala.. kenoo upanishad. swami satchidanandendra saraswathi. 152 pgs. Linguistics. Literature. 1987. Sanskrit. kavimanoranjakachampu. 2000. Literature.2/14/2011 A list of scanned Sanskrit books at III… karnasundari. Literature.k ramachandra aiyar. 402 pgs.. Language. Literature. Language. Sanskrit. khaadiragrxhyasutrama~. 204 pgs. 98 pgs. 1966. Linguistics. Willem Caland. Language. karnd-akutuhala. rangaraamanuja. 62 pgs. Language.. shang-karaananda. Language. aar. Literature.. Sanskrit. 1921. kavalamkara sara samgraha.. Sanskrit. Literature. Language. Sanskrit.. Not available... 1932.. Linguistics.. Linguistics. 322 pgs.. 185 pgs. kathaakallolini paand-iniiyalaukikavyaakarand-asamaapaniiyaa. kavayadarsha. Linguistics. kavyanusasana.

sri vishvanath divedi. valmiki. 1957.. Linguistics. kruushhnd-ayajuvaidiiyataittiriiyasan'hitaa_bhaaga_7.t. 584 pgs. 1901. 1954. Linguistics. THEOLOGY.. Linguistics.. Language. kinkind-ii maalaa.. 588 pgs. 1954.. Linguistics. 1904. Linguistics. krxshhnd-aayajuvediiyataittiriiyasan'hitaa Kanda Ii Part Iv. shriiniilakand-t'hashivaachaarya. kriyaasaara upadeshachatushht'ayaatmaka prathamo bhaaga. hari naaraayand-a aapat'e. 100 pgs.. Linguistics. 1964.. 542 pgs. kaasmiirika keishava bhat't'a. Sanskrit.. khand-d'anakhand-d'akhaadya Part 1. 586 pgs. kriyaasaara panj-chamaadichaturdashopadeshaanta dvitiiyobhaaga. 1936. Sanskrit. khilaadhikaaran' bugusan'hitaa. Language. visnutrata. 586 pgs.. 442 pgs. Language. 584 pgs. 217 pgs. d'an' chandrabhaana raavata. Sanskrit.. Bhrga Samhita. Language.. kiraataarjuniyamu. Sanskrit. Sanskrit.. krama diipika. 1905. Sanskrit.. Language. kokasandesa. Sanskrit. Mahalinga Sastry.. Language. 1905. RELIGION. 1917. Linguistics. Theology.. kriyaadhikaaran' bugusan'hitaa.. kruushhnd-ayajuvaidiyataittiriiyasan'hitaa bhaaga 8..… 119/167 . 180 pgs. 1913. Technology... 318 pgs.org/…/SanskritIIIT. krishhnd-a yajurveidiya taitiriiya san'hita. shriiniilakand-t'hashivaachaarya. 1924. 0. sanskritdocuments. Theology. krxshhnd-a bhakti saahitya vastu srota aura san'rachana. Literature. 1913.. 428 pgs. shriishriiharshha. Literature. Linguistics. Sanskrit... Sanskrit. Sanskrit. 434 pgs. Religion. 315 pgs. THEOLOGY. Sanskrit. Literature.. Linguistics. Sanskrit.. Linguistics. Samhita. kaashinaatha saastri. kishhkin'dhaa kaand-d'amuu. kaashinaatha saastri. Sanskrit. kriyatmaka ausadahiparichaya vijnan. Religion.. 522 pgs. Literature. bhaaravi. 0. G... Sanskrit. Literature. Literature. 128 pgs... RELIGION.. Sanskrit. kiraataarjunaayamu. kriyaasaara upadeshachatushht'ayaatmaka prathamobhaaga. Language. A. Literature. 502 pgs. 125 pgs. Literature. Sanskrit. Literature. Ganapati Sastri. Sanskrit. kowt'iliiyan' arthaishaastramu. 0. bhaaravi. 642 pgs. 204 pgs. chan'd'iiprasaada sukla. Psychology. krishhnd-a yajurveidiya taitiriiya san'hita.. Language. Sanskrit.. pg A list of scanned Sanskrit books at III… khaadiragrxhyasuutramu vyaakhyaayasahitamu. 1934. Ramanuja Swamy. Literature. 868 pgs.. Theology.p. Bhrugu Maharshi. kiskindhakanda.. khaadiragrxhyasuutrn' rudraskandavyaakhyaasahitan. 580 pgs. Kasinatha Sastri Agase. Literature. khand-anakhand-akhaadhamu. khand-d'anakhand-d'akhaadhyamu.. Literature.. 1937. Language. 1953. shriiniilakand-t'hashivaachaarya.. 1954.... 1997.. rudraskanda. Linguistics. 1966. 88 pgs. Language. Literature. Linguistics. 294 pgs. Sanskrit.. Literature... Language.v... Linguistics. Language. Sanskrit. hari naaraayand-a aapat'e. Sanskrit. Language. Language. 1940. Literature. shriiniilakand-t'hashivaachaarya. Religion.. Sanskrit. Sanskrit. 1917.y. 1905. Sanskrit.. Language. kanhaiyaalaala krxshhnd-adaasa. Literature. Sanskrit.. Economics. Linguistics. 1965. 248 pgs.. Mahadeva Sastri. Philosophy. 438 pgs. Jha..2/14/2011 .. Linguistics. Sanskrit. kriyaasaara upadeshachatushht'ayaatmaka prathamo bhaaga.

Language. Philosophy. Sanskrit. Sri Varadaraja Mishra.… 120/167 . 1962. Linguistics. 1901.. Literature. 580 pgs. 659 pgs. ayendra sharma gen ed. Linguistics.... Theology. Literature. 268 pgs. Linguistics. krxshhnd-ollaasa champuukaavyaprakaand-d'amu. bhakta Darshan. kun'damaala.. 1901. Literature. krxtyakalpataru daanakaand-d'an' Vol 5. Sanskrit.. 646 pgs. Language. 1948. 1922. Philosophy. shriimatsaayandaachaarya. kusumaanj-ajalibodhanii. Language. 468 pgs. 1908. 58 pgs.. krxtyakalpataru shraddhakaand-d'an' Vol 4.. 1900. krxtyakalpataru niyatakaalakaand-d'an' Vol 3. 340 pgs. 354 pgs. shriiratnapaand-i. Religion. Linguistics. Language. 1943. Sri Kasinath Sastri. Sanskrit. kalidasa... 566 pgs. 1901. kutuuhala vrxtti. Linguistics. Sanskrit. kumaarasambhavan' mahaakaavyamu pun'savaniivyaakhyaaya sanaathiikrxtamu. 420 pgs.. A listpg of scanned Sanskrit books at III… krxshhnd-aayajuvediiyataittiriiyasan'hitaa Part Ii. kusumaanj-jali shriimadudayanaachaar^yavitachita. Language.. Sanskrit.. Social Sciences. Language.. Language. Linguistics.. 1956. bhat't'a lakshmidhara.. 1961. Not Available. Sanskrit.. kushhnd-agiiti. Religion. Sanskrit. 1937... Language. Sanskrit. 0. Language.. Theology. kutuuhalavrxtti.. Religion. Sanskrit.. krxyajuraveda. kusumaanj-jalibodhani. 1950. Linguistics. 1901. Linguistics. Sanskrit. Sanskrit. 178 pgs. shri paa raa subrahmand-yashaastriind-aa. Sanskrit. ksemendra. Linguistics. krxshhnd-ayajuvaidiiya taittiriiyasan'hitaa ddhitiiyo bhaaga.2/14/2011 g . 358 pgs. Raghu Vira.. Bhatta Lakshmidhara. 1977. 1912. Literature. Language. 486 pgs. Sri Kasinath Sastri. 1922.. Sanskrit.. 478 pgs. Sanskrit. 646 pgs. krxshhnd-ayajurvediiyataittiriiyasan'hitaa bhaashhyasametaa etatpustakamu. Sanskrit. Language... krxtyasaagara.. Literature. Linguistics. Linguistics.. 32 pgs.. mahaakavishriikaalidaasa. 390 pgs. Language. Literature. 176 pgs. Religion.. 545 pgs. krxshhnd-ayajuvaidiiya taittiriiyasan'hitaa prathamo bhaaga.... Sri Kasinath Sastri. krxtyakalpataru grahasthakan'd'aa vol 2. 422 pgs. 646 pgs. Social Sciences. Psychology.. Sanskrit. Literature. 1960. Psychology. Sanskrit. ksemendralahukavya sangrha.. Linguistics.. 300 pgs. krxshhnd-ayajuravediiyaa kapishht'ala kat'ha san'hitaa. Literature. kumarasambhava. Literature. Linguistics. Sanskrit. Language. 1941. Literature. Literature.. 1932. Bhatta Lakshmidhara. Theology. Sanskrit. Sanskrit. krxtyakalpataru raajadhar^makaand-d'an' Vol 11. Sanskrit.. 0. 276 pgs. Sanskrit. Bhatta Lakshmidhara. 406 pgs. 1950.. sanskritdocuments. Linguistics. krishna kumar davan. Sanskrit. Social Sciences. 402 pgs.. Linguistics. Theology. shrii vaasudeivadiiqs-ita.org/…/SanskritIIIT. 1951. soomanaatha.. Language.. Social Sciences. Literature. 1944. Shriimatsaayand-aachaara~yaa. 1961. Language. Language. krxshhnd-ayajura~vediiyataittiriyasan'hitaa Shhashht'ho Bhaagah. Sanskrit. Linguistics.. Language.. krxshhnd-ayajuvaidiiya taittiriiyasan'hitaa trxtiiyo bhaaga.. Literature.. Kasinatha Sastri Agase.. Sanskrit.. Linguistics.. Bhatta Lakshmidhara... dinnaaga. Literature. kundmala. Sanskrit. Pandit Laxman Sastri Dravid.. Sanskrit. 297 pgs. Literature. 0. varadaraaja. ksemendra. Literature. 308 pgs. Literature..

2/14/2011

A list of scanned Sanskrit books at III…

kutuuhalavrxtti... bhakta Darshan, Language. Linguistics. Literature. Sanskrit, 1960. 526 pgs. kutuuhalavrxttisaarasam'graha... Not Available, Philosophy. Psychology. Sanskrit, 0. 368 pgs. kuvalayaananda chanddraalokasahita alang-kaarachandrikaavyaakhyaaya cha vibhuushhita... budhavarashriimadappayyadiiqs-ita, Language. Linguistics. Literature. Sanskrit, 1833. 282 pgs. kuvalayaanandachandrikaachakairan'alad'akaaratatvaj'ja... Venkatachari, Art. Sanskrit, 1943. 319 pgs. kuvalayaanandakaarikaa alan'kaaradiipikaavyaakhyaayaa san'valitaa trxtiiyaavrxtti... shriiyutaashaadharabhat't'a, Language. Linguistics. Literature. Sanskrit, 1927. 114 pgs. kyo uttaraadhai... Madavacharya Sastri, Religion. Sanskrit, 1982. 693 pgs. laayanashrautasuutramu vrxtti... naaraayand-a, Language. Linguistics. Literature. Sanskrit, 1917. 471 pgs. laghu upanishad... narayana swamy aiyar k tr, Religion. Theology. Sanskrit, 1967. 302 pgs. laghukaumudii... varadaraaja, Language. Linguistics. Literature. Sanskrit, 0. 415 pgs. laghukomudii... 0000, Linguistics Literature. Sanskrit, 0. 147 pgs. laghumaanasamuu... Gangadhar Bapurao Kale, Philosophy. Psychology. Sanskrit, 1944. 40 pgs. laghupaaniiyamu... Rajaraja Varma, Sanskrit Grammer. Sanskrit, 1911. 228 pgs. laghupaaraasharii bhaashhya... diivaana raamachandar kapuura, Religion. Theology. Sanskrit, 0. 396 pgs. laghusabendusekjara... nagojibhatta, Language. Linguistics. Literature. Sanskrit, 1927. 846 pgs. laghushabdedndushekhara vyaakarand-avibhaage saptadasan'pushhpamu napadaantasuutraanto bhaaga... mahaamahopaadhyaayashriinaageshabhat't'a, Language. Linguistics. Literature. Sanskrit, 0. 264 pgs. laghushabdendukalaa... pand-d'ita shrii shobhaakaanta jhaa, Religion. Theology. Sanskrit, 1970. 144 pgs. laghushabdendusekhara... khuhiijhaa, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1938. 264 pgs. laghushabdondushokhanamulapuvedhve... , . Sanskrit, 0. 163 pgs. laghushabdondushokhanamulapuvedhve dvitiyo bhaagaha... , . Sanskrit, 0. 163 pgs. laghusiddaantakomudii... Kaushika Venkatanarasimhachari, Linguistics Literature. Sanskrit, 1937. 186 pgs. laghusiddanta kaumudi... varda raja, Language. Linguistics. Literature. Sanskrit, 1948. 180 pgs. laghusiddhaantakaumudii anuvrxttyaadisuuchakena t'ippand-ena pratyaahaara varnd-avyavahaaragnaapaka koshht'akau... shriivaradaraajapand-d'ita, Language. Linguistics. Literature. Sanskrit, 1894. 176 pgs. laghusiddhaantakaumudii san'skrxta hindiit'iikaa... shriivaradaraajaachaarya, Language. Linguistics. Literature. Sanskrit, 1970. 382 pgs. laghusiddhaantakaumuditattvaprakaasha sottaraa prashnaavali 20 varshhaand-aan' prashnapatrasahita... pand-d'itashriiraamagovindashukla, Language. Linguistics. Literature. Sanskrit, 1974. 248 pgs. laghustuti... t'i gand-apati saastri, Language. Linguistics. Literature. Sanskrit, 1917. 63 pgs. lalitamaadhavan' naat'akamu t'ikayaa... shriiruupagoosvaamiprabhupaada, Language. Linguistics. Literature. Sanskrit, 1969. 310 pgs. lalleishvariivaakyaani... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 36 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

laqs-and-aavimashe... V. Subrahmanya Sastri, Philosophy. Psychology. Sanskrit, 0. 32 pgs.

121/167

2/14/2011 A Sastri, list of scanned Sanskrit books at III… laqs and aavimashe... V. Subrahmanya Philosophy. Psychology. Sanskrit, 0. 32 pgs.

laqs-miisahasramu... Not available, Religion. Theology. Sanskrit, 0. 813 pgs. laqs-miitantramu... vi. krishhnd-amaachaarya, Language. Linguistics. Literature. Sanskrit, 1959. 389 pgs. laqs-miitantramuu volume 87... pan'dita vi krxshhnd-amaachaarya, Language. Linguistics. Literature. Sanskrit, 1959. 391 pgs. lat'akamelakamu... shriishadgadhara, Language. Linguistics. Literature. Sanskrit, 1900. 36 pgs. laugaaqs-i grxhya suutraand-i bhaashhyopetaani dvitiiyobhaaga uttaraarthamu... devapaala, Language. Linguistics. Literature. Sanskrit, 1937. 460 pgs. laugaaqs-i grxhya suutraand-i devapaalakrxtabhaashhyopetaani Vol 2... Madhusudan Kaul Shastri, Language. Linguistics. Literature. Sanskrit, 1934. 448 pgs. laukikanyaayaanj-jali dvitiiyobhaaga... colonel g a jacob, Language. Linguistics. Literature. Sanskrit, 1925. 94 pgs. laukikanyaayaanj-jali trxtiiyobhaaga... colonel g a jacob, Language. Linguistics. Literature. Sanskrit, 1911. 158 pgs. lectures on patanjali s mahabhasya vol I... subrmanya sastry p s, Language. Linguistics. Literature. Sanskrit, 1944. 384 pgs. life divine... aurobindo, Language. Linguistics. Literature. Sanskrit, 1942. 160 pgs. liilaavatii uttaraardharuupo dvitiiyobhaaga... shriimadbhaaskaraachaarya, Language. Linguistics. Literature. Sanskrit, 1937. 180 pgs. ling-ganushaasanamam... Panini, Philosophy. Psychology. Sanskrit, 1885. 192 pgs. ling-kapuraand-amuu... mahaarshhi vedavyaasa, Religion. Theology. Sanskrit, 1885. 848 pgs. list'as aaph manuscript's... Not Available, General. Sanskrit, 1925. 106 pgs. lokaparalokakaasudhaara bhaaga 2... hanumaana prasaada, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 0. 244 pgs. lokaparalokakaasudhaara bhaaga 4... hanumaana prasaada, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 0. 288 pgs. lokikanyaayaatralin' tutiyo bhaagan... jaakobha, Language. Linguistics. Literature. Sanskrit, 1904. 169 pgs. maadava vijaya... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 457 pgs. maadhamaahaatmaya... , Religion. Theology. Sanskrit, 0. 134 pgs. maadhavanala kaamakn'dalaa... shriikrxshhnd-adaasaatmaja, Language. Linguistics. Literature. Sanskrit, 1889. 214 pgs. maadhaviiyaa dhaatuvrxtti paand-iniiyadhaatupaat'havyaakhyaanaatmikaa... shriisaayand-aachaarya, Language. Linguistics. Literature. Sanskrit, 1964. 720 pgs. maadhurii darshanamu... raayaproolu subbaaraavu, Language. Linguistics. Literature. Sanskrit, 0. 69 pgs. maadhvamukhabhad'ga... Sri Surya Narayana Shyam Sukhla, Philosophy. Psychology. Sanskrit, 0. 48 pgs. maal'avikaan'gnimitramu naamanaat'akamu... shriimatkavikulashiromand-inaa shriikaal'idaasamahaakavi, Language. Linguistics. Literature. Sanskrit, 1892. 282 pgs. maalatiimaadhavan' prakarand-amu vyaakhyaaya... mahaakavishriibhavabhuuti, Language. Linguistics. Literature. Sanskrit, 1864. 500 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 122/167

2/14/2011

A list of scanned Sanskrit books at III…

maalatiimaadhavan' prakarand-amu vyaakhyaaya... mahaakavishriibhavabhuuti, Language. Linguistics. Literature. Sanskrit, 1864. 310 pgs. maanameyarahasyalokavaatvikamu... Srinivasa Charya. L, Sanskit Sastras. Sanskrit, 1925. 672 pgs. maanameyoodaya... t'i. ganapati saastri, Language. Linguistics. Literature. Sanskrit, 1912. 133 pgs. maanasaprachaarikaa... Not available, Language. Linguistics. Literature. Sanskrit, 1885. 156 pgs. maanava dharma saara... Not Available, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1943. 285 pgs. maand-d'uukyaadhupanishhatrayii... pn'. raamadevaachaaye, RELIGION. THEOLOGY. Sanskrit, 0. 474 pgs. maatukaabhedatantramu... Pandit Amareswar Thakur, Lord Hanuman. Sanskrit, 1933. 153 pgs. maayaavaadakhan'd'anamu... Srimadananda Theertha, Art. Sanskrit, 1875. 165 pgs. madanapaamnidhant... krishna das, Technology. Sanskrit, 1954. 192 pgs. madanapaamnidhant... krishna das, Technology. Sanskrit, 1954. 328 pgs. maddhvamukhaalankaara... Vanamali Misra, Philosophy. Psychology. Sanskrit, 1936. 148 pgs. madhthasida ntakaumudii... prabhaakara, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1939. 693 pgs. madhuraan'jali... G.ramacharya, Literature. Sanskrit, 1996. 346 pgs. madhusuudanasarasvati kruti advatasiddhi... Sri Harihara Sastri, Philosophy. Psychology. Sanskrit, 1893. 344 pgs. madhuvidhyaa shriivishvakarmapaaramyaparend-a sauparnd-ena vyaakhyaanena samaalin'gitaa... durishet'i ven'kat'araamaachaarya, Language. Linguistics. Literature. Sanskrit, 0. 70 pgs. madhvanidanmu... shrii sudarshan sharma, Technology. Sanskrit, 0. 530 pgs. madhvasiddaan'tasaarasan'grahada vishhanurxmand-ii... Not available, Language. Linguistics. Literature. Sanskrit, 0. 253 pgs. madhvatantramukhamadarnamu... shriimadappayadiiqs-ita, Language. Linguistics. Literature. Sanskrit, 1940. 156 pgs. madhyakaaliina san'skrxta naat'aka... raamjii upaadhyaaya, Language. Linguistics. Literature. Sanskrit, 1974. 516 pgs. madhyamavyayoga... bhasa, Language. Linguistics. Literature. Sanskrit, 1948. 56 pgs. madhyasiddhaantakaumudii... shriimadvaradaraaja, Religion. Theology. Sanskrit, 1906. 312 pgs. madyakalin sanskrit natak... ramji upadya, Language. Linguistics. Literature. Sanskrit, 0. 522 pgs. mahaaban'dho... Sripati Sharada Misra, Literature. Sanskrit, 2001. 493 pgs. mahaabhaarata aranyakaparvam bhaaga 4... vishnu s sukthankar, Language. Linguistics. Literature. Sanskrit, 1942. 610 pgs. mahaabhaarata sabhaaparvamu gn-aanadiipikaa... shriidevabodha, Religion. Theology. Sanskrit, 1949. 55 pgs. mahaabhaarata san'skrxta muula hindii anuvaada... Not available, Religion. Theology. Sanskrit, 0. 1282 pgs. mahaabhaaratama~ shaantipar^vand-i Part I... P. P. Subramanya Sastri, Language. Linguistics. Literature. Sanskrit, 1935. 690 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

h

bh

hh

k

j hik

d

bh

d d' l

t

t'h

d'hii

i

i

d

123/167

. 1968.. Language. mantraratna manjushhaa. . Linguistics. shrii vii svaaminaathana. Literature. 112 pgs. Not available... V.. Language. Sanskrit. Linguistics. Language. Linguistics. 1970. Literature. Language. mantraayechandodaya. 442 pgs. vi.. 795 pgs. Literature. 1965. .. Linguistics... Language. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… mahaabhaashhyakunj-chikaa darabhang-gaamand-d'alaantargara t'haad'hii graamanivaasinaa. manusambhava. Language.. shriidaqs-ind-aamuurti. Literature.. 190 pgs. 151 pgs. Literature. Not available. Literature... 575 pgs. manu. maitraayand-iiyamaanavagrxhyasuutarman. vyasa.. Sanskrit.. Literature. king someswara. 1066 pgs. Language. shrii raajanaaraayand-a shaastri. Language. 302 pgs... mahaavidhyaavid'ambanamu t'ikaabhyaan' dashashlokii vivarand-a t'ippand-i.. Sanskrit. manmahaabhaaratamu bhiishhmaparva 6. Sanskrit. t'ii aara krxshhnd-achaarya. ke. malayamaarutan' dhvitiyan' spandan. Sanskrit. Linguistics. 166 pgs. mahadeva. mahinmastotramu madhusuudanii vyaakhyaa trxtiiyan' san'skarand-amu. 50 pgs. 330 pgs. Sanskrit. goopiinaatha. mahaaviiracharitamu. Spiritual Experience And Mysticism. 0. mahabharat sahitha pradma kand. Sanskrit. Sanskrit. 0. Literature. 1982. 1941. Sanskrit. baladeva upaadhyaaya. Sanskrit. 1971. Linguistics. Sanskrit. 48 pgs. Linguistics. mand-isaara anumaanakhand-d'a. 1971. 1964.. Linguistics. 163 pgs. Ramakrishna Harshaji Sastri. 1891. 110 pgs. malavikamitra naatakamu. manasollasa vol Iii. 170 pgs.. mantramahaidadhigrandhahaa.. 310 pgs... 894 pgs.. Language. 0. 1914. manu smruti. Sanskrit. Language. shrimadhusuudanasarasvatii. . 1961. Sanskrit.. 190 pgs. Theology. 173 pgs. 1926. 0.. mantroddhaarakosha saubhaagya tantrashcha. Literature. mahaabhaashhyat'iikaa chaturthaanhikaparyantaa bhaaga 1..... Sanskrit. Linguistics. Sanskrit. 0. Sanskrit. Language. Literature. Language. 482 pgs.. 1920. Literature. Damodar Jha.. mahaaradha padakooshaa. Literature.. Linguistics. Literature. 554 pgs. Linguistics. mahaapuraand-apanachamapathalakaand'aa.. Linguistics. Linguistics. Language. Literature..org/…/SanskritIIIT.... manoramaashabdaratna praqs-aittaraava liipradhamakhand-d'an. Sanskrit. Not available. 0. Linguistics.. bhat't'avaadiindra. sheishhasharma. mal'aya maaruta part Ii. 790 pgs. mahaakavibhaasa eka adhyayana. 1928. Somraj Krishna Das. sanskritdocuments. Sanskrit. Linguistics. 248 pgs. mand-d'ala braahmand-opanishhatuu. Religion. maharastriya gyan kosh sharir khand. Literature.… i t N t il bl L Li i ti Lit t S k it 0 350 124/167 . Language. Linguistics. Sanskrit. Language. Sanskrit.. 0. 1926. General.. majamuuaajaabtaa phaujadaarii. Language. Sanskrit.... Theology. . 301 pgs. 1896.. mahaakaavyaa ratnaavalii. raaghavan. Literature. Linguistics. Literature. Linguistics.. 202 pgs. Language. 50 pgs. shriibhavabhuti.. Language. Linguistics.raghavan. Literature.. Language. Linguistics. Sanskrit. Sanskrit. Linguistics. Literature. Literature. 0. pandd'itashriiharishang-karatbhaasharmand-aa. mahaabhaashhyamuu. 1901. 1971. Pandit.... Sanskrit. 804 pgs.. Sanskrit. RELIGION. 1828. THEOLOGY. Religion.. Sanskrit. Literature.. Language. trivikramabhat't'aaraka. 1979.. Language. 456 pgs. sridhar venkatesh kethkar. -. Sanskrit..

miimaan'saakoshha Part 3. LANGUAGE. 1021 pgs. Language. Religion. Sanskrit... 214 pgs. Philosophy. . Sanskrit. Language. Language. Literature.. Language.. Theology. 1914. Sanskrit. Theology... Linguistics. gan'ganatha jaha. 1898. Language. 96 pgs. Literature. shriishang-karabhat't'a. General. LINGUISTICS.. 210 pgs. Religion. 238 pgs. 1948.... 551 pgs. kevalaanandasarasvati. mimaan'saanukramand-ikaa. 1831. LANGUAGE.... mevad'a patana..… 125/167 . mimaan'saanukramand-ika. manusmuuti Vol I. Sanskrit. manuscripts. Sanskrit. 0. Language. shriikrxshhnd-adaasaatmaja... kalidasa. Literature. 90 pgs. Sanskrit... miimaan'saanyaayaprakaasha saaravivechinyaakhyaayaa. Tatacharya.. Sanskrit. Language. LITERATURE. maraat'i gran'thaan'chii bayaajavaara yaadi bhaaga nowlaa. 1934. LANGUAGE. 1930. 645 pgs. Not available. 0. Linguistics. Language. aapadeva. miimaan'saakoshha Part IV. 1898. Literature.. 1953.. Halayudha. Literature.. Linguistics. 405 pgs.. Language.. 142 pgs. miimaan'saashlokavaartikamu nyaayaratnaakaraaravyayaa vyaakhyayaa. Literature. LITERATURE.. LINGUISTICS. Language. Linguistics. Sanskrit. Language. Literature. Linguistics. 1909.. 531 pgs. 0. 541 pgs. Sanskrit.t. miimaan'saashlokavaartikama. shriimadaapadeva. shriimadaapadeva. 1930.. 1925. shriimatkrxmaarilabhat't'a. sanskritdocuments. Sanskrit. 216 pgs. Psychology. Linguistics.. miimaan'saanyaayaprakaasha saaravivechinyaakhyaayaa. Linguistics. Ganganatha Jha. Linguistics. Sanskrit. Malkuluka Bhatta. LITERATURE.2/14/2011 A list of scanned Sanskrit books at III… manuscripts. Sanskrit. Sanskrit. sabhara bhaasya.d.. not available.. Linguistics.org/…/SanskritIIIT. Sanskrit. LANGUAGE. kevalaanandasarasvatii.. Sanskrit. LITERATURE.. Sanskrit. Literature. miimam'saashaastrasavasve. miimaan'saadarshanamuu. 1980. 120 pgs.. LANGUAGE. Sanskrit.. manusmrxte. . Linguistics.. LINGUISTICS. Linguistics. 539 pgs.. 502 pgs.. mimaan'saamand-d'anena mand-id'ataa.. Literature. miimaan'saanyaayaprakaasha aapodevii. miimaan'saaprakarand-agrantha miimaan'saanyaayaprakaasha t'ippand-yaadisamalan'krxta. 1954. Sanskrit. 1943. 1948. Sanskrit. Not available. 0. Language. LITERATURE. Linguistics. 0. Sanskrit. 613 pgs.... 570 pgs. 1940. 48 pgs. 1956. Not available. LANGUAGE. manusmaruthihi. mimaan'sha darshanam pada I.. gan'ganatha. LINGUISTICS. Sanskrit. 427 pgs. miimaan'saakoshha Part II. LITERATURE. 0. LITERATURE. Literature. Language. Literature. miimaan'saadarshani. 536 pgs. Literature. 246 pgs. Sanskrit. 740 pgs. 1961.. Sanskrit.. 1928.. Literature. meghasandesa...... mandana mishra.. LINGUISTICS... LINGUISTICS. miimaan'saabhyudayan. 350 pgs. LINGUISTICS. Sanskrit. aapadeva. shrimajjaimini. 238 pgs. 554 pgs. 1948. 638 pgs. Sanskrit. kevalaanandasarasvatii.. Literature.. LANGUAGE.. manusmrxtivishhayaanukramand-ikaa. Philosophy. Sanskrit. 1940. kevalaanandasarasvatii. 86 pgs. Linguistics. miimaan'sasaarasang-graha. Language. Linguistics. raamachandra. 1932. Literature. Sanskrit. shriimatkumaarilabhat't'apaada. Sanskrit. mediniikosha.

Language. Sanskrit. Linguistics. swami satchidanandendra saraswati. Literature. Language.. Sanskrit. -.. Sanskrit. Sanskrit. naa mahaaraashht'ra yaatra. General. Theology. Sanskrit. Sanskrit. Linguistics. Language. mitaaqs-araat'iikaayaa. 382 pgs. Linguistics. 1918. 30 pgs. Visakadatta. subramanyasharmand-a.v. Language. mundaka upanishad. 453 pgs. Literature. Sanskrit.. 1943. Mimamsa Shastram. Literature. na ii hindii rachana pahalaa bhaaga. Literature.. Not available. Linguistics. mudraraksasa. 1962.. 580 pgs.. 390 pgs. 1975.. Language.. 278 pgs. 107 pgs. Literature. shriiraamaachaarya. 128 pgs. Linguistics. Literature. Language. muulaavidyaniraasa.. 1986. Literature. Literature. Sanskrit.. 0. not available. 1882. 84 pgs. Sanskrit. mulaavidhaa bhaashhyavaartikavirudva. LITERATURE. 490 pgs. Not available. 1882. Language. Literature.. . mugendraagaman. 1925. muuhuurtamaartan'd'a maartad'avallabhaaravyavyaakhyaasahita. mruchhakatikamu.. Sanskrit. 82 pgs. shriikaashipati. muhurta chintaamand-i.. Literature. Not Available.. Sanskrit.… 126/167 . LINGUISTICS.. N R Bhatt.. Sri Gadadara Battacharya. Linguistics. Religion. mishrabandhuvinoda bhaaga 1. Literature. 466 pgs. 1948.. Sanskrit. naaraayand-araam aachaarya. 2000.. sanskritdocuments. LITERATURE. Sanskrit. Not available. mrxgendragam. LINGUISTICS. mukttipradiipa. bhatta naaraayand-akaant'a.. Literature. Sanskrit. Sanskrit. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… miman'sadarshanei. mukundaanandabhaand-an.. 1894. ke e krxshhnd-asvaani ayyara. Sanskrit.. 1999.. Sanskrit. mitralaab. Linguistics. 320 pgs. Language. 1937. 0. Language. Not Available. Julius Jolly. 798 pgs..rangaswami. LANGUAGE. Language.. 1961. Literature. 130 pgs. mnut'iikaasad'gahan. Sanskrit... muulavidayaa niraasa.. mudrakshasa. 380 pgs. muchchhakat'ikan. Sanskrit. 382 pgs. LANGUAGE. shrudrakavi... Language. ramnaraya lal beni madhav.. Sanskrit. Linguistics. 394 pgs. mudraaraaqs-ase pradhamo kand'khaha. Astrology. 0... 1970... 146 pgs. muhutairatnamu. 1962. Linguistics. Language. Sanskrit. Language. mumuksu savasvaasaraa sangrahaa. 0... 336 pgs. General. LANGUAGE.. . 1904. Sanskrit. Linguistics. Kastnath Trimbak Telano.. 386 pgs.. Not Available. Sripada Bhat. Visadhadatta. Sanskrit. 433 pgs.... visakhadatta.. Literature. Language.. 1970. 0. 228 pgs. 1893. 274 pgs. Sanskrit. Language. mulagadaadhariyo shabdakhand-d'an. Not Available. mishrabandhuvinoda bhaaga 3. Linguistics. Linguistics.org/…/SanskritIIIT... mudraaraaqs-ase. LITERATURE. Sanskrit..... muhuurtachintaamand-i pramitaaqs-araat'iikaasameta. K. Language. LINGUISTICS. 433 pgs. saahityabhuushhand-a shriijonnalagad'd'a satyanaaraayand-amuurti. Linguistics. Linguistics.. 1850. Linguistics..a. Language. Literature. Linguistics. varashudrakaraaja.. Sanskrit. Literature. Language. 1945... Linguistics.. 0. Literature. 0... Sanskrit. Linguistics. moqs-akaand-d'amu chatudaisho bhaagan. Literature. Literature. 501 pgs. Linguistics Literature. 330 pgs. 138 pgs.. 1918.. mrxchchhakat'ikei. Sanskrit. 156 pgs.

Sanskrit. naaraayand-iiyan. Sanskrit. Literature. 1929. 0. 0.. Literature. 1962. 724 pgs. -. narasin'gapuraand-amu. nalacharitranaat'akamu. 0. Linguistics. Linguistics. Linguistics. Language.. Sanskrit. naanaartharnd-avasan'qs-eipa. Sanskrit. 1956. Literature.. 84 pgs. 0. shriimadvedavyaasa.. naishhadhakaavya. 1913. Language. Sanskrit. narapatijayacharyaasvarodaya jayalaqs-miit'iikaasameta.. naat'yadarpeind-amuu volume 1. Literature. narakasuravijaya vyayoga. Literature... shriimachchhiromand-isudhii. Linguistics. Linguistics.krishna Das. Sanskrit. venkataramaniah. 380 pgs. 184 pgs. Language. Literature. Language. kheimaraaja shriikrxshhnd-adaasane. naat'uuyadarpand-amu prathamoo bhaaga. Linguistics. vyasa.org/…/SanskritIIIT. nalopakhyanam. naishkarmya siddhi. 270 pgs.. shri suresvaracarya... Sanskrit.. sri bharatamuni. Linguistics. Language. amarasimhudu.. Literature. Sanskrit. Literature. Linguistics... Language. Literature. ta gand-apatishaastrii. Sanskrit. 396 pgs... Sanskrit. shriimannarapatikavi. bharatamuni. navagiitaakusumaanj-jali. naageshaashayanind-aiyan' pradhamo skandhahan. Language. 1940.. K. Literature.. Religion. 90 pgs. Linguistics. baabulaal shukla. 1951. sanskritdocuments. Literature. 0. Linguistics. The Arts. dharmasuri... Literature. Sanskrit. 1903. 1927. Literature.. Linguistics. Sanskrit. 216 pgs. Literature. 1956. Geography. Literature. Narayana Sastrigal.. raamachandra. Language. 265 pgs. Language. Sanskrit. . Sanskrit. 2005. 676 pgs. Sanskrit. Sanskrit. Language. raamachandra.. Literature. Literature. 518 pgs..… 127/167 .. Sanskrit. naushada charitam. Sanskrit. Literature.. 1932.. Language. Literature. 204 pgs.. Linguistics.. 612 pgs. Language. Language. naishhadhakaavyam vyaakhyayaa sameitam.. nanj-avaada nanj-avaadasan'gn-akayinaddigajatna t'ikayaa.. naaradhiya mahaapuraand-amu. nandisuttram. Sanskrit.. 1964. Linguistics. -. Language... natyasastra. Sanskrit. 1929. naatyashaastram. Theology. Language.. naishhakarmya sidhdhi. History. 135 pgs. Sankara Rama Sastri C. Biography. Language.. Language. 1912.. 0. c. nalooparavyaanamuu. mahaakavi shriiharshha. naat'yashaastramu vivrxtisametamu bhaaga 1. Sanskrit. Linguistics. Linguistics.. 0.. 54 pgs. Literature. naasikeita paakhyaanamu. The Arts. 242 pgs.. 252 pgs. 1954. Sanskrit. Linguistics. 267 pgs. bharata.. 366 pgs. namalinga sasanam.. Linguistics. Linguistics. 1817. Literature. 550 pgs. 77 pgs. 1966. Language.. 1925.. natyasastra with the commentary of abhinavagupta vol-iii. 460 pgs. 292 pgs. Sanskrit.. 18 pgs. naaraayand-abhat't'a. m.. Linguistics. nagananda. Sanskrit.. 254 pgs.. Linguistics. -. Sanskrit.. 1911. 1506 pgs... Not available. naaradapancharaatran. Literature. Sanskrit. Linguistics. 1899. Linguistics. Sanskrit. 1961. 274 pgs.2/14/2011 A list of scanned Sanskrit books at III… Language. 350 pgs. Language.. naat'akachandrikaa. Sanskrit.. Language. 1943. Linguistics. Literature. Language..ramakrishna kavi. 220 pgs. Literature. 584 pgs. Literature. Sanskrit. Linguistics. 1965. shri devavaccaka... chan'drika. Sanskrit. Language. Literature.. Language..

LINGUISTICS. Narasimha Vajapeyin. niruttk bhaashhyat'iikaa... nagesha bhatta. Linguistics.. Linguistics. Language. 625 pgs. 76 pgs. . Sanskrit... raamanaathashaastri. Sanskrit. Theology. Language. kuu.. Vasudeva Sarma. Literature. niruktan' nighand-t'upaat'hasamupetan' dvitiiyobhaaga. Sanskrit. Sanskrit. vaagbhatta. Literature. Literature.. 1940. Sanskrit. niilakand-t'havijayan.. Sanskrit. Literature. 1972. Sanskrit. Mahamuni Vyasakcharya. Language. nrxgamooqs-aprabandha.. niyatakaalakaand-d'amu trutiyo bhaagan.. Literature. Linguistics. Natural Sciences. Sanskrit. 1955. 133 pgs. Linguistics Literature. Thallahtanath Pandit. Literature. 286 pgs. Social Sciences. A. Literature. 1912. Language. 1951. Philosophy.. 649 pgs. 456 pgs. Sanskrit. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… nayaayaamrutamu dhvitiyo bhaagan. 545 pgs. 179 pgs. Sanskrit. Language. nipaataavyayopasagaivuttin. Linguistics. Philosophy. 140 pgs. 283 pgs. Linguistics. shriimadhyaarakaachaarya. nityaachaaradapaind-an. Sanskrit. Literature. Sanskrit. P V Ramanujaswami. Social Sciences. 127 pgs. Linguistics. nityaachaarapradopan. swetaranyam narayana sastriar. Psychology. A.… 128/167 .. ng-aapakaasan'grahamuu. 1927. Psychology. K. Linguistics. 1941. nir^nd-ayasindhau. Sanskrit. 768 pgs. Language. nir^nd-ayaamrxtamam. T.. sanskritdocuments. Literature.. shrii kamlakar bhatt.. 365 pgs. 1967. 1950. shriimanmaharshhivarayaaskiiya.. Linguistics. Sanskrit. Linguistics. 86 pgs.v.. Sanskrit. Religion. 246 pgs. 1926. 1940.. Theology.. 1949. 1941. Sanskrit. Krishnacharya. Sanskrit. 1926. nayadviveka. Psychology..... Language. 1930. 1936. 158 pgs.. se . Sanskrit. 248 pgs.. 482 pgs.. 1956.. 1942. 85 pgs.. Literature. nityaachaarapradiipa Part I. Narasimha Vijapeyt Vol Ii.. Philosophy. 226 pgs.... Sanskrit. Sanskrit. Language. nayamanjarii. 1937.. niitimaalaa. 0. nayadhyumand-i... LITERATURE.. 1925. 480 pgs. Narayanarya. Philosophy... Language. neetisataka.. Language. Linguistics. nayaviveka. Literature. Sanskrit. Literature.. Literature. . Sanskrit. 1907. niitimayuukha. Bhavanatha Misra. nityotsavan.. Psychology... 174 pgs. Linguistics. 321 pgs. Brahmanandaji. naaraayana bhat't'aa. Literature. nayaayakusumajjalii. Language. Sanskrit..... C. niitipaat'han.viraraghavacharya.. Mahesvara. 68 pgs. 1937. Religion. nayaviveika.org/…/SanskritIIIT. nidraa vign-aana kyon' kahaan' kaise aura kaba sonaa chaahiye. Bhatta Nilakantha. Language.. 746 pgs..mahadeva Sastri. pan' prabhunaaraayand-a tripaat'hii sushiila. 166 pgs. neiminirvaana. Sanskrit. meighanaadaarisuuri. 1951.. Linguistics. jvaalaapraasaada mishra. Sanskrit. nipaataavyayopasagraivuttin' t'ilaka. Linguistics..rangaswami. 768 pgs. Social Sciences. Language.t. Srimad Appaya Diksita. 76 pgs. niruttkalaghuvivrxti panj-chapaadikaa. Literature. Sanskrit. 1928. LANGUAGE. Literature. nirnayasindu. 320 pgs. 86 pgs... 330 pgs. Sanskrit. Social Sciences. 1967..r. Literature.. Someswara Sarma. Sanskrit. niruttkmn.. 1951... 1827. Sanskrit. Language.. Sanskrit. 1918.. nirnayasin'd'hu. bhaavanaatha mishraa.. Linguistics. 1908. Pandith Priyanath Vidyabhushan.shankara Rama Sastri. 0. 91 pgs.. Sanskrit. 1937.. Linguistics Literature. nayachandrikaa praaramyate.

Linguistics. Not available. nyaayakulishamu. nyaayakalaapasan'graha. lakqs-mand-aachaaryand-a.. Not available. 1937. 1941. chidaghanaanandagiri. Sanskrit. shrii vallabhaachaarya. 1940. 0. gautama.. K.. Sanskrit. Philosophy. Sanskrit.. 168 pgs. LITERATURE. 0. Philosophy. 68 pgs. 0000. Literature.2/14/2011 A list of scanned Sanskrit books at III… nrxtta san'grng-aha.. nyaayaratnaakarakhyaavyaakhyaasahite shlokavaartike.org/…/SanskritIIIT. 1924. 1934. Language. Psychology.. Linguistics. Sanskrit. Sanskrit. Sanskrit. Language. Religion.. 432 pgs. nyaayaashiddhaajnaamuu. Linguistics. Literature. Nyayasar. Religion. 1970... Literature. Philosophy. Philosophy. 0.. Literature. Sanskrit. LANGUAGE.. nyaayarakqs-aamand-i. Sanskrit. Parthasarathi Misra. 622 pgs.. Sanskrit. 379 pgs. 1962. Philosophy. 204 pgs. Sanskrit. nyaayaratnamala. Philosophy. 0. Sanskrit. T. 426 pgs. Language. Viraraghavacharya. Sri Kamakshi Amma. Linguistics.. Sanskrit. nyaayabhaashhyavaarttikataapyarya vivarand-apanj-jikaa 2 5. Athreya Ramanuya.. Psychology. nyaayaboodhini baakyavrxtti. Sanskrit. 0. Saktism. Not available. 0. 118 pgs. Sanskrit.. 444 pgs. nyaayabodhinii vaakyavrxtti nirukti. nyaayaliilaavati.. Literature. nyaaya parishuddii. 299 pgs. Sanskrit. 1915. Sri Senesvaracharya.. Linguistics. Theology. Literature.. paarthasaarathimishraa.sambashiva Sastri. nyaayaparishudin. 1941. Philosophy. 0.... Literature.. 315 pgs. 432 pgs. Sanskrit. Psychology. Chandrashekhar Shastri. Psychology. . 1956. Sanskrit. Sanskrit. 90 pgs. nyaayadarshanamu bhaashhya vrxttisahitamu. Sanskrit. Language... Philosophy. Sri Appayah Dikshita. nyaaya jaagadiishiivyadhikarand-amu. 1918. Venkatanath Sri Vedantacharya. ti . nyaayadarshana suutras bhasya. nyaayaprakaasha nyaayashaastra. 218 pgs. Literature. nyaayakulishamuu. 1931. 222 pgs. pat't'aabhiraama. Literature. Linguistics. 1919. Linguistics. nyaayasaara shrii bhaasar^vagn-aprand-iita.. Satyapramotheertha sripada. 1938..… nyaayasudhaamand-d'anamu. Literature.. LINGUISTICS.. nyaayakaalaapasang-agraha. 96 pgs. Sanskrit. Sanskrit... nyaayabindu qs-idhamakiirti prand-iita... sanskritdocuments. nuutanadhrmmaniyamasya. Religion.. Sanskrit. anuruddhaachaarya. viiraraaghavachaayaund-a. nyaayabodhinii niilakan't'hiiya vishhauamaalaa. 94 pgs. nyaayanibandhaavalii.. Linguistics.. Psychology.. Linguistics... si. 592 pgs. Psychology.. 363 129/167 . Language. Sanskrit. 291 pgs. 1925. Language. Sanskrit. Sanskrit. Philosophy.. 421 pgs. Psychology. Sanskrit.. Sanskrit. 1953. 461 pgs.. Atreya Ramanuja. Theology. 350 pgs.. Language. Theology. Theology. 178 pgs.. 298 pgs.. 1938.. Psychology. 426 pgs. Viraraghavacharya.. Psychology. Language. Linguistics.. 1941. 1010 pgs. Linguistics. shriiseneshvaraaryai. vaatsayaayanamuni.. Philosophy. 1969... 1937. 534 pgs. Psychology.. d'aa priyabaala shhaa. nyaayakusumaanj-jali Vol 1. nyaayaratnamaala. 91 pgs. Language. Religion.. T. nyaaya muktaavali raaghavendra yati. . nyaayakusumaanj-jali Vol I.. Sanskrit. Not Available. Sanskrit. 524 pgs.. shekhara. nyaayakusumaanj-jali Part 2... 1923. Sanskrit. 1912. Literature. Language... 1935.. Language. Dwaita Philosophy.

. 258 pgs. saishasrikrishna. Sri Sadasiva. 538 pgs. 1992. Not available. Philosophy.. Sri Mad Ramakrishna. 1902. Sanskrit. pajjadashii. Sanskrit. 568 pgs. 1944. 487 pgs. paarabhaashondradipikaa. 342 pgs.. sanskritdocuments.. 88 pgs. Linguistics.. 56 pgs. 324 pgs. 64 pgs. Sanskrit. 1894. Sanskrit. 1926. Sanskrit. Rama Murti. Philosophy. nyaayatatvaalokan. 1983. shriibaand-abhat't'a.. Sanskrit. Literature. Psychology. 1962... 654 pgs... 38 pgs. vishhnd-u sharma. Language.. Ramakrishna.. Linguistics. Sanskrit. 60 pgs. Linguistics. panchasiddaantikaa.. Linguistics. Literature. padmapuraand-amu tatraadimamaadikhand-d'an' dvitiiyan' bhuumikhand-d'an' chetyetaddvayaruupa prathamabhaaga..s. Sanskrit. paat'hakamukhavispot'akamu. Linguistics. paaia sadda mahand-nd-aavo praakrxta shabdamahaarnd-ava. depatment of pali. 1953. 1818.r.. 77 pgs. kurugand-t'i suryanaaraayand-ashaastri. bhimacharya jhalakikar. Sanskrit. 118 pgs. 1946. Geography.. Literature. trinaatha sharma.. pachchatantrakamuu. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Linguistics. Linguistics.. Linguistics Literature. Language. Psychology... paand-iniiyavyaakarand-ebhinavavaarttikaani. Sanskrit.. 0. mahaamunishriimadvyaasa. Literature. Language. Sanskrit. panchaman' pushhyamu. 0. 1918. paaribhaashhikapadaaryasan'graha. nyayakhosh. 716 pgs. 338 pgs. Philosophy. pandit durgaprasaada. LINGUISTICS. Language. Natural Sciences. Dwaita Sanskrit. 172 pgs. 364 pgs.. Literature.. pan'chaprakriyaa. Biography. 0. paarijaatahrnacampa. 1941. 390 pgs. Vamana Daji Oka.k. nyaayasudhaamand-d'anamuu.. Literature. Sanskrit Grammer. Psychology. 1104 pgs. 1930. varaaha mihiraa. khemaraaja shriikrxshhnd-adaasa. Literature. pancharatnakaarikaa. 1200 pgs.org/…/SanskritIIIT.. Linguistics.. Literature. 1874. Literature....u. Sri Koliyalam Swami. Language. 1939.. Literature. Philosophy. Sanskrit. 1973. Literature. Language. Literature. paat'hashodhanamuu. Sanskrit. Literature.... Philosophy. Language. Linguistics.. Sanskrit. 1893.. 0. paavaitiiparind-ayamu.... Sanskrit. Linguistics. Language. 1972. Vidyasekharalu. pan'chaadashi bai vidyaarand-ya. Language. at III… nyaayasudhaamand d anamu. Language.. Sanskrit. Linguistics.... Psychology. panchadashii. panchadashagiitaa. padasan'grahan' bhaaga pahilaa. Language. LANGUAGE.. Sanskrit. 1900. panchatantramu 1.. 54 pgs. pan'chamapushhpamu shriiguruchartrikaavyan' shriidattachan'puu sat'iikaa.. paarijaataharand-achampu. LITERATURE... Linguistics. 408 pgs... 1953. Sanskrit. Language.… 130/167 . 1896. ruupalaala kapuur. not availabe.. 175 pgs. palitipitakasassanukkamanika part 2.. Literature. 204 pgs. History. Sanskrit.. Satyapramotheertha sripada. 1889. paadukaapat't'aabhishhokamu. Sanskrit. 0. 144 pgs. 579 pgs. T.. Language. 0. shriivaasudevaanandasarasvatiit'embesvaami. Chintamani. Literature. Not available. Linguistics.. Sanskrit. kielhorna. Sanskrit. Psychology.. . Language. 363 pgs. Vacant. 1954.. Literature. 64 pgs.. Linguistics. Language. paarijaataharanachampu. Kishore Nath Bha. Linguistics. Sanskrit. Sanskrit.. vishvabhandhu. Literature.2/14/2011 A list of scanned Sanskrit books Philosophy.

shivadatta. paraashara san'hitaa.. Language. not available. 68 pgs.. 578 pgs. Literature. 0. Linguistics. 1995. Sanskrit. Sanskrit. Philosophy. Sanskrit. vaamanasharma. 234 pgs. . Sanskrit. paribhaashendusekharaa. paribhaashheindu sheikhar vyaakarand-a vibhaagamu. Literature.. Sanskrit. Language. 1916. Linguistics.. vinaayaka gand-eish. Literature. paraasharadharmasn'hitaa vyavahaarakaand-d'amu practhamoodhyaaya. LANGUAGE. paribhaashhendrashokharan. 1833.. Language. 162 pgs. Linguistics. Sanskrit. nagojibhatta. Sanskrit. 1946. 1306 pgs. Language.. Sanskrit. sanskritdocuments. Sanskrit. 144 pgs. Linguistics. Language. parasara dharma samhita vol 2 part 1.. S. vishhnusharmaa. Literature. Sanskrit. 344 pgs. Sanskrit. Sanskrit. Religion. 1105 pgs. 56 pgs. 370 pgs. paramaarthasaaramu vivarand-ena sametamu.. parishhkaaradarpand-a saastraarthakalaasahita. 1923. Sanskrit.. 389 pgs. Krishnaswami Aiyangar. 1900. parishhkaaradapaind-an.. Sanskrit. 114 pgs. 2000. paramasan'hitaa. parashuraamakalpautramu. panj-chatantramu.. Literature. Sanskrit. Sanskrit. 1940. 1898. 1114 pgs. sesha srikrishna.. Literature. Linguistics. Sri Venumadhava Sukla. panj-chatantramu. Psychology. Linguistics. Sanskrit. Sanskrit.. Linguistics. kumaratatacarya. Language.. Language. 1958. 282 pgs. Language. Language. 518 pgs..… 131/167 . paqs-ataaprakarand-amuu.. shriiraamashaastriind-aa.. Philosophy.. Literature.. pashavalaan'ba mimaan'sa. Language. 1916. paramaarthasaara.. 0. 216 pgs. 1992.. Literature.s. Psychology. Ropahavvamana Sastri. paribhaashheindu sheikhar. 412 pgs..a. Psychology.. Linguistics.. Sanskrit.. Language. Linguistics. 1935. panj-chalaqs-and-iisarvasve. Padmanabhan. vinaayaka gand-esha aapat'e. Sanskrit. paribhaashheindu sheikhar 1938. Language. parayaayaratnamaalaa.... jayadeivasharma mishra.. 140 pgs. Literature. Language. pashht'aalambhamiimaam'saa. parijata natakam... Dr. LINGUISTICS. Literature. veind-imaadhava shaastri. Sanskrit. 434 pgs. 1934. Language.. Literature... 60 pgs.org/…/SanskritIIIT. Linguistics. Linguistics.. Literature. Literature. 1923. sayana madhvacharya. Sanskrit. Abhinava Gupta. 60 pgs. 200 pgs. Sanskrit. Linguistics. 1959. 280 pgs.. paramaayesaaran. Linguistics. 0000.. 62 pgs. Literature. LITERATURE.. Mahadeva sastry. Language. Language. pashvaalambhamiimaan'saa. Sanskrit. 1923. Linguistics. Abhinava Gupta.. Literature. Sanskrit. Sanskrit. Sanskrit. Literature. Not available.. shriimadhdighaarand-yamuni. 1911.. Literature..2/14/2011 A list of scanned Sanskrit books at III… panj-chadashii. Sri Bhagavad Adesesha. Parasara Samhita. paramaarthasaara. 1926. 581 pgs.. Linguistics.. Literature. Language. 1923. 1938. 202 pgs.. shrii viiraraaghavaachaaryaind-a. 136 pgs. 505 pgs. Linguistics. Philosophy Psycology. Philosophy. Linguistics. 0.. maadhavakaravirachitaa. 1949. shriibhagavadaadisheshha.. vaiyaakarand-ashiromand-i sukla shrii vendiimaadhavashaastrii. parijataharanachampu. Sanskrit.. 1943... Theology... Saktism.. 1868.. paramaarthabhuushhand-amuu. Religion.. Theology. Linguistics. Language.. 1989.

. Sanskrit. Philosophy. LITERATURE. Sanskrit. d'aakt'aru jagadiishachandra jaina. Sanskrit... mukunda. -. 256 pgs. praaryavidhaanamuu. Sanskrit. 252 pgs. Psychology... Literature. 230 pgs. 1937.. 585 pgs.. Literature. 257 pgs. 308 pgs. Linguistics. Psychology. Religion.. 1949. Language. Linguistics. Literature. prabodhachandrodayamu chandrikaavyaakhyaa prakaashaakhyavyaakhyaabhyaan' shhashht'haavrxtti. Language. Vaishnavism. pragnaapaaramitaasa pradhamo bhaagan. 1935. LINGUISTICS. raamadaasa. Literature. Linguistics. Language. 1932.. 246 pgs. Linguistics. laqs-minaadabhat'a. 119 pgs. T. Language. Philosophy. Language. Language...t. mantreshvaraa.. bhagavatiiprasaada vaajapeiyii. praakrxta pushhkarind-ii prastaavanaa sahita. Kasi Nath Sastri.. praakrutamand-idipan. Linguistics.. 1915. Theology... Philosophy. Sanskrit. Psychology. Literature. shriipurushhottamajiisahaaraaja. Language.. 1974.. sanskritdocuments. Linguistics.… prakriyaasarvasvan' savyaakhyamu prathamo bhaaga. 1968. 1908.. praakrutapingalasutraand-i. 292 pgs. prabodhachandrodayamuu. Sanskrit... Literature. 116 pgs. Linguistics.. Literature. 1972. Sanskrit. Sanskrit. 0.. Sanskrit.. Sanskrit. Sanskrit.r. pradhikaara kaa prashna. Buddhism... 0. Sanskrit.srinivasagopalacharya. Philosophy.. 132/167 ..... praakrxtasarvasvamu. krishna chandra acharya. 1935. Sanskrit. 1968. prabhakaradijaya. Sanskrit. Linguistics. 670 pgs. Linguistics.. krishna chandra acharya. prakiirnd-aaprabandhaa prathama khand-d'a. 430 pgs. 134 pgs.. 292 pgs. Language. praathamika san'giita. Sanskrit.. Sanskrit..org/…/SanskritIIIT. LANGUAGE. Sanskrit. Sanskrit. Linguistics. B. pand-d'ita vishveishvaranaaya reit'ha. Literature. prakriyaasarvasvan' dvitiiyo bhaaga. prakrita sarvasva.. Linguistics. pracya pascattyam. 1862. Sanskrit. praayashvattamayuukha dashaman.. Language. Not available.. 259 pgs... phaladiipikaa adhyaaya 1 28. shriimatkrxshhnd-amishrayati. LITERATURE.. Language. shriibhat't'aniilakand-t'ha. 280 pgs. 1940. shriinaaraayand-abhat't'apaada. 365 pgs. Language. Sanskrit. prakrita sarvasva. LINGUISTICS. Bhattacharyya. Sanskrit. Philosophy.. 1956. 160 pgs. 1953. b.. Sanskrit. pattuppaat't'u san'skrxtaanuvaada. Sanskrit.. swmi vivekananda.. Literature.. 71 pgs.2/14/2011 A list of scanned Sanskrit books at III… patanj-jalayogasuutraand-i vaachaspatimishravirachita t'iikaavyaasabhaashhya sametaani. Literature. 101 pgs... Sanskrit. 1932. 674 pgs. Linguistics. Literature. 285 pgs. prakaasha shriimadbhaagavatadashamaskandha. LANGUAGE. patanjali yoga sutrani. Linguistics. pand-t'itapravara shriiraamaavataarasharma. 174 pgs. shriimaddidhaarand-yamuni. 612 pgs.. bhattacharya. 470 pgs. 1935.. Literature. Psychology. 1904.. Linguistics. 1968. Psychology. shriinaaraayand-abhat't'apaada. prakat'aathaivivarand-amu. Language. 1894.chinatamani. Language. 0. 132 pgs. Literature. prakarand-apajjikaa. 0. Sri Ramnath Sastri.. Literature. Sanskrit.. Language. 1973. Language. Linguistics. Sanskrit.. pro shan'kara gand-eisha vyaasa. patyadarshii. Literature. Language. T. yas n shriiraama deishikana. 1961. The Arts. prajnapaaramitaas abhisamayalankaaralooka bhaaga 1.

Literature.. The Arts. . Language. 1894. Religion. . Bellokoth Ramachandra Sharma. . Literature. prajnaakaragupta. Sreenivasachariar.. Sanskrit.... 1953. 426 pgs. pramaand-a vachana sadgahan' tutiyan'samput'amu. 121 pgs. 223 pgs. Philosophy. 1945. Linguistics. Tantras. 1950. LITERATURE. vidhyaanaatha. raghunaatha kavi. sanskritdocuments... Religion. 1950. 0. Literature. Sanskrit. Sudara Chary. Language. Literature. prameyakamalamaarataand'aa. 1973.. prapannaparijatam.k. Sanskrit. pramaand-ayavaada.. 48 pgs.. Sanskrit. prashropanishhatan't'iikaasan'valita san'karabhaashhyasametaa. san'kara bhagavatpaada.. prapan'chasaara saara san'graha bhaaga 2... 1942. 160 pgs. 1954. 391 pgs. Literature. prand-avavaadan' pradhamabhaagan. 390 pgs.. Language. . prashnashiromand-i bhaavaarthabodhiniibhaashhaat'iikaasahita. 1896. 694 pgs. 1964. shriividhyaanaatha. Sanskrit. 123 pgs. Sanskrit. 0. 1963. 0. 1949. Literature. pramaand-ayavaada. 73 pgs.. 0. 1979. Language. Literature.v. LINGUISTICS.. ratna gopala bhat't'a.. Theology..… 133/167 . H. prataaparudriiyamu alan'kaarashaastramu vyaakhyaaya.. Sanskrit. 1909.. Language. 1896. Anandagiri. Literature. Linguistics.. 106 pgs. prasnopanishhatuu. 1964. 1953. Language. pramaand-amajjarii.. Sanskrit. prameiyakamalamaarttaand-d'a. Linguistics. Sanskrit. Jayadeva. Linguistics.. Literature.. Jayadeva.. Language. Language. Sanskrit. 1915.. Language. 126 pgs. Sanskrit.shastri. Language. prapatrapaarijaatan.org/…/SanskritIIIT. 342 pgs... Linguistics. Not available.. Literature. 858 pgs.. prasannaraaghavamu sat'iikamu. prashanj-aanamu. 323 pgs. Theology. Sanskrit. 529 pgs. Language. Literature. Language.2/14/2011 A list ofbhaaga.. Sanskrit. Language.. pratidvarasutramu. 0.. Not available. Linguistics. pan'd'itarudramund-i. Linguistics. Theology. Linguistics. Sanskrit.. 146 pgs. Literature.. prasannaraaghavaa. pramaand-aprameyakalikaa. 690 pgs. Jinaviya Muni. Sanskrit. Sanskrit. prakrutaananda. 350 pgs.. 215 pgs.. pramaand-amajjarii granthaan'ka 4. 106 pgs. 1954.. hari naaraayand-a. Linguistics. Literature.. T. LANGUAGE.. Pandurangacharya Srinivasacharya Waiker. Sanskrit. Sanskrit. prasthaanaratnaakara. Sanskrit. prashnootararatnamaalikaa.. sri vatsya vardacharya..v. RELIGION. Sanskrit. K. Vaishnavism.. 82 pgs.. 1984.. Sanskrit. Religion.. Sanskrit. maheindrakumaar shaastri. 1992. Linguistics. Pandit.. Linguistics. prasang-kavign-aanaatsiddhamu. Sanskrit. Language. 360 pgs.. Literature.. Sanskrit. Linguistics. pramaanavaartikabhaashyam vartikalankaarah. 916 pgs. Literature. girvanendra saraswathi. 121 pgs. Language... 104 pgs.. Sanskrit. scanned Sanskrit books at III… prakriyaasarvasvan savyaakhyamu prathamo shriinaaraayand abhat t apaada. Sanskrit. Not available. Language. Sanskrit. T. Literature. 0.. Not Available. Sanskrit. 1999. prataaparudrayashobhuushhand-an' ratnaapand-aaravyat'iikayaa. prameya kaamalamaarthanda prabhaachandraan.n. Linguistics... 194 pgs. Pattabhiram Sastri.. Linguistics.. 1973. THEOLOGY. 668 pgs.. pramaand-avaattaka bhaashhyamuu. . Linguistics. Literature. Linguistics. Sanskrit. subramand-ya saastri. 140 pgs.

109 pgs... Sanskrit. . 320 pgs.. Vasudeva Sarma... 1955. 432 pgs. Sanskrit.. Linguistics. Philosophy. 608 pgs. Sanskrit. Linguistics. pratyabhijnahrdayam. Literature.. 140 pgs. Sanskrit. emil baer ed.. e pi karmaarkara. pravachanasaara. Literature. Literature. sundareisha sharma.. Language. Sri Sadanandha Vidyadhar. Sanskrit. 679 pgs.. not available. Shaacharya Shidarajamaloki.. Literature. Sanskrit.. 1935. hari naaraayand-a. 0. Not available. 1941. Linguistics. shriikushhnd-amand-itripaat'hii. Linguistics. Linguistics Literature. Language. Language... Linguistics.. . 0. Sanskrit. 1992. 346 pgs. Unknown. Literature. Language. 1961. Literature.. 324 pgs. prayaaga mahaatyamu. si ar deivadhar.2/14/2011 A list of scanned Sanskrit books at III… pratijnj-ayaugan'dharaayand-amu.. Language. Linguistics. 1928. Psychology. Unknown.. Unknown. Sanskrit. 1914. Linguistics. Literature. prayogaratnamaalaa. Religion... 1956.. 0. Sanskrit.. 1942. 674 pgs. Sanskrit . pratap singh. 1976. visvanaatha pandit. Sanskrit. puraand-akaavya stootra sudhaa. 443 pgs. Sanskrit. 608 pgs. purushhaarthasudhaanidhi. purchryarnav. Sanskrit. Language. priitilataakusumopetaa vrxttamaalaa. 1943.org/…/SanskritIIIT. purushhasitramu. 392 pgs.. Pandit Ramlal. Linguistics.. purushhaarthachintaamand-isthavishhayaanukrama. shriikund'akund'aachaarya. 1955. Language.. 319 pgs. puurvamiimaan'saadarshanamu dvitiiyasamput'amu. 388 pgs. 1938. 1911... Sanskrit. 626 pgs. shriikushhnd-amand-itripaat'hii. premarasaayana.ramanuja Tatacharya.... 17 pgs. 134 pgs... 1962. Sanskrit.. 1991. shriikhand-d'adeva. Sanskrit. 596 pgs. puraand-aparyaloochanamu bhaag Ii. Literature. Language. Literature. puraand-aparyaloochanamu. T. 0. 454 pgs. No. Sanskrit. Sanskrit. purajjanacharita naat'akamuu. Linguistics. Language. 248 pgs. Sanskrit.. Literature.. Language. .. sayaana kaarya. pratistaa sangrahn. Literature.. Hanumacharya.. purushhaarthachintaamand-i.chandrasekharan... Language. Sanskrit. 1917.. Language. Sanskrit. Linguistics. purushhaathaisudhaanidhin.. 1955.Religion. 646 pgs. Linguistics. Theology. 138 pgs. N S Ramanuja Tatacharya.. pratyakatvachintaamand-i Vol 2. 0. pratyaqs-attvachintaamand-ivimashain. K. 1975... Sanskrit. shrikhand-d'adeva.. Linguistics. Language. purushhaathaichin'taamand-o. Literature. Linguistics. preimavijaya. 0. 488 pgs.. Sanskrit. Linguistics. Literature. Religion. Sanskrit.. 64 pgs. sanskritdocuments. Language. Linguistics. . 1922. puurvamiimaan'saadarshanamu trxtiiyasamput'amu. Sanskrit. Language. Sanskrit. Sanskrit... 174 pgs. Language. 35 pgs. prodamanoramaa. Literature.. praud'hamanooramaakhand-d'anagranthasya.. krxshhnd-adatta maithila. Linguistics. Literature..… 134/167 . puraand-amu.. Sanskrit. Sanskrit Grammer. 100 pgs. 0. Literature.

2/14/2011

A list of scanned Sanskrit books at III… puurvamiimaan'saadarshanamuu chaturthasamput'amuu... shriikhand-d'adeva, Language. Linguistics. Literature. Sanskrit, 1916. 428 pgs.

puurvamimaan'saa darshanamu Vol.i... e mahaadeiva saastri, Language. Linguistics. Literature. Sanskrit, 1908. 372 pgs. qs-airatarad'agnd-ii... Kshira Swami, Sanskrit Grammer. Sanskrit, 1955. 417 pgs. qs-i bhagavadraamaanujavirachite qs-ishaarirakamiimaan'shaabhaashhye Part 1... Sri Lakshmi Narasimhakumar, Philosophy. Psychology. Sanskrit, 1936. 434 pgs. qs-i bhuvanadevaachaayevirachitaa aparaajitaprachha... Popatbhai Ambashankar Mankad, Religion. Theology. Sanskrit, 1950. 791 pgs. qs-ibhaashhyamuu chatushuutribhaaga... Maha Mahopadya Sudarshana Vyasabhatta, Philosophy. Psychology. Sanskrit, 1916. 290 pgs. qs-iimada naarand-yamuniprand-iitaa panchadashii... Narayana Ram Acharya, Philosophy. Psychology. Sanskrit, 1949. 580 pgs. qs-imaddhekhaanasekaasyapajaanakaand-d'a... Parthasarathi Bhattachar, Philosophy. Psychology. Sanskrit, 1948. 214 pgs. qs-imadraamaanujaachaayeprand-iitan' qs-ibhaashhyamuu Part Ii Introduction And Notes... Vasudev Shastri Abhyankar, Philosophy. Psychology. Sanskrit, 1916. 368 pgs. qs-imatsanatsujaatiiyamuu... B. Gururaja Rao, Religion. Theology. Sanskrit, 1940. 144 pgs. qs-inad'apaadavirachitaa seikodheshat'iikaa... Mario E. Carelli, Religion. Theology. Sanskrit, 1941. 148 pgs. qs-ivanamaalivirachitaabrahaasuutrasiddhaantamuktaavali... Not Available, Religion. Theology. Sanskrit, 1942. 252 pgs. qs-utiratnaprakaasha qs-itimateudyota... Tryambaka Sastri, Philosophy. Psychology. Sanskrit, 1910. 102 pgs. raadhaaparind-aayamuu mahaakaavyamuu... Not Available, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1931. 304 pgs. raagaratnaakara... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 706 pgs. raagaratnaakaraa... khemaraaja shriikrxshhnd-adaasane, Language. Linguistics. Literature. Sanskrit, 1966. 702 pgs. raagatattvaviboodha... shriinivaasa, Language. Linguistics. Literature. Sanskrit, 0. 84 pgs. raaghavanaishhadhiiyamu savisheshhavimarshinii prakaashasan'skrxta hindiivyaakhyopetamu... shriiharadattasuuri, Language. Linguistics. Literature. Sanskrit, 1969. 95 pgs. raaghavanaishhadhiyamu... shriiharadattasuri, Language. Linguistics. Literature. Sanskrit, 1896. 74 pgs. raaghavapaand-d'aviyamu... shriikaviraaja, Language. Linguistics. Literature. Sanskrit, 1897. 216 pgs. raajadhamaikaand-d'amu... K.v. Rangaswami, Language. Linguistics. Literature. Sanskrit, 1944. 117 pgs. raajadhamaikaand-d'amu ekaadasho bhaagan... K.v.rangaswami, Language. Linguistics. Literature. Sanskrit, 1943. 410 pgs. raajatarangind-i... durgaprasada, Language. Linguistics. Literature. Sanskrit, 1892. 393 pgs. raajatarangind-i Ii... durgaprasada, Language. Linguistics. Literature. Sanskrit, 1894. 308 pgs. raajatarangind-i Iii... durgaprasada, Language. Linguistics. Literature. Sanskrit, 1896. 410 pgs. raama charchaa... premachanda, Language. Linguistics. Literature. Sanskrit, 1948. 168 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

d

kh

j

h iik

hh d d

L

Li

i ti

Lit

t

S

k it 0 920

135/167

2/14/2011

A list of scanned Sanskrit books at III… raamaayand-a... khemaraaja shriikrxshhnd-adaasa, Language. Linguistics. Literature. Sanskrit, 0. 920 pgs.

raamaayand-a baalakaand-ad'a... tulasiidaasa, Language. Linguistics. Literature. Sanskrit, 1886. 553 pgs. raamaayand-a sampuurnd-a qs-epaka... khemaraja shriikrxshnd-adaasa, Language. Linguistics. Literature. Sanskrit, 1827. 753 pgs. raamaayand-amajjari... shriikshemendra, Language. Linguistics. Literature. Sanskrit, 1903. 519 pgs. raamaayand-amu ayoodhyaakaand-d'amuu... shriimayaakavishrivaalmiiki, Language. Linguistics. Literature. Sanskrit, 1923. 316 pgs. raamaayand-amu baalakaand-d'amuu... shriimayaakavishrivaalmiiki, Language. Linguistics. Literature. Sanskrit, 1867. 224 pgs. raamaayand-amu kishhkindhaakaand-d'amu... shriimadvalmiiki mahaamuni, Religion. Theology. Sanskrit, 1915. 318 pgs. raamaayand-amuu arand-yakaand-d'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 0. 342 pgs. raamaayand-amuu baalakaand-ad'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 1912. 426 pgs. raamaayand-amuu sundarakaand-d'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 1916. 354 pgs. raamaayand-amuu uttarakaand-d'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 1920. 362 pgs. raamaayand-asan'qs-eipasagrarasasvaada... Not Availble, Language. Linguistics. Literature. Sanskrit, 0. 124 pgs. raamakarnd-arasaayanamu prathamo nishhyanda... Not available, Language. Linguistics. Literature. Sanskrit, 0. 74 pgs. raamakathaa... vaasudeva, Language. Linguistics. Literature. Sanskrit, 1929. 66 pgs. raamasandesha padaarthaprakaashaakhyayaa t'iikaayaa sameta... shriiraajaraajeshvarapuujyacharanda, Language. Linguistics. Literature. Sanskrit, 1917. 140 pgs. raamasvayan'varsya vishhayaanukramand-ikaapraarambha... mahaaraaja shriiraghuraajasen'hajii deiva, Language. Linguistics. Literature. Sanskrit, 1822. 1006 pgs. raavand-aarjuniyamu... shriibhat't'abhima, Language. Linguistics. Literature. Sanskrit, 1900. 218 pgs. raghunaathavilaasamu naama naat'akamu... yagn-anaaraayand-adiiqs-ita, Language. Linguistics. Literature. Sanskrit, 1958. 174 pgs. raghuvan'shamuu... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 576 pgs. raghuvan'shavimarsha... ra. krxshhnd-amaachaaryend-aa, Language. Linguistics. Literature. Sanskrit, 1908. 168 pgs. raghuvansh... kalidasa, Language. Linguistics. Literature. Sanskrit, 1944. 360 pgs. rasa mitra... tryambak nath sharma, Technology. Sanskrit, 1965. 276 pgs. rasa mitra... tryambak nath sharma, Technology. Sanskrit, 1965. 382 pgs. rasachandrika... pande v, Language. Linguistics. Literature. Sanskrit, 1913. 110 pgs. rasachandrika... parbatiya pandita vishweswara pandeya, Language. Linguistics. Literature. Sanskrit, 1926. 108 pgs. rasadiirdhikaa... kavi vidhyaaraama, Language. Linguistics. Literature. Sanskrit, 0. 102 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 136/167

2/14/2011

A list of scanned Sanskrit books at III… rasadiparigyan... jaganath prasada shukla vaid, Natural Sciences. Sanskrit, 0. 174 pgs.

rasagan'gaadharahrudayamu... jnj-aanachandrastyaagii, Language. Linguistics. Literature. Sanskrit, 1964. 138 pgs. rasagangadhar... jaganath, Language. Linguistics. Literature. Sanskrit, 0. 430 pgs. rasamajjarii... bad'ri natha, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1929. 222 pgs. rasamiimaan'sa... aachaarya raamachandrashuklaa, Language. Linguistics. Literature. Sanskrit, 0. 516 pgs. rasasadanabhaand-an... yuvaraaja, Language. Linguistics. Literature. Sanskrit, 1893. 70 pgs. rasavilas... bhudeva sukla, Language. Linguistics. Literature. Sanskrit, 1952. 162 pgs. rasen'drasaarasan'graha bhaashhaat'iikaasahita... mahaamahopaadhyaaya gopaalakrxshhnd-abhat't'a suuri, Religion. Theology. Sanskrit, 1844. 528 pgs. ratiratna Pradiipika... liilaadhara sharma, Language. Linguistics. Literature. Sanskrit, 1930. 148 pgs. ratna samuchchaya... not availabe, Language. Linguistics. Literature. Sanskrit, 1928. 504 pgs. ratnaavali kii kathaavastu... Not available, Language. Linguistics. Literature. Sanskrit, 0. 366 pgs. ratnaavalinaat'ikaa... shriiharshhadeva, Language. Linguistics. Literature. Sanskrit, 1953. 216 pgs. ratnaavalinaat'ikaa... shriiharshhadeva, Language. Linguistics. Literature. Sanskrit, 1953. 270 pgs. ratnakiirtinibandhaavalii volume Iii... anantalala t'haakuura, Religion. Theology. Sanskrit, 1957. 220 pgs. rattamatam... h. sesha iyengar, Language. Linguistics. Literature. Sanskrit, 1950. 174 pgs. rauravaagaamaa Vol.i... yan.aar bhat't'a, Language. Linguistics. Literature. Sanskrit, 1961. 277 pgs. rauravaagaamaa Vol.ii... yan.aar bhat't'a, Language. Linguistics. Literature. Sanskrit, 1972. 366 pgs. rig veda samhita volume Iv mandala X... max muller f ed, Religion. Theology. Sanskrit, 1892. 732 pgs. rigbhaashhya bhuumika... vi. kapaali saastri, Language. Linguistics. Literature. Sanskrit, 1952. 284 pgs. rigveda samahita (manuscript)... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 830 pgs. rigveda samhita... f max muller ed, Religion. Theology. Sanskrit, 1890. 974 pgs. rigvedasanhitoupanishadchatakam... -, Religion. Theology. Sanskrit, 0. 490 pgs. riitikaalina kavitaa men' abhivyaan'janaa evan' shilya... Not available, Language. Linguistics. Literature. Sanskrit, 1966. 491 pgs. rudraadhyaaya bhaashhya etatpustakan... saayand-aachaaryabhat't'a, Language. Linguistics. Literature. Sanskrit, 1976. 186 pgs. ruupamaalaayaamu bhaage Iii... not Available, Language. Linguistics. Literature. Sanskrit, 1982. 70 pgs. rxgbhaashhya... Not available, Religion. Theology. Sanskrit, 0. 73 pgs. rxgbhaashhyasan'graha... sva d'aa devaraaja chaananaa, Language. Linguistics. Literature. Sanskrit, 0. 440 pgs. rxgveda prathamos-shht'aka chatuthes-shht'ake shhashht'os-dhyaaya... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 952 pgs. rxgveda san'hitaa Part I... daamodara bhat't'a, RELIGION. THEOLOGY. Sanskrit, 0. 776 pgs. rxgveda san'hitaa Part II... daamodara bhat't'a, RELIGION. THEOLOGY. Sanskrit, 1940. 978 pgs. rxgvedaanukramand-ii... kunjanuu raajena, RELIGION. THEOLOGY. Sanskrit, 1932. 160 pgs. rxgveida bhaashhyamu volume 15... udgita aachaarya, Language. Linguistics. Literature. Sanskrit, 1935. 124 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 137/167

Linguistics. 939 pgs. saamaanyaniruktti. 772 pgs.. Language. Linguistics. rxtuvarnd-ana vyaakhyaaya. 1867. 1111 pgs. saamavedasan'hitaa. 362 pgs. Not available. Not available. Linguistics. Language. Linguistics.. Sanskrit. Literature. Sanskrit. Sanskrit. Sanskrit. Not available. Sanskrit. Linguistics. Linguistics. saamaveda uuhauuhyagaanamu anubandhasahita trxtiiyo bhaaga san'put'amu 2. Literature. Language. Literature. Indology. Linguistics. Sanskrit. shrisaayand-aachaarya. 500 pgs. Linguistics. Not available....... 2002. 0. saamaveidasan'hitaa aagneiyakaand-akamuu prathamoo bhaaga. Literature. Religion. Literature.. uppalla someshvarasharma. 1863. 0. 1947. shriimadhvaachaarya. Literature. 1024 pgs. rxgveidasan'hitaa dvitiiyoo bhaaga..u oriental journal vol-1. Sanskrit. saahityadarpand-amu vyaakhyaamavalambaa samudbhaasitamu panj-chamasan'skarand-amu. Not available. 193 pgs. shriimatsaayand-aachaarya. 1951. rxkuusuuchii. saamaveda uuhauuhyagaanamu anubandhasahita trxtiiyo bhaaga san'put'amu 1.org/…/SanskritIIIT. rxgveidasan'hitaa trxtiiyoo bhaaga. Theology. 644 pgs. Theology. Sanskrit. Theology. 516 pgs.. Language. Literature. 1147 pgs. Language. Linguistics. rxgveidasan'hitaa prathamoo bhaaga... 299 pgs... Sanskrit. Religion. saahityakaumudi.... Literature.. Literature.. 1908.chenna reddy. Sanskrit. Linguistics. Linguistics. s. LINGUISTICS.. Literature. madhava. Sanskrit. Sanskrit. Language.. t'iikaachatushht'ayasanaathii. Language. 1955. Literature. 1941. 0.. shriivishvanaathakaviraaja. Language.. Religion. rxktantran' saamapraatishaakhyam. Sanskrit. Language.. 1900. Linguistics. 180 pgs.. Literature.. 0. Linguistics. Linguistics. 1958. Literature. Language. Language. Not available. saahityaratnamanj-jushhaa.. saahityavimarsha sakalasaahityaan'shasang-grahatmaka. LANGUAGE. shriikrxshhnd-asuurind-a. Literature.. Surya Kanta Shastri. LITERATURE. Sanskrit. 426 pgs. saamavediiya ashht'a braahmand-e taand-d'yamu pad'avin'shabraahmand-an' prathamo bhaaga. Sanskrit. Linguistics. rxgveidasan'hitaa panchamoo bhaaga. Language... vidhyabhushand-a.. durlabhaa.. 0.. 1858. 1982. 639 pgs. 630 pgs. Sanskrit.. 2002... Language.. raamachandravinaayaka pat'avardhana. Prof. Sanskrit. 217 pgs. C.. Kunhan Raja. Language. shrii vai raamamuurtishrautii.. Literature. Linguistics.. Sanskrit. Language.. Language. Literature.. 100 pgs. 1933. 1897. 1933.. Not available. 1873.. saahitya darpand-a. saahityadarpand-amu. Language.. 1062 pgs. Literature. Literature. Linguistics.. Linguistics. shrii vai raamamuurtishrautii.v. Sanskrit. rxgveidasan'hitaa chaturthoo bhaaga. Sanskrit. Not available.. prof. Linguistics. saamavediiya ashht'a braahmand-e saamavidhaanan' aarshheyan'cha gn-iiqs-aadi san'valitamu dvitiiyo bhaaga. 1148 pgs. rxvedavyaakhyaa bhaaga 2 ashtaka 1 adhyaaya 5 8. 1981. Linguistics Literature Sanskrit 1973 327 pgs sanskritdocuments. 313 pgs.. krxshhnd-amoohan shaastri.… 138/167 . 1056 pgs. Language. rxveda san'hitaa bhaaga 1. 1969. Language.j. Literature. 64 pgs. 234 pgs. Sanskrit.. Sanskrit. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… rxgveida prathamoshht'aka. 20 pgs. Language. Sanskrit.

Sanskrit. Linguistics. saayand-iiyargvedabhaashhyabhuumikaayaa vaadashiinaathii t'iikaa. 476 pgs. 1942.. Literature. 0. 310 pgs.. sadaashivendrastuti. 1983. 1907. 208 pgs.... 0. sahityaratnakosh abhilekha sangrha. Language. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… Linguistics.... 140 pgs. shriimadvaradaraajaachaarya. Literature. not Available.. 1906... sachithra yogaasan. 272 pgs. Linguistics. Language. saan'khyaakaarikaa. Language.. Sanskrit. 0. vishva bhandu ed. Religion. Sanskrit. Language. shriivaasudevavidvadvara. Literature.chintamani. saata inakalaabii itavaar bhaaga tiisaraa. Linguistics. Linguistics. saamavidhaana braahmanamuu. Sanskrit.. 164 pgs.. 252 pgs.. Language. saang-khachaayanagrxhyasang-graha. Language. Sri Amalananda... saariirakavyaaravyaaprasthaanaani. Language.. Sanskrit. Language...r. shriisachchidaanandashivaabhinava.. 0. pan' shriitrilokanaathamishra.. Linguistics. 1964. 511 pgs. saarasvatavyaakarand-amuu. Religion.. 572 pgs. brahmha charya raam. 1939. Sanskrit.. 194 pgs. LINGUISTICS. sahaavein' pustaka.. 1930. Sanskrit. Theology.. Linguistics. 222 pgs. saaraavalii. Literature. Literature. Linguistics. 1989.. t'haakura jyotishhaachaariyaa. Sanskrit. sahityaratnakosh pradama kand. 1908. baabuu raamachandra. Literature. Linguistics. Guruswamy. Literature. kausun'varavaastavyapand-d'itavara vaasudeva. Literature. Not available. Philosophy. Sanskrit. Sanskrit. Language. Language. Literature. 1908. Sanskrit. 138 pgs. Sanskrit. saarasiddhaantakaumudii raakaa san'skrxta hndiivyaakhyaaya dvitiiya khand-d'a... 0. Sanskrit... saariirakanyaayasan'graha By Prakasatmayati. Sanskrit. LITERATURE.. Sanskrit. saaravyaayanagrxhyasang-graga kaushhiitakigrxhyasuutrand-i. Philosophy. Philosophy. sanskritdocuments.. Language.. 1973. 1916. Literature. Language. Psychology..… 139/167 ... shriipataraaya. Sanskrit. Literature. 1913.v. saastradiipikaa.. Literature. Literature... Sanskrit. Linguistics. thibaut'a. LANGUAGE. 1940. 62 pgs. 342 pgs. 414 pgs. Language. Sanskrit.s. Linguistics. Linguistics. 0. 370 pgs. Theology. Linguistics. Not available.. Religion. bhadhur chand chhabra. Linguistics. LITERATURE. Psychology. 266 pgs. Literature.. 98 pgs. saambapuuraand-amu upapuraand-amu. d'aa shriikrxshhnd-amand-i tripaat'hii.. LANGUAGE. Sanskrit. shriimatkalyaand-avarma. laqs-and-a. 108 pgs. LINGUISTICS. 1937.. Sanskrit. saarasvatiikand-t'haabharand-amu. Sanskrit. saastradapend-amuu. saamyavaada. naaraayand-a raama aachaarya.org/…/SanskritIIIT. Sanskrit.. Linguistics. sabhaashhyarxksan'hitaayaa varnd-anukramasuuchii. Sanskrit. saang-kaadarshanamu. Language. Language. 430 pgs. 208 pgs. Literature.. 327 pgs. T. 580 pgs. Theology. sachitra jyotishha-shiqs-aa. Literature. ji. 202 pgs. 1890. Theology.. shriimatkalyaand-avarmaa. kai pan' vishhnd-u naaraayand-a bhaatakhan'd'ei.. 1941. Sanskrit. saaraavali kaantimati hindii vyaakhyaa sahitaa. Sanskrit. Sanskrit. 1992. V. 1966. d'aa bii aar sharmaa. Literature. 1919. Language.. Religion. 96 pgs. Linguistics. Psychology. 751 pgs..

Language. 143 pgs. shriini shang-kashaang-giideva. Linguistics.. jaiminii. Yajnika Srirama Krishna Sarma. Language.. LINGUISTICS.. Sanskrit.. Psychology. 1917. Linguistics. Linguistics. san'kalpasuuryodayanaat'akamuu Part I. Language.. sanskritdocuments. Linguistics. san'giitaratnaakara etatpustakan' kalaanidhyaaravyat'iikaasan'valita. Literature. Sanskrit.. Philosophy. LITERATURE. sakalapuraand-aabhyarhita shriibhaagavata dashamaskandha puurvaardhamu. shrii vein'kat'anaatha. Sri Ramnath Sastri Vaidye. sakalaagama saara sang-graha shaiva aagama. samkalpa suryodaya part-2. Sanskrit. 194 pgs. 263 pgs. 830 pgs. samayochita padamaalika. 514 pgs. Linguistics. Sanskrit. Linguistics... 110 pgs. gangadhara krishna draavida. 0. Literature.org/…/SanskritIIIT. 1973. Linguistics. Literature.. Psychology. 296 pgs. Sarvajnatma Muni.. Literature. Kasinath Sastri.. Literature. 1955. Sanskrit. Literature. adi sankaracharya. sam'skaaradiipaka Part I. Kasinath Sastri.. Theology. Philosophy. san'karshha kaand-d'amu shhod'ashaadhyaaya sheshhachaturadhyaayiisvaruupamu. Sanskrit.. shrii kuruganti veinkataramand-a shaastri. Sanskrit. mahaamahopaadhyaaya pan' raamashaastribhaagavataachaarya svaamii. Sanskrit.. 1948. Language. 1937. Sanskrit. Religion. san'qs-epasaariirakamu vyaakhyaasamalang-krxtamu prathamobhaaga. san'giitaratnaakara kalaanidhyaaravyat'ikaa prathamo bhaaga.. 84 pgs. sam'skaaragand-apati Kandika Xii Of Kanda Ii. Language.. Sanskrit. Linguistics.. 236 pgs. san'kalpa suuryoodaya. samayasaara bhaaga 8. Sanskrit. Language.. 855 pgs. Sanskrit. 1897. Literature. samskruthapadamaala trutiiya kusumam. sampaadhya prakaashataan' niita.. Sanskrit. Not available. 600 pgs... Language. Social Sciences. samraat'uu shubhaagamana. 1899. Linguistics. Sanskrit. Language. Language. 644 pgs. 1932.. Sanskrit.4. Literature.. Linguistics.. 1910. shriimatsarvagn-amuni. Literature. 490 pgs.. Srirama Krishna. 1919.2/14/2011 y p A list of scanned books gy at III… . 1953. raajen'dranaatha pan'd'ita. Language... Sanskrit. 1896. sakhyakarikaa. Literature.. 1974. Sanskrit g . sam'skaaragand-apati Fasciculas Vi and Vii. Literature. 250 pgs. sam'skaararatnamaalaa Part I. 1895. 1936. Linguistics. sam'skaararatnamaalaa Part Ii. Sanskrit.. Language. 1938. 1948. Language. 508 pgs. Sanskrit. Social Sciences. Literature. krishand-amaachaari. Mahamahopadhyaya. Language. Literature. krishnamacharya. Language.. 1912.. 460 pgs. 417 pgs..v. Linguistics. pg saitubandhamu... 202 pgs. 1971.. Sanskrit. Sanskrit. Literature.. Social Sciences. vimand-d'alavakra. Sanskrit. Literature... shrii a vi narasin'haachaarya. Linguistics. 82 pgs.… 140/167 . Literature. 820 pgs. shri kunda kunda acharya.. shriiraamadaasabhupatiprand-itadhaa.. Language.. Sanskrit.. 1899. samasyaasamajyaa. 255 pgs. 1864. Linguistics. san'qs-epashaarirakamuu with Thatvabhodini Part 3.. san'qs-epa shaarirakamuu Vol 2 Adhayas 2 . shriinirang-kashaang-giideva. LANGUAGE. Language. Linguistics. Linguistics.. 48 pgs. 1930. Sanskrit. 75 pgs.... Literature..

. Sanskrit. sankhya karikas.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit. The Arts. shriisholataataachaayaind-a. san'skrxta naat'aka udabhava aura vikaasa siddhaan'ta aura prayoga. 1913.. 308 pgs. 127 pgs. d'aa brahmaananda sharmaa. 0. Language.. Philosophy. Sanskrit. Psychology.. Literature. Neelakanta Shankar. Sanskrit. 1941. Linguistics. 86 pgs. 432 pgs. Linguistics. Sanskrit. Religion. 1938. Linguistics. 68 pgs. anjinyea murthi.. Literature. Literature. Linguistics. 248 pgs. 0. Psychology. Theology. 1954. vyasacala. sankaravijaya. 172 pgs. Language. Sanskrit.. Sanskrit. san'skrutaavataaran. 1977. Not available. san'skrutakaadambarikathaa. 1984.. 1947.. Sanskrit. 858 pgs.. Literature. Linguistics.. 430 pgs. Sanskrit. 1959. Language.. Linguistics. miimaan'sakashriinilakand-t'habhat't'a. 439 pgs. Sanskrit. Sanskrit. Sarvajnatma Muni. 770 pgs. 274 pgs. Linguistics... Language. Sanskrit. 48 pgs. sanskritdocuments.. 100 pgs. Literature. Linguistics. Literature. yam. Sanskrit... sang-aameshar krodamu.. Language. Language... Linguistics. 264 pgs. Language.. Sanskrit. 1946. sankshepa sarirpaka.. Sanskrit. 650 pgs. 183 pgs. Theology. sankhya sara. LINGUISTICS. General.. Literature.. Linguistics... Literature. san'skrxta vyaakarand-a shaastra kaa itihaasa dvitiiyabhaaga.. 0. san'skrxtadvitiiyapaat'ha san'skrxtabhaashhaayaan' san'bhaashhand-ashiqs-aka. Not available. Language. Sanskrit.… k it lf t h t2 d t l k L Li i ti Lit t S k it 1971 60 141/167 .org/…/SanskritIIIT. 1933.. Sanskrit.. savanjatma muni. vyasa. Language.. Literature. mallikaarjuna raavu. san'skaaramayuukha ekaadasha. san'skaaravidhi shhod'ashasan'skaarai. Pandit Sri Rama Krishna. suuryanaaraayand-a shaastri. 126 pgs. Not available.. 1926. Sanskrit. san'qs-epashaarirakamuu with Thatvabhodini Part 5. 0. Linguistics. Linguistics. Language. Philosophy. Not available. 0. san'skrxta vyaakarand-a shaastra itihaasa trxtiiya bhaaga. 338 pgs. Literature. san'qs-epashaarirakamuu with Thatvabhodini Part 4. 498 pgs. Language.. Literature. a. Sanskrit. 630 pgs. Sanskrit. 1955. Linguistics. shriiveng-kat'aramand-aaryend-a. Literature. vilayat hussian khan. sanaatana vign-aana samudaya. 1979.. 1965. san'skuuta kal'aapuurnd-odaya. Linguistics. LITERATURE. 292 pgs. Venkataramana Sastri. 522 pgs. berriedale keith. 1958. Sanskrit. 528 pgs. Sarvajnatma Muni. 76 pgs. Literature. sanshipt mahabharath dritya kand... malliyan' raamaachaaryasuununaa. Sanskrit.. san'skaaragand-apati.. 1884.. Literature. Language.. Philosophy. Psychology. Literature. 1934.. san'skrxta kavi jiivitamu. Language. Sanskrit. isvara karikas.... Literature. LANGUAGE.. Language. san'skrxta saahitya men' saadrxshyamuulaka alan'kaaron' kaa vikaasa. Sanskrit. Sanskrit.. 340 pgs. yagn-adatta. Literature..... Vijnana Bhikshu.. san'skruta saahitya itihaasan. Language. Religion.. san'skrxtaan'dhranighan't'uvu. 1956.. Linguistics. 1934. Sanskrit. 1939. sanskrit pravaahini shabd kosh. Sanskrit.. san'skrxta vyaakarand-ashaastra kaa itihaasa prathamabhaaga. not availabe. Linguistics. 1996. sangeethgnan ke sansmar. Literature. 1950. Language. 370 pgs.

60 pgs. -. Linguistics. 1908. Language. Sanskrit.. 1912. 372 pgs. Psychology. Sanskrit.. satyaashhaad'haavirachitan' shrotasuutran' tatraas-s. Sanskrit. s d satwalekar. Linguistics. shriimanmaadhavaachaarya. satyaashhaad'haavirachitan'shrotasuutran' ekaadashaadichatudeshaantaprashraatmaka panchchamo bhaaga.. Literature. Literature. 1928. -. Linguistics. Psychology. Sanskrit. 155 pgs. Linguistics. satya shodhanam... satapathabrahmana. satyaashhaad'haavirachitan'shrotasuutran' saptadashaashht'adashaa prashraatmaka saptamo bhaaga. Sankara Sastri Marulkar. LINGUISTICS. sarvadarshanasan'graha prasthaanabhedashcha.. satyaashhaad'haavirachitan'shrotasuutran' panchchadashashhod'ashaprashraatmaka shhashht'amo bhaaga. Linguistics. Sanskrit. 1932. Not available.. Literature.2/14/2011 A list of scanned Sanskrit books at III… sanskrit self teacher part 2. sarakaara tumhaarii aan'khon'men'. Literature. Linguistics.. Language. Literature. sri sarangadhara acharya. Sanskrit. 1962... Sanskrit. Sanskrit. saral sanskrit sikshak baag 8. 60 pgs. Sanskrit. Literature.. 0. 60 pgs. Language. Language. satyaartha prakaasha... sapal jiivan ki mahatvapoorn gatnaaye. Not available.. saral sanskrit shikshak bhag 4. Sanskrit. 1965. saral sanskrit shikshak bagh 2. Language. Language. Literature. 930 pgs... 0.. Shankara Sastri Marulkar. LITERATURE.. 394 pgs. Sanskrit. 150 pgs. -. Linguistics. Sanskrit. Literature.. 1939. 1942. Sri Kasinatha Sastri Ahhore... sarvavedaanta siddhantasaarasan'graha. sarala kahaaniyan' bhaaga 2. satyashhaad'havirachitan' shootasuutran. 130 pgs. 1927. Literature. Linguistics. Sanskrit. Language. 1907. Sankara Sastri Marulkar. LINGUISTICS. Sanskrit. Language. Sri Shankaracharya. Not Available. Language. 204 pgs. sarasvatiivilaasa vyavahaarakaand-d'a.. Language. 0. sanskritdocuments... LANGUAGE. 1965. 162 pgs.. 150 pgs. 88 pgs. Linguistics. Literature. sarvalaqs-and-asang-graha hitachintaka.. satyaashhaad'haavirachitan'shrotasuutran' dashamo bhaaga.. 1928. 537 pgs. 202 pgs. Sanskrit. Literature. Sanskrit... Linguistics... -. Biography.. Sanskrit. Sanskrit. 1970. Unknown. 0. paand'eya bechana sharma. harinaaraayand-a aapt'e. LITERATURE. mahtma gandhi.. 60 pgs.. Sanskrit. 1997. Language. 52 pgs. 724 pgs. LANGUAGE... jayantkrishna h dave. Philosophy.. LANGUAGE. Shankara Sastri Marulkar.... Sanskrit. arya bhadanta asvaghosa. 1927. 1927. 426 pgs.. Language. sat'iikaamarakoshasya. 600 pgs. 0. Sanskrit. Language.. Language. 0. 438 pgs. satyaatheprakaasha. Sanskrit.… 142/167 ... Sanskrit..chennareddy. Literature. Linguistics. 1971. Linguistics... Language. 468 pgs. Linguistics. LITERATURE. shriiprataaparudramahaadevamahaaraaja. Literature. santhrajshakunam.. Linguistics. Language. Linguistics. Literature. sarangadhara samhita. bhiqs-ugauriishang-karend-a.dhaprashratrayaatmaka prathamo bhaaga. History. Not Avaliable. 0. Sanskrit. Linguistics. saral sanskrit bala bhodh... Linguistics. 396 pgs. 1994.. m. sarvaveidaan'tha sidhaan'ta saara san'graham. LINGUISTICS. Language. Language. 1937.. Literature. Philosophy. Literature. Language. 166 pgs. Literature. Linguistics. Geography. Sanskrit. 222 pgs. Literature. Vacant. -. Literature.. saundarananda kaavya. 308 pgs. Linguistics. Sanskrit. Sanskrit.. 0.org/…/SanskritIIIT. Not Available. 62 pgs.

shaastramuktaval'ii. Linguistics. Linguistics. LITERATURE... 2258 pgs. 1992.. 383 pgs. Not available. 1913.. pat't'abhirama. Sanskrit. 356 pgs. Literature... Language. Literature. Language. Literature. 98 pgs. Linguistics. shriimadabhat't'ojiidiiqs-ita. Theology. Language. LINGUISTICS. Sanskrit. Sanskrit. Literature. Sanskrit.. laqs-mand-a shaastri. Language. Sanskrit.. Sanskrit. shaang-karn' vedaantamiimaan'saabhaashhyamuu kramaang-ka 1. shrii shriisachchidaanandendrasarasvatii. Sanskrit. 294 pgs. 1938. shabdakaustubha trxtiiyobhaaga. Psychology. Social Sciences. Sanskrit... Language. Sanskrit. 1933. 0. Not available. shabdakaustubhe.. Religion. 152 pgs. Literature. Linguistics. 386 pgs. satyashhaad'ha... 238 pgs... Sanskrit. bhat't'ojiidiiqs-ita. shaastradiipikaa. Sanskrit. bhagavadamalaananda. vyaasa. 394 pgs.. 1924. Linguistics.. Literature.. 307 pgs.. LANGUAGE. Literature. shaastradiipikaa... 1915.. Language. 563 pgs.. Sanskrit. 1917. Sanskrit.org/…/SanskritIIIT. 1974. Language. 414 pgs. savesamavrxttaprabhaava. 1052 pgs. shriimadven'kat'anaatha vedaantadeshika. mahaakaal'isubbaaraaya.. sanskritdocuments. Language. shaarirakanyaayasadgagrahan' pradhamodhyaayan. Literature. 0.. Literature. Linguistics. Language. Linguistics. Language. Not Available. sri shankaraacharya.. Sanskrit. shaan'karapaadabhuushhand-amuu. Psychology. Language. 1281 pgs. gand-apati.2/14/2011 A list of scanned Sanskrit books at III… saundaryalahari bhaavanopanishad devi panchastavi vyakhyaaya sahita. Not Available.. 476 pgs. 296 pgs. LANGUAGE. 1971. Sanskrit.. . Philosophy. saurapuraand-a.. LITERATURE. Linguistics. Language. Theology. Religion... Appaya Dikshita. Linguistics. 0. Lokesh Chandra. Linguistics. Psychology. Sanskrit. Literature. 51 pgs.. Sanskrit. shaastrarambhasamarthanamu. 0. Language. Linguistics. 1971.. 510 pgs. shaatpit'akamu. 400 pgs. Sanskrit. Sanskrit. Literature. 1930. 1896.. Literature.… shabdashaktiprakaashikaa shriijagadosha takailadkaara Language Linguistics Literature Sanskrit 143/167 ... 0. Sanskrit. seshvaramiimaan'sa miimaan'saapaaduke... shaastrashuddhapan'chaan'ga ayanaan'sha nirnd-aya. shriimadden'kat'anaatha vedaantadeshikulu. Linguistics. gn-aastradarpand-amu. Linguistics.. Philosophy. Sanskrit.. 1982. LINGUISTICS. Linguistics. 240 pgs.. shaastradarpand-amu. 560 pgs. Linguistics. Philosophy. Literature. LITERATURE. shaastrasiddhantaleshaasan'graha of Appaya Dikshita. Somanatha. Sri Venkatraman. Sanskrit. Language. sevantikaaparind-ayamuu. LINGUISTICS. Literature. 0.. shaastrasiddhaantaleshasan'graha. Not available. Language.. 1074 pgs. 1969. shaastradarpand-amuu. Literature. seshvaramiimaan'saa miimaan'saapaaduke miimaan'saapaadukaa parittraand-amu.. LANGUAGE. 174 pgs. 1935. 1822. sautasuutramu san'kalitaprayokachandrikaa.. shabdakaustubha Vol II. 141 pgs.. 1937. Sanskrit. 1921. Literature.... shabdaarthachan'drika aan'dhranighan't'uvu. Sanskrit. 1913. Sanskrit. savyaakhyonind-aiyasindhoo pradhaman' parichchodan. Sri Radhanath Suri. Language. Linguistics.. 320 pgs.

shiroomand-iikutadiidhitya anumitigrantha.. shrii dattakasuunumahaakavi shriimaaghaprand-iitan. Language. Sanskrit.. shhrii vishnusahasranama. Linguistics. Sri Gadadhara Bhattacharya. 218 pgs. Not Available. Language. Linguistics.… hi t ttik bh k R li i Th l S k it 1970 210 144/167 . 421 pgs. Literature. shhad'ashiiti.. 1927. Linguistics. Language. shhrii an'daal tiruppavai. sri gadadhara bhattacharya. 185 pgs. Religion.. Language. Language. 148 pgs..venkata Raghavacharya. Linguistics. shrii chokkaanaatha. Sanskrit.. 182 pgs. Language. Sanskrit... 1984. 1960. shishupaalavadhamuu. 104 pgs. shaktivaada manjusha vivrxtti vinoodhini. 0. Sanskrit. Linguistics. 124 pgs.. Language. 567 pgs... Sri Yamuna Muni. 484 pgs.. Motilal Sharma Bradwaj. Language.. 249 pgs. Sanskrit. 0.. Language. Literature. 386 pgs. Sanskrit. shattlivaada. 1952. shivastotraavalii. Psychology. aadityaachaarya.. 186 pgs. Linguistics. Sanskrit.. Philosophy. Literature. appayya diiqs-ita... Linguistics. 188 pgs. shivaadvaita nirnd-ya.2/14/2011 A list of scanned Sanskrit books at III… shabdashaktiprakaashikaa. Language. Sanskrit. 1929. 1935. 226 pgs. Linguistics.. shishhyadhiivrxddhidamu vivarand-a. 239 pgs.. 264 pgs. Linguistics. Literature. Sanskrit. Literature. Literature. Narasimhacharya. 169 pgs. 1971. Literature. Literature. Linguistics. shriijagadosha takailadkaara. Linguistics. Sri Barthruhari.. Language. Linguistics. shriilallaachaarya. Literature. 1947. 1881. 1981. Sanskrit. Literature. Literature.. Literature.. Sanskrit.. Literature. Sanskrit.. Philosophy.. Religion.. 29 pgs. not available. shhood'asa raamaayand-a san'grah a.. Language.. Literature.. 100 pgs. 334 pgs. 0. aanandagiri. 1958. Sanskrit. Linguistics. 260 pgs. Sanskrit... Literature. 1961. Literature. shivasan'hitaa. Theology. Sanskrit... Psychology.. 1900.. jagadiish. shabdashakttiprakaashikaa krxshhnd-akaanti t'ikayaa prabodhinii vyaakhyaaya tippand-yaa. 1956. Language. 1825. Sanskrit. 1911. Sanskrit. shriimadiishvarapratyavitgnakacharyachakravarthi. Literature. Religion. 240 pgs... shevan'tikaaparind-aya naat'akamu. shatapathabraahaand-a Part 5.. Sanskrit.. Literature. shrii sridahara venkateshakrutha. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Linguistics. shabdendusudhaa. Linguistics... shishht'aprayegasn'graha. Language. pan' raamalochanashaastrii. Linguistics.. Sanskrit. Sanskrit. khemaraja shriikrxshnd-adaasa..s.. S N Sriramadesikan. 0.. 1340 pgs. shaindravilasa. Theology. Language. Language. Sanskrit.. shang-karavijaya. shatakataryam shrii bhatrxharivitachitam.. Literature. 194 pgs. 1904. Language.. shhrii aniirud'ha samn'hita. Philosophy. A Sreeenivasa Iyengar. Linguistics. Philosophy.. 1927. 68 pgs. sanskritdocuments. shiddhitaryamuu. shabdashittkprakaashikaa.org/…/SanskritIIIT. 90 pgs. Linguistics. Psychology. shatapathabraahaand-a Part 3. Sanskrit. khemaraaja shriikrxshhnd-adaasane shreshht'inaa. 1956. Linguistics. 1973.. Sri Uttamur Viraraghavacharya. shiqs-aamanovinj-aanamu.. 1951. V. Language. Language. 0. Psychology. shriimajjagadiishatarkaalang-kaarabhat't'aachaarya.

500 pgs. Sanskrit. shrii paanj-charaatre mahoopanipadi utsava san'graha prathama bhaaga.. 1962. 0. 1933. K. Religion. 96 pgs. 1927.. Literature.. 77 pgs. 1939. Theology. Language. Linguistics. ramarayakavi bellamkonda. Literature.. shivavilaasakaavyamuu. Sanskrit. Literature. 1946. shrii phakkika ratna manjusha.. Sanskrit. 242 pgs. 0. Literature. Sanskrit. K. shrii krishna leela tarangini. shrii ramakrishna maha kavayam.. Literature.. shri vyaasa paanini bhavanirnaya. Religion. 566 pgs. Language. Linguistics. Literature. shrii harikathamrutham. 34 pgs... 1972. Language. 0. shrii harikathamrutham. Sri Pasupathi Sastri. Literature. shriimanmaharshhikaatyaayana. Sanskrit. shriiniilakand-t'habhat't'a. 1920. 132 pgs.. 0.2/14/2011 A list of scanned Sanskrit books at III… shivasuutravaarttikamu. 616 pgs. Sanskrit. shrii guruvaayupureishvara. Theology. Language.. 266 pgs.. 176 pgs. shrii prabhudev vachanamrut. Sanskrit. Not available. shraaddhamayuukha chaturtha. Literature. Sanskrit. Rangaswamy. not available. Sanskrit.. narayanadasa adi bhatta. 1972. shonakiiyamn' rxgaveda pratishaakhayamn... shrii bhaaskaroodaya. styanarayana raju. 1950. 1942. 200 pgs. 1942. 64 pgs. daamoodara. Theology. Philosophy.. Sanskrit. Linguistics. Sanskrit.. Linguistics. Theology. 232 pgs. s. Linguistics.. Linguistics... shrii raamaayand-aasaar kaavya tilakamu. Literature. Language. ramaswami shastri. Sanskrit. aar krxshhnd-asvaami ayyar. Religion. Linguistics. Linguistics. Linguistics.. Language. shraadvakaand-ad'amu chatutho bhaagan. Sanskrit.. shrautasuutramu devayaagn-ikapaddhati. Language. 1946.. 1970. Sanskrit... 104 pgs. Literature... bhaaskaraa. Literature. Language. Sanskrit. shlokavaar^tikat'iikaa shar^karikaa. Linguistics. Venkata Raman. Religion.v. 1955. Language. 0.. 1968. Language. Sanskrit. Language. gopinath kaviraj. ramtej pandeyan... 528 pgs. 188 pgs.. narayanadasa adi bhatta. suryakant tripathi. Sanskrit. 256 pgs.. Sanskrit. 0.. Language. sethumadhavaacharya. Language. Linguistics. shrii dgargaachaaryasan'hitaa dashakhand-d'atmikaa mahaatmyasametaa. Literature. shri deisikaashatakamu.. Literature. shrii hanumat shahastri naamaan'jali. Literature.. Psychology. Linguistics. Sanskrit.. Language. Linguistics. shivatatva ratnakaramu. Sanskrit. madhuravaand-i.. Literature. Theology. 99 pgs... 0. Sanskrit. Language. Sanskrit. Literature. 0. 1956. Religion. s. 1959. Language. 530 pgs.. Language. sanskritdocuments. 210 pgs. 300 pgs.r. 322 pgs. Not available.. 421 pgs. Linguistics. k. 212 pgs.. 475 pgs.. 1960. Language.. not availabe. Sanskrit. Linguistics.. Linguistics.... ubhayabhaashhaasanaatha dvibhaashhi somanaatha. Literature. shrii raamakrishnavachanaamruth. 1939. shrii mahaabhaaratamuu. shivatatvaratnaakara. Linguistics. Literature.. Not avilable.. The Arts. The Arts. Sanskrit.. shrauta sutras and prayogas.. Linguistics. amrxtaanandayogivaryand-a.. 244 pgs.org/…/SanskritIIIT. san'patkumaar.… 145/167 .. Sanskrit. Literature. Sri Bhattaputra Jayamishra. Sanskrit. Language. shrii raajaratnakaamaachampuu. Sanskrit. Linguistics. 253 pgs.

Sanskrit. Sanskrit. 1926. 240 pgs. Language.. 1917. Language. 1944... Linguistics. Sanskrit. shriimadhusuudanasarasvatii. vinaayaka gand-esha aapat'e.. shriiprxthviidharaachaarya.. 1989. Sanskrit. shriibhaashhyamuu.. Literature.. Language. 1922. shrii tyaagaraaja shatavaarshhika smrxti gran'thaaval'i 1947. Language. Sanskrit.. Literature. yas seitumaadavaachaarya. Literature. 111 pgs. Literature.... 478 pgs. Linguistics. 1942. 1960. Religion.. 234 pgs. 1989. Literature. 448 pgs. Linguistics. Language. shrii shankara shankara bhasya vimarsha. Sanskrit. shrii vishhnd-uchitiiyamuu. Sanskrit. 0. tyagaraja.. Sanskrit. Literature. shrii sitarmayanam... Sanskrit. shriivaasudevaanandasarasvatiit'en'besvaami.. shriilaqs-miidhara. 416 pgs. Literature... Linguistics.. Not available. 727 pgs. Language. 1947.... shriigiitaagovindakaavyamu. Theology. Lakshmana Suri. 170 pgs. Linguistics.. Religion. esa anantaachaaryand-a. Sanskrit. 746 pgs. shriigautamamuniprand-iitanyaayasuutraand-i. Sanskrit. Sanskrit. Language. 159 pgs.. Sanskrit. 856 pgs.. shriibhaashhyamuu shrutaprakaashikaaravya.. shrii vimaanaa charna kalp. Linguistics. 210 pgs. 1984. Linguistics. Linguistics. Sanskrit. Linguistics. Literature. shriiyuta raa raa mootiilaala ravishan'kara ghood'aa. Philosophy. shrii vyaasa panni bhavanaaraayand-a. shriidattapuraand-amu sat'iikamu. Not available.. Religion. General. Literature. shrii kun't'imahi sheshhasharma. Language.. Literature. shriicharakasan'hitaa taatparyetyaparaparyaaya aayurvedadipikaakhya vyaakhyaaya samalang-krxtaa prathamavrxtti. 0. Sanskrit. shriibhuvaneshvariimahaastotramu. Sanskrit. shrii venkatachalamahatyam. shrii keshri kant sharma. Sanskrit. Language. 0.. Linguistics. 690 pgs. Language. Theology.. Language.. shriibhagavadraamaanuja. Literature. shriimachchrakachaturaanana shriichakrapaand-idatta. Theology. Language. Literature. Literature.. Linguistics. Sanskrit.. Sanskrit. 1948. 0.2/14/2011 A list of scanned Sanskrit books at III… shrii ramayanasaar kaatha tilakamu. Psychology. Religion. Literature. Language. 186 pgs.. shriigautamamuniprand-iitan' nyaayadar^shanan. Literature. 564 pgs.. aar ran'garaamaanuja ayyan'gaaru bi ye yal t'i. 1974. Religion. Linguistics. Sanskrit..… shriigurucharitamu dvisaahastrii sat'iikamu sachuurnd ikan'cha shriivaasudevaanandasarasvatii 146/167 . shrii rxgyaju shaavri vaishhnd-avaanaan' brahmakarma.. shriigiitaasvaamivijaya. Linguistics. 1922. 222 pgs. 255 pgs. 74 pgs. Theology.. 1362 pgs. shriibhagavatpaadaabhyudayamu. Sanskrit. 1972. Linguistics. shriigitaa bhaavachandrikaa. madhuravani. Literature.. Theology.. 266 pgs. sanskritdocuments.. Language.. 1954. shriibhagavannaamakaumudii miimaan'saa prakaashat'ikayaa sahitaa. 1989. 0. 1943. Literature. bhagiirathaatmajena. bellamkonda ramaraya kavi. Sanskrit.. Language. Linguistics. 1926. Language. sii ema paadmanaabhaachaarya... Sri Padmaprasad Sastri. 735 pgs. shrii shaang-akhaayana grxhyasuutra. -. 286 pgs. Sanskrit. Linguistics. 1954. shrii yatipativaibhavadiipikaa cha. 145 pgs..org/…/SanskritIIIT.. 222 pgs. Sanskrit. shriibhagavadbhakttirasaayanamu t'ikayaa premaprapayaa.. shriibhagavadraamaanuja.

.. kedaaranatha. 279 pgs. Sanskrit. sanskritdocuments.. shriikushhnd-avilaasakaavyamu. Linguistics. Linguistics.. Literature. GENERALITIES. Language. Language.. shriimadanuvyaaravyaanan. Sanskrit..org/…/SanskritIIIT. Literature. shriilokaprakaashan. shriimadbhagavadagiigaa.... 590 pgs. 1946. Linguistics.. Sanskrit. 1110 pgs... Sanskrit. Linguistics. Linguistics. 397 pgs.. 1953.. Sanskrit.. 67 pgs. 1921. Literature. 284 pgs. shriimadaand-ubhaashhyamu. Religion. Linguistics. 62 pgs. 317 pgs. Religion.. Not available. Religion. shriimadvallabhaachaarya. Not available. sukumaara kavi.. shriimabrahmasuutrand-i saadhanaadhyaaya.. Sanskrit. 1935. 0.. Linguistics. 26 pgs. 1997. 2004. Sanskrit... Language. Literature. Linguistics. Literature. 0. Language. Linguistics. Literature.. Linguistics. Theology. LITERATURE. moot'e aqs-aravaalii.... 599 pgs. 0.. shriimadbhagavadgiitaa. Literature.. 0. 156 pgs. Sanskrit. Not available. shriilokaprakaashan' dhvitiya bhaagan. Sanskrit. Theology. shriimatpuujya shang-kara bhagavatpaadaachaarya. 601 pgs. Psychology. 1942. shriimadbhagavadgiitaa bha t't'aatmajasham'karashaastrind-aa sam'shodhitam.. Language. Language. Language. shriimadbhagavadgiitaa. pand-d'itaratna rayapaalya raaghavendraachaarya.. Linguistics. Sanskrit.. Literature.. Sanskrit. 480 pgs. Sanskrit.. shriimadbhaagavatamahaapuraand-amu muulamaatramu. Language. Sanskrit. 330 pgs. 120 pgs. Language. 166 pgs. 768 pgs. Sanskrit. shriikand-t'hacharitamu t'iikayaa. shriilalitaasahasranaamastootramu. Literature. 492 pgs. Sanskrit. Language. LINGUISTICS. Sanskrit.. 1985.. shriivaasudevaanandasarasvatii. Sanskrit. Sanskrit. shriikoshha. Theology. 1928. Sanskrit. Religion. Linguistics. Sanskrit.. 233 pgs.. Language. 1987... 1936. Sanskrit. 0. maharshhi vedavyaasa... 1923. Philosophy. Literature. Literature. Sanskrit. Linguistics. Literature. 614 pgs.. 467 pgs. Not Available.. 1958. Sri Rajagopal Shastri. shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru.. 274 pgs. Linguistics. shriimadavaalmiikiraamaayand-amu saralagadyatmakam.. 748 pgs. Religion. Sri Madramanujacharya. hayavadanaravuu. Not available. Literature. shriimadraamaanujaachaarya. shriimadamarasin'havirachitei. 1902. Language. Language. 1954. Language. kaaluuri hanumantaraavu. Literature. Literature. shriimadbhaashhyat'iikaabhaavadiipedditiiyaadhyaaya. shriimadbhagavadgiita san'put'a 2 ( 10 rin'da 19 adhyaayagal'u ). kapaali shaatri. Language. . shriikarabhaashhyamuu. Language. shriikand-t'hacharitamu t'iikayaa. Language. 1997. Sanskrit. Literature. Literature. Language. .. 1923. Linguistics. Theology. maharshhipravara shriikrxshhnd-aadvaipaayana. Theology. Sanskrit. Sanskrit. shriimaatrxtattvaprakaasha. 1983. shriimadbhagavadgiitaa.2/14/2011 A list of scanned Sanskrit books at III… shriigurucharitamu dvisaahastrii sat iikamu sachuurnd-ikan cha.. 0.. Literature.… h ii dbh d iit bh hh kh b dhi ii d'h th t tt l k 147/167 . shriiharivan'shachampu. shriimadadvaita siddhaanta krama prasthaanatraya bhaashhyaanusarend-a. Linguistics.. Sanskrit. Linguistics. shriimadbhagavadgiitaa... 610 pgs. si . 114 pgs. Linguistics. 570 pgs. shriimadbhaagaravamu pan'chama khand-d'a. Not available. 0.. 1997.. maagad'i shriiveng-kaachaarya. LANGUAGE.

Religion. Language. Linguistics. bala gangadhara tilak. Linguistics.. 1917. shriimadbhahavadgiitaas-r^thaprakaashikaa. shriimadbhagavadgiitaa shriimachchhang-karabhaashhyayutaa. Language. Sanskrit. 0. shriimadbhagavadgiitaa dvitiiyyashhat'kamu. Linguistics. Language. Linguistics. 1955. shriimadgand-eshagiitaa. 144 pgs.. Philosophy. Vadiraja. shriimaddeidaantadeishikagranthamaalaayaan.. Sanskrit. shriimadbhagavatgiitaa. Language. Sanskrit. shriimadvalmiikiraamaayand-amu prathamoo bhaaga.. Not available. 807 pgs. 346 pgs. 270 pgs. 0. Theology. Theology. 1834. Sanskrit.. Religion. Linguistics.org/…/SanskritIIIT. Linguistics. Sanskrit. Religion.. shriimadragavadraitaa. Language... Theology. aanandagiri. Language. shriimadbhagavatamu ashht'ama skn'dha.. Linguistics. harinaaraayand-a aapat'e. shriimadbhraahmasuutraand-i samanvayaadhyaaya. shriimachchhaang-kara. shriimadbhagavadgiitaa gn-aanakarmasamuchchayaakhyayaa vyaakhyayaa samaln'krxtaa. Sri Valmiki. 386 pgs.. Literature. Language. vidvaan a san'patkrxmaaraachaarya. Sanskrit. 1965.. Linguistics.. 591 pgs. Philosophy. Language.. Language. t'ii aar krxshhnd-aachaarya. 783 pgs. Literature.. Sanskrit. 392 pgs.. 1940. yadupatii.. Sanskrit. Religion. Sanskrit. Literature. Sanskrit. 155 pgs. 130 pgs. 0. Not available. Sri Valmiki. 202 pgs. 309 pgs. Literature. Literature.. 0.. Linguistics. Not available. Sanskrit. Psychology. 1926. Sanskrit. 1912. aanandavardhana.. 420 pgs.. 1911. Sanskrit... shriimaddeidaantadeishika granthamaalaayaan.… shriimadveidaantadeishikagranthamaalaa shrii kan'chi pi bi annangaraachaaryaara Language 148/167 . Religion. 949 pgs. 782 pgs. shriimadbhrahmasuutraand-i saadhanaadyaya.. 1941. Language. shriimadbhahmasuutraand-i saadhanaadhyaaya. Literature. t'ii aar krxshhnd-aachaarya. 1887. sanskritdocuments.... shriimadvadiraajiiyagrandamaalikaayaan' ashht'aman.. 1903.. shriimadvalmiikiraamaayand-ama arand-yakaand-d'a. 449 pgs. shriijagannadthaya. shriimadbrahmasuutratadaabhaashhya trxtiiyaadhyaaya. Theology. 0. Language. 1941. Theology. 273 pgs. Literature. shriimadvalmiikiraamaayand-ama~ ayodhyaakaand-d'a Part I.. Theology.2/14/2011 A list of scanned Sanskrit books at III… shriimadbhagavadgiitaa bhaashhya vyaakhyaaya subodhinii guud'haarthatattvalokan.. 353 pgs. 1917... Linguistics. Sanskrit. Sanskrit. Sri Brahma Yogin... Not available. shriijagannathayatii.. t'ii aara krxshhnd-achaaryand-a. Literature. 1827.... Sanskrit. 324 pgs. shriimadvalmiikiraamaayand-amu yuddakaand-amuu 6. Literature. Language. Literature. Literature.. Not Available.. 0. Linguistics. shriimadvalmiikiraamaayand-amuu yuddakaand-d'amu 6. shriimadveidaantadeishikagran'thamaalaa.. Religion. Sanskrit. 1941. shriimadvalmiikiraamaayand-ama~ uttarakaand-d'a~. Sanskrit.... Sanskrit.. Literature. Language. 0. 476 pgs. Sanskrit. 492 pgs. shriimadbhagavata pan'chama skan'dha. Religion. shriijakannatha. Literature.. Sanskrit. 170 pgs. Sanskrit. Linguistics.. 1834. vidvaanu a san'patkumaaraachaarya. viddaanu a san'patkumaaraachaarya. Linguistics. Language. Literature. Sanskrit. 338 pgs. Linguistics. 958 pgs. Language. Theology. 1964. Linguistics.. Literature. Sanskrit.

Language. Maharshi Vedavyasa.. shriimanmahaabhaaratama~ bhiishhmapar^va. Sanskrit. 251 pgs.. 1934. Not Available.. 419 pgs.. 310 pgs. Sanskrit. 508 pgs. shriiman mahaabhaaratamu vishhayaanukramand-i. Linguistics.. Sanskrit. t r krishnaacharya.. shriimaath kapilananda swamy. Sanskrit. Linguistics. Sanskrit. Theology. Sanskrit. 0.. t'ii. Religion. Religion.. 1832. Linguistics. Language. 431 pgs.. 1951. shriimadvishhnd-utattvavinirnd-aya. Theology. Language. 538 pgs.. shriimadviddyapayonidhitiirtha shriipaa. 0. Sanskrit. shriimanmahaabhaaratamu. Literature. shriijaanakiivallabha. 789 pgs. Theology. Not available. Sanskrit. Sanskrit. Sanskrit. 722 pgs... Sanskrit.. shriimahaabhaaratamuu drond-aparvamu. shriimanmantrarthamanj-jarthaa. Linguistics. Literature. shriimanmahaabhaaratama~ anushaasanar^vand-i... shriimanmaharaaja san'skrxta mahaapaat'hashaalaa patrikaa. 1911.. t r krishnaachaarya. sanskritdocuments. Sanskrit. Sanskrit.. Literature. 0. shriimana nyaayasudhaa.. 262 pgs. shriiman mahaabhaaratamu upoodghaatamu. shrii a vi narasin'haachaarya. Theology. Not available.. 86 pgs. Religion. Language. Religion. Literature. 200 pgs. shriimaggavth kapila githa. Linguistics.. vinaayaka gand-esh. Language. Sanskrit. Sanskrit. shriimajjeiminiiprand-iite mimaan'sadarshind-i.org/…/SanskritIIIT. 1940. Language. Linguistics. Not available. 368 pgs. 1912. Religion. 1905. shriimahaabhaaratamutoojeirina 1901. Not available.. Not available. Theology. Religion. Literature. 716 pgs. 276 pgs. Language. Literature. Language. Literature. Literature. Language.2/14/2011 A list of scanned Sanskrit books at III… shriimadveidaantadeishikagranthamaalaa. Religion. Not available. 540 pgs. P. 1907. 822 pgs. 0. 1914. Language.… 149/167 . shriimanmahaabhaarahamu. P. Theology. Not available. shriikaanj-chi prativaadibhayang-kara and-ndan'garaachaarya. Sanskrit. aara krxshhnd-aachaaryan. 238 pgs. pan' jvaalaaprasaadajii sharma. Theology. Literature. Not available. Sanskrit. Linguistics. Not Available. Language... Literature... Language. 1932. Religion. Linguistics. 1941. shriimata jayatiirtha. Religion... 0.. Sanskrit.. 215 pgs.. shriimadveidaantadeshikagranthamaalaa.... shrii kan chi pi bi annangaraachaaryaara.. 1846. Theology. 842 pgs. Theology. Theology.. 860 pgs. 292 pgs. Sanskrit. Language. 727 pgs. Linguistics.. Language... 0. shriiman mahaabhaaratamu anushaasanaparva 13. shriimallalitaraamacharitramu baalakaand-d'an' sat'iikamu.. Linguistics. 0. Sanskrit. Sanskrit. Literature. shriimahaabaarataantargata shriimadbhagavadgiitaa dvitiiyyashhat'kamu. shriimahaabhaaratamu shaan'tiparvamu. 1901. shriimahaalaqs-myupaaravyaana. 341 pgs. 0.. Linguistics. Religion. shriimanmantraarthamanj-jarii.. Sanskrit. 0. Religion. Subramanya Sastri.. Not available.. Literature. Linguistics.. yer'r'aapreggad'a rachiyin'chinadi.. 207 pgs. shriimanmahaabhaaratamu udyoogaparvamu.. Sanskrit. Linguistics. Sanskrit... 1909. Literature. 225 pgs. Sanskrit.. Literature. Theology.. Linguistics. 0. shriimahaabhaaratamu shaan'tiparvamu. 1811.

Sanskrit. Literature. 1987. 0. Literature. Language. 1986. Seshasayi Iyengar.. shriinaaraayaneupanishad. Linguistics. shriimadvedaantadeshika. shriimanyaamutan. shriimannigamaantamahaadeshikaa. 1929.. 0. m. Sanskrit.. shriiraamalin'gheishvarasthavaraaja.... shriiraamaayand-a mahaakaavya bhaaga 5. Literature. shriimannyaayasuudhaa sheshhavaakyaarthachan'drikaat'ippand-i. shriimatsarvamulan'san'puurnd-a. 244 pgs. Linguistics. 240 pgs. siddheswar jena. raamachan'dra. Religion. 228 pgs.. Linguistics. Sanskrit. shriiraamaayanama. 1968. Sanskrit.. shriimatuu saathand-aachray. Linguistics. Literature. 1100 pgs. 408 pgs. Literature.. 411 pgs. 0. shriimanu nyaayasudhaa prathamoobhaaga. Not available. shriiraamaliilaa raamaayand-a sat'iika. 38 pgs. Sanskrit... Theology. Linguistics.. 128 pgs. Not available. Linguistics. Literature. Literature. . shriimatsanatsujaatiyamuu kramaang-ka 8. n ramaswamy iyer. Sanskrit. Language. Language. Sanskrit... Sanskrit. Language. shriinyaayamutttaavalin. Linguistics.. Sri Raghvendra Swami. shriimannyaayasudhaaparimal'e dvitiiyadhyaaya prathamapaada. 1110 pgs. 240 pgs. shriinaaraayand-iiyamuu. Literature. Literature. 1942. 391 pgs. saqs-mand-a raamachan'dra paan'gaarakara. Language.. shriimattan'trasaara chhallaarii vyaakhyaana. dvibhaashhi somanaatha. shriirahasyatrayasaarasan'graha. Language.. 0. Literature.... shriimatyaagaraajavijayamu prathama sn'skarand-amu. LITERATURE. 0. 153 pgs. LINGUISTICS. 48 pgs. Linguistics. Linguistics. Sanskrit. Linguistics.. Psychology. shriimannyaayamrxtataran'gind-i. 308 pgs. Not Availble.. THEOLOGY. Linguistics. 101 pgs. 1972. Literature. Sanskrit... RELIGION. Language. shriiraamadaasasvaamiin'che samagra gran'tha shriisamarthagran'thabhaan'd'aara.. Religion. Sanskrit. Sanskrit. 1960. Linguistics. Sanskrit. Not available. .. 120 pgs. Not available. madhuravaand-ii. daamodara saatavalekara.. 1930. 226 pgs. shrii vaadiraajabhagavatpaada. Language. Language. 0. 0. 248 pgs.. 1958. Religion.. Literature. shriimadraaghavendragurusaarvabhauma. 760 pgs.. Philosophy. not availabe.. 424 pgs. Linguistics. LANGUAGE. 617 pgs. 1952. 402 pgs.. Language. Literature. Sanskrit.. sanskritdocuments. Language. Dwaita Philosophy..2/14/2011 A list of scanned Sanskrit books at III… shriimannaaraayand-iiyamu. Language. Sanskrit. 0. shriiraajaratnamaalaachampuu.. Language. Language. 1829. Literature.. Literature. 1956. 584 pgs. Sanskrit..… 150/167 . Linguistics. 260 pgs. Theology. shriimatryaayasudhaaparimat't'an.. Not available. 0. Language.. Linguistics. 0. Linguistics. Literature. Language. Sanskrit.. 0. Sanskrit.. shrii mudigond-d'a subrahmand-yasharmand-aa.. shriiraamaayand-asaara kaavya tilakamu. 485 pgs. khemaraaja shriikrxshhnd-adaasa. 0.. 1974. Language. Literature. Theology. mootiilaala jaalaan. 267 pgs. Pandit R. shri direndra tirth. Linguistics.. shriipaadukaasahasramu muulamaatramu. Sanskrit. Sanskrit. Sanskrit.org/…/SanskritIIIT. Language. shriipanj-charaatraraqs-aa paanj-charaatragamasya.. Sanskrit. Sanskrit. . 1940. Sanskrit. Sanskrit. Linguistics. shriinarasimhapuraanamu. Sanskrit.. Literature.......

. Sanskrit. LITERATURE. jagannaatha parashuraama dvivedi. LINGUISTICS. 789 pgs. shriivign-aanabhairava. Linguistics. Literature. 224 pgs.. pand-d'itavara shriikeshariikaantajiisharma. 279 pgs. shriivishhnd-uyaagapaddhati navagrahamakhasahitaa. LITERATURE. shriiyaajnj-avalkyasmrxti. shriivishhnd-enaamasahasramu. Not Available. 1921. LANGUAGE. shriiveidaantaachaaryavijaya. 384 pgs. 568 pgs. Language.. Sanskrit. Theology. Linguistics.. sanskritdocuments.. Sanskrit. Religion.org/…/SanskritIIIT. shaaravot't'ai kushhnd-aasvaamyayya. Not available.. Linguistics.. Sanskrit. prabhudatta brahmachaarii. Sanskrit. Linguistics.. Hari Raghunath Bhagavat. Literature.. Literature. Linguistics.. 1898.. prabhudatta brahmachaarii. khemaraaja shriikrxshhnd-adaasa. shriishriichaitanya charitaavalii bhaaga 3. Sanskrit. Sanskrit.. Literature. shriishriichaitanya charitaavalii bhaaga 4.. Literature. Language. LANGUAGE. 318 pgs. 376 pgs. Sanskrit. shriisvachchhandatantramu. Sanskrit. LANGUAGE.. 190 pgs... 0. shriishriichaitanya charitaavalii bhaaga 5. shriishriichaitanya charitaavalii bhaaga 2. 1986. 288 pgs. 1950. LITERATURE.. shriishang-karadigvijaya hindii anuvaada vistrxta t'ippand-e tathaa vivechanaatmaka bhuumikaa.. Theology... 1938. Language.... 1852. Language. shriitantralooka vivekaakhyat'iikopeta dvaadashobhaaga. Sanskrit. shriirang-garaamaanujamuniiprand-iitaa. shriiveng-kat'aachalamaahaatmya prathamabhaaga hindii anuvaada sahita. Language.… 151/167 . Literature.. Language. 338 pgs. Not available. 1955. 274 pgs. Sanskrit. Language. Language. 1937. Linguistics.. Sanskrit. LINGUISTICS. Sanskrit. 120 pgs. Linguistics.... prabhudatta brahmachaarii. 170 pgs. Language. Literature.. shriishan'karaachaayaivirachitagran'thasan'grahan'prakarand-agran'thaan. 1972. prabhudatta brahmachaarii. 230 pgs. Linguistics. Not available. 749 pgs. shriisubodhinii t'ippand-isahita sampradaayavidushhaa. Language. ramaraju b ed. Language. LANGUAGE. Sanskrit.. Literature. Sanskrit. 242 pgs. shrii krxshhnd-adaasa. Linguistics. Linguistics. 1918... shriishaantikalpadruma vaastushaantisahita. shriiven'kat'aachaletihaasamaalaa. Sanskrit. 299 pgs.. 1929. Sanskrit. 244 pgs. Literature. Linguistics.. 0. Language. Linguistics. shriishivasvaroodaya.. Sanskrit. LINGUISTICS. shriimadabhinavagupta. Literature. shriikrxshhnd-adaasaatmaja. shriivallabhaachaarya. shriishriichaitanya charitaavalii bhaaga 1. Sanskrit.. Literature. prabhudatta brahmachaarii.. shriiupaasanaatrayasidddhaan'ta.. Literature. shriimahaamaheshvarachaarya.. LINGUISTICS. Sanskrit. Literature. 340 pgs. Linguistics.. Sanskrit. 1925. LITERATURE. 0. Language.. 300 pgs. Literature. 814 pgs. Linguistics.2/14/2011 pg A list of scanned Sanskrit books at III… shriiramayansaar kavya tilakam madhurvani. Sanskrit. bhaalachandra jagannaatha dvivedii. 0. Language. LANGUAGE.. 0. Sanskrit. Literature. 2000. Linguistics. Literature. 1947. 368 pgs. 0.. Religion.. Language.. 108 pgs. 0. LITERATURE. LINGUISTICS.. ti viiraraaghavaachaaryaind-a. shriiveng-kat'aachalamaahaatmya dvitiiyobhaaga hindiibhaashhaamayt'ikopeta. maadhavaachaarya. 0. 0.

1950. 1959. Linguistics. 0.. Linguistics. shrikaara bhaashya vol 1. Sanskrit. 294 pgs. Literature. Religion. 1923. Sanskrit. shriimadgang-geshopaadhyaaya.. Religion. Linguistics.. Language... Literature. bhat't'aachaaryend-a shrii paadasharmand-a.. Linguistics. shrxng-gaarasundarabhaand-a. Linguistics. Language. shukraniiti. Not available. Language. 107 pgs. Sanskrit.. shung-garatilaka... RELIGION.. Literature.. Language. Literature. Literature.. shuddhiprakaasha. 282 pgs. Sanskrit.. K. pn' . Linguistics. Language. 154 pgs. Literature... Linguistics. shrundgaratilakamu. 1894. Linguistics. Psychology. Sanskrit.. 1919. e. siddaantalaqs-and-amu. shuddhadhar^ma mand-d'alam' shriimadbhagavadgiitaa. Literature. 283 pgs. 0.. Literature. hiiraalaala.… 152/167 . shrii madanan'da jagapati.. Sanskrit. Sanskrit. 1968.. Sanskrit... Theology. 232 pgs.. 1902.. Religion.. vi . Language. LITERATURE. 1936. 46 pgs. 171 pgs. shripati.. Literature.. Sanskrit. 23 pgs. Linguistics. Sanskrit.. 1965. Sanskrit. Literature. Literature.2/14/2011 y j j y A list of Sanskrit books at III… gscanned g g pg shriiyatiindrapravand-aprabhaava. shriinallaa. Language... shrungarasarvasvasvabhaand-an.rangaswami. shripatipaddhati adhyaaya 1 8 bhaaga 7. Literature. 240 pgs. shuklayajurveda sahitpani shachhtakamu.. 480 pgs. Theology.. siddaantaratnamusat'iikamu. Sanskrit. shuklayajurvediiya kaand-va san'hitaa. Language. Sanskrit. Linguistics. Sanskrit.. Language. Sanskrit. shukraniitisaara. 68 pgs.v. shrxn'gaara haaraavalii. Theology. Language. Sanskrit. shrungarabhushhand-amu. 1950.. 1964. 1912.. 640 pgs. Sanskrit..org/…/SanskritIIIT. iishvarasharma. subrahmanya shastri. Literature. Language. sidantabindu. 108 pgs. 0. Rangasawami Aiyangar. Language. swamy maheshvarananda giri. 946 pgs. 1945. Not Available.v. 65 pgs. Language. 632 pgs. 240 pgs. Literature. LINGUISTICS. v. 164 pgs. Linguistics... krishnajanth panth. shriivaamanabhat't'a.. 352 pgs. shrishang-karabhagavatpaadiiyaprakarand-aprabandhavali trxtiiyasan'put'amu. mahaadeivashaastri. Sanskrit.. Bhrga Samhita. LANGUAGE. Sanskrit. LINGUISTICS.. 1937. shukasaptati agn-aatakartrxkaa kathaakrxti. Sanskrit. Literature. 1862. Literature. Sanskrit. THEOLOGY. Sanskrit. 1968. 1932.. Linguistics. Philosophy. Language. LANGUAGE. Sanskrit. jiivaanandavidhaasaagara. shrudhikaand-d'amu dashamo bhaagan. shriiraamabhadra. Sanskrit.. 486 pgs. 1890. Linguistics. sahadayaaliila. 744 pgs. 1899. Linguistics. sanskritdocuments. 200 pgs. Religion. shrishivamahaapuraand-mu. e . maagad'i shriirang-ganaathaachaarya.. Not available. 846 pgs. shuudrakamalaakaramu. Language. Linguistics.. ilaivilli jagguu veng-kat'aachaarya.. 1956.. Linguistics. shriibaladevavidhyaabhuushhand-a. K. LITERATURE.. Language. 0. gad'gan'prasaadajii. shrudikaand-d'amu dashamo bhaagan. Theology... shrimadbhrahmasuutraand-i. 232 pgs. shrii harshha. Sanskrit. 1896..

sidditrayii.. 1921. 1917. Literature. Psychology.. Linguistics. Sanskrit. siddhaanta shiromand-e grahargand-itaadhyaayo vaasanaabhaashhyasahita.. Sanskrit.. THEOLOGY. RELIGION. Philosophy. sidditrayamu vedaantaprakarand-amu vishishht'aadvaita brahmaniruupand-aparamu. 0.. 1940. 1917. siddhaantasiddhaanj-janan' trxtiiyo bhaaga. shrii yaagn-ikadevand-abhat't'opaadhyaaya. 0. shrii yaagn-ikadevand-abhat't'opaadhyaaya. Language. 1917. Linguistics. 170 pgs. Linguistics.. Sanskrit.. Linguistics... Philosophy. Language. shriikrxshhnd-aanandasarasvatii. smrxtichandrikaa san'skaarakaand-d'a 1. 90 pgs.2/14/2011 A list of scanned Sanskrit books at III… siddanta kaumudi. 152 pgs. 112 pgs. Literature. 170 pgs. Literature. Literature. 1911. siitaaraavand-asan'vaadajharyu ttarabhaaga. Linguistics. 236 pgs. Sanskrit. 153/167 . Linguistics. smrxtichandrikaa aahnikakaand-d'amuu 2.. siddhaantasiddhaanj-janamu. Literature. Language. Language. smritichandrika 3 vyavahaara khanka bhaaga 2. Philosophy.. Sanskrit. 358 pgs.. Sanskrit... 0.... Language. Tryambakam Sastri. siddhaantabindu of madhusuudanasarasvati. 810 pgs. vasudev lakshman shastri pansikar ed.... Language. sindhukaustubha... Sri Krishnananda Sarasvati. Not available.. 146 pgs.… smrxtichandrikaa shraaghdakaand-ad'a. 0. Language. Philosophy. LANGUAGE.. Literature. Language. Literature. 1925. 562 pgs. Literature.. 1919. madhusudana sarasvati. 0. siddhaantaleshasan'graha sat'ippand-abhaashhaanuvaada... Psychology. Sanskrit. sitaaraavand-asamvadaajharya uttarabhaaga. Sanskrit. Theology.. Sanskrit. Not available. Language.. Sanskrit. Sanskrit. Literature. wasudev laxman sastri pansikar ed. Sanskrit.. Sanskrit. sisupalavadha of magha.. siddhasiddhaantasan'graha. 156 pgs. Linguistics. siddanta rahasyam. shrii yaagn-ikadevand-abhat't'opaadhyaaya. Literature. Linguistics. 1929. 54 pgs. Sanskrit.. Sanskrit. sivalilarnava. Sanskrit. Language. shriimadappayyadiiqs-ita. 490 pgs. 156 pgs. Religion. siddhanta kaumudi.. Linguistics. 242 pgs. siddhantasiddhaajann'part 4. siddhaantashiromand-e gorlaadhyaayo vaasanaabhaashhyasahita. Sanskrit... Linguistics. Linguistics. Linguistics. sri ramnatha shastri tr... Literature. devana bhatta.. parashuraama shaatri. Sanskrit. Linguistics. riitaaraamashaastrii. Language. sanskritdocuments. Language. prataap sin'ha. 1993. Language. 1918. 1928. Literature... 596 pgs.... 410 pgs. Linguistics. Not available. Not available.. LITERATURE. siddhantasiddhaajann'part 2. 102 pgs. Philosophy.. Linguistics. Sanskrit. 1916. Psychology.org/…/SanskritIIIT. Language. 404 pgs.. Literature. 1932. LINGUISTICS. 469 pgs. nilakanta dikshita. 132 pgs. 566 pgs. Sanskrit. 380 pgs. 1919. pandit durgaprasada ed. Linguistics. 810 pgs. 0.. Literature. Sri Krishnananda Sarasvati. Language. 1914. Sanskrit. Literature. Not Available.. Language. Sanskrit. Literature. balabhadra. Sanskrit. pan' svaamishriiraamamishrashaastrind-aa.. Language. Sanskrit.. Psychology. siddhaantachandrikaa san'qs-iptabaalabodhinii t'iikaa. 1914. siddhantabindu nyayaratnavali laghuyakhya. Psychology. 1928.

809 pgs.. Language. Language. sri tuurvaasamunivar.. 1942.. 232 pgs. Sanskrit. Language.. Language. Language.. 1969. Language. shrii yaagn ikadevand abhatat t opaadhyaaya.. 29 pgs. Language.. 230 pgs. Literature. Theology. 1852. Sanskrit. Literature... Language. Literature. Sanskrit. sri bhaashhya paart' I. smrxtinaan' samuchchaya. Language. 852 pgs. raamaanujaachaarya. Language. -. Not available. Language. Sanskrit. Literature. Linguistics. Linguistics. Sanskrit. Literature. sri raama giita. g krishna shaastri. Language. Language. vinaayaka jand-esha aapat'e. 1961. smrxtichandrikaa vyavahaarakaand-d'a 3 bhaaga 1. Literature. sri suresvaracarya. Not available... Linguistics. sphoot'asiddhi. 0. Literature. Linguistics.. 0. Linguistics. sragii. 1921. 148 pgs. Literature. Linguistics.org/…/SanskritIIIT. aapstaan'baa. sottaraaprashnaavalii dvitiiya khand-d'a 23 varshhaand-aan' prashnapatrasahita. 1914. 1909. 0. 0. 1902. sanskritdocuments. 497 pgs.2/14/2011 A list of scanned Sanskrit books III… smrxtichandrikaa shraaghdakaand ad a. Sanskrit. Language.. Linguistics. sri vemageeta prathama sahasram.. Theology. sribhasyaprakasika. tukaaraam.. 326 pgs.. Literature. ramanujacharya.... srimad bhagavadgita purushaarth bodhani bhaasha tika. Literature. Sanskrit. vemana. Language. veda vyas. Linguistics. Linguistics. smurichandrikaa asaucha kaanda. Sanskrit.. 339 pgs. Linguistics. Literature.. Sanskrit. 222 pgs. Linguistics. Linguistics. 1970. Religion. 478 pgs. srimad bhagavatam tasya chatutho bhag. Linguistics. Language. Sanskrit. Literature. devanabhatta. 208 pgs. Sanskrit. 776 pgs.. Theology. 40 pgs.. Literature. damodar s. veda vyas. smrxtichandrikaa yaamaashauchakaand-d'e. prashnapatrasahita. smrxtikaustubha. 1969. 1931... Language.. 1885.... Literature. srimad bhagavatam tasya dritya bagh. 0. Linguistics. 386 pgs. 1902. Linguistics. 1835. Srinivasagarya. khemaraaja shriikrxshhnd-adaasane shreshht'inaa. Sanskrit. 1944. Linguistics. 0. Linguistics. Linguistics. smrxtyarthasaagara. Language. 1244 pgs. shrii yaagn-ikadevand-abhat't'opaadhyaaya. shriimada aapadevatmaja anantadeva. 610 pgs. Language. Religion.… 154/167 . Literature. sri svayamvaraa paarvatii man'tramaalaa stootram.. Linguistics. Language. 1918. 1914.... spandakaarikaa. 1930. Sanskrit. Sanskrit. Literature. 314 pgs. Religion. Not available. Sanskrit. 490 pgs.. 1986. 42 pgs. 824 pgs.. sri raamaanuja champu... Linguistics... 236 pgs... Sanskrit. Sanskrit. Literature. Language. Sanskrit. Literature. Sanskrit. 439 pgs.... Linguistics. Sanskrit. Sanskrit. Sanskrit.. Literature. Literature. Linguistics. 158 pgs. spandakaarikaa. Sanskrit.. Sanskrit. srautasuutra 1-5. kallat'a. shriimadvidhanaada. Literature.. 1974. Literature. Theology... 514 pgs. Sanskrit. Linguistics. smuti kaustubhan. aachaarya mand-d'anaamishra... Literature. 1970. veda vyas. Sanskrit. Not available. Language. spandakaarikaa.. Religion. Language. 184 pgs.. sowgandhikaaharand-amu.. Sanskrit. 222 pgs. srimad bhagavatam.

422 pgs. Sanskrit. Not available.. sumadhvavijaya... 416 pgs. srngarasekhara bhana. 0. subhaasita ratna bhaand'aagaaramu. Language. abhinava kaalidaasa. Literature. Sanskrit... subhaashhitaniivii. 1916. 238 pgs.. Pandith Laxmikanth Kanyaal. 890 pgs. Literature. 1933.. kulashekara varmaa. -. Sanskrit. srimad valmiki ramayanam. Sanskrit. Philosophy. Sanskrit. Literature. Sanskrit... Psychology. 1961. subhaashhitaniivyaan' durvrxttapaddatishchaturthii 4. 218 pgs. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… srimad ramayan dritya bagh. Sanskrit. si sundara shaastriyaara. Linguistics. Language. Linguistics.org/…/SanskritIIIT..12. Language. Language. statvaprakash. Literature. Language. Literature. Not available. Sanskrit.. r. Sanskrit.. Technology. Linguistics. Literature.. Literature. Language. Language. subhaashhitaniivii. Literature. 999 pgs.. Language. 86 pgs. 74 pgs. Linguistics. Literature. 1971. Theology. suurasaagara. Linguistics. Sanskrit. Language. Literature. Sanskrit. Sanskrit. 258 pgs. Linguistics. Sanskrit.. Philosophy. Linguistics... 142 pgs. Language.. Sanskrit. Sanskrit. Language. 1886.. 1134 pgs. 1931. pandita nilakanta devarao deshpande.. 1925. 156 pgs. P. sutravt'ati. Literature. Language. 584 pgs. Language. subhaashita trishaati vyaakhyaayasahita. Language. Religion. Sanskrit.... 192 pgs. 1935.. veidaantadeishikulu. Language. Linguistics.. 1968. Sanskrit. bhartrihari. Language. Sanskrit. Language. 111 pgs. Language. chandrashekarana. sushrutasan'hitaayaa. Literature. Not available. 1912.. Literature.. Sanskrit.… 155/167 .. 1891. Linguistics. subhaashita ratna bhaand'aagaara.. Sanskrit. Psychology. shriirang-kanaatha. 0. Not Available. 1971. Literature. Philosophy.. Literature.. 916 pgs. 322 pgs. subhadraaharand-amu. Literature... subhaashhita sudhaanidhi. Literature. abhinava kalidasa. subod sanskrit vyakhan pradhama bhag. Psychology. Linguistics.v. 25 pgs. 412 pgs. Linguistics. sri vedanta desika. Literature. kaasiinaatha paan'd'uran'ga paraab. Literature. 0.. Language. kaashinaatha panduranga paraba. 556 pgs. Linguistics. Literature.. 1951. subhashita niva. 350 pgs. suutraarthaamrxtalaharii. valmiki.. subhadraadhananj-jayamu. 138 pgs. Language.. 198 pgs. 1955. Sanskrit. Sanskrit.. 0.bapat. Linguistics. Sanskrit.. sushrata sanhita sharira staanamu.. Literature.. 1911. Literature. suuryyasidddhaanta.. sanskritdocuments. saayand-a. srngara sekhra bhana. Linguistics. Language. 1961.. Linguistics. Sanskrit. Unknown.. 569 pgs. Sanskrit.. Linguistics. 1899. 1941. valmiki.. subhashita ratna bhaandaagaaram. 170 pgs.. Not Available. srimadbhaagavatam skandhas 8 . t. Linguistics.. Linguistics.. Sanskrit. 1952. shriinigamaantamahaadeshikaa. sundararaamaayand-amu aura satiivilasitamu. 1988.. Linguistics. Language. shriisachchidaanadendrasarasvatii. Sanskrit. 498 pgs. Linguistics. Sanskrit. 812 pgs. shriimadullabhadeva. 0. 1924. shriimaadhavabhat't'a. 1940.. suttanipaato. subhaashhitaavalin.. 1917. sugamaa. Linguistics.. Linguistics. Literature.. Linguistics. naaraayan ram acharya. ti... 84 pgs. Language. krishnaachaarya. 0... 260 pgs.

Sanskrit. taajiiraatahinda. 1961. Literature. 0.. Bhatta Kumarila.iv. taittiriiya rand-yakan' bhat't'abhaaskara bhaashhyasahitan' Vol 3.. taddhitaantaa kechanashabdaa. Literature. Linguistics. 1898. taitiriiya san'hitaa. Sanskrit. Literature. Literature. 360 pgs.. Linguistics. aachaariyaraghuviirend-a. Linguistics. Psychology.. Language. Not available. Theology. Sri Ganapathi Sastri.2/14/2011 A list of scanned Sanskrit books at III… suutrabhaashhyaarthatatvavivechani. 126 pgs. 221 pgs.. Language. 550 pgs. sanskritdocuments.. Sanskrit.. Sanskrit. taajika niilakand-t'hii t'ikayaa savisheshhopapatti sodaaharand-a bhaashhaabhaavaarthana.iii.. Religion. svachchanda tantramu Vol. Literature. shriiniilakand-t'haachaarya. Not Available. Literature. mahadeiva saastri.. 540 pgs.. 478 pgs... Literature. pan'd'ita harishan'kara. 34 pgs. Religion. 362 pgs. svaanubhavaadarsha.. Language. 570 pgs. 0. Linguistics. mahaadeiva saastri. 224 pgs.ix. Language. Sanskrit. 1902.. Language. 1926. Philosophy. Literature.v. 0. kaashiinaatha vaasudeivashaastrii. mahaadeiva saastri.. Language. 1948. mahaadeiva saastri. Linguistics. Linguistics. taitiriiya san'hitaa krishhnd-a yajurveida Vol. Sanskrit. svaravyaajjanamu. Sanskrit. taitiriiya san'hitaa krishhnd-a yajurveida Vol. svarasiddaanta chandrikaa. 306 pgs. siitaaraama shaastri. 89 pgs. svasthavrxttasamuchchaya bhaashhat'iikaasahita. shriisambhavai jyothorupaaya. Not Available.. Literature.org/…/SanskritIIIT. Literature. Language. Philosophy. Literature. Sanskrit. Linguistics. e. 1896. Language. Language.. Language. Sanskrit. 480 pgs. Linguistics. taatparyachandrikaa. Sanskrit. A. Linguistics. Language. Sanskrit.. t'ood'araanandamuu volume 1. 136 pgs. Linguistics. 374 pgs. 170 pgs. Language. Sanskrit. 1964. svaanandavanavihaarakaavyamu. Psychology. 470 pgs. taitiriiya san'hitaa krishna yajurveida Vol.. Language. d'aa maagiirathapraasaadatripaat'hii vaagiisha shaastrii. Literature. 1917.. 288 pgs. qs-emaraajaa.. Mahadeva Sastri. Sanskrit.. shriisachchidaanadendrasarasvatii. 0. e. Sanskrit. 0.… 156/167 . Not available. ramanujacharya. 1896. Literature. taitiriiya brahmand-a baashha part Ii.. svaraajyasiddhi qs-igagd'adharendra sarasvati virachitaa.. svayambhupuraand-amu. Literature.... Literature. Sanskrit. e. Theology. Language.. 1896. Language. svaraprakriyaa.. 362 pgs. 0. Language. Sanskrit. Linguistics.. taatparyachandrikaa dvitiiyasamput'amuu. Sanskrit. ke maadhava krxshhnd-a sharma. vyaasatiirtha. Sanskrit.. Linguistics.. Literature. t'upuut'iikaa. shriimadgrund-i shan'bhubhat't'a. Linguistics.. taaraanaayatarkavaachaspati jiivanacharitamu. Linguistics. Literature.. shivaraamakushhnd-ashaastri.. Sanskrit.. 1895.. Linguistics. 0. 470 pgs. 1927. Language. Language. 346 pgs.. 454 pgs. Sanskrit. 1904. Sanskrit. Linguistics.. Literature. Linguistics.. Literature. Linguistics.. Sanskrit... 0. 101 pgs.. Literature. Linguistics.... 1898.. Sanskrit. Linguistics. Literature. 471 pgs. taitiriiya san'hitaa krishna yajurveida Vol.iii. Language. 1956. 0. 1983. Language. Sanskrit. Language. Sanskrit... Linguistics. 454 pgs.

1934.. Philosophy. Literature. Sanskrit.. Sanskrit.. 1921. tantraprakaashikaasamete mimaaman'sa ar^thasan'graha. tantrayeprasuunamaalikaa. 370 pgs. Theology. Theology..2/14/2011 A list of scanned Sanskrit books at III… taittiriiya san'hitaa Vol II.… 157/167 . shrii sachchidaanadendrasarasvatii. 238 pgs. Linguistics.org/…/SanskritIIIT. Language. Literature. Religion. Philosophy. THEOLOGY... Linguistics. Sanskrit. Sanskrit. -. Philosophy. Sanskrit. Sanskrit.. 558 pgs. taittiriiyasan'hitaa bhaaga 10. Theology. takra sangra. tantrasaara. Language..b. Religion... 140 pgs.. tantrashuddvaya prakarand-an' bhat't'aarakaqs-ivedottama prand-itan. Theology. 227 pgs. Sanskrit. T. 230 pgs. Religion. Psychology. Religion.. 186 pgs.. Sanskrit. 0. 1921. 0.. 361 pgs. swami satchidaanandendra saraswathi. mahadeva shaastri. bhat't'abhaaskaramishraa. 1922. Sanskrit. -. Ramanujacharya. tantralooka bhaaga 8. Theology. Language.. mahaamahopaadhyaaya parashuraamashaastrind-aa.. Language. 1882. Theology. tantrasaara. Sanskrit. Literature. Religion.. Religion. 239 pgs. tarkakutuuhalamu. Sanskrit. Sanskrit. Sanskrit. Linguistics. tantralooka bhaaga 2. tarka sangrah.. bhat't'abhaaskaramishra. Theology. Sanskrit. 1911.. 1918. Psychology. Sanskrit. Religion. abhinavagupta. bhat't'abhaaskaramishra. Not available. Ganapathi Sastri. Theology. Philosophy. abhinavagupta. Linguistics.. 1953. 1898. Religion. Literature.. Literature.. Sanskrit.. Psychology.... tantralooka bhaaga 4..annanagarachari. mallaadi vasun'dhara. P. Linguistics. Literature. 1915.. Madhusudhan Kaul Sastri. Religion. taittiriyasan'hitaayaa padaanukramand-ii prathama khand-d'a. 333 pgs. taittiriiyasan'hitaa bhaaga 2. taittiriya upanishad. 1918. tarkabhaashhaa. Theology.. Linguistics. taittiriiyabraah-hmrxnd-amam.. shriikeshavamishra. 0. tarkai shaastra nirupand-amu. 244 pgs. Literature. Psychology.. Psychology. Sanskrit.. 66 pgs. Theology.. 1930.. Sanskrit. 480 pgs. Religion. 512 pgs.. Language. taittiriyopanishhata.. bhat't'abhaaskaramishraa.. 1989. 1924.. tantrarahasyamn. taittiriya upanishad anandavalli bhriguvalli. 1897. Sanskrit. Sanskrit. Language. 104 pgs. tark shastra terminology of logic part 1.. tantralooka bhaaga 1.. 102 pgs. Sanskrit.. 1971 512 pgs sanskritdocuments. 1918. tantralooka Volume Iii. 1949.. Philosophy. RELIGION. Psychology. 48 pgs. 72 pgs. 454 pgs.. Religion. Psychology. parvatiiya shriivishveshvarapaand-d'eya. 1930. Philosophy. 1952. taittiriiyabraahmand-amu trxtiiyaashht'ake prathamabhaaga 1 7 prashnaa.. Linguistics.. 98 pgs. 0. abhinavagupta. 280 pgs.. tantraadhikaaranirnd-aya.. Linguistics. Literature. tan'jaavuurupatanamu. 1923. abhinava gupta. 1952... Language. Theology. Religion.. Theology. abhinavagupta. 102 pgs. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Not Available. Narayana Sastri. 374 pgs. taittiriiyasan'hitaa bhaaga 12.. Language. Linguistics. Sanskrit. 216 pgs. Not available. Religion. Sanskrit.. Language. bhat't'abhaaskaramishraa. Literature. raghu vir. 1917.. Philosophy... Sanskrit. 38 pgs. 443 pgs. 1962. taittiriiyabraahmand-amu prathamaashht'akamu... 1894.. abhinavagupta. Sri Lowgakshi Bhaskara.. Sanskrit. 271 pgs. 1894.. 425 pgs. Sanskrit. 206 pgs.

214 pgs. tattvabodhinii puurvaarddha viyaakarand-asiddhaantakaumudiivyaakhyaaruupan. 1932.. tarkasan'graha diipikaa nyaayabodhiniisamalan'krxta. 216 pgs. Jayarasi Bhatta. shriimachchitsuravaachaaryamunivara. Sanskrit.. 0. 448 pgs. LINGUISTICS.. Philosophy. llokaacharya. Sanskrit. 1916. tattvat'iikaa shataduushhand-ii. shriimadannambhat't'a. janaardanashaastrii paand-d'eya. tatva vichaar. 520 pgs. 0... tattvatrayamuu. Linguistics.. Language. Linguistics. LITERATURE. 116 pgs. Literature. Linguistics.. Sanskrit.. tarkakutuuhalamuu. Literature. 315 pgs. 200 pgs. Gangesopadhayaya. Literature. aanandajnana. 0.. 1992. 1003 pgs. 401 pgs. tatvabodhanyaa uttaraardhda.. Language.. 518 pgs. Sanskrit.. shriimadvaradaachaarya. 1940. Linguistics. s chandrasekhara sastrigal.. Literature. 60 pgs. 1938.. tattvapradiipikaa chitsuravi nayanaprasaadiniisamaakhyayaa vyaakhyaaya sahitaa. tarkasan'graha nyaayabodhinii siitaa padmaabhyaan' san'skrxta hindii vyaakhyaaya. Language... Literature. shriimadavedaantadeshika. Sanskrit. Literature.org/…/SanskritIIIT.. 349 pgs. Literature. jayadayaala. Sanskrit. kamalashiila. Linguistics.. 1926. 0.… 158/167 .. tarkakutuuhalamuu. mahaamahopaadhyaaya shrii ganggeshopaadhyaaya. 512 pgs. 2003. Sanskrit. Sanskrit.. tatvabiidhinyaa uttaraardha subiidhinyaakhyan' svaravaidikaprakarand-an. Language. jvaalaa prasaada kaanod'iya. Psychology.. Language. Sanskrit. Language. 1944. shriimadannabhat't'a. tattvabindu. LITERATURE. Sanskrit. 552 pgs. Language. Linguistics. 0. Language. Sanskrit... Language... Language. Language. Sanskrit. 1938. 523 pgs. Sanskrit.. LINGUISTICS.. Literature. Linguistics. 398 pgs. tattvasaara samanugrxhita... sanskritdocuments. Language. Sanskrit.. tarkataand-d'avamu trxtiiyan' san'put'amu. pan' shriiaanandabhtaa nyaayachaarya. 360 pgs. Linguistics. LINGUISTICS. tattva chintaamand-i bhaaga 7. Literature. Sanskrit. sri vachaspati mishra. 1974..... Sanskrit. 32 pgs. Language. 0.. Sanskrit.. Literature.. 278 pgs. 0. 1917. LITERATURE. 52 pgs. shrii vyaasatiirtha. Sanskrit.. Language. Language. 1969. Literature.. shriimadannan'bhat't'a. 1932.. Language. yativarashriignaanendrasarasvatii. tarkataand-d'avamu prathamasamput'amu nyaayadiipaaravyaakhyaaya. LANGUAGE. Language. Sanskrit. Sanskrit.. 830 pgs. 1888. Sanskrit. Sanskrit. tattvopaplavasin'ha. 386 pgs. Linguistics. Sanskrit. Literature. Philosophy. janaardanashaastrii paand-d'eya. tarkasang-grahasarvasvamu tarkasan'grahavyaakhyaa t'ippand-yaacha samalan'krxtamu. tattvachintamand-i Part I. jayadayaala.. Literature.. Literature. shriivyaasatiirtha. Literature. Linguistics. Literature. tarkasangraha. tarkasan'graha nyaayabodhini vaakyavrxtti niruktti t'iippand-yaa. Linguistics. Not available.. Language. Linguistics. Literature.. 456 pgs. Psychology. Language.. Not avilable. Linguistics.. Linguistics. tattva chintaamand-i bhaaga 6. LANGUAGE. 1917. 192 pgs... Sanskrit. Linguistics. 612 pgs. Literature. 364 pgs. Language. tattvasan'graha volume 1. Sanskrit. Linguistics. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… 1971. 1924. Linguistics. tattvachintaamand-e saamaanyalaqs-and-aprakarand-amu. Literature. Literature. 1953. tarkasangraha. Linguistics.. LANGUAGE. 1915. Linguistics.

Psychology. Literature. Linguistics. Philosophy. 1975. the anargharaaghava of murari. Linguistics. Psychology. 0. 1954. vaman shivaram apte.. the raghuvamsa of kalidasa. Sanskrit. the jnanadipika tika mahabharata tatparya tika. Literature. veidaan'taachaarya. tatvat'iikaa.s.. kalidasa.. S.. k.. Linguistics.. pandit durgaprasad. Linguistics.iii. Linguistics. Sanskrit. 1926. Sanskrit.. 1953 262 pgs sanskritdocuments. Psychology.org/…/SanskritIIIT.. Literature. 1933. the ashtadhyayi of panini vol .. Not available. 0. Literature. Philosophy. Psychology. the ranadipika of kumaraganaka.. not avaliable. Sanskrit..ii. shriinivaasagopaalaachaarya.. Religion.. 1938.suryanarayana Sastri. asvaghosa. Linguistics. Theology. Sri Nigamantha Mahadesikar. Sanskrit. Literature. Language. 212 pgs. Linguistics. 356 pgs. Sanskrit... Philosophy. Psychology. Sanskrit... Dr Suresh Chandra Mishra. kasinath pandurang parab. Philosophy. 106 pgs. 448 pgs. 428 pgs. 750 pgs. 0. Linguistics. tatvatrayamuu. Unknown. 1936. Sanskrit. tatvashuddhijaanadhanapuujyapaadavirachitaa. Language.. Sanskrit.s. tatvasan'khyaanaraaghaven'dratiirthiiyat'ippand-ii. Language. Sanskrit. 50 pgs. D. 830 pgs. Sanskrit. tatvamuktakalaapa Vol.. Linguistics. shriinivaasaachaar. Language... tatvashuddhi. Language. Sanskrit. Literature. the dasakumaracharita of dandin.. Linguistics. 466 pgs.. Philosophy. Sri Mallikacharya.. the saundarananda. pg tatvakostubha Part 1. 1937. Linguistics. t'i. 306 pgs. 29 pgs. Suryanarayana Sastri. 1900. Language.... sambasiva sastry k. Language. Literature. devabodhacarya. 60 pgs. Language. Language. tatvamuktaakalaapa Vol 1... 1989. srisa chandra vasu. Literature. 746 pgs.. the supreme epic of devotion. Language. 1997. Sanskrit. Literature. Language. 0. 362 pgs. Sanskrit.. Sri Bhattoji Dikshita. 254 pgs. of scanned books at III… g g Sanskrit g . Language.. Linguistics. Literature. 330 pgs. Literature. narayana balakrishna godbole. Psychology. tatvasan'graha. 1917.. t'i.i. 1928. the students guide to sanskrit composition.… 159/167 . 946 pgs. Sanskrit. Literature. Psychology.. Sanskrit. S. 670 pgs. thakavarg Mahanibandh. Sanskrit. 1933.. Literature... Language. 406 pgs.. Philosophy.. 100 pgs. 298 pgs. Sanskrit. 430 pgs. Philosophy. 670 pgs. Literature. Linguistics. kshemaraja. Language. krishhnd-amaachaarya. Linguistics. tatvamukta kalaapa Vol.. swami satchidanandendra saraswati. the panchatantrika of vishnu raman. Literature. Srinivasachar.. 542 pgs.2/14/2011 y A list. the meghaduta. 1925. 1941. 1944.. Sanskrit..... 1955.. Sanskrit.s. Sanskrit.. Literature. 152 pgs. moreshwar ramachandra kale tr.. Linguistics. Sanskrit. Language. Sanskrit. Sanskrit. tatvamukta kalaapa Vol. the students sanskrit-english dictionary. ramaswami shastri. Literature. Sanskrit. Language. 0. Linguistics. di. 1956.. Sanskrit. the pratyabhijna hridaya. 1945. the essential gaudapada. 1941.. Linguistics.. Language. Iv.

Language. Literature. 1918.. 135 pgs... 20 pgs. Sanskrit. trin'shachchhlokii sat'iikaa. 107 pgs.. Srinivasachariar. hari raghunaath. 0. 1949. kalidasa. Sanskrit. Not available. 19 pgs.… upanishhadaan' samuchchaya hari naaraayand a aapat'e RELIGION THEOLOGY Sanskrit 1895 160/167 .2/14/2011 1953.. Social Sciences. 1936. tisarii kitaaba. Language.. Linguistics. Sanskrit. Linguistics. LINGUISTICS. upadesasahasri. Literature. Religion. Linguistics..m. 1934. Language. Psychology.. Sanskrit.. Language.. Language. shriibhaaskara.. 1930. 1947. unmattaraaghavamu. 0. Sanskrit. Psychology. Philosophy. 0. 90 pgs. 0. Sanskrit. Not Available. Philosophy. 1899. 1914... Literature. Sanskrit. Linguistics.. ung-ad'aamareshvaratantramu. Language. 1937. Sanskrit. 140 pgs. 63 pgs. 1915. tritalaavachchhedakataavaada.. Sanskrit.. Sanskrit. Sanskrit. Sanskrit.. Sanskrit. tithisaamaanyanirnd-aya.. 144 pgs. 262 pgs. Literature. tithichintaamand-i. 0. Linguistics. Language.. swami satchidanandendra saraswati. Not available. kalidasa. Philosophy.. Language. Sanskrit... 298 pgs.. Linguistics.. kalidasa. 443 pgs. tristhaliisetu. udhaanapatrikaa. Sanskrit. A list of scanned Sanskrit books at III… the taittiriya upanishad. 1957. 178 pgs. Not Available. Psychology. tristhaliisetu tiirthendushekhara kaashiimoqs-avichaara.. Psychology. upadeshasahasri Part I and Ii (prose and Poetry).. Linguistics.v. 1997. Sanskrit. 160 pgs. Sanskrit. Sanskrit. 73 pgs. Literature. naaraayand-abatta.. Language.. 389 pgs. Literature. 380 pgs. 112 pgs. upadeshasaara bhaashhyasahita. 394 pgs. Psychology. Philosophy. the uttararamacharita of bhavabutta. trim'shaachchhalokii pat't'aabhiraamat'ikaasahitaa. shriibhagavadramand-amaharshhi.. Literature. Literature. Sanskrit. 1954. tripuradahanamu. 1924. 382 pgs. Sanskrit. trishaati seituhu. 1942. sanskritdocuments. 262 pgs. Sanskrit. upanishhad'asa Vol. 194 pgs. Linguistics. Language. trikaakhaad'amakhad'ana. Language. Sanskrit. LITERATURE. 360 pgs.. LANGUAGE. Linguistics. Linguistics. 413 pgs.. Language... Language.. Philosophy. Sanskrit. Philosophy. upaakhyaanamaalaa. Bhrga Samhita. Sanskrit.. Linguistics. Badi Mudgara Kuthara Kumara Swami.. tithaivivechanakaand-d'avishhayasuchikaa.. Literature. 1977. Pandit A. trin'shachchhulokii. 0. Linguistics. I. Linguistics. shriiharisin'hajii. suranada kunjan pillai.. 1922. Literature.. Literature.. 346 pgs. K. Literature. 1915.. Literature. Sanskrit... the vikramorvasiy. 1922. veidaantaachaaryaa. Psychology.. 124 pgs. 1903. Narayana Bhatt. srimad ramatirtha. the vikramorvasiya of kalidasa. Linguistics... bhat't'ojidiiqs-ita. Language. Literature. Literature.. 473 pgs. Language. Not available. 1962. Rangaswami Aiyangar. 52 pgs.. the vikramorvasiyam of kalidasa.. Linguistics. upadeshasahastrii gadyaruupa sat'iikaa. bhava butta. 446 pgs. upakramaparaakrama. Literature.org/…/SanskritIIIT.. 1942. Not available. Linguistics.. Language. pand-d'ita shriishashinaatha bhkaa.. Sri Rama Pisharoti And Subrahmanya Sastri. Sanskrit. Linguistics. Language.. vinaayaka gand-esha aapat'e. Literature.. Literature. Srimad Bhagawatpadacharya. 154 pgs. Language... Linguistics. Theology. Sanskrit. Sanskrit.

. Literature. 187 pgs. vaakyapadiiyamu trxtiiyakand-d'amu vrxttisamuddesaatmakamu ambaakartriivyaakhyaaya samalangkrxtamu. aachaarya karapuut'ugala shrii dharmmashrii. vaamadeshvaratantraantargatanityaashhod'ashikaarnd-ava vyaakhyaaya. Language.. shriimadvedavyaasa. mahaakavishriibhavabhuuti. mahaakavi shrobhavabhuuti. 126 pgs.. Linguistics. Linguistics. Philosophy... Sri Madahobala Suri. 0. suuyranaaraayand-aa... 1956. Literature. vaajaneyipraatishaakhyan' kaatyaayanaprand-iitan. Linguistics. Linguistics. Sri Venkatarama Sharma. Literature. Literature. 1966. 38 pgs. ushhaaparind-ayaprabandha.. Literature.. 84 pgs. Language.. jaakooba. gi. Language. Linguistics. Language. Sanskrit. Linguistics.. 1937.. Linguistics. Sanskrit.e.. veimuuriraamagovindashaastrii.2/14/2011 A list of scanned Sanskrit books at III… upanishhadaan samuchchaya. Religion. vaakyaatharatnam. Linguistics.. Linguistics. Literature.. Literature. Linguistics. Sanskrit. 500 pgs. Literature. 374 pgs. 1895. Linguistics. 475 pgs. Sanskrit. Sanskrit. Language. Philosophy. Language. RELIGION.. Sanskrit.. Sanskrit. shuuranaad'a krxjjanuu pilla.. pand-d'ita brahmashang-karamishra. mahakavi bhavabhuti. Sanskrit. Sanskrit. LITERATURE. Sanskrit. upasamhara vijaya. Linguistics. vaadanaqs-atramaalaa. Sanskrit... Linguistics. Literature. Literature. not availabe. uttaragiitaa.. jagadguru vijendra trtha. Linguistics.. 0. 1915. sanskritdocuments.. 62 pgs. 1908.. LANGUAGE.. 1957... Sanskrit. Theology. uttarapaqs-aavali. 1912.. Sanskrit. uttararaamacharitamu. 164 pgs. Psychology. Literature. 1835. Literature.. uttararaamacharitamu naat'akamu. Language. Language. uttararaamacharitamu. uttararaamacharitamu t'iikayaa sametamu. 1943. Language. Sanskrit. vaadaavalii. Literature. 1891.. hari naaraayand-a aapat e. 491 pgs. vaadanaakshatramaalaa puurvoottaramiimaamsa. 1977. 1956.org/…/SanskritIIIT. vaakyapadiiyamu dvitiiyobhaaga vaakyakaand-d'amu t'ikayaa ambaakartriivyaakhyayaa.. 1934.. shriibhavabhuti. 154 pgs. 0. Literature. 82 pgs. Literature. Language. uttaramiimaan'saa vidaantadarshanamu shaariirakanaamnaabhaashhyan' t'ippand-ii. 1980. shuuranaad'a krxjjanuu pilla... 572 pgs... Language.. 1823. Sanskrit. 0.… 161/167 . Language. Sanskrit. Literature. 536 pgs. Sanskrit. vaakyapadiiyamuu brahmakaand-d'amuu.. 384 pgs. Literature. 128 pgs. Language. 1103 pgs. 1903. 392 pgs. appaya diiqs-itaa. 212 pgs. 467 pgs. 1926.. LINGUISTICS. Language. uttaragitha.. 1988. Language. Linguistics. Language. Sanskrit... 0. Sanskrit. Appaya Dikshita. 56 pgs. Sanskrit.. Literature.. Sanskrit. Sanskrit. Sanskrit. shriimachchhan'karaachaarya. Language. Language. Language. bhartrxhari. Linguistics. Not available. 214 pgs. Psychology. shriibhaaskararaayonnitasetubandhaara. Sanskrit. Sanskrit. Literature. Linguistics. Sanskrit. -.. bhartrxhari. utsargapatrtramu. Literature. ushhaaparind-ayaprabandha.. Linguistics. upanishhadddakya koosha.. Literature. Language. vaakyavrxtti.. Language. Linguistics. Linguistics.. 366 pgs. 618 pgs. 1912.. uttararamacharitam.. THEOLOGY. Linguistics. 182 pgs. 1944.. shriimadgod'apaadachaarya. 216 pgs. vaadaavalii praaran'bhaha.

1892. 144 pgs. Linguistics. 1872.. Theology.. 0. 1923. Sanskrit. Linguistics.. gan'gaavishhnd-u shriikrxshhnd-adaasane. Linguistics.. Language.. 1943. mahaakavi subandhu. vaidikakoshha prathamo bhaaga. 65 pgs. Literature. Religion. vajjaalaggan. vachaspatya part 1. 1961... shriimatkaund-d'abhat't'a. bhat't'ojidiiqs-itulu. vaiyaakarand-abhuushhand-asaara abhinavasaralaa vyaakhyaaya t'ippand-ayaa samalang-krxtya. 476 pgs... vararuchaniruktasamuchchaya.2/14/2011 A list of scanned Sanskrit books at III… vaaraahagrxhyasuutramu. 166 pgs. 1961... 68 pgs. 1288 pgs. Sanskrit. Literature. Not available. 222 pgs.. Sanskrit. 1926. Linguistics. Literature. Linguistics. vaishampaayananitipraashikaa. Language. L. Literature.. Language.. Linguistics. Sanskrit.. shriimadraajaanakakuntaka. Sanskrit.. Language.. Sastri. bhat't'ojidiiqs-ita. 1932. 240 pgs. Language. vaishhnd-avadharmaratnaakara.. Linguistics. anantashaktipada.. Religion. Religion. Literature. Literature. 1923. vaidik sahitya charitram. Linguistics. 0. Language. 1958. Theology. Language. pi bii annangarachaarya. 374 pgs. vaiyaakarand-a bhuushhand-asaara.. 406 pgs. 134 pgs. P.. Religion. 375 pgs. Religion. 1822. 1927. S. a mahaadevashaastriind-a. bhat't'ojiidiiqs-ita. Sanskrit.. vaasavadattaa. Sanskrit. 270 pgs. 55 pgs. Language. 619 pgs. jayatirtha. 270 pgs.. vikhaanas. Sanskrit. Sanskrit. Linguistics. subramanya shastri p p. varivasya rahasya. Literature.. vaididasaahityacharitrama'm. sri t viraraghavacharya. 65 pgs. Language. Literature.. Linguistics. 1965. 198 pgs. 105 pgs.. vadavali.. vaishhnd-ava upanishhada. 122 pgs. vaatulanatha sutras vritti. Language. Sanskrit. Theology. shriikaund-d'abhat't'a. Language. Linguistics. Sanskrit. V. 1458 pgs.. 1952. Sanskrit... 1913. Language. 1828. Linguistics. Literature. P.. var^shhakrxdiipaka.. Sanskrit.. 1957. bhaskararaya makhin. Literature.. Religion. Linguistics. Theology. Sanskrit. vaiyaakarand-asiddhaantakaumuti paand-iniiyavyaakarand-asuutravrxtti. Language. Sanskrit. Literature. Dr.. vaidikamanoharaa. vararainugrxhiteshhu panj-chasuvijayeshhu. Mahamahopadhyaya. Sanskrit. Literature. 442 pgs. Chandrasekharan.… 162/167 .. Literature. 75 pgs.. Language. 1927. Linguistics. 1873. Sanskrit. Theology... Literature.. 1953. vasu charitam. Language. Linguistics. Language. Theology.... vaikhaanasadharmaprasna. Sanskrit. Sastri and K. vallabhapushht'iprakaasha chaaroon' bhaaga... vaiyaakarand-asiddhaantakaarikaa vaiyaakarabhuushhand-asaaravyavyaakhyaaya. 1933. vallabhapushht'ipradkaasha chaaroon' bhaaga. Sanskrit. Linguistics. 1934. Literature. 407 pgs. 804 pgs.. Sanskrit. Sanskrit.. 1828. Social Sciences. vaiseshika darsana. Sanskrit. sanskritdocuments. 568 pgs. Sanskrit.. Literature. Sanskrit. Literature. T. 1938.. kalahasti kavi.. Language. taranatha tarkavachaspati.. khemaraaja shriikrxshhnd-adaasa.. maadhava vaasudeiva. Sanskrit. khemaraaja shriikrxshhnd-adaasa.. vakrottkijiivitamu khopagn-avrxtti. Linguistics. 380 pgs.org/…/SanskritIIIT. Linguistics. General. Sanskrit. Language. 704 pgs.. shriimadvaadhulamahaachaarya. 1901. Kunhan Raja.. Linguistics. 1937. Sanskrit.. Literature. Literature. hamsaraaja. Language. vaiyaakarand-asiddhaantakaumudii. C. Literature. Sanskrit.

vedaantavichaaramaalaa. Sanskrit. Language. vedaantaparibhaashhaa dhameraajaadhvarendrakruti. Language. Literature. vedaantaraqs-aamand-ivimarsha chaturthabhaaga. veimabhuupaalacharitamuu. 166 pgs. Psychology. Literature. Linguistics. 1965. harikrxshhnd-adaasa goyandakaa. 145 pgs. vedhaantaraqs-aamand-ivimashe. Linguistics. vasu charitram. shrii baalaghanvi jaggu veng-kagaachaarya. 154 pgs... Literature. 1934. shrii bhagavad raamaanuja. veidaantaraqs-aamand-ivimarsha trxtiiyabhaaga. Literature. Language.. Sanskrit.. 1833... Language.. Sanskrit. vedaprakasa. Dharmaradhwarindra. veidaanta darshana brahmasuutra. Linguistics. 524 pgs. 142 pgs. Psychology. 1942. Sri Madhusudan Prabhuji. Literature.. 0.. 242 pgs. vedaantapan'chadashi. Literature.. 1949. shriimanmaharshhi vedavyaasa.. rayaprolu l somyaji..2/14/2011 A list of scanned Sanskrit books at III… vasu charitram. 1942. Linguistics. Sri Satyajnananda Tirtha. qs-emaraajashriikrxshhnd-adaasa. svaamii vidhyaananda sarasvatii.. Language. 314 pgs. Linguistics. Sanskrit. A. Literature. Sanskrit. Sanskrit. Linguistics. 1887.. Literature. 0. vedanta desika. Literature. 190 pgs.… 163/167 . Not Available. 580 pgs. Sanskrit. Literature. Linguistics. Language. 1937. 0. Language. Sanskrit. Linguistics. Sanskrit. pan' bhat't'ashriigauragoopaalashamaa. 1943.. Linguistics. Philosophy.. Sanskrit. Language. 219 pgs.. 0. 1965. Not available. Linguistics.. Psychology. 1959. Linguistics.gopalacharya... 1942. Language. 480 pgs. Philosophy. 0. Literature... Sanskrit. 1902. 230 pgs. Literature. Sanskrit. Sanskrit. Sanskrit. goopaalaachaarya. Philosophy.. Sanskrit. Philosophy. vedaartha bhuumikaa. 106 pgs. 176 pgs. Linguistics. shriimatsvaamidayaanandasarasvatii. Linguistics.. 0.. 1969.. Language. vedaang-gaprakaasha navamobhaaga vyaakhyaaya. vedaanta dharshana brahmasuutra sarala hin'dii vyaakhyamu. 233 pgs. Sanskrit. Linguistics. Language. vedaantadeepa bhaagha 2.. Language.. Literature. Language. Language... Sanskrit.. Sanskrit.... Swami Govindasingh Sadhu..org/…/SanskritIIIT. Literature. Sanskrit. Language. Sanskrit. Sanskrit. vedaantapan'chadashi. Not available.. Philosophy. veidaantabaalaboocdhini kramaan'ka 99.. 0. Religion.. Linguistics. -. Language. 1927. Sanskrit. Lingannasomayaji. Psychology. 463 pgs. Sanskrit. veidaantavijayamang-galadiipikaa. Literature. 370 pgs. Sanskrit. Philosophy. shriimaddharmaraajaadhvariindra. vedaanta darshana. 1992... vedaantaparibhaashhaa. 490 pgs. 0.. Sanskrit.. Linguistics. Literature. kalahasti kavi. 51 pgs. kalahasti kavi.. Linguistics... 617 pgs. Literature. vedantapanchadashi. Sanskrit.... 620 pgs. 1928.. sanskritdocuments. shriividyarand-aya.. Raja Sri Sri Rama Varma. 614 pgs.v. vedaantaparibhaashhaa. vedadhammevyaakhyaanamn. vedaantaparibhaashhaa.. Language. Language. 416 pgs. Linguistics. shriibhagavatpaadaachaarya. Literature. Psychology. 62 pgs. Psychology. 300 pgs. vedaantaparibhaashhaasan'graha. 1985.. Literature. Theology. 236 pgs. Language. Linguistics.

1923. 674 pgs. Sanskrit. Linguistics. Social Sciences. Literature.. vishhnd-usharmaa. 1917. 1916. Sanskrit.. 578 pgs. 1935. viiramitrodaya Part Vii. 1932. Language.. Language. viiramitroodayei bhakti prakaasha Vol. Literature. 0. 256 pgs. viiramitrodaya tiir^thaprakaasha. Literature. 1959. 147 pgs. Language.. Literature. 161 pgs. 1916. mitra mishra. mitra mishra. mahaamahopaadhyaayashriimitramishra. Mahamahopadhaya Pandita Mitra Misra. 1925.. vidhyaamaadhaviiyamu prathamasan'put'amu 1 5 adhyaaya. raamajii upaadhyaaya. vikramorvasiya. 394 pgs. Xxi. kalidasa. 266 pgs. Social Sciences.. Language. 1913.. vikramorvasiyam. Literature. Literature.… vishhnd ubhaktikalpalataa mahidharakrutayaa t'ikayaa Language Linguistics Literature Sanskrit 164/167 . kalidasa. Mahamahopadhaya Pandita Mitra Misra. Linguistics. 1972. 1917. 292 pgs. Mahamahopadhaya Pandita Mitra Misra. Language. Social Sciences.. Mahamahopadhyaya Pandita Mitra Misra. Linguistics. Sanskrit.. Literature. viiramitrodaya shraaddhaprakaasha.k. 382 pgs. Language. Literature. viiramitrodaya puujaaprakaasha. Literature.. Religion. Theology. vemana padyamulu. Language. srirama desikan siromani. Language. Linguistics. Language. shriimahaamahopaadhyaayashriimitramishra. Language. 381 pgs. 228 pgs. Literature.. 50 pgs.... nyaayaacharya.. Sanskrit.. Linguistics.. Sanskrit.... Theology. 501 pgs. Linguistics. 1925.. 225 pgs. vishatantram. Sanskrit. Language. Sanskrit.. mahaamahopaadhyaayashriimitramishra. Sanskrit. Linguistics.. Language. viduraniiti. Sanskrit. Mahamahopadhyaya Pandita Mitra Misra... Linguistics. Linguistics.. 614 pgs. Literature... 166 pgs. vend-iisan'haaramu. Social Sciences. viiramitrodaya laqs-and-aprakaasha. vish vekharaanandasan'sthaaniiya hastalekhasan'grahaparitaalikaa saacha khand-d'advayavatiisati. Sanskrit. Sanskrit. Literature. 1939. 577 pgs.ii. Literature. viiramitroodaya Vol. viiramitrodaya Part Ii. Linguistics. bhatta narayana. Linguistics. Literature.. 194 pgs. vin'shashataabdikan' san'skrxta naat'akamu. parameishvara. Sanskrit... Sanskrit. 494 pgs. Language. Sanskrit. Sanskrit. sanskritdocuments.. dr sir c p raamaswamy aiyar. shriikaalidaasa. Vishva Bandhu. Sanskrit. Sanskrit. 208 pgs.. Linguistics.. 158 pgs. Sanskrit. Sanskrit.. Linguistics.org/…/SanskritIIIT. Sanskrit. shrii veera raja charan gupta. ramamurti. 158 pgs. Language. 1903. Social Sciences. Sanskrit... jagadgurukrutayaa t'ippapyaa. 1913. 1936.... Theology. Literature. Sanskrit. Language. 1959. Linguistics. 0. Sanskrit. Linguistics. Sanskrit. 1070 pgs. vikramoovrashiiyamuu. Literature..x. Linguistics.. 383 pgs. viind-aalaqs-and-amuu. viiramitrodaya raajaniitiprakaasha bhaaga 6. viiramitrodaya paribhaashhaaprakaasha. viiramitrotayasya shraaddhaprakaasha. kaalidaasa.. 234 pgs. Linguistics. 1955. vidyamaacdhaviiyamuu. Religion. Language. Sanskrit. viiramitroodaya Vol.. Literature.2/14/2011 A list of scanned Sanskrit books at III… vekramorvasiyamu. Literature... Language. 610 pgs. 1962. 85 pgs.. 1906. Literature. Sanskrit.. venisamhara. 1914.s... Sanskrit.. vijaya vikrama vyayoga.. 0. Language. 1897. vidhyaamaadhava. 1913. Religion.. Linguistics.. 1991. mahaamahopaadhyaayashriimitramishra.

Language. 1963. Linguistics. Linguistics.. 1892. visvasanskrit shatabdi granth yojnaaya.. Linguistics. Philosophy. Religion. Language. 407 pgs.. Swetharnia Narayana. 1965. Linguistics.… 165/167 .. 118 pgs. Language. Sanskrit.. Sanskrit. Literature. Literature.. Language. Literature. Sanskrit.. 1953. Language. Language. Sanskrit. M. 1925. lakqs-mii narasin'ha bhat't'aa. 1965. Religion.. Literature. Sanskrit. 1909.. 516 pgs. vivarand-apajnikaa ashht'amo bhaagan. 382 pgs. Language. Literature. M.. Literature. Sanskrit. Literature. Sanskrit. Literature. Sanskrit. Language. nijagund-ashiva yoogi. vishhnd-usan'hitaa. viveikachin'taamand-i paart' I.. Literature. gan'gaavishhnd-u shriikrxshhnd-adaasa. 286 pgs. Sanskrit. Language. Kuberanath Shukla.. Rangacharya. Literature. Sanskrit. vivaakachuud'aamand-i kramaan'ka 93. 0. paramaanandachakravarti. Theology. Linguistics. Sanskrit. vyaakarand-a granthaa.. 298 pgs. Sanskrit. bhaaratiitiirtha. 511 pgs.. Language. shriisachchidaanan'dein'drasarasvati. Psychology. mahidharakrutayaa t ikayaa. Sanskrit.. K. Sanskrit. Rangaswamy Aiyangar.. Sanskrit. Sanskrit. Philosophy. 482 pgs. 264 pgs.. Not available. Theology. Religion. 354 pgs. shriikrxshhnd-aabhat't'a. Theology. vishhnd-udharmottaramahaapuuraand-a.. Language.. 1964. -.. vivarand-apajnikaa trutiyo bhaagan. 413 pgs.. vrxttivaartikamu.. Bhrga Samhita. vrxttamuktaavalii. b j sandesara. Sanskrit. shriimadappayadiiqs-ita.... Rangacharya. Rangacharya... Sanskrit. T. Literature. vrxttaratnaakara. Literature. Literature. 169 pgs. vishhvaksenasan'hitaa. Linguistics.. Linguistics. Theology.2/14/2011 A list of scanned Sanskrit books at III… vishhnd-ubhaktikalpalataa. vrxttaalang-kaararatnaadlii. 1957.. not available. 244 pgs. vushhabhaanujaa. Psychology.... 1895. 272 pgs. shriimaduraadaasa. vivarand-apajnikaa ekaadasho bhaagan. 1972. Linguistics.. vishhnd-udharmoottara puraand-e trxtiiya khand-d'a. vistaarikaavyaakhyaaya san'valita kaavyaprakaasha dvitiiyobhaaga. 268 pgs.v. Linguistics. sanskritdocuments.. Language.. Sanskrit. Sanskrit. Sanskrit. vivarand-aprameyasan'graha vidhaarand-ayamuniprand-ita Vol 5 Sanskrit Text.. Sanskrit. Not available.. vrxddhasuuryaaruund-akarmavipaaka. Language. Not available. 1964. Sanskrit. 1982. Sanskrit. Religion. Literature. Sanskrit. Sanskrit.. Linguistics. Language. 1962. Religion. Literature. Sri Kedara Bhatta. Religion. Ganapathi Sastri. Rangacharya. M. 1893. 725 pgs. Sanskrit. M. viveikachuud'aamand-i.. 518 pgs.. Religion. Linguistics. Religion.. 120 pgs.org/…/SanskritIIIT. 2001.. 1814... Language. 62 pgs. 1879.. vrajavilaasa. vuttamautkika. 1972. 1961. 186 pgs. shriishn'karabhagavatpaada. Religion. 0. 146 pgs. vratakaand'amu chado bhaagan... 44 pgs. Ramasastri Tailanga. Literature. 376 pgs. vivarand-apajnikaa saptamo bhaagan. Sanskrit. Linguistics. 1956.... Linguistics. T P Upadhyaya.. 440 pgs.. Not available. 147 pgs. vivarand-aprameyasan'graha... Sanskrit. 0. Language. 440 pgs. Sanskrit. vivarand-apajnikaa dashamo bhaagan... Linguistics. 0. 1958. vivarand-apajnikaa dvadasho bhaagan. 1931.. M Rangacharya.. Language. 676 pgs. vivarand-apajnikaa dvitiyo khand-d'an. 327 pgs. Linguistics.. 1940. 237 pgs. 1926. Linguistics. viveika chuud'aamand-i. 1942. Religion.. 988 pgs. Linguistics. Literature.

Linguistics. 114 pgs. Philosophy. 0. Literature. 310 pgs. yajnj-avalkyasmuti Vol I. vyaasasan'grahamu nov 1933. Sanskrit.. Sanskrit. vyaktiviveka of rajanaka sri mahimabhatta. pand-d'ita veing-kat'araamashammrond-aa. Linguistics. 0. 306 pgs. Sanskrit. Sanskrit.. Philosophy. Theology. Sanskrit. bapu shastri moghe. Sanskrit. vyaasaadhikaarand-amaalaa. Literature. Sanskrit.org/…/SanskritIIIT. Religion. Language. Linguistics. 680 pgs.. 1892. vyutpattivaada guud'haarthatattvaaloka... yogiishvarend-a maharshhind-aa yaagn-avalkyena. Not available. -. 98 pgs. 166 pgs. Linguistics. vyaakarand-abaalabodha prathamobhaaga.. J. Not available.. Balasubramanyam. vyutpattivaada.. Sanskrit. 1150 pgs. 1931.. Language. LITERATURE.. Language. Sanskrit. Linguistics. Sri Varadaraja. Sanskrit. shriiraajaanakamahimabhat't'a.. Sanskrit. shriimadagadaadharabhaat't'aachaarya.2/14/2011 A list of scanned Sanskrit books at III… vyaakarand-a puurvapashnaavalii.. vyakaran siddanta kaumadi. 1977. 1986. vyaaptipanj-chakamu. 190 pgs.. 630 pgs. Linguistics. LANGUAGE. yaadavaabhyudaya. Language.. rewaprasada dwivedi. Language. Language. Literature. Linguistics. shriiniilakand-t'habhat't'a. Not available. vyaaktiviveka vyaakhyaaya madhusuudaniivivrxtyaa. Linguistics. 0. Pandit Durgaprasad.. Psychology. 0.. Sri Maha Mahopadya Kapisthalamdesikacharya. Psychology. 556 pgs. Sanskrit.k. Social Sciences. Linguistics. yaagn-avalkyasmrxti viiramitrodaya mitaaqs-araa t'iikayaa.. Linguistics. Language. LINGUISTICS.. Literature.. Literature. shriimadagadaadharabhat't'aachaarya.. 270 pgs. 283 pgs... 1993. vyakaran pradip. 1929.. shriimathuraanaathatarkavaagiisha. Sanskrit. Literature. Linguistics. Literature.. Language. vyaasataatpayenind-eya. Theology. 886 pgs. vyaatpipanj-chakarahasyamu sin'havyaadhralaqs-and-arahasyan. yaajushha jyautishhan' bhaashhya aarcha jyautishhan. Literature. Linguistics. Language. sircar mk. hari naaraayand-a aapat'e. Language. 0. sanskritdocuments. shriivedaantachaarya. Linguistics. 0.… 166/167 . Language. 1929. Linguistics. vyaasashiqs-aa.. mahaamahopaadyaya kapistalama desikaachaariyara. gopaalashaastrind-aa. yaagn-avalkyasmrxti trxtiiyaavrxtti.. 0. Linguistics.. 1964. 430 pgs.. 1927. Literature. Linguistics. Language. Linguistics. vyaasashiddhaantamaataand-d'a. vyutpattivaada guud'haarthatattvaalokena samudbhaasita. Literature. LITERATURE.. Sanskrit. Language. 1933. Literature.. 1908. Sanskrit. Sanskrit. Literature. 90 pgs.. Language.. 0. vyaasasiddaantamaartaand-d'a. vyavahaaranir^nd-aya.. Sanskrit. 484 pgs. Sanskrit. 1230 pgs. Sanskrit.. Sanskrit.. Literature. Literature.. Literature.. 568 pgs.. 492 pgs.. vedavidhaalaya. Literature.. Language. 1892. Linguistics. 722 pgs. Sanskrit. Sanskrit. 1942. Sanskrit.. vidvadbhi ke vi subrahmand-yashaastrii. LANGUAGE.. Language. 480 pgs. Language. Literature.. LINGUISTICS.. Language. Literature. Religion. Linguistics... 1950.. 1937. Sanskrit.. 76 pgs. yaajnd-aavaalkyasmrithi. 0... Language. 122 pgs. shriimitramishra. Sanskrit. somaakarasudhaakara. 1942. 116 pgs. Literature... 124 pgs. vyavahaaramayuukha miimaan'sa. vyadhikarand-aprakarand-amuu.

yogavaasishht'a bhaashhaa bhaaga 2 6 t'haa nirvaand-aprakarand-a puurvaarddhottaraarddha. 246 pgs. 597 pgs. 226 pgs. 484 pgs.... yudhishht'hiravijayamu vyaakhyaaya.. 218 pgs.. khemaraaja shriikrxshhnd-adaasane. 202 pgs. Not available. Language.. 1849. Linguistics. Language. Religion.. Sanskrit. 802 pgs. Sanskrit. Sanskrit. Religion. 616 pgs. Sanskrit. Literature.... yashasitalakamu. navare ityupaabhidhakrxshhnd-asharmand-a. 1909. Literature. 1903. Sanskrit. Sanskrit. 1919. Literature. 1983. Sanskrit. 0. Sanskrit. Literature. Language.. 1857. Philosophy. yuktimallikaa. Language. Theology. 1897. Sanskrit. 1884. Linguistics. 493 pgs. shriishrutasaagarasurikutayaa. 1946.. Sanskrit. yojavaar^tikama~.org/…/SanskritIIIT...… 167/167 . hari naaraayand-a. Sanskrit.. Linguistics. Literature. Linguistics. 1949. Linguistics. Language. yogaratnasamuchchaya dvitiyo bhaaga. 322 pgs. 0.. Literature. vaajasaneyi madhyaandina shukla. yoogavaasishht'he. yudhishthiravijayamu.. yuktimallikaayaan'gund-asaurabhan. 1903... Not available.. 969 pgs. Sanskrit. yatiindramata diipika. Language. 1 0-9 A-D E-H I-L M-P Q-T U-Z sanskritdocuments.. yoogasandhyaa. Literature. Not available... Language. Language. Linguistics. Search matched 4853 books with 1743368 pgs. Linguistics. Literature. Language. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit. ghatikasatam vatsya varadacharya. shriivaasudeva. 212 pgs. 252 pgs.. Language. yajurveda san'hitaa. Linguistics. yathiraja vijaya natakam. Linguistics. mahaakavi shriivaasudeva.. Literature. 802 pgs. 126 pgs. Language. 0. Theology. Sanskrit. yogaratnaakara vaidyakagran'tha dvitiiyaasrxti... Not available. Sri Vijnana Bhikshu. khemaraaja shriikrxshhnd-adaasane. Sanskrit. Literature.. Psychology. 1834. Literature. Linguistics.

Sign up to vote on this title
UsefulNot useful