2/14/2011

A list of scanned Sanskrit books at III…

12780 laghupaaraasharii... gagaavishhnd-a shriikruushhnd-adaasa, General. Sanskrit, 2005. 44 pgs. 127801 vrxddhayavanajaatakama... davis pingree, General. Sanskrit, 2005. 452 pgs. 12782 kaavyaadashar... acharya ramachandra mishra, General. Sanskrit, 2005. 332 pgs. 12783 muhhuurtachintaamand-i... narayana acharya, General. Sanskrit, 2005. 492 pgs. 12787 taajikaniilakand-t'hii... pandit srimadhukantagana jyotishacharya, General. Sanskrit, 2005. 478 pgs. 12789 liilaavatii... pt.shri lakhanlal jha, General. Sanskrit, 2005. 386 pgs. 12790 rupachandrikaa... ramachandrajhaa vyaakarand-aachaayra, Religion. Theology. Sanskrit, 0. 318 pgs. 12790 rupachandrikaa... ramachandrajhaa vyaakarand-aachaayra, Religion. Theology. Sanskrit, 0. 672 pgs. 12793 sachitra jyotishha - shiqs-aa... b.c thakur, General. Sanskrit, 2005. 270 pgs. 12794 jyotishha vdaaraa roga upacchara... prem kumer sarma, General. Sanskrit, 2005. 214 pgs. 12795 shatayoogaman'jari... madhurakrishnamurthy sastry, General. Sanskrit, 2005. 92 pgs. 12796 muhuurtadarpand-amu... vavilla rama swamy sastrylu and sons, General. Sanskrit, 2005. 180 pgs. 12798 vitti evan' vuutti prabandha... aacharya mukund devagna, General. Sanskrit, 2005. 254 pgs. 12802 Jyotishha ratnaakara... devakiinandana sih, General. Sanskrit, 2005. 1118 pgs. 12803 dasharsurpakamuu... keshavaraava musalagaavakara:, General. Sanskrit, 2005. 574 pgs. 12804 saahityadaprand-ama... aachaariya sheshharaajashamaa regmii, General. Sanskrit, 2005. 1146 pgs. 12805 chamatkaara chintaamand-i... malaviyadaivajna dharmesvara, General. Sanskrit, 2005. 556 pgs. 12807 bharatiiya jyotishha... nemichandra sastri, General. Sanskrit, 2005. 450 pgs. 12808 sachitra jyotishha shiqs-a... b.c thakur, General. Sanskrit, 2005. 904 pgs. 12809 shhad'avagar phalamuu... krishan kumer, General. Sanskrit, 2005. 450 pgs. 12810 ladhupaaraasharii madhyaparaasharii... kedaaradatta joshii, Religion. Theology. Sanskrit, 0. 128 pgs. 12811 vrxddhayavanajaaakamuu... davis pingree, General. Sanskrit, 2005. 414 pgs. 12812 vasan'taraajashaakuna... -, General. Sanskrit, 2005. 610 pgs. 12815 saaraavaali... -, General. Sanskrit, 2005. 400 pgs. 12816 sarvaarda chin'taamand-i... sri kambampati ramgopalamurthy, General. Sanskrit, 2005. 328 pgs. 12817 maanasagarii... Dr . ramachandra pandey, General. Sanskrit, 2005. 540 pgs. 12818 brxhatparaasharaherashaastramu... madhurakrishnamurthy sastry, General. Sanskrit, 2005. 408 pgs. 12819 sachitra jyotishha shiqs-a... bii . ela . t'hakura, General. Sanskrit, 2005. 286 pgs. 12821 jyothisyashhabdakoshha:... Pandit Sreemathru Prasadha Pandeya, General. Sanskrit, 2005. 440 pgs. 12822 sachitra jyotishha shiqs-a... b.c thakoor, General. Sanskrit, 2005. 252 pgs. 12823 jyautishha- san'hhitaa... aacharya baskaranand lohini, General. Sanskrit, 2005. 272 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 1/167

2/14/2011

A list of scanned Sanskrit books at III… 12824 bhuvanadiipaka... pandit kashiram, General. Sanskrit, 2005. 88 pgs. 12826 svapnavaasavadantamuu... gang-ga'saagararaaya:, General. Sanskrit, 2005. 278 pgs.

12828 jyotirveidan... gobboru venkatananda raghavarao, General. Sanskrit, 2005. 230 pgs. 12831 prashnachand-d'oshvara... pandit vishnu dutt, General. Sanskrit, 2005. 88 pgs. A Catalogue Of Sanskrit And Prakrit Manuscripts In The Rajasthan Oriental Research Institute Part Iii A... Muni Jinavijaya, Unknown. Sanskrit, 1967. 626 pgs. A Cattalouge Of The Sanskrit Manuscripts... Dr.aryendra Sharma, Unknown. Sanskrit, 1964. 338 pgs. A Critique Of The Brahmasutra Part 1... P M Modi, Unknown. Sanskrit, 0. 530 pgs. A Critique Of The Brahmasutra Part 2... P M Modi, Unknown. Sanskrit, 1956. 422 pgs. A Descriptive Catalogue Of Sanskrit Manuscripts Volume I Part Ii... T P Upadhyaya, Religion. Sanskrit, 1953. 266 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts... P P S Sastri, Unknown. Sanskrit, 1929. 530 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts... Vidya Sagara, Unknown. Sanskrit, 1934. 452 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts Vo Iii... P P S Sastri, Unknown. Sanskrit, 1929. 632 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts Vol 14... Tanjore Maharaja Serfoji S, Unknown. Sanskrit, 1932. 523 pgs. A Dictionary English And Sanskrit... sir monier monier williams, Unknown. Sanskrit, 1957. 666 pgs. A Dictionary Of Sanskrith Grammar... Kashinath Vasudev Abhyankar, Unknown. Sanskrit, 1961. 436 pgs. A Grammatical Dictonary Of Sanskrit Vedic... Surya Kanta Sastri, Unknown. Sanskrit, 1953. 308 pgs. A Grammatical Word Index To Atharvaveda... vishva bhandu, Unknown. Sanskrit, 1963. 734 pgs. A Grammatical Word Index To Rigveda... Vishva Bhandhu, Unknown. Sanskrit, 1963. 648 pgs. A Grammatical Word Index To Taittiriya Samhita... vishva bhandu, Unknown. Sanskrit, 1963. 376 pgs. A Grammatical Word Index To The Four Vedas... Vishva Bandhu, Unknown. Sanskrit, 1963. 506 pgs. A Grammatical Word Index To The Principle Upanisads... vishva bandhu, Unknown. Sanskrit, 1966. 579 pgs. A Handful of Popular Maxims... Dr.m.d.balasuramanyam, Unknown. Sanskrit, 1983. 336 pgs. A Short History Of Sanskrit Literarure... T K Ramachandra Iyer, Literature. Sanskrit, 2002. 220 pgs. A Study Of Bharatas Natyasasatra And Avaloka On Dhananjayas Dasarupaka... Dr Manjula Gupta, Unknown. Sanskrit, 1987. 342 pgs. A Vedic Word Concordance Vol 5 Part 2... Visva Bhandu, Religion. Sanskrit, 1965. 174 pgs. A Vedic Word Concordance Vol Ii Part Ii... Visva Bandhu Sastry, Religion. Sanskrit, 1936. 746 pgs. Aachaara Bhuushhand-ama~ Grantha 57... Paahatryambaka Oko, Religion. Theology. Sanskrit, 1908. 449 pgs. Aachaara~yaa Abhyudayaa... D'indi'ma Raajanaatha~, Language. Linguistics. Literature. Sanskrit, 1945. 130 pgs. Aachaarendu Grantha 58... Aapat'e Hari Naaraayand-a, Religion. Theology. Sanskrit, 1909. 415 pgs. Aadhaanapadhdati... Aapat'e Mahaadeva Chimand-aajii, Religion. Theology. Sanskrit, 1947. 145 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 2/167

2/14/2011

A list of scanned Sanskrit books at III… Aagaashe Ispupaahai Gran'tha 5... Aapat'e Hari Naaraayand-a, Philosophy. Psychology. Sanskrit, 1912. 103 pgs.

Aanandakandachampuu... Mishraa Mitra, Social Sciences. Sanskrit, 1931. 260 pgs. Aapastambashulbasutrama~... Aapastan'ba, Philosophy. Psychology. Sanskrit, 1931. 352 pgs. Aapastambiiyan' Shraotasuutrama~... Chaara~ya Narasin'haa, Religion. Theology. Sanskrit, 1944. 816 pgs. Aapracharya Yasak Ki Vedvyakhya Paddhati... Dr Gyan Prakash Shastry, Unknown. Sanskrit, 1985. 164 pgs. Aapradarshprastavmala Vol I... Pandit Sri Vishwanath Shastry, Unknown. Sanskrit, 1951. 147 pgs. Aaprayyorday Kavyam Poorvadharm... Pandit Ganga Prasad Upadhyay, Unknown. Sanskrit, 0. 250 pgs. Aapstamba Shulba Suutrama~... Chaara Shriinivaasa, Religion. Theology. Sanskrit, 1931. 352 pgs. Aara~tha Shaastra Padasuuchii Trxtiiyo Bhaaga... Shaastri Shamaa, Social Sciences. Sanskrit, 1925. 358 pgs. Aara~thavara~nd-a Jyotishhama~... Dattaa Bhagavata, Religion. Theology. Sanskrit, 1924. 45 pgs. Aara~yaasaptashatii Faskikyulasa~1,2 Cha... Shriivishveshvaraapand-d'ita, Religion. Theology. Sanskrit, 1925. 376 pgs. Aashvalaayana Shraota Suutrama~ Prathamo Bhaaga... Shaastri Man'gala Deva, Religion. Theology. Sanskrit, 1938. 187 pgs. Aath Shri Madrunu Bhasyam... Shri Vallabha Charya, Unknown. Sanskrit, 0. 792 pgs. Aath Shrimadbhagwatha Darshini Ekhadarshaskarandra Prarbhaythe... -, Unknown. Sanskrit, 0. 478 pgs. Aath Smrithisaarodhwarprarambh... -, Unknown. Sanskrit, 0. 102 pgs. Aath Vamanpuranam Prarabhyathe... -, Unknown. Sanskrit, 0. 420 pgs. Aatmadarshanam... Vedhanth Anjaneyakumara Swamy, Unknown. Sanskrit, 1987. 178 pgs. Aatyoug pradipika... Shemraj Shri Krishnadass, Unknown. Sanskrit, 1874. 236 pgs. Aayura~vedasutrama~... Yogaanandanaatha, Philosophy. Psychology. Sanskrit, 1922. 356 pgs. Abhidavimarsh... Yogeshwar Dutt Sharma, Unknown. Sanskrit, 1980. 150 pgs. Abhidhaana Ratnamaalaa... Aupharet'a, Language. Linguistics. Literature. Sanskrit, 1928. 419 pgs. Abhidhana Manjari Of Bhishagarya... Shankar Sharmana, Unknown. Sanskrit, 0. 530 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrit Vol I... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 1056 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrit Vol I I I... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 1378 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrith Vol I V... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 1297 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrithvol I I... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 728 pgs. Abhidhanarajendrah Prakriti Magadhi Sanskrit Vol 6... Vijayarajendra Suri, Unknown. Sanskrit, 1985. 1482 pgs. Abhidhanarajendrah Prakriti Magadhi Sanskrit Vol 7... Vijayarajendra Suri, Unknown. Sanskrit, 1985.
sanskritdocuments.org/…/SanskritIIIT.…

1217

3/167

Sanskrit. Sanskrit. Abhidhara~maasamuchchayasya.. 1964. Asan'gaa. 1950. 993 pgs. 130 pgs. Abhisamayalankara Prajnaparamita Upadesa Sastra. Aapat'e Hari Naaraayand-a. 0.. Technology.5... Abhinavam Prasutitantram First Edition.. Advaitasiddhi Prathamasamput'ama~. Philosophy. Literature. Srimath Paramhans Parivrajakachary.. Unknown. E. Sri Guru Prasad Shastry. Sanskrit. Acharya Jinabhadras Visesavasyakabhasya Part Iii. 161 pgs. Th Aufrecht. Unknown. 0. Sanskrit. Sanskrit. 1950. Philosophy. Sarasvatii Madhusudhanaa...2/14/2011 A list of scanned Sanskrit books at III… 1217 pgs. 464 pgs. Philosophy.4. 210 pgs. Sanskrit.. Unknown. Sanskrit.. Unknown. 1933.. Abhidharmamrta Of Ghosaka. Vijayarajenda Suri. 1618 pgs. 120 pgs.. Sanskrit. Rasiklal C. 1990. 648 pgs. Unknown. 1861. 1900. 1982. Abhinavaratnamaala Davitiiya Bhaaga. Srimannarayana. Theology... Abhidhanarajendrah Vol. 0. Sanskrit. 364 pgs.. Abhijnana Sakuntalam Of Kalidasa. Theology.. 1991. Sanskrit... Theology... Dalshuk Malvania. 405 pgs. Shaastri Vaamana. Theology. Sanskrit... Unknown. Sri Viswanatha Shastri Prabhakar. 690 pgs. Religion. Abhidhanarajendrah Vol. Unknown. 304 pgs. Sanskrit. Paand-d'uran'ga Oke Mahadevo. Pandith Damodar Sharma Gaud. 532 pgs... Abhidharmakocarikah. Sanskrit. Sarasvatii Madhusudhana. 260 pgs.. 1910.. Religion. Vijayarajendra Suri. Religion. Narakand-t'hirava Shaastri Vat't'ipalli. Acyutarayabhyudaya Of Rajanatha Dindima. Bahadur Chand Chhabra. Unknown.. 1937. Unknown. Abhilekha Sangraha Sixth Khandah. 518 pgs. Sanskrit. Unknown.. Sanskrit. 1953. 1910. 1950. 1945.. Psychology. Abhinava Vaasavadatta. 879 pgs. Sanskrit. Shanti Bhikshu Sastri.. 134 pgs. 0. 284 pgs. Agnihotra Chandrikaa Grantha 87. Parikh. Adhyathyamramayana Vol Iii.. Sanskrit. Ghoshhaka. Social Sciences.. Sanskrit. Adharva Vedha Samhitha. Pandit Ramachandra Sharman. Abhidhara~maamrxtama~. Sanskrit. Unknown. Abhijnana Sakuntala. 1992. Abhijnana Sakuntalam Naam Natakam. Abhijnana Sakuntalam Of Kalidasa. 1922.. Sanskrit.. Psychology. Unknown. 1940. sanskritdocuments. 732 pgs. Mahakavi Kalidasa.... Abhidhanaratnamala. Unknown. Sanskrit.. Sanskrit. Advaithdeepika..… 4/167 . Adharsha Prasthav Rathnamala. Agnipuraand-ama~ Grantha 41. Advaitasiddhi Trxtiiyasamput'ama~. Aasn'ga.. Unknown.. Mr. 152 pgs. 1301 pgs. Sanskrit. 882 pgs. 100 pgs. Sarasvatii Madhusudhana.. 1992.. Language.. Sanskrit. Unknown.. Sanskrit.. Unknown.kale. Sanskrit.obermiller.... 522 pgs. Satavadhana Srinivascharya.. Sanskrit. Unknown. Unknown.. 208 pgs. 1968. 1950.. 1921. 620 pgs. Psychology.org/…/SanskritIIIT.. A N Krishna Aiyangar. 0. Abhidhara~masamuchchaya. Sanskrit.. Sri Chelamcheral Rangacharya. 172 pgs. Unknown. 326 pgs.. 1953. Sanskrit... Sanskrit. Sanskrit. Religion. 170 pgs. Vasubandhu... Addaitasiddhi Dditiiyan' San'skarand-an. 1912. 40 pgs... Linguistics. Acharya Ddhruva Smaraka Grantha Vol 3. Ganesh Kashinath Kale. 0.. Abhijnana Sakuntalam. Unknown. 1946. Unknown. 194 pgs. Abhijnana Sakuntalam.

Sanskrit.. Sanskrit. brahmananda tripathi. 1927. Sanskrit... H L Jain. Paand-d'eya Shriivishveshvara. 339 pgs. 1987. Parakaalasvamii Shriikrxshnd-abrahmatantra. 1923. Religion.. 441 pgs. Sanskrit. Amara Bharathi Astami Kaksha. 1923. Literature. Lokanatha Chakravarthin... Sanskrit. Alang-kaaramand-ihaara~ Chatura~tho Bhaaga.. 100 pgs. Sanskrit. Sanskrit.. Subrahmanya Sharma. 1931.. Unknown. 1981.. Literature. 139 pgs. Parakaalasvaamii Shriikrxshhnd-abrahmatantra.… 310 pgs 5/167 . Alankara Sangraha Of Amrtananda Yogin. 1921. Alankarathatvascha. Sanskrit. Sanskrit.. Alang-kaaramand-ihaara Prathamo Bhaaga. 134 pgs. Suranad Kunjan Pillai. Alphabetical index Of The Sanskrit Manuscripts Vol I. 1929. Unknown. Theology. Shastrii Esa~ena~. Parakaalasvamii Shriikrxshnd-abrahmatantra. Linguistics. Amarakosa Namalinganusasanam Of Amarasimha.. Ajnanadhavanta Candabhaskarah. Literature.. 1964. Surya Narayana Murty. Sanskrit. Unknown. Sanskrit. 282 pgs.. Language. Linguistics. Sanskrit. Sanskrit.. 449 pgs. v krishnamacharya. 1984. Literature... 252 pgs. Religion. Sanskrit. Unknown. Sanskrit.. Art. Language. Parakaalasvaamii Shriikrxshhnd-abrahmatantra. Jaggu Venkatachari. Sanskrit. Alang-kaaramand-ihaara Da~tiiyo Bhaaga... Sanskrit. Literature. 0.. Biography..sivadatta. Literature. Biography.. Akaradhanukrmanika. Anantakrisna Sastri. 319 pgs. Unknown. Amara Bharathi. Gaurinath Sharmana. 138 pgs. Literature. Aanandagiri. Alankarakaustubha Of Kavi Karnapura. Sanskrit. Unknown. Sri Amaru Kavi. Mm.. 338 pgs. C.. Alankaraustubha Of Visvesvara Pandita. History. 1942. Religion.v. Unknown.. 94 pgs. 559 pgs.. All India Oriental Conference Thirteenth Session Nagapur University October 1946. Alang-kaaramuktaavalii. 262 pgs. Language.. Alang-kaaramand-haara Trxtiiyo Bhaaga. Language.. Parakaalasvamii Shriikrxshhnd-abrahmatantra... 1986.. Akasmika Dana Laba Ke Yoga.. Sanskrit. 1983. Language.. 1982. Religion. Alang-kaaramand-ihaara Chatura~tho Bhaaga. 662 pgs. 1949. Sanskrit. 876 pgs. Sri Bharateeya Yogi.. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Aitareya Brahmana Of Sadgurusisya Vol I 1 To 15 Adhyayas. 1923. Alamkarasamgraha Of Amrtanamdayogin. Dr Raj Kumari Trikha. Enter Subject Of The Book. Linguistics.. 1957. 1982. History. Theology. Unknown. Sanskrit.. 98 pgs. 1997. Unknown.s. 1943.. Alamkaras In The Works Of Banabhatta.. Aldankar Sarvasvam. 242 pgs. Theology. 369 pgs. Language. Alang-kaara Kaumudii. 1950. 1929.. Sanskrit. Misropahvedacharyapandithsrivamshidharshastriyna. Kondapudi Apparao. sanskritdocuments.. Unknown. 1996. 520 pgs. 1917. 46 pgs. Sanskrit.. Sanskrit. Sanskrit. Aitareyopanishhata~ Panj-jamii Khand-d'a Grantha 11.. 334 pgs. Parakaalasvaamina~ Shriikrxshhnd-abrahmatantra. 69 pgs... Alang-kaaramand-ihaara Trxtiiyo Bhaaga. 0... 368 pgs..org/…/SanskritIIIT.. Linguistics. 1951. Linguistics. Sanskrit. Amara Shatakamu. Alankaramand-ihaara Trxtiiyo Bhaaga. 366 pgs.. Theology.. k bhaskara rao. Linguistics.. R. 182 pgs. Sanskrit. Geography. Unknown... Parakaalasvaamii Shrii Krxshhnd-abrahmatantra. Geography.

Sanskrit. Anekartha Tilaka Of Mahipa. Shriimuraarimishra Mahaakavii. Unknown. Literature. 168 pgs. Unknown.. Sanskrit... 305 pgs.... 1952. 1955.... Unknown. Mr.. Language. Language. Unknown. 0. Sambu Prasad.. Amelioration Genetique Des Arbres Forestiers Forets 20.. Amarkosh Namalingaanusasana. Sanskrit. 709 pgs. Sanskrit. 328 pgs. Annamacharya And Surdas. Anthya Karmadeepika.. 1979. 1947. Sanskrit. H H Wilson. Sanskrit. Dr Ram Naresh Tripathi.. Amarakosah Dwithiya Khandah... Unknown. 138 pgs..s. Unknown.. Unknown... Amarzakosha Vigraha Comm.. An Anthology Of The Epics And Puranas.. Religion. Jean Paul Lanly.… 6/167 .. Linguistics. 358 pgs. Sanskrit. Anandh Samastha Granthavali. A N Upadhye. 1936. Sanskrit. Sanskrit. 1864. Chandra Sekhara Sharma. 242 pgs. Linguistics.aruna Gupta.. 1999. Sanskrit. 375 pgs. Haragovinda Sastri. 1970. Unknown. An Anthology Of Poetry And Drama Part I. 1985. History.. 1981. An Introdution To The Grammar Of The Sanskrith Language. 236 pgs. 1993. 1939. Sanskrit. 268 pgs. 1947.. 314 pgs. Unknown. Viswanath Bhatt. Shiromani Sannidhanam Suryanarayanshastry. Annanda Sramasamskrutha Grandavali. Sanskrit. Andhra Bhagvthanuvad. 1995. . Unknown. Amarkosha Of Amarsingh. Anara~gharaaghavama~ Trxtiiyo San'skarand-ama~.. Anekaathara~tilaka. Sanskrit. Literature. Geography.. 258 pgs. Literature. 1947. Amerika Bhaaga Pahilaa.. 0. 1986. Sanskrit.. Unknown. Sanskrit. 468 pgs... Sanskrit. Unknown.. Unknown. Mahiipa. 377 pgs. 168 pgs. Sanskrit. Sanskrit. 130 pgs. Sanskrit. Sanskrit. Nithyananda Parvathiya. pgs. Anandashramasanskruthagranthavalihi. Sanskrit.s. 1971.org/…/SanskritIIIT. Pandith Haragovinda Sastri. 0.. Prof. Sanskrit. Unknown. 1998.. 524 pgs. Unknown. 571 pgs. 300 pgs. M. Sanskrit.. sri amar singh. Sri G A V Ms Uppalacharyulu. Amarkosh Pratham Kandam. Sanskrit. 1969. Sanskrit. Madhukar Mangesh Patkar. Sanskrit. Literature.. Mahiipa. 239 pgs. Sanskrit.. 233 pgs.. Literature. 194 pgs... 1984. Ananda Ramayana. Amarakoshah. 358 pgs. Sanskrit. 1952... Ancient Indian Economic Thoughts. 400 pgs. 1990. Anandasundari.. 745 pgs. 66 pgs. Mamchala. Anandasramsanskritgradhavali. Dr. Anandanandini. Sanskrit. Jaganadha Rao. Ogale Gurunaathaprabhakara.. Language. Ramaswarupa Bholanath Pandit. An Anthology Of Subhashitas Part Two. V Raghavan.. Anu Bhashya Vallabhacharya Art Sanskrit 1921 495 pgs sanskritdocuments. 70 pgs. Sanskrit.snankarsastri marulkar.. Linguistics. Shriman Mahadev Chmanji Aftee... Sanskrit. 1866. 1983..r.. Dr V Raghavan.. Anekaara~thatilaka. Unknown. Unknown. Unknown. 136 pgs.kale.. 1984. General.. Anandashram Sanskrith Granthavali Trishtlisethu.. 2000. 1940. Arjunavarmadeva. Kuttakarshiromani... Sanskrit.tirupati. 1932.. V. Narayan Bhatt.. S K De. 1961. Biography. -. 336 pgs... Ttd.. 736 pgs. Amarakosa of Amarasimha. Unknown.2/14/2011 A list of scanned Sanskrit books at III… 310 pgs. Unknown. Amhar Vani (sathvi Kaksha). Theology. 388 pgs.. Literature.. Amrau Shatakam. Unknown. Unknown. An Indian In Western Europe.

0.. Unknown.. Sanskrit. Philosophy. Sanskrit. 720 pgs. .. 122 pgs. 1940. Anuvrath Vidhya Trishati. Asalayina Gruhasutram. Unknown.. Unknown.. Shaastri Shamaa. Architecture Of Manasara.. D Srinivasacharya. 247 pgs. 0.. Sanskrit... . Religion. Unknown. Unknown. Unknown. Arthasastra Of Kautilya.. Ara~tha Shaastra Padasuuchii Dditiiyo Bhaaga. Ganapati Sastri.. Social Sciences. 72 pgs. 1931. 1955. Srinivasa Murti. 1924. Sanskrit. Swamy Pramodgiri Vedanthkishore. Unknown. Ara~thashaastrapadasuuchii Prathamo Bhaaga.. 262 pgs. Sanskrit. Sanskrit. Sanskrit. Sanskrit. 896 pgs. prasanna kumar acharya. Unknown. 0..2/14/2011 A list of scanned Sanskrit books at III… Anumana Pramana. Somraj Krishna Das. Apastambasrautasutra Dhurtasvamibhasya. Popatbhai Ambashankar Mankad. Ved Prakash Shastri.. Sanskrit. 0.... 1927. Unknown. Maharshi Panini. 157 pgs. -.. Aryavidya Sudhakara.. Sanskrit. A Chinna Swami Shastrulu. 459 pgs. 473 pgs. 1924. 1950.. Ara~tha Shaastra Padasuuchii Prathamo Bhaaga.. 277 pgs. Sanskrit. 469 pgs. Sripad Damodar Satvalekar. 1925. Arthasatra Of Kautilya Vol Ii. 0. 865 pgs. Unknown. Ramachandra Sharma. Language. Sanskrit. Dhamodar. 1923.. 1951. Unknown. 552 pgs. Vidwan Shivasri.. R Shama Sastry. 1950. 588 pgs... Sanskrit.. Social Sciences. 1998. Apabhran'shakaavyatrayii.... Unknown. -. Pandith A Chinnaswami Sastri. Unknown.. Astadhyayisutrapatha. Sanskrit. Ashvinao Devtaki Bhoomika.. Astadasasmrtayah. 1928... 1924. 367 pgs... Unknown. Unknown.t. Ardh Srimadbagavathardha Dharsan.. Sanskrit. Sanskrit.. Arthvaved Sanhita. 1950. 469 pgs. 472 pgs. History. Sanskrit.. Unknown. Sanskrit. Dr Bali Ram Shukla. . Psychology. 1924...… 7/167 . 1064 pgs. 1955... Anuvaada Kalaa Athavaa Vaga~vyavaharadara~sha. 0. 1986.. Social Sciences.. Sanskrit. 289 pgs. 346 pgs. Arthavedatdhasamhitha. 248 pgs. Apasthamba Sulba Sutra. sanskritdocuments. 540 pgs. Literature. Sanskrit.. Shaastrii Shaamaa. Apaharvarma Charita... Jindaattasuurii. pgs. 280 pgs. 0. Sanskrit. Yajneswara Cimana Bhatta. 1976. 1948. 346 pgs. Anustana Prakasaha Mahanibandhaha. Sanskrit. Linguistics..org/…/SanskritIIIT.. Sanskrit.. Aparajitaprccha Of Bhuvanadeva. Sanskrit..... Shaastri Shamaa. Religion.. Arya Salistambe Sotra. Anusuchi. Religion.. Ardh srimadbagavathardha dharsan vol 1. Unknown. Ashtanga Samgraha. Vethanamanom. Kunj-chanaraaja Chi Dakt'ara~. 330 pgs. Unknown. 444 pgs. Artha Sastra Of Koutilya. Ramchandra Sharmane.. Ashtadyayi Sutrapaat. 762 pgs. Apastambagrihya Sutra.. N Aiyaswami Sastri. Sanskrit. Sanskrit. Sanskrit. 1989. Unknown. 1924. 1955. 458 pgs.. 0.. Sanskrit. Sanskrit. Theology.. J Jolly.. Aprakaashitaa Upanishhadah. 158 pgs. Theology. 2000. Unknown. Shaastrii Shriichaarudevashaastii. Arya Salistamba Sutra. Sanskrit.. History. Sanskrit. Unknown.. Theology. Sanskrit. 492 pgs. 986 pgs.

. Atha Tatpurusha Prakaranam. Religion. Unknown.. Ath Shuklayajurvedakavya Samhitha. Sanskrit.. 362 pgs. 594 pgs. Bhagavadatta. Theology. Sanskrit... 986 pgs.. Sanskrit....a. Sanskrit. 1956. Atharva Vedha Samhita Mulya Mantra Sayaye Bhashya Kshiks Kandah. Unknown.. 363 pgs.. Theology. Damodar Sathwalekar... 1951. Sanskrit.. 180 pgs. 0. 0. Atha Gaayatrii Tantra. Sanskrit. Shaastrii Raamagopaala.Vivaram-vranam.. Sanskrit. Sanskrit.... 1037 pgs. Sanskrit. Religion. Ath Sriskanandmahapuranam. Atharavaanaa Upanishhada Second Edition.. Atharva Vedha Samhitha.. 1824 pgs. 404 pgs.. Astanu Hrudayam. Theology. Sanskrit. ... Baladevaprasaada. 0..2/14/2011 A list of scanned Sanskrit books at III… Astam. Atha Tatpurusha Prakaranam. Theology.c. Sanskrit. Pandith K P Aithal. 234 pgs. Acharya Sri Sitaram Shastri. Religion.. Linguistics Literature. Somraj Krishna Das. 1922. Jacob G A.. Asvasastram. Sanskrit.. Athara~vedasan'hitaa Bhaaga 2. Shri Anand Van Aagadi. Ath Srimaddwaramahapuranam. 0... 1916.. Sanskrit. 0. -.. Unknown. 562 pgs.. 436 pgs. 130 pgs. Sri Venkatesho Vijaytetram. P. 340 pgs. Asvalayaand-a Graha Suutraa Vol I. Atma Purana With Hindi Commentary. . . 1898.. Sanskrit.. 1923. 668 pgs.. Sanskrit. Shri Anand Van Aagadi. Sanskrit. Unknown. Ath Sriskand Mahapurane Brahmkhande Sethumahatmay Vol I I I. 0. . Sanskrit.... 1996. Unknown. Shiva Sharma. Ath Vishnudharmottar Mahapuranam. 100 pgs.org/…/SanskritIIIT. sanskritdocuments.. 1895. 0. . 288 pgs. Unknown. Theology. Unknown. Religion. Sanskrit. -. Religion.. Atma Purana.. 1644. 474 pgs. Sanskrit. . Asvalayanagrhyasutra Bhasyam Of Devasvamin. Sanskrit... Theology. 0.kunhan Raja. 483 pgs.. 310 pgs. Sanskrit. Sanskrit.Puspam. 867 pgs.. Religion. Ityupaadhidhaarind-aa Ema O Ela. 650 pgs.. Unknown. 257 pgs. Unknown. 0. Religion. Athagreya Mahapuranam. Athara~va Pratishaakhyama~ Prathamogyan' Bhaaga. -.. 266 pgs.kumaraswamy. 73 pgs.. Tira~tha Svaami Ravi. 1996. Sanskrit.vishnuteertha.. 666 pgs. Unknown. 547 pgs. Atha Tatpurusha Prakaranam. -. Rama Chandra Sharma. Ath Sriskande Mahapurane Shanst Nagar Khand I I I.. Dr. 1955. Unknown. 0. 1955.. 696 pgs. 1952. Ath Srimnmatsyamahapuranam Prarbhyate. Asya Vamasya Hymn. Atma Praboda... Gulab Chand. pgs. Asthadhyayisutrapaath. Sanskrit. Unknown. Theology. Sanskrit. 106 pgs. 0. . Sanskrit.… 8/167 . -. Unknown. Religion. Athavarvediiya Panj-chapat'aalikaa.. Literature... saayand-aachara~ya. Sanskrit.. Ath Koormmahapuranam Prarabhyate.. Athara~vavedasan'hitaa Trxtiiyobhaagaa.. Sanskrit. 0. -. Sanskrit. Theology. 0. Unknown.. Literature. Dr. Ath Sriskande Mahapuranm Vaisnavkhande Venkatachalammahatmay Vol I I. 0. 214 pgs. Sanskrit. Religion. 0.. 263 pgs. Religion... Sanskrit. 1928. 520 pgs. Unknown. 1987... Athara~vavediiyaa brxhatsara~vaanukramand-ika..v. Literature. Unknown. Sanskrit. 1944. Nakula. 1920. Theology. Atmadarsanam. 555 pgs.. Saayand-aachara~yaa. 1955. Sanskrit.

Speyer. Unknown.. Sanskrit.. Balabharatham Of Agastya Pandita. Ayodhyeche Nabaaba.. 1889.. 442 pgs. Subrahmand-ya. 382 pgs.. Unknown.s. 1965. 51 pgs. Chantaamand-i Ti Raa. 1964. Theology. Bakthamala Ramramsikavali. 190 pgs. 1983. Religion. Padhye. Aya Srimadhnrumatrayam. Sanskrit.. 674 pgs.. The Greatness Of Badari Kshetram Or Holy Place. 602 pgs.. Sanskrit.. Philosophy. Balaramayana. Biography. 1956.h. History.. 1933. Theology. Language. 1939. Baismi Parinaya Champu. 193 pgs. Avadanacataka A Century Of Edifying Tales Vol I.. Religion. Shriimadatkhand-d'adeva. 191 pgs.. 1939.. 182 pgs.. 1924. 432 pgs. Unknown. Vaidhopahsriparushuramsharma. 1983. Unknown.. Sanskrit..a.. 132 pgs. Ayurved Vigyanasar. p sri ramachandrudu. Unknown. 280 pgs. Sanskrit. Geography. Avantisundariikathaa.. Bala Bharatam.. Beauties From Kalidas. Aund-aadikapadaand-ara~va Grantha 7. Unknown. Ayurvedhakandah. sri laxmiramaswami mahabhagavanamu. Sanskrit. Sanskrit.. Unknown. 1982. 136 pgs.. Language. 0. Unknown. Bhaashhyaara~tha Ratnamaalaa Grantha 75. 1991. 1989. Unknown. 412 pgs... Linguistics. Sanskrit. Sanskrit. Biography.. Aund-aadikapadaara~nd-avah. Sanskrit. 1945. Geography.... Shaaligraama Shan'karatukaaraama. -. Bhaaminiivilaasa. Paarasaniisa Dattatrayabalavan'ta. Sanskrit. 324 pgs. Linguistics. Linguistics. Unknown.kunhan Raja. kalluri ahobila rao. Sanskrit. Religion. Religion. Ayurvedabdhisara Part 1.. Dr. 1922. Literature. 1899... Jaikrishndas. Unknown. Sanskrit. 480 pgs. Vaachaspathimishraa. 401 pgs. 346 pgs.. Sanskrit. Literature... Sanskrit. Kapaaliishaastrii Ti Vi. Language. Raramurthi.org/…/SanskritIIIT. Avachedakatvanirukti Of Sri Jagadisha Tarkalankara With Lakshmi Commentary. Literature. 290 pgs. Sanskrit. Sanskrit. 206 pgs. kaas'inaatha paanduranga paraba..... 1939. 1054 pgs. Sanskrit. G. J. Bhaaratiistava Prathaman' Mudrand-ama~. History.. 324 pgs. Sanskrit. Chintaamand-ih Ti Raa.. Bhaaminiivilaasa. Mahaakavii.. Sanskrit. Beejganitham Vol I I I. 125 pgs. Sanskrit.. Theology. 146 pgs... Sanskrit. 1915. 1935. Sanskrit.… Bhagavadgaiitaa Bhaaratiiyadashara~naani Cha Shaastrii Ananta Krxshhnd-a Religion Theology 9/167 .. Ratna Ketamkavi.. Unknown. sanskritdocuments. Sanskrit.. C. Literature. Sanskrit. Baktha Mandram. 1941. Sanskrit. 294 pgs. Baoudhagamarth Sangraha.. K S Ramamurty... Literature. 126 pgs. 1984. Literature. Sri Durga Prasad Divyvedaen. Unknown. Sanskrit. 52 pgs. 1948.. Dr. 1986. 1902... Sanskrit. 327 pgs.. Bhagavadajjukam. Swami Sri Dharmananda. Psychology. Philosophy. Pand-ashiikarasan'shodhitaa. 1933. Unknown. Bhaat't'adiipikaa Niviitaanto Bhaaga 1..2/14/2011 A list of scanned Sanskrit books at III… Atmarpanastutih.. Sanskrit. Aunadikapadarnava. 1962.k.k.ganga Sagar Rai. 1927. Baapuu Gokhale Yaan'chen' Charitra.... 1958. Sri Sankaranarayana. Psychology. 772 pgs. Theology. Veturi Prabhakara Shastry.bhatt. S. Bhaamatii Prathamo Bhaaga.

Vachaspti Gairola. S R Sehgal. 510 pgs. Unknown. Bhatruhari S Neetisataka. Unknown. Matha. 165 pgs.. General. 0. 1985. 304 pgs..org/…/SanskritIIIT.. Unknown. .. Ananta Deva. . 519 pgs. 112 pgs. Sanskrit.. Unknown. Unknown.. Sanskrit. Dr Radha Kumud Mookherji. Sanskrit. 172 pgs. 860 pgs. sanskritdocuments. Bharadvajasiksa. Bhartiya Darshan Ka Itihas. Literature. Bhakti Chan'drikaa. Bhatta Dipika Uttarasatka Part I I. Sanskrit. Sanskrit. Unknown.. Bharatiyam Vrttam.ramachandra Dikshitar. Sanskrit. Bharathi Nirukth Vedh Swarup Darshan. Sanskrit..surya Narayana. 1952. Bhagavantabhaskara Of Sri Nilakantha Bhatta Vol I I... 589 pgs. Kumudranjan Ray. 291 pgs. 1983.dasgupta. 1956.r. Sanskrit. n gopalapanicker.. Manju. pgs.jd. Theology. 552 pgs. Bhatta Chintamani Tarkapada. 0. Bhagavatham With Curmikatika Vijayadwaja Tirtha Padaratnavali 1892. Bhasa's Pratima Part Ii Natakam. Art. 174 pgs. 316 pgs. Bhatti Kavyam Canto 10.. Literature. Sanskrit. Bhagavadgitha Anandatirtha.. Sanskrit... K Vasudeva Sastri. 1985. Bharathiy Darshan Me Parivarthan Ka Swarup Vishestha Boudd Darshan Ke Sandarb Me. S. Bharatarnava Of Nandikeshwar. Bharata Natya Darsanam. 1921..2/14/2011 A list of scanned Sanskrit books at III… Bhagavadgaiitaa Bhaaratiiyadashara~naani Cha. 223 pgs.. Bhagavata Tippani Chalari. 306 pgs.. Unknown.. Unknown.n. Unknown. 1991. 1942.r. Janaswamy Subramanya Shasthri. S Subramnya Sastri.. Bhasa Ki Sambhandi Thatha Natakiya Visheshathaye. 798 pgs. Sanskrit. Sanskrit.… Bhatti Kavyam Canto 11 12 Saradaranjan Ray Vidya Vinoda Unknown Sanskrit 0 280 pgs 10/167 . 111 pgs. V.. 1935... Swetaranyam Narayana Sastriar.... . Sanskrit. Literature. Har Dutt Sharma.. 1959. 1942. Kumudranjan Ray. 1951. V S Venkata Ragavacharya. 1973... Sanskrit.. Sanskrit. Sanskrit.. Panditraja A Subramanya Sastri. Venimadhav Sahastri Musalgonkar. 1952. Unknown. 1936. Sri Laxmana Sastry. Sanskrit. Bharata Kaumudi Part I. Sanskrit. S. Bhagavantabhaskara Of Sri Nilakantha Bhatta Vol I.. 240 pgs. Bhaminivilasa. Sanskrit.. 1959. Sanskrit.. Bhattaldankartikaythu.. 120 pgs. Bhasa's Pratima Part Ii Natakam. 1968.. Unknown. Naaraayand-atiira~tha. Unknown.. 0.. M. 0 pgs. Unknown. Eeshwar Singh.. 0. .. 1945.... Theology. 1938.... Bhamti Ekk Adhyayan. 512 pgs. 1978. 340 pgs. Venimadhav Sahastri Musalgonkar. 518 pgs. Unknown. Saradaranjan Ray. Religion. Unknown.. Sanskrit. Dikshit. Sanskrit. 1921. 297 pgs.. Sanskrit. Unknown. Bhatta Dipika(uttrasatka Part I) With The Prabhavali Of Sambhu Bhatta.. 1887.. 1933. Unknown. Bhaismiparinayacampu.. Sanskrit. Vacant.. Literature. Sanskrit. Bhasas Balcharitam.. 316 pgs. Bharatarnava Of Nandikeswara.. Sanskrit. 442 pgs... Sanskrit. Religion. Dikshit Jd. Shaastrii Ananta Krxshhnd-a.. 712 pgs. Unknown. 1985. .. 383 pgs. Sanskrit. Bhas Kee Bhasa Sambandhee Tat(natakeeya Visheshtaem. Sanskrit. 1981. 1938.. 1944.. 252 pgs. Dr. 954 pgs. Sanskrit.. 1335 pgs. Sanskrit.. Unknown. Unknown. Bhattalankara Tikayuta.

Maheshchandra. Bhushanasara Samiksha Part Ii. V. 1933. 280 pgs.. R Nagaraja Sarma. 362 pgs. 1949. Sanskrit.. 50 pgs. Philosophy. Sanskrit. Unknown. 1945. sri ranga ramanujamuni.. 1951.. Sanskrit. 434 pgs. 2003. Unknown. -. 212 pgs. Vacant. Bhelsanhita. -. 0....... Unknown. Saradaranjan Ray Vidya Vinoda.. Gopinath Kaviraja. 576 pgs.. Bibliotheca Indica Volume 71 1. Unknown.. Bibliotheca Buddhica Vol Vii Nyayabindu. Geography. Sanskrit. Bibliotheca Indica Volume 45 1. Tirumala Charya. 134 pgs. Sanskrit. E. Bhoja. Sanskrit. 1959. Sri Girijadayalu Shukla. 301 pgs.. Philosophy. E. Bibliotheca Indica A Collection Of Oriental Works. Bibliotheca Indica Volume 71 5. Vasudeva Sharman. C Lakshmi Kantaiah. 1991.rajendralal.. Sanskrit.. Sanskrit.. 108 pgs... Unknown...rajendralal. Bibliotheca Indica Volume 71 2. Sanskrit. Unknown. Kavikarnapura. 66 pgs. 60 pgs.. Bibliotheca Indica Volume 3.. Unknown. Unknown. Unknown. Biblotheca Indica.. Literature... 1980.rajendralala. Sanskrit.. 1962. Bhavaprakasa Of Bhavamisra. M. 0.. 1987. Literature.. Prahladacharya. 1980.. Sanskrit. Sanskrit. pandit sri bhramha shankara misra.. Sanskrit. Bibliotheca Indica Volume 27. 0. 1981. Narayana.....rajendralala.. 1991. Bibliotheca Indica Volume 71 4. Sri Govind Das. Bheda Vidya Vilasa.. Psychology. Vacant. Bhedojjeevanam..2/14/2011 A list of scanned Sanskrit books at III… Bhatti Kavyam Canto 11 12. 1934... Sanskrit. 640 pgs. Bhedojjivana Of Sri Vyasaraja.. Bheddo Jevana Of Sri Vyasaraja. M. 220 pgs... Unknown. 1987. Sanskrit. 830 pgs.. Late Vinayak Narayan Shastri Vasudev Laxman Shastri. 0. Unknown. 1854.. Bhoja s Samaarangana Suutradhaara Vol I. Bibliotheca Buddhica V. Bhesajya Rathna Vathni.. Sanskrit.rajendralal.rose. 122 pgs. Sanskrit. 0. Unknown. Sanskrit. Unknown. Geography. 1954... Literature. 1903.. 1959. Unknown.. Unknown. Bodhaikyasiddhi Prathamo Bhaaga.. Sanskrit. Bhavprakashnidhantu. 722 pgs. Sanskrit. Geography. -. 1980. M. Literature. Bhuhgoghatharangani. Bhava Prakasika. Ramakrishnamacharya K.. Sanskrit. Sanskrit. 580 pgs..rose. Sanskrit. Achyutaraaya. Geography. Bhoja Prabanda Of Ballala. Bhupala Mandanam Of Devasri Narada. Balvanth Singh. 1987. -. Bibliotheca Indica Volume 4. 135 pgs.. Y Mahalinga Sastri. Geography. 388 pgs. Sanskrit. Venkataramana Reddy. 90 pgs. 320 pgs. Literature.. 1995. 134 pgs. 220 pgs. Sanskrit. 636 pgs. V. 0. Bhattikavya Of Bhatti.. 1983. 1987... Bibliotheca Buddhica Vol Vi. Unknown.. 422 pgs. Language. 968 pgs. Bibliotheca Buddhica Vol Vvxx. 1856. 646 pgs.… 11/167 .. Vijnanabhikshu. 1918. Sanskrit. Geography. M. Sanskrit.. Vijnana Bhikshu.. Linguistics. 1992... 185 pgs. Sri Vyasaraja Tirtha.. Sanskrit. Sanskrit. 984 pgs.org/…/SanskritIIIT.. Bhavya Bharatham. Geography. Bibliotheca Indica Volume 31 1. Bheda Ratnam. Sanskrit. Sanskrit. Geography. 120 pgs. Sanskrit.. 540 pgs. sanskritdocuments. 504 pgs.. 294 pgs. Dwaita Philosophy. 1998. Geography.. Sanskrit. Sanskrit. 0. M. 557 pgs.. Sanskrit. Bhramara Sandesa. 580 pgs.

Unknown. Brahmasutras And Dasasloki. 336 pgs. Brahma Sphuta Siddhanta Vol Ii. 1966. Sanskrit. Brahma Sutra Dwithiya Bagamu. Sanskrit. 1904. I.. Brahmasutra Bhashya. Sanskrit.. Brahma Sphuta Siddantha Vol I. Acharyavara Ram Swarup Sharma.s.. Shankar Shastry Venegavakar. G..… 12/167 . Brahatstotraratnavali Vol I. Arka Somayaji.. R. R. Religion. Bodhicharya Vatara Of Santideva. Unknown. Sanskrit.. Unknown. Brahmachary Vishnu. Sanskrit. 1966. Sanskrit. 1911. 1953. Unknown. Unknown. Unknown. 0.... Sanskrit. 462 pgs. Brahma Sutra Nyaya Sangraha. Geography. 402 pgs. P. Brahma Sphuta Siddhanta Vol 3. 1960. 536 pgs... 1966. 95 pgs. 0. Unknown. Sanskrit. 200 pgs.panchamukhi. 586 pgs.... 758 pgs. shri bramha gupta. Sanskrit..s. Pandurangatmaj Kashinath Sharma. 0.. Not Available. 586 pgs. Somraj Krishna Das.. Book Of Exercises Part I.. 326 pgs. 750 pgs. Sanskrit.. Sanskrit. Linguistics.panchamukhi. Brahma Vaivartha Puranamu Vol 1. . sathyanarayan tripati.. Khemraj Sri Krishnadass. Sri Narahari with a Commentary by the Author's Pupil Pandit Divakar.... Bodhayana Grihya Sutram... . Unknown. Sanskrit. 1980. 1982. 779 pgs. 0. Sanskrit. Brahatkatha Manjari.. Brahdaranyakopanishath Vol-liv.ananthacharya. Unknown. 372 pgs. P L Vaidya. Unknown.. Theology. Unknown. 644 pgs. 740 pgs. Sanskrit. Sanskrit. sanskritdocuments.2. 890 pgs. Brahmasutrabhasya Vol 1.. Sanskrit. Pandit V.s.s. 1992. Brahmasutrashaariirabhashhyaara~tha Bhaaga tiisara. Archaryavara Rama Swarup Sharma.. 222 pgs. Brahmasutravrtti Mitaksara Of Annambhatta.. Sanskrit. Sanskrit. Sanskrit... 1941. Brahmasutrabhashya. Physical Fitness. 0. Sanskrit... Literature. Bhaapat'ashastrii Vishhnd-uvaamana. K V Rangaswami Aiyangar. Sanskrit. 1906.srinivasacharya. .... 584 pgs.. Dr. 286 pgs. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Bodhasara a treaties on Vedanta. Bodhicaryavatara... 1950. Brahama Sphuta Siddhanta Vol Iii. Laxman Shastri Pansikar. 1966.tekct. 329 pgs. Sanskrit. Brahmanjali Nam Parameswararpitha Slokamalika. Sanskrit.. Unknown. Language.. 168 pgs. 452 pgs... 1937. Brahmanda Puranam. 18 pgs. Unknown. Acharya Mandanmisra. 661 pgs. Brahma Vaivarth Eak Pradyayan. 1937. 1979.. Sanskrit.rama Sastri. Sri Vijayeendra Tirtha. Unknown. 1980. Religion. Unknown.. L. 1927. Ram Swapup Sharma.2... 1832. Natural Sciences... Religion... Brahmasutra Bhasyamsahithayatham Thathvaprakasika.. 708 pgs. 0.. Sanskrit. Brahmasiddhi. 334 pgs. Brahmasutras. Sri Madra Dwapayamuni. Ram Swarup Sharma. Sanskrit.. 505 pgs. 88 pgs.sampurnananad. 0. 762 pgs. Unknown. Sanskrit. Sanskrit. Sanskrit. 1965. 1925.nene. Brahaspatismrti.. 0. General. Brahmanda Purana Of Sage Krsna Dvaipayana Vyasa. R Antoine. Brahma Sphuta Siddhanta Vol.. Unknown.. 1973. Unknown. Brahma Suutraand-i Grantha 67.. Brahmasutra Bhashya Of Sri Madhvachrya. Philosophy. Sanskrit..... Sanskrit. Sanskrit. Theology. 1915. Unknown. Brahmasutra Bhasyamsahithayatham Thathvaprakasika. 584 pgs.tatvaprakashka1. 600 pgs. 1944. J L Shastri. 486 pgs. Unknown. 448 pgs.org/…/SanskritIIIT.. Brahma Sphuta Siddhanta Vol 4.. Unknown. Sanskrit..

Religion.. 1935. Sanskrit. 0. 1953. Sanskrit. Aapat'e Vinayaka Gand-esha.sharmistha Sharma.. Sanskrit.. Religion. Theology. 190 pgs. Sanskrit. Bruhajjyothi Sarnava (mirra Skandha) Hari Krishna. Dr. Unknown... . General. Aapat'e Vinaayaka Gand-esha.. Brihadaranyakopanishad Bhasya Part 1. Upanishads. 437 pgs. .. .. 216 pgs. 0. Unknown. . Buddhist Logic Vol 1. 86 pgs. Brxhadaarand-ya Kopanishhadabhaashhya Vaara~tikama~ Prathamo Bhaaga Grantha 16. Brahmavaivatar Puraand-ama~. 1953. Kenjiu Kasawara.. Sanskrit.. 1935. A list of scanned Sanskrit.. Unknown. Literature.. Franklin Edgerton. Gand-esha Vinaayaka.. Theology. Religion. Sri Krishnadas Aatmajain Ganga Vishnuna.. Buddhapalita Mulamadhyamakavrtti. Sanskrit... 0.. Sanskrit. Sanskrit. Unknown. Sanskrit. Bruhat Samudrika Sastramu.. Brxhatii Prabhaakaramishraprand-iitaa Prathamo Bhaaga. Brihat Sarvanukramnika Of The Atharva Veda. Sanskrit. . Brxhadaarand-yakopanishata~. 206 pgs.. . 351 pgs. Religion. 914 pgs.. Unknown.. Bruhadh Hodachakra vivaranamulu.. 0. Stcherbatsky. jyotirvdaya datta...Bhashya. 600 pgs. Sanskrit. 268 pgs. -. 56 pgs.. Brhajjatakam Bahotpala Tika.. 457 pgs.. Unknown.. Religion...t. 1922. Chaara~ya Matsureshvaraa.. 260 pgs. Somraj Krishna Das. Brahmavaivarta Puranam. 1992.. Sanskrit. 334 pgs.. 1936.... 1935.2/14/2011 . Sanskrit. Brxhatii Prabhaakaramishraprand-iitama Da~tiiyo Bhaaga. Philosophy. Unknown.. . Religion. sanskritdocuments. Max Walleser.. Brahmavaivara~tapurand-ama~ Dditiiyo Bhaaga Grantha 102. 1954. pg Brahmavaivara~tapuraand-ama~ Prathamo Bhaaga Grantha 102.. Buddhist Avadanas. Sanskrit. 0. Sanskrit. Sanskrit. 1994. 880 pgs. 1935. Theology.. Bruhaddevagnanaranganam. 580 pgs.... Linguistics. Sanskrit. Unknown. Brhadaranyakopanishad Bhasyam. . Sanskrit. Sanskrit.. Brahmavaivatara~purand-ama~ Ddvitiiyo Bhaaga Grantha 102. Religion. 503 pgs. 0. 396 pgs. 926 pgs. Srilnarayana Bhatta Goswami.. T Veeraraghavacharya. Language... Theology... 1980. Unknown. Pandit Ramgopal Shastri. 0. Sanskrit. Sanskrit... 225 pgs. Vira Raghavachaya. 0. Theology. Brahmavaivarta Maha Puranam. Theology. Prabhaakaramishra.. 110 pgs. Theology. Buddhist Hybrid Sanskrit Reader. Bhat't'achaara~yaa Vidhu Shekharaa. 1934... 0. Sanskrit. 1867. 1986. 1954. Unknown. Theology. Sanskrit. Sanskrit. Religion. Unknown. 503 pgs. Sri Krishna Das Satmaj Gangavishnu. 463 pgs. 457 pgs. Buddhist'a T'eksat'a Ashokaa. Sanskrit. Philosophy. Maraat'he Vaasudeva Shaastrii. 616 pgs. Brhadavanyaka Bhava Botha.books at III… Brahnni Ghantu Ratnakar Vol V I.. 214 pgs. Sanskrit. Bruhanigantu Rathnakara Panchama Bagh.… 13/167 . Brihadaranyakopanishad . Sri Krishnalal Thanaya Datt.org/…/SanskritIIIT. 385 pgs. Braj Bakthi Vilas. 753 pgs. Religion. Sanskrit. . Sanskrit. Sri muralidhar. Brahnnighantu Ratnakar Vol I. 1937. 614 pgs. 1886.. Sanskrit. Shaastrii Kashiinaatha. Theology. Theology.. Sanskrit. 282 pgs. Buddhist Technical Terms.. Psychology. 1992.. Prabhaakaramishra. 1885. Religion..

2/14/2011

A list of scanned Sanskrit books ,at III… y g

gy

,

1948. 73 pgs. Budhabhushhand-ama~... Shambhu Shriimada~, Philosophy. Psychology. Sanskrit, 1926. 132 pgs. Budhabhushhnd-ama~... Shriimachchhan'bhunrxpa, Philosophy. Psychology. Sanskrit, 1926. 132 pgs. Bugusamhita Mahashastra Palitha Kanda... , . Sanskrit, 0. 613 pgs. Bugusamhitargata Yogavali... Somraj Krishna Das, . Sanskrit, 0. 343 pgs. Calcutta Sanskrit Series... Pandit Amareswar Thakur, Unknown. Sanskrit, 1934. 830 pgs. Camatkarachandrika Of Visvesvarakavichandra... Dr P Sri Rama Murhy, Unknown. Sanskrit, 1969. 270 pgs. Canakya-caritam... Dr.thakur Prasad Mishra, Unknown. Sanskrit, 1981. 180 pgs. Candravyakarana Of Candragomi... K C Chatterji, Language. Linguistics. Literature. Sanskrit, 1953. 360 pgs. Carudattam Edition I I... C R Devadhar, Unknown. Sanskrit, 1943. 136 pgs. Catalogue Of Sanskrit Pali And Prakrit Books Vol-i... -, Unknown. Sanskrit, 1951. 354 pgs. Catalouge Of Sanskrit Parakrit Manuscripts Vol 3... Muniraja Sri Punyavijayajit, Unknown. Sanskrit, 1968. 368 pgs. Chaitanyachandroday Naam Natakam... Sri Rajendra Lal Mitrena, Unknown. Sanskrit, 0. 294 pgs. Chamatkaar... Dr Krishna Lal, Unknown. Sanskrit, 1985. 112 pgs. Chamatkara Chintamani... bhatta narayana, Unknown. Sanskrit, 1964. 550 pgs. Chanakyasuthram Part 1... Pandit Vijendermisra, Unknown. Sanskrit, 0. 48 pgs. Chandas Sastram... Sri Pingalacahrya, Unknown. Sanskrit, 2002. 321 pgs. Chandha Shastramu... Sri Pingali Nagh, Unknown. Sanskrit, 0. 326 pgs. Chandogya Panisad Bashyam Pradhama Bagamu... Sri Ranga Ramanuja Muni, Unknown. Sanskrit, 1952. 546 pgs. Chandogyopanishad... Sri Ranga Ramanuja Muni, Unknown. Sanskrit, 1952. 596 pgs. Chandologyopanishad... Venkata Subramanyam Sastri.m, Ayurveda. Sanskrit, 1924. 939 pgs. Chandrapeeda Katha... Pandit V Ananthacharya, Unknown. Sanskrit, 1946. 90 pgs. Chandraprabha Charithramu... P.amruthlal Jain, Unknown. Sanskrit, 1954. 34 pgs. Chandrika Sahitha Kuvalayananda... , Religion. Theology. Sanskrit, 0. 328 pgs. Charak Saheta Vol 3... Sri Narendrasen Gupt, Unknown. Sanskrit, 0. 664 pgs. Charaka 1... -, Unknown. Sanskrit, 0. 502 pgs. Charaka 5... -, Unknown. Sanskrit, 0. 626 pgs. Charaka Samhita 3... -, Unknown. Sanskrit, 0. 326 pgs. Charaka Samhita 6... -, Unknown. Sanskrit, 0. 534 pgs. Chaturdashalakshani With Didhiti,didhitiprakashka,vivarana... N.veejhinatha, Indian Logic. Sanskrit, 1997. 867 pgs. Chhaandogyopanishhata~... Upanishhata~, Religion. Theology. Sanskrit, 1952. 549 pgs. Chhaandogyopanishhata~ Grantha 14... Aapat'e Vinaayaka Gand-esha, Religion. Theology. Sanskrit, 1934. 539 pgs. Chhaandogyopanishhata~ Grantha 79... Nityaananda, Religion. Theology. Sanskrit, 1915. 223 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Chhanda Shaastrama~

Chaara~ya Pin'galaa Language Linguistics Literature Sanskrit 1950 272

14/167

2/14/2011

A list of scanned Sanskrit books at III… Chhanda Shaastrama ... Chaara ya Pin galaa, Language. Linguistics. Literature. Sanskrit, 1950. 272 pgs.

Chhatrapatisan'bhaajii Mahaaraaja... Rangand-ekara Keshavaman'gesha, Geography. Biography. History. Sanskrit, 1950. 86 pgs. Chidgagana Chandrika... Kalidas, Unknown. Sanskrit, 0. 208 pgs. Chitra Champu... sriram charan, Unknown. Sanskrit, 0. 146 pgs. Chitra Prabha... Bhagavata Hari Sastri, Unknown. Sanskrit, 1932. 480 pgs. Chitrasenapadmavati Charita... Mulraj Jain, Unknown. Sanskrit, 1942. 98 pgs. Chittavishuddiprakarand-a... Aara~yadeva~, Religion. Theology. Sanskrit, 1949. 147 pgs. Chrak Samhitha Part 2... -, Unknown. Sanskrit, 1950. 568 pgs. Chytanya Nandanam... Nistala Subramanyam, Unknown. Sanskrit, 1987. 170 pgs. Cikitsa Of Srinivasa... sri s venkatasubramanya sastri, Unknown. Sanskrit, 1953. 414 pgs. Cikshasamuccaya... Canti Deva, Unknown. Sanskrit, 1992. 494 pgs. Cola Campu Of Virupaksa... T Chandra Shekaran, Unknown. Sanskrit, 0. 90 pgs. Collected Papers Of Manavalli Ramakrishna Kavi... P S R Appa Rao, Unknown. Sanskrit, 1986. 340 pgs. Critical Study Of Vedarthasangraha... t v raghavacharyulu, Unknown. Sanskrit, 1989. 250 pgs. D'a Had'agevaara Charitra... Paalakara Naaraayand-ahari, Geography. Biography. History. Sanskrit, 1882. 538 pgs. Da Aara~ya Shatakama~... Shriimadappayyadiiqs-ita, Philosophy. Psychology. Sanskrit, 1944. 72 pgs. Da Ethimalojiisa~ Apha~ Yaska... Vara~maa Siddheshvara~vara~maa, Language. Linguistics. Literature. Sanskrit, 1953. 272 pgs. Da Jaataka Maalaa Prathama~ Bhaaga... Aara~ya Kuuraa, Philosophy. Psychology. Sanskrit, 1943. 279 pgs. Da Katuhsataka Dvitiya Bhaaga... Ara~yadeva~, Religion. Theology. Sanskrit, 1931. 344 pgs. Da Mahaabhaarata Sabhaapara~va... Vishhnd-u Esa~ Suktaankara~, Language. Linguistics. Literature. Sanskrit, 1943. 217 pgs. Da Saundarananda... Ashvaghosha, Philosophy. Psychology. Sanskrit, 1928. 200 pgs. Daa. Ketakara Vyaktti Aand-i Vichaara... Ketakara Shriidharavyan'kat'esh, Geography. Biography. History. Sanskrit, 1955. 216 pgs. Daivat Sanhita Vol-3... Sripad Damodar Saatvalekar, Unknown. Sanskrit, 1948. 284 pgs. Daivata San'hita Prathama Bhaaga... Shriipaada Daamodara Saatavad'ekara bhat't'aachara~ya, Religion. Theology. Sanskrit, 1941. 987 pgs. Daivata San'hitaa Bhaaga 2... Saatavalekara Sriipaada Vasan'ta, Religion. Theology. Sanskrit, 1943. 923 pgs. Dandanitiprakaranam... V S Bendrey, Unknown. Sanskrit, 1943. 144 pgs. Daqs-ind-achyaa Mdhyayugiina Itihaasachi sadhane Khan'd'a 2... khera~ Gand-eshaharii, Geography. Biography. History. Sanskrit, 1934. 119 pgs. Dara~sha Puura~nd-a Maasa Prakaasha Prathamo Bhaaga Grantha 93... Daad'ekaro Sarasvatii Bhushhand-a, Religion. Theology. Sanskrit, 1924. 652 pgs. Darsan Ka Prayojan... Bhagvan Das, The History Of Philosophy. Sanskrit, 1987. 312 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Das Gopatha Brahmana

Dieke Gaastra Unknown Sanskrit 1919 360 pgs

15/167

2/14/2011

A list of scanned Sanskrit books at III… Das Gopatha Brahmana... Dieke Gaastra, Unknown. Sanskrit, 1919. 360 pgs.

Das Purana Pancalaksana... Wllibald Kirfel, Unknown. Sanskrit, 1927. 664 pgs. Dasa Charitam... Sri Sailusuri, Unknown. Sanskrit, 1989. 232 pgs. Dasapadyunadivrtti No 81... Dr Mangal Deva Shastri, Unknown. Sanskrit, 1943. 578 pgs. Dashaa Kumaaraa Kathaa Saaraa... Appaayaamatya, General. Sanskrit, 1949. 39 pgs. Dashopanishhada Grantha 106... Maarulakara Shan'kara Shaastrii, Religion. Theology. Sanskrit, 1937. 227 pgs. Dasopanishadas Vol 1... C.kunhan Raja, Unknown. Sanskrit, 1935. 520 pgs. Dasopanishads Vol Ii... The Pandits Of The Adyar Library, Unknown. Sanskrit, 1936. 644 pgs. Dasopanishads Vol-1... C.kunhan Raja, Upanishads. Sanskrit, 1935. 519 pgs. Dasopanishads With The Commentary Of Sri Upanishad-brahma-yogin... C.kunham Raja, Upanishads. Sanskrit, 1936. 518 pgs. Dasopanishads With The Commentary Of Sri Upanishad-brahma-yogin... G. Achari, Art. Sanskrit, 1936. 518 pgs. Dathu Rathnakara... Sri Madwi Jayalavanya Soori, Unknown. Sanskrit, 0. 348 pgs. Dattakamiimaan'saa Grantha 116... Nanda Pand-d'ita, Religion. Theology. Sanskrit, 1954. 379 pgs. Dattapuranam... Swami Vasudevananda Saraswathi, Unknown. Sanskrit, 2004. 736 pgs. Descriptive Catalogue... K.s.ramamurthi, Upanishads. Sanskrit, 1993. 111 pgs. Descriptive Catalogue Of The Government Collections Of Manuscripts Jaina Literature And Philosophy Vol Xvii... Harilal Rasikdas Kapadia, Unknown. Sanskrit, 1954. 330 pgs. Descriptive Catalogue Vol I... Dr.k.s.ramamurthi, Religion. Sanskrit, 1993. 222 pgs. Deshabhakta Krxshhnd-aajii Prabhaakara Uura~pha Kaakaasaheba Khaad'ilakara Charitra... Khaad'ilakara Kaashinaathahari, Geography. Biography. History. Sanskrit, 1949. 428 pgs. Deshabhaktta Saahityasamraat'a Narasin'ha Chin'taamand-a Kelakara Yaan'chyaa Aat'havand-ii... Baapat'a Sa Vi, Geography. Biography. History. Sanskrit, 1945. 680 pgs. Deshii Naama Maalaa Dditiiya Khand-d'a... Hema Chandraa, Religion. Theology. Sanskrit, 1938. 523 pgs. Deshiinaamamaalaa... Hemaachandraa, Language. Linguistics. Literature. Sanskrit, 1938. 525 pgs. Devalaya Grama Mahatmyam... Balachandra Kavishvar, . Sanskrit, 1827. 277 pgs. Devanandamahakavya of Sri Meghavijayopadhyaya... Pandit Bechardas.j. Doshi, Unknown. Sanskrit, 1937. 102 pgs. Devatadhyaya Samhitipanisad Vamsa Brahmanas With Commentaries... Ballikoth Ramachandra Sharma, Unknown. Sanskrit, 1965. 270 pgs. Devatadhyaya Samhitopanisad Vamsa Brahmanas... B Ramachandra Sharma, Unknown. Sanskrit, 1965. 264 pgs. Devendra Mahakavyam... P.bhochardas Jeevraj Desi, Unknown. Sanskrit, 0. 114 pgs. Dhaara~mikavimara~shasamuchchaya... Bhaaratii Svaami Vidyashan'kara, Religion. Theology. Sanskrit, 1944. 237 pgs. Dhaatukoshaa... Shaastrii Baahuballabha, Language. Linguistics. Literature. Sanskrit, 1912. 288 pgs. Dhanyaalokaa... Chaara~ya Aanan'davaradhana, Language. Linguistics. Literature. Sanskrit, 1937. 149 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 16/167

. 117 pgs. 1952.. Unknown. M L Jacks. Theology. 2001. Sr Madananthram Shastry Vetalen.. 1950. History.. Dutadangand. Religion. Dhatvarthavijnanam.. Sanskrit... Educationas A School Social Factor... Unknown. Unknown.. Unknown. 860 pgs. Religion. 216 pgs. Sanskrit. 145 pgs. Dharmakosa Upanisatkanda Volume 2 Part 4. Drahyana Grihya Sutra. Unknown.l. 86 pgs. Theology. Biography. Unknown. Theology. Sanskrit. Dhaturupa Manjari. 415 pgs. Sanskrit. 120 pgs. Dharmasindhu. Charandas Shastry. Joshii Prahlaadanarahara. Unknown. Khem Raj Krishna Das. 56 pgs... Religion.org/…/SanskritIIIT. laxmanshastri joshi. Sanskrit. Sanskrit. 1935. Gokhale. sanskritdocuments. vadilal bapulal shah. 1952. Dilkush Untasdi Gayaki Prathama Bhag. Sanskrit. Dr. Pandith Sri Shobhit Mishra. Geography... Dharmakosa Upanisatkanda Vol 2 Part 2. 1954. 1935. Unknown. Religion. Sanskrit. 320 pgs. Unknown. 352 pgs. 1980. Sri Purshoutam Sharma Chaturvedi.. 0..… 17/167 . 1942. Unknown. Sanskrit. Sanskrit.. 1929. 1949.. Dharmakosa Vyavaharakhanda. 1977. Vaidy Jadwaji Trikamaji Acharya. 109 pgs. Sanskrit. Sanskrit. Laxmansastri Joshi. Sanskrit. Sanskrit.. 1941. 0. Hari Bhadraa. Sanskrit. Unknown. Dhara~matattvanind-ara~ya Prathamaa Bhaaga 1. 0.. 388 pgs. Docrichikitsarnava. Aapat'e Gand-osha Vinaayaka.. 1950.. Dhwanyalok Rahasyam Prashnouttari.. Dr Nagendhra.. Sanskrit. Shriivasudevaanan'da~... 1940. Dvadasaranaya Chakra Of Sri Mallavadisuri Vol 1.. Dhvani Vicara. 167 pgs. Unknown. 764 pgs. -. Aapat'e Gand-osha Vinaayaka. Dhathuratnakarah Shasthi Vibhagah. 544 pgs... Unknown. Unknown.. 0. 0.2/14/2011 A list of scanned Sanskrit books at III… Dhara~ma Bin'duu. Dr C Kunhan Raja Presentation Volume. Biography. Pandith Marulkaropahvanar Hari Shastry. 1946. 552 pgs. Unknown.. Dura~daivii Mohare.. Ddivedii Dura~ga Prasaada... 0. Geography. Theology.. Dvadashan' Pushhpama~.. History. Dharmikvimarsamuchya Vol I I. Sanskrit..... Late Munichaturvijayaji. Dravya Gun Vignan Purvardhamu. Laxmana Shastri Joshi. K. Sanskrit.. Theology... 463 pgs. Dhavnalokha.. Sanskrit. Sanskrit. Dina Visheshha. Religion... 146 pgs.. 76 pgs. laxman shastri joshi. Unknown.. 674 pgs.bhagiratha Prasada Triputhi Vagisa Sastri. Unknown.sastri. 182 pgs. 1937.. Sanskrit. Dhavnyaloksar. Sanskrit. Khemraj Shri Krishnadas. Unknown. 1950. Lelegan'gadhara~ Vinaayaka~. Religion. Unknown. 1872. N G Kalelkar. 1914. Sanskrit. 214 pgs. Unknown. Sanskrit. Dura~gaa Pushhpaanj-jali Grantha 22.. Dharma Kosah Vyavaharakanda Vyavaharamatrka Vol 1 Part 1. Dhara~matattvanind-ra~ya Parishishht'ama~ Bhaaga 2. Sanskrit. Thakur Udaya Narayana Singh. 232 pgs.. Theology. 1953. 211 pgs.. Sanskrit. Unknown. pandit feroz phamaji. 1955. 212 pgs. Sanskrit. 156 pgs. 424 pgs... Draahmaayand-a Grxhma Suutravrxtti Grantha 74. Sanskrit. Sanskrit. 1954... Sanskrit.v.. 166 pgs. 294 pgs.. 528 pgs... Dhaturoop Sangraha. 1937. Unknown.

. 2001. First Lesson In Sanskrit. Sampurnanand.. 0. Sanskrit. 152 pgs. 226 pgs.. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Eeshavasya Upanishad I. 1920.. 1949. 1950. Dr P Sriram Chandrudu. Eethi Sriskande Mahapuranam Prabhaskhand.. Somraj Krishna Das. P L Vaidya..org/…/SanskritIIIT. Sanskrit. 542 pgs. Language.. Gangavaratana. Theology. T. Dr. Unknown. Gatagoshha~t'i Arathata~ maajhii Jiivana Yaatraa. Sanskrit. 0. Unknown. sanskritdocuments. Kelakara Chin' Na. Sanskrit. 1987.. Sanskrit. History.. Unknown. Tantras. Sanskrit.. Unknown.. 1975. 1958. . Biography. 1968. Sree Krishna Sarma E. 1992. 130 pgs. Krishana Gi Parisharam Bide. Sanskrit. 360 pgs.padmanabhachrya Chitaguppa. Gananeshwari. Sanskrit. Unknown. Sanskrit. -. Social Sciences. 82 pgs. P. Sanskrit. 140 pgs. 1920. Theology..tadpatrikar.. Gaud'ayaada. Esevyopanishad Bhashyam.. Sanskrit. 707 pgs.. Sternbach Ludwik. 0. 490 pgs.. Gaja saastram of paalakapya muni.ballantyne. . Sanskrit...... Sanskrit. 1084 pgs.. Raamataarand-a. Gaadadhari Vol Ii. Gadhy Padhy Mala Chaturth Kusumam Vol I. 116 pgs.V I I I. Sanskrit. Gand-akaarikaa. 534 pgs. Ganesa Purana... Unknown..r. Sanskrit. Garuda Puranam. Unknown... Unknown. 1981. Psychology.. 253 pgs. 1937. Religion. Ekavali Of Vidhydahra... 470 pgs. Sripati. 561 pgs.. Sanskrit. Unknown.. Garuda Maha Puranam Of Sri Vedavyasa Mahamuni. Unknown. 383 pgs. Gand-ikaa Vrxtta San'grah Khand-d'a 1 Grantha Maalaa 4. 2000. 0.. Pandit Kedaranatha Sastri. Gajagrahana Prakasa. 106 pgs.. naradamuni.. Gandavyuhasutra. 1933. Literature. 418 pgs. Exercises in sanskrit translation. Gautamiyamahatantram. Sanskrit. Gaekwad's Oriental Series. 1968. 214 pgs. Gaud'apaadoyama~ Aagamashaastrama~. Ganitatilaka. 94 pgs. Sanskrit.. 1954. Gajasiksa. Unknown..brej Mohan. Linguistics. Unknown. Dr.. Unknown. 96 pgs. Bhattacharya. Unknown.ramaji Malaviya. Religion. 490 pgs. subrahmanya sastri k s. Sanskrit.. Geography. Sanskrit.k ramachandra aiyar. Unknown. 1801. Dr..n. 1953.… 18/167 . 1916. Bhasara~vajnaa Aacharaya~...r. Language. Literature. Gandhi Gita. 1975....sreekrishna sarma. Ganatiya Kosh. Gajasiksa. 177 pgs. 0. Gajasiksha.. 90 pgs.. Unknown. Sanskrit.j. 1960.. 2004. Srimath Paramhans Parivrajakar Chary Brahmanisht Loksangrahi. 702 pgs. -.... Sanskrit.. Unknown.. 78 pgs. Linguistics. Literature. E. Unknown. S. Ganesh. Sanskrit. 0. Unknown. Sanskrit. -. 348 pgs. Unknown.. Sanskrit. 1975... 96 pgs. 100 pgs. 1939. Linguistics.r.. Language.. mahadeva deshiah. 206 pgs. Sanskrit. Sanskrit.. Gand-adara~pand-a Shhashht'ha San'skarand-ama~. 1867. Veeraragava Achariya.. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Philosophy. Eeshopanishanthu. Narayana Dikshita. 670 pgs...

tatacharya. 360 pgs.l. Sanskrit. Religion. 1990. Geethopadesa. 532 pgs. Sanskrit. Religion. Unknown. E R Sreekrishna Sarma. Unknown.. Religion. Unknown.s.. Sanskrit. Gomileeygruhakarmaprakashika. Gopath Brahmana Of Atharva Veda.. Unknown. Mohan Lal. Gilgit Manuscripts Vol Iii Part Ii.s. Unknown.. Sanskrit.. 200 pgs.. Sanskrit. k s ramamurty. A. 100 pgs. 1932. Bhaaskaraachara~yaa Shrii. 1942. 338 pgs..nalinaksha Dutt.. 184 pgs. Grihya Sutras Of Varah.. Gopala Sahasranama Stotram. Guruparampara Charita With Comm sanskritdocuments. Unknown. Unknown.. Sanskrit.. 1939. 316 pgs.. 1939. Sanskrit. S B Valankar.. Gochar Aur Asthakavarga. Sanskrit. Geetageervanam. 1934. Sharma. 246 pgs. Gudhartha Dipika. Gruha Vidhan. 1972.. Gramegeya Ganamatk. Unknown.. Sanskrit. Gilgit Manuscripts Vol Iii... Gudharthatattvaloka A Commemtary On Samanyanirukti Gadadiiari. Gilgit Manuscripts Vol Ii. Sanskrit. Nalinaksha Dutt. 0.. 890 pgs.Bhashya. Gitagovinda Kavyam. 322 pgs.. 100 pgs. Sanskrit. Dr. 1942. -. Geetharthsangraharsha Geetabhashytathparyachandrikach. Geetha Dharm Chandogyaupanishad Vol Ii. Dr Nalinaksha Dutt.. Religion.. Unknown. 247 pgs. Gilgit Manuscripts Vol I. Nalinaksha Dutt. Sanskrit.. Sanskrit. Sanskrit. 219 pgs. Sanskrit.. 1971.. 1941. 1946.. 116 pgs.aryendra Sharma..... Unknown. 0. Unknown. Gitagovinda Of Jayadeva.org/…/SanskritIIIT.. 1952. Sanskrit.sampath Kumara Charya. Unknown. 507 pgs.. Sanskrit. 186 pgs... 0.r. 132 pgs. 256 pgs.. 66 pgs. . 0.2/14/2011 A list of scanned Sanskrit books at III… Geeta Vignana . 1952... Unknown. Glimpses Of Buddhist Culture In India.. Anil Varan Roy.. 1935. Gitagovinda Mahakavyam. Subhramanyamvidhusha. Gita Samiksa. Unknown. 1943. Gitagovinda Of Jayadeva With Commentary Of Laksmidara. Sanskrit. Gilgit Manuscripts Vol Iii Part 3. 338 pgs. Sanskrit.. 512 pgs. Aara~muni Pand-d'ita~.. Unknown. Religion. Ramamurthi. Unknown. 1983.. 126 pgs.. Goladyay Dwithiya Bagam. Sanskrit. Religion.. Sanskrit. Dhanapati Suri. Rajendra lal Mithra. Unknown. Pandit S'ri Lakshminatha Tha. 244 pgs. 1908. Sanskrit. Unknown. Sanskrit. Sanskrit. Dattatrey Venkateshwar Kettar. 1948. 1972.. Unknown.. 383 pgs. 1934. Sanskrit. 174 pgs. Sanskrit. Sanskrit. Narayan. 322 pgs. Dr Nalinaksha Dutt. 1990.. K. Goldavyaprashnavimarsh. Aacharya baskaranand lohini. Sanskrit. 253 pgs. Unknown. Religion. Sanskrit. Theology. 186 pgs. Dr... Sanskrit... Theology. V Subramaniam.… Religion Theology Sanskrit 0 1049 pgs 19/167 . 1941. Theology. 1927. Nalinaksha Dutt. Sri Math Paramhans Parivrajakarchary Brahmanisht Lok Sangrahi.. Sanskrit. Gommatasara Karma Kandah. Unknown. Gangadar Bapurao Kale.. 1924. Unknown.. 284 pgs. Krishna Yajurved. veerendrarai chandra shankar mehatha. Gilgit Manuscripts Vol I I I Part I I I. 178 pgs. Graganithadyaya... Religion... Narayana Ram Acharya. 1943.m.. 1941.. 1969. Sanskrit.... Unknown. Golaadhyaaya Uttarara~dharupo Da~tiiyo Bhaaga.. 320 pgs.. Dr.n. Giitaayogapradipaara~yyabhaashhya. 1985. 452 pgs.

Jaya Shankar Joshi. 1957. 1917. Gulab Chand. 139 pgs. Sanskrit. Theology. Kelakara Narasin'hachin'taamand-a. Religion.. 113 pgs. Bi h Hi t S k it 1939 500 sanskritdocuments. Sanskrit. Hatopadesha. Aappaapaadydhye Keshava~. Haridiiqs-itakrxtaa Brahmasutravrxtti. Unknown. Guruvamsha Mahakavyam... Harshacharitha Sangraha. Haravijayam Of Rajanaka Ratnakara. 1896. .… 20/167 . Dr Suram Srinivasulu... Haasyaara~nd-avaprahasanama~. Harshacharita The Fifth Ucchhvasa. 0. Paanase Venubaaii. 1917. Sanskrit.p. Literature.. Haricharita. Unknown. Krishnamacharya. Sanskrit. Vasudevasaran Agarwal. Sanskrit. Religion. 556 pgs. Bal Govind Jha. Piit'ara~sana~ Piit'ara~.... 1958... 0 pgs. 0.. 1879. Haimsa phrama~ Da Rxgvedaa. Vaamanashaastriikhare Vasudeva.. 146 pgs. Sanskrit. Jai Shankar Joshi. Sanskrit. Religion. Sanskrit. Biography.. Sanskrit. 1948. The Arts. Hanumannnatak. Psychology. Geography. Mahadevaiah K. Sanskrit. 0... 1948. Unknown.. Sanskrit. Sanskrit. . R.. Theology. 0 pgs. Unknown. Sanskrit. 1948. 763 pgs.. 238 pgs. Halayudhkosh Abhidhanratnamala. Sanskrit. 1948. Sanskrit. pgs..dhorasamaiah. Theology. Shriijagadiishhvarabhat't'aachaara~ya.. 1939.. Religion. Paramesvara Bhatta. 1909... Sanskrit. Pandit V Ananthachary.y. History.m. Sanskrit. 120 pgs. Religion. Psychology... Religion..2/14/2011 A list of scanned Sanskrit books at III… Guruparampara Charita With Comm. Religion. Sanskrit.. Hari Naaraayand-a Aapat'e Charitra Va Vaang-a~mayavivechana. Bodhendrasarasvati. 1960. Sanskrit. Unknown..sri. Unknown. Hashacharitha Sangraha. Sanskrit. Sanskrit. 764 pgs. 1951. Durgaprasada amp Kasinath Pandurang Parab... Theology. 0.. 1922.. 1948. Sanskrit. 305 pgs. Ram Swaroop Sharma. Biography. Theology. Unknown.. Subrahmanya Shastri. 1964. Unknown. Sanskrit.. 419 pgs. Sanskrit. Harshacharita Sara. 1982. 261 pgs... Sri vadiraja Tirtha. Harshacharitha Sangraha. Literature. Literature. 1920. 115 pgs.. Religion. Halayudh Kosha. Sanskrit. Hara Naaraayand-a Aapat'e Yaan'chen' San'qsipta Charitra. The Arts.. 1989. 249 pgs. Vopadeva. Harmakutam Sundarakanda. 590 pgs. Geography. Haricarita By Paramesvara Batta. 1049 pgs.. Hariharaaddaitabhuushhand-ama~.. Sanskrit. O. Unknown. Philosophy.. Religion. 167 pgs...k. Hariliilaa Nan' 3.. History. 166 pgs.. Haridiiqs-ita. 1945. 254 pgs. Harivan'shaachii Bakhara. 144 pgs. Durgaprasada amp Kasinath Pandurang Parab. 1954. Unknown. Sanskrit. Theology. Aan'bekara baapujiimaara~tan'd'a..org/…/SanskritIIIT. Sanskrit. Haricharita. Philosophy. 743 pgs. Sanskrit.. 1952. 1999. 93 pgs.. Unknown. 98 pgs. Unknown... 153 pgs.. Hari Charitra. Tryambaka Makhin.. Gyaariibaald'ii.. Haribhadra Suri Grantha Sangrahah. C Sankara Rama Sastri. Gurvarthadipika. 383 pgs. 199 pgs. Sanskrit... Parameswara Bhatta.. Geography. Harshacharita Ek Samskrutika Adhyayana. 0.. Harsha Charitam.. 96 pgs.v Krishnamachariar. 308 pgs. Haricharita... 67 pgs. Hasya And Prahasana A Critical Study. Sanskrit.. 1931. Sanskrit. 1850. Hemaadra Uura~pha Hemaad'apan'ta Yaachen' Charitra. 1994. Shri Dhanya Kumari. 104 pgs..... Jaya Bharati. Theology. Religion.

.. 457 pgs. 530 pgs. 1921.. 323 pgs..org/…/SanskritIIIT. Bhin'd'a Sadaashivashaastrii.. Sanskrit. Theology. Iishaavaasyopanishhata~ Grantha 5. Sanskrit.. Sanskrit. Hitopdesh. 1925. Sanskrit. C Dwarakanatha.. 515 pgs. Iishrvarapratyabhijnaavivrxtivimara~shini.. Religion.. Sanskrit. Sanskrit. 1943. Sanskrit. Hetubindutika Of Butta Arcata.. Iishvarapratyabhinj-aa Dditiiyo Bhaaga Grantha 33. 168 pgs. 1939.. Sanskrit. Hitopdesh Mitrlabh... Theology. Deva Utpala. Unknown. Sanskrit. 0.2/14/2011 A list of scanned Sanskrit books at III… Biography. Theology. Iishrvarapratyabhijnaavivrxtivimara~shinii Trxtiya Bhaaga.. 457 pgs. Ishvara Pratyabhijna Vimarshini Of Utpaladeva... 176 pgs. Kiranvalli. Sanskrit. 1953. 1949. N Padmavathy. Unknown.. Arthasasthra Visarada. Intermediate Sanskrith Selections. H M Lambert. 0. 1948. Sanskrit. Iishvara Pratyabhinj-aa Prathamo Bhaaga Grantha 22. Unknown. Psychology. 1973. 1949. G V Devasthali.. Indo Aryan And Hindi. Iishvara Pratyabhi Nj-aavivrxti Vimara~shinii Prathamo Bhaaga Grantha 60. 1986. Unknown. Religion.. Religion. Index Verborum Part Ii.. Theology. R Shama Shastri. Sanskrit. Gupta Abhinava. History.. Sanskrit. Unknown.. 1930. Theology. Dr Jatindra Bimal Chaudhuri. Theology. Influence Of Kalidasa On Harshavardhana. Unknown. Sanskrit. Unknown... 1951... 454 pgs. Theology.. 1934. Unknown... Sanskrit. Introduction To Kayachikitsa. Religion. Shan'karaananda. Sri Madhusudan Sharma. Sanskrit.. 1990. Sanskrit. Intermediat Patchabagh. Sanskrit. Theology. Intermediate Sanskrit First Year. Index Verborum Part Iii. G V Devasthali. Raghu Vira. Introduction To The Study Of Mudra Raksasa. Indravijay.… 21/167 . 1924. Introduction To The Devanagari Script. Unknown. 290 pgs... 1918. 1953. Suniti Kumar Chatterji.. G V Devasthali. 1986. 423 pgs. i srinivasa rao.. Hetubhindut'hiikaa. Sri Krishnavallabha Charya. Introduction To The Study Of Mrcchakatika. Sanskrit. 520 pgs. Hitopdesh Suharbudedh. Philosophy. Unknown. 354 pgs.. 78 pgs.. 1942.. 0.hargovind Shastry.. 134 pgs. 258 pgs. 302 pgs. Theology.. Religion. Index Verborum Part 1. 1930. 132 pgs.. Dr R Shama Shastry. Bhat't'a Aara~ya. 436 pgs.. 120 pgs. Pt. 90 pgs.... 274 pgs. Sanskrit. 466 pgs. Sanskrit. Sanskrit.. 105 pgs. Iishaavaasyopanishhada~. Sanskrit. 1921. 632 pgs.. 192 pgs. Unknown. Hinduism.. Unknown. Gupta Mada Abhinava.. Unknown. Peterson Peter. -. Sanskrit. Govinda Das.. History Of Sanskrit Poetics.. Religion. Sanskrit. 354 pgs. Unknown. Unknown. Unknown.. History Of The Duta Kavyas Of Bengal. 1949. 100 pgs. Sanskrit.. Mukunda Rama Shastri. Sanskrit. Indian Scientific Nomenclature Of Birds Of India Burma And Ceylon Vol X X... Hymns From The Rgveda.. Sanskrit.. 1938. Sanskrit.. 1969.. Deva Utpala. 470 pgs. Sanskrit. 2002. Unknown. Sanskrit. Sanskrit. 500 pgs. 1925. Unknown. Unknown. 197 pgs. Religion. 1953. Religion. 360 pgs.. Unknown.. P V Kale. Gupta Abhinava. sanskritdocuments. Unknown. Pandit Sukhlaji Sanghavi.. 161 pgs.. 1938. 1941. Religion.

. Unknown.. Jaiminiya Brahmana of the Samaveda. Panditharinarayansharmami.. Itihasah Shaastra Va Tattvajnj-aana... Sanskrit.. Sanskrit. Linguistics. Jalabheda. 406 pgs. Jaisinhakalpadrumah Dharmashstragranth 1. Sanskrit. Theology. Geography. Language.. Acahrya Jinvijay Muni. Jathaka Bharanam. shambhunath tripathi. Unknown.r. 455 pgs. Jainendra Mahavritti Of Shri Abhayanandi. 1922. 446 pgs. 178 pgs. Unknown. Jaiminiya Arseya Jaiminiya Upanishad Brahmanas. Muura~tii Vijaya. 524 pgs. Sanskrit.. Jainadara~shanasaara.. Gupte Ke Esa~. Mahopadesaka S Rajavallabha Sastrigal. Achyatananda. Theology. 1944. 1984. Sanskrit. 0... 296 pgs. 76 pgs. Sri Vallabhacharya. Religion. Sanskrit. 171 pgs. Jainashiilaa Lekha San'grah Dditiiyo Bhaaga. 1982. 105 pgs.. Unknown.. Jaimani Sutra Vritti Subhodini Namika. Linguistics Literature.. Jataka Parijata Adhyayas 11-15. 350 pgs. Sanskrit.. Astrology.... Sanskrit.. 0. 536 pgs. 170 pgs.. 145 pgs. Sanskrit. Unknown. Unknown.. 1951. 0. Unknown.... Tripitakacharya Bhikshu Dharma Rakshit. V. brahmachari sarveswaranand. 408 pgs.. Theology. Sharma. Linguistics Literature. . 1952. Sanskrit. 1984.. Unknown. 248 pgs. Unknown. Religion.. 0.. B. Literature.. 714 pgs. Jaatakapaarijaata. 81 pgs. 1947... Unknown. Sanskrit.. Unknown. Linguistics. Sanskrit. Jatakatthakatha Vol I. Jaiminiya Brahmana Of The Samaveda. Religion.. Biography. 247 pgs. Sanskrit. Sanskrit. 0. 1954. 0. Jagadruru Sri Sacchidananda Sivabhinava Nrisimhabarathi Vijayakavya. 414 pgs. Raghuvira. 0. Sanskrit.. Jagadish Anumitha Grandhah... Geography... Unknown. Jaathakadesha Margaha Chandrika. Theology.. Sanskrit. 1950. Linguistics. Language. sanskritdocuments. Bhiqs-u Dhara~maraqs-ita. Sanskrit. Unknown.. Daivajana Vaidyanatha. Sanskrit. Literature.. 1951. Biography. Sanskrit. Religion. Javaahara~lala~ Neharu Aatmacharitra. Sanskrit. Sanskrit. 344 pgs. 1980. 582 pgs.. Religion..m. Bellikoth Ramchandra Sharma. Jambu Chariyam Number Xxxxiv.. Jathaka Baranamu. Jaiminigrxhmasuutrama~. Religion. Dr B Ramaraju.2/14/2011 A list of scanned Sanskrit books at III… Isvasyopanished Asyam.. Jambhavati Parinayam. 568 pgs. Theology. Dr Prabhakar Shastry. Sanskrit. Jaiminiiya Braahmand-an' Dditiiye Kaand-d'e.. 0. Unknown. Sanskrit. Jainendravyaakarand-ama~.. Sanskrit. 1933. 146 pgs. Theology.. 333 pgs... 305 pgs. Janasrayi. Mallinathana Si Esa. 1956. Raghu Veera.org/…/SanskritIIIT. gopesh kumar ahoja. History. 1937... 1951... Pullagummi Venkatacharyulu. Kalaan'da Vi. Jaminiya Arseya jaiminiya Upanishad Brahmanas. 1904. Sanskrit. Jathakat'a~t'hakathaa Prathama Bhaaga. 1934. V. 1950. 1969. Lokeshachandrend-a.. Sanskrit. Unknown.… 22/167 . Sanskrit.r. 538 pgs.. Sanskrit. 1950. Jatakattha Katha. Devanandimunii... Vacant. Jathaka Baranamu.. Subramanya Sastri.. 342 pgs. 175 pgs. Jaipur Ki Saskrith Sahitya Ko Daen.. Gandesha~gore Naaraayand-a. Sanskrit. 940 pgs. Unknown. Language. Bhikshu Dharm Rakshit. . Acharya.. Sanskrit. 1920. 442 pgs. Literature. Ramakrisha Kavi.

Philosophy. Jinasahasranaama.. Pandit Pannalal Jain Sahitya Charya.. 88 pgs. Sanskrit. 1925. Literature.. Pandit Narayan Datta Vaidy. Theology. R. 304 pgs.. 488 pgs. Linguistics... 264 pgs. Sanskrit. Sanskrit. Jnaanaara~nd-avatantrama~... 736 pgs. Sanskrit. Theology. Unknown. Language. Jayapoorva Bhavamu.. Sanskrit. shyam lal. Shriibaand-abhaat't'aa Mahaakavii... Sanskrit. 1925. 1944.... History. Literature. 563 pgs. Unknown. Sanskrit. 0. Literature. Rajanadh Sarma.. Aashaadhara Pand-d'ita. Biography. Unknown. 1954. Sanskrit. Vilomakaaland-d'a Shriidakt'ara~. 314 pgs. Jnaneshwari.. 623 pgs.. Language.. Balasharma. Sanskrit.. Linguistics. 416 pgs. Language. 0. Sanskrit. Jinaratnakosa Vol I.... Kaarikaavalii Mukttaavaliida~vitiiyan' San'skarand-ama~. Literature. Language. Unknown. Philosophy. 1921. Sanskrit.. 1959. Sanskrit.. Kaalidaasa. 1944. 64 pgs. 1934. 1131 pgs. Sanskrit. 1947. Sanskrit.… 23/167 . 0.. Sanskrit.. Buddhi Jinendra. Sanskrit. Kaashikaavivarand-apanj-jikaa Prathama Bhaaga. Jivanandanam. Kaadambarii Shhashht'a Vrxtti.. Theology. Sanskrit. Kaadambariikalyaand-an' Naat'akama~. Theology. 0. Pandit dayashanleareupadhyaya. -. 216 pgs..2/14/2011 A list of scanned Sanskrit books at III… History. Iishvara~ Proktama~. 408 pgs. Linguistics. 0. Sanskrit. 1954. 1947. Literature. Kaasyapagnaanakandaha. Sanskrit. 1867. Religion.. Bhat't'aachaara~ya. 714 pgs. Geography... 1913. Kaat'hakagrxhyasutrama~ Bhaashhyatrayasarasutama~. M. Sanskrit. Chaara~ya Maadhava. 0. Linguistics. K t'h k i hh t Ch t thi k tti V d Phil h P h l sanskritdocuments. Unknown. Sanskrit. Kaat'hakopanishhata~. 694 pgs. Psychology. Shriidhashaastrii Pan'd'ita. 1976. Sanskrit. Jyothishshamasangraha Jaathakbhag.. 1929. 141 pgs. Literature. Language.. -. Jitante Stotram. Theology. Kaashi Kaa Vivarand-a Panj-jikaa Khand-d'a 3. Chakravara~tii Chan'draa. Jotisha prasna phala ganana. Religion. Sanskrit. Unknown. Sarasvatihrdayalankara. Jayasri Grandhavali. Sanskrit.. Unknown. Ram Chandra Narayan Velingkar. 545 pgs. Language. Journal Of Sri Venkateswara Orintal Institute Tiruoathi Vol 2. Religion. G Laxmi Kantaiah. Unknown.. Ramchandra Kesava Bhagwat. Language. Religion. 1948.. Sanskrit. 1909.. Kaalamaadhava.. Unknown. 1919. Miraashii Vaasudevavishhnd-u. Parthasarathy Battacharya.org/…/SanskritIIIT. Jeevanandanamu.. 217 pgs. 772 pgs.. Linguistics.duraiswami Aiyangar. Sanskrit. Hari Damodar Velankar. 188 pgs. Sanskrit. Kaashi Kaa Vivarand-a Panj-jikaa Vol Ii Part I. 264 pgs. 134 pgs.. Kaalidaasiiyama~ Rxtusan'haarand-ama~ Da~vitiiyo Granthaa. Buddhi Jinendra.. 576 pgs. 1952.. 56 pgs. Kavii Narasin'ha. Jyaneswarinche Shabda Bhandar. Literature. Jeevandhara Champuh.. Linguistics..... 247 pgs. Unknown. Religion.. 643 pgs. Sanskrit. Sanskrit. 1076 pgs. Religion.b. Literature. Jayadevacharitram.. 142 pgs. 1995. Linguistics... Unknown. 1951.. 1936. Jigyansadhikarnpoorvapaksh... Kaalidaasa. 1975.. 349 pgs.

363 pgs. 376 pgs. 0. Language. Technology. 1934. Sanskrit.. 1955. 290 pgs. Kaavyaprakaashakhand-d'ana. 715 pgs.. Sanskrit. -. Kabeer Manshur.. 1938. Ara~hadhaasii. Kalpadrukosa Of Kesava Vol I Ramavatara Sarma Unknown Sanskrit 1928 564 pgs sanskritdocuments. Shriimaanatung-gaachaaraya... Literature... Philosophy. Sin'h Satyavrata. Kadambari . 1972. Psychology. Sanskrit. Sanskrit. 156 pgs.. 0... Kalidasa Sahitya Evam Vadana Kala. 1931.. Sanskrit... Kalpa Kalkika. Dura~gaaprasada~ Pand-d'ita. Kasinatha Panduranga Parab.r. Raajashekhara Kaviraajaa. Unknown. Kaavya Prakaasha 15.. Raajashekhara Kaviraaja. Social Sciences. Sanskrit. Language. 147 pgs. Biography. Sanskrit. Sreemannarayanamurthy.. -. 1932. 126 pgs.. Linguistics Literature. Kaavyamaalaa Dvadasho Guchchhaka. 1953. Language. Durgaprasada~ Pandita~. Literature. Shaastrii Shriivasudeva. 207 pgs.Purva Bagha. Sanskrit. Language. 1937. Biography. Sanskrit. Geography.. 108 pgs. Sanskrit. Kai Govin'dasuta Ura~fa Parushuraama Govin'da Chin'chaalakara.. Sanskrit.. 510 pgs. Linguistics. Unknown.org/…/SanskritIIIT.. 175 pgs. 1959. kapila vatsyayan. Kaat'hakopanishhata~ Grantha 7. Kainkaryaratnavali. Language.. 1394 pgs...… 24/167 . Sanskrit.. 143 pgs. 1935. Kalidasa Vol Ii.. Literature. 282 pgs. Biography. Kaavyamaalaa Saptamo Guchchhaka... Sanskrit. Theology. Kalaamruthamu. Sanskrit. S. Kalapoornoday.. Raajashekhara Kaviraajaa. Kaayaparishuddhi. Unknown. 1954. Dand-d'i Aachaara~yaa.. 300 pgs.. Kalidasa's Kumarasambhavam (cantos I-vii). 1926. Unknown. 1954... Sanskrit.... Kaavyamaalaa Shashht'ho Guchchhaka. 1935... 1993.. Vyasadevena. 212 pgs. Kakolutikeeyamu. Dr Sushma Kulshreshtha. Linguistics.. Sanskrit. Kaavyaratnan... Linguistics. Unknown. Kaavyamiimaan'saa. Sanskrit. 412 pgs. K S Rama Swami Sastri. Sanskrit. Harihara Kripala Dwivedi. Unknown. Kadhambari Purvabaga Part 2. Sanskrit. Geography. Literature. Sanskrit. Sanskrit.. Unknown. Language. Literature. 254 pgs.. Kala Madhav. Unknown.. Dr M Srimannarayana Murti. 1936.. 1939. Literature. 160 pgs.. Kaavyaadara~sha. Sanskrit. Religion. Sri Paramanandaji.2/14/2011 A list of scanned Sanskrit books at III… Kaat'hakopanishhata~ Chatura~thiyamang-kanaavrxtti... 240 pgs. Literature. 114 pgs. Linguistics.. Psychology. Sanskrit. Linguistics Literature.. Kaavyamiimaan'saa Aalochanaa Nibandha. 1955. History.. 1993. 1986. Sanskrit. Philosophy. Kaavyamaalaa Da~tiiyao Guchchhaka. Sanskrit. Technology.sehgal. 172 pgs. 176 pgs. 1952.. 352 pgs. Unknown. Sanskrit. 0. Durgaprasada~ Pandita~.. Kainkaryaratnavali Of Paravastu Krsnamacaharya. 389 pgs. Sanskrit. Linguistics. Geography.. 140 pgs. S Suryanarayan Shastry. Sanskrit.. Kaavyamiimaan'saa Prathama San'skarand-ama~. 1914. 1958. 0. Aapat'e Mahaadeva Chimand-a. Sanskrit. Linguistics. 1992.. Unknown. Parushuraamachin'chaalakara Dattatraya. 606 pgs. History. Kalatattvakosa. Madhava Charya. 1930. Sri Vishnu Sharma. Literature... 377 pgs. Siddhichandragand-i. History. 280 pgs.

148 pgs. Kalpadrukosa Of Kesava Vol I I. Gauri Shankar. Parthasaradhi Bhattarcharya. 760 pgs. Theology. 1969. Sanskrit... Hanuman Prasad Pothar. Karmakanda Karmavali. 234 pgs. Language.. Kalyan. 370 pgs.... Unknown.... Vamana. 900 pgs. Unknown. Kashyapajnana Khandah. 0. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Kalpadrukosa Of Kesava Vol I. Unknown.. Sanskrit. 1947. Karakan'd'achariu. Linguistics. Kamalavilasabhana. 90 pgs. 1971. Kashyapashilpama~. Manomohan Ghosh. Unknown.. -. 0.. Sanskrit. 1915. 674 pgs.. 140 pgs. Sri Kalanath Jha.… 25/167 .. Sanskrit. 0. Kalyana Sancheka. 306 pgs. 1928. Kanva Sanhita. Kalyaanamaalla Mahaakavi.. Murari Lal Nagar.. 100 pgs. Religion. Sanskrit. Kalyan Sanshikpt Skand Puranam. Sanskrit... Kalyan Markandeya Puranam. Unknown.. Unknown.. 0.. Sanskrit.. 1967. 412 pgs. Srikanth Sharma. 1960. Unknown.. 192 pgs. Linguistics. Kalpalataviveka By An Anonymous Author. Bapuharshet Devalekar. Unknown. Kanakaamara Munii. Kashika Part 3. 1899.. 782 pgs. 1934. 1932.... 1860. Unknown. Kalyaanamaalla Anan'garan'gama~. Kara~maviira Bhaauuraava Paat'iila Charitra Va Kara~ya. Panditraj Dhunddhiraja Sastri. Unknown.. 216 pgs. 0. 176 pgs. Technology. 112 pgs. Sanskrit. Literature. Kesava. Somasnambhu.org/…/SanskritIIIT.. Sanskrit. Sanskrit. Ghorapad'e Ekanatha Keshavarava.. . Sri Somashambhu. Sanskrit.. 0. Kalpasutra(subhodhika Vyakya).. Kashyagnanakandah.. 1947. Kashyapa Mahaara~shhi. Kalyan Sankhya-i. Sanskrit..patrusarthi Bhatta Charya. Sanskrit. Sanskrit. Kalyan Ank. Sanskrit. 1942. 234 pgs. 2001. 1960. Sanskrit. Sanskrit. Language. Krishna Das Gupta. Literature. 313 pgs. Pardha Saradhi Battacharya. Sanskrit. 0. Ramavatara Sarma. Unknown. Sanskrit. Biography. 30 pgs.. 1948. Karanaprakasa. Kashyapgyaankanda... Indian Astrology. 528 pgs.. 1927.. Hanumanprasad Pohar..b... Sanskrit. Unknown. Kanva Sanhitha.satyendra Mishra. The Arts. 240 pgs. Sanskrit. Sanskrit. Kaniviya Anthyashti Padhathi. 1915. Kanya Sanhitha Of The Shukla Yajurveda.. 906 pgs.. Unknown. -. Sanskrit.. Linguistics Literature. Unknown. Sanskrit. Unknown. Kartika Masa Mahatmyam. Indian Astrology. 231 pgs.. Karaka Mimamsa. Dr... R. sanskritdocuments. Karak Darshanamu. Sanskrit. Madhava Shastri. Sanskrit. Karupuramanjari Edition Ii. Geography. 1976.. Unknown. 302 pgs. Karana Kutuhalam Of Sri Bhaskaracharya. Kamakunjalata. 1937. Bhattacharyen Sripad Sharmana Damodar Bhattsununa. Sanskrit. 240 pgs.. Linguistics Literature. Brahmadeva. 207 pgs... Hanuman Prasad.. 268 pgs.. 212 pgs.... Unknown. Unknown. Narayana Kavi. 0. 294 pgs. Sanskrit. Unknown.. Karmakanda Kramavali No Lxxiii. 0. Unknown. Sanskrit. 307 pgs. Kapphinabhyudaya. 558 pgs. Badlikar Sriyeag Raghavrisurisununa... Kasaya Pahudam Iii Thidi Vihatti. Unknown. Gunabhadracharya... 1175 pgs.. History. Sanskrit.. Unknown. 564 pgs. Sanskrit. 1932. Sanskrit. 1958. Sanskrit.. Motilal Joshi. Sanskrit. 395 pgs. Unknown. 1991.. 0. 462 pgs. 0. Sanskrit.. 1926.. Unknown.. Kalpadrukosha Da~vitiiya Bhaaga.. -.

Har Dutt Sharma. Rarthasarathi Bhattachar. Language.. Sri Parushuram Sharmana. Unknown.. Kavyadeepika. Parthasarathy Battacharya. Sanskrit. 1984. Sanskrit. 1904.. Unknown. K C Varadachari. Sanskrit. 1987. 1944.. Theology. 1924. Unknown. Sanskrit. Unknown. 202 pgs. Kathasaritsagara Part 2. Social Sciences. 58 pgs.. 1924. S V Shastri. Sanskrit. 339 pgs. Unknown. Linguistics.. Kasyapa Jnanakanda. Kavikalapadruma Of Vopadeva. Kasyapa Maharshi. Dr.. Kautilya Vol I. 1948. Unknown.Jnan kanda. 1923.. Sanskrit. 84 pgs.. 1952. Kasyapa Samhita. Sanskrit. 1951. 172 pgs. Sanskrit. 1938.. Unknown.. Unknown. Unknown. 1923. Social Sciences... Chintaamand-i Ti Ra. Kat'hopaanishhada~ Aavrxtti Pahilii. 1960.. R Ananta Krishna Sastry..willem Caland. Katiyeshti Dipaka. 342 pgs.vedeshiya Teeka. 1925.... Kaut'iliiyama~ Ara~tha Shaastrama~ Khand-d'a 1. Katha Kagruha Suthra. Kavya Parisha. Katha Sarithsagara. 423 pgs. 0. Shriivopadevagosvaamii. 164 pgs. Sanskrit. Religion. Jollii Je. Kavyakotukadarsh.manduka Vyasatirtheeya... 1965. Language.. Kaushhiitakagrxhyasutraand-i. Religion. Pandith Rangacharya Raddi Shastry...girdhar Sharma. Rambalak Shastri. Unknown. 210 pgs. Sanskrit. Unknown.. Unknown.. Literature. 1979..… 26/167 . 1948. T. Rarthasarathi Bhattachar R. 1924.r.. Kaut'iliiyama~ Ara~tha Shaastrama~ Dditiiyo Bhaaga. 211 pgs. Unknown. Dr Gaya Charan Tripathi. 62 pgs. Kaut'iliiyama~ Ara~tha Shaastrama~ Dditiiya Khand-d'a.. 142 pgs. 220 pgs.. William Caland. Linguistics Literature. 1904.srinivasa Tirtheeya Etc. Sanskrit. Sanskrit. Sanskrit. Sanskrit.. Sanskrit. Literature. Sanskrit. 1969.. Sanskrit... 92 pgs.. sanskritdocuments..b. 378 pgs.. Somadeva. 338 pgs... Unknown. 338 pgs. Sanskrit. Kathakagrhyasutram. 222 pgs. Kavikalpadruma Prathama San'skarand-ama~... Sanskrit.. Social Sciences. Unknown. Pandith Sri Ram Govind Shukla. Sanskrit.. Kaut'iliiyan' Ara~tha Shaastrama~. 114 pgs. F Keilhorn. Bhin'de Sadaashivashaastrii. Social Sciences.. Pt. Sanskrit. Sanskrit. 624 pgs.. 486 pgs.. Kathaka Vyasatirtheeya Teeka. Kavindracharya List.krishnacharya.... Theology.. 1921. Katyayana And Patanjali Edition Ii. 1959.. Jolli Je. Jolli Je.. 348 pgs. Unknown. 230 pgs. 330 pgs. Gajanan Balkrishna Pa sule. Kavya Prakash. -. Unknown. Katakarajavamsavali Vol I. 502 pgs.. Sanskrit. 236 pgs.. Unknown. Dr Ram Gopal Mishra. 266 pgs. 1934. Kathamruthamu.. Shaastrii Ra Shamaa. 142 pgs.. Sanskrit..r.. 1930. 122 pgs.m.. Unknown. M. Unknown. R.nitya Nanda Parvatiya. Sanskrit. Sakuntal Rao Sastri.. 1919. Sanskrit.. 344 pgs. 240 pgs.p. Kavindracandrodaya. Sanskrit.org/…/SanskritIIIT. Kavyadarpana Volume 1.. Sanskrit. Kasyapa Gnanakandaha. Kathopanisad Bhasya. Sanskrit.. Kavyadarsh. Unknown. 466 pgs. Kaumudi Mahotsava. Kasyapa .. 1925. Unknown. Religion. Rajachudamani Dikshita.2/14/2011 y pgy p A list of scanned y Sanskrit books at III… pg Kasika Part 1.. Literature. Sanskrit.. 1954.. Sanskrit. Sanskrit. Sanskrit. 260 pgs. Vamana And Jayaditya. 1939. 0. 1963. 1998. 0. Linguistics.

Keinchuifantsan.. Laqs-mikaantasyaa jii. Naaraayand-a. Sanskrit. Kavyasamudaya. 510 pgs. 1925. 176 pgs. 587 pgs.. Unknown. Unknown... Machchhakad'araachaara~ya. Kavyamala Part 13. Sanskrit... Kenopanishhata~. 1934. 108 pgs. 191 pgs. 449 pgs. Kavyanusasana Vol I. 174 pgs. Arka Somayaji. 356 pgs. Sanskrit. 1951. Sanskrit. Sanskrit. Sanskrit. 232 pgs. Unknown.. Unknown.org/…/SanskritIIIT. Khilandhikara. Mahamahopadhyaya Pandith Shivadatta... 190 pgs. 1938. Theology.... Sanskrit. 1166 pgs.. Philosophy. Sanskrit. Bhat't'a Keshava.. 43 pgs. Unknown... Kavyalankara Sara Sangraha.n... 1937.. 1992. Keralodaya (a Historical Poem). 1956.. 1957. 1959. 2003. 0. Sanskrit. 1889. pg Kavyalaksana Of Dandin.. Sanskrit. 1951. Language. 166 pgs. 332 pgs. Kemopanished. 0... Pandit Durgaprasad. 117 pgs. 1919. Sanskrit. 1917. 180 pgs. 124 pgs... Sanskrit.. 1962.... Kavyasangraha 3. 0.madladevi Shastri. Srigowrinatha Shastri. Indian Logic.. Kishkindhakandah Of Srimad Ramayanam. Sanskrit... K. Sridhar Shastri.. Pandit R. 359 pgs. Sanskrit.. Unknown.. Dr. of scanned Sanskrit books at III… . 1997.. Unknown. Acharya Hemachandra. Kavyalankara. Banhatti. The Arts. 1961.. Kiratarjuniya 1889. Sanskrit. Linguistics. Kramadiipikaa. Ganeshopadhyay. Kavyalankara. Sanskrit. Unknown. Sri Venkataramanarya.. Kiranavalirahasyam Of Mathuranatha Tarkavagisha. Kavyalankara. Narayan Nathaji Kaulkarni. 1929.. -. Poems. Narayan Ram Acharya.. 1938.… 27/167 . 582 pgs. Unknown. Sanskrit. 1934... Kiirasandeshah. Kavyalamkarasutravritti Of Vamana. Kevalanavyiprakarnaam. Dr. Pandit. Sanskrit. 1981. 70 pgs.. Unknown.. Kavyaprakash.. Koushetika Brahmanam Achara Vichara. Kavyamala Part 5. Sreeramamurthy. ananthalal thakur.. 203 pgs. 1952. Narayana Daso Banahatti. 57 pgs. 114 pgs. 646 pgs. Khiladikara. Pandit Sivadatta. 1916... Kenopanishhata~ Shhashht'hiiya Khand-d'a Grantha 6. Sanskrit. Unknown. 538 pgs. 327 pgs... Unknown.. Psychology. Kavyalankarasutrani Vol I V. Sanskrit. Kavyamala Part I X. 1916. Unknown.. 1919. Kiratharjuniyam. Sudhakar malaviya. Sanskrit. Religion. Sanskrit. Sanskrit. 1944. 1929. Poems. Pardha Saradhi Battacharya. Jivananda vidyasagar Bhattacharya.. Sanskrit. Unknown. Religion. Kavyanusasana. Unknown. Sanskrit. 576 pgs. Khanda Kadya Sahastrika. 1992.. Hari Narayan Aapte.... Sanskrit.. Sanskrit. Krishna Charitam. Kavyamrtam. . Sanskrit. Unknown..b. Unknown. Theology. N. Sanskrit. 123 pgs. Unknown. Kavyamala Part 1. 626 pgs.. Sanskrit. 1927. Kiichakavadhama~.. Kasinath Panduranga Parab. Theology. Unknown. Nitiivara~ma Mahaakavi.. Kavyaprakasa of Acharya Mammata.. Sri Harishankara Sarama. Sanskrit. 1938... Krishna Charitramu Peri Venkateswara Shastri Unknown Sanskrit 0 74 pgs sanskritdocuments. Religion. 112 pgs. Rajvaidya Jivaram Kalidas Shastri. Pandit Durga Prasad.pathrusarthi Bhatta Charya..2/14/2011 y p A list. 140 pgs. 224 pgs. Kavyamala. -. Unknown.d. Durgaprasad. Unknown. Sanskrit. Sanskrit.ezhuthachan. 275 pgs. Literature. 2002. Sanskrit.. 334 pgs..

Unknown. Theology. Dr. Kriyaasaara Vol I. 1976. Rama Murti. 1954. Unknown. Unknown. Rangaswami Aiyangar... Religion. Thakkura. Sanskrit. Krithya Kalpataru. Unknown. Krxshhnd-a Yajura~vediiya Taittiriiya San'hitaa. C. 1967. Krtyaratnakara.. 580 pgs. K V Ranga Swami Aiyangar. 424 pgs..sudhakar Malaviya.. Kumparnapuranam. Kumarasambhavam Mahakavyam.. Krtyakalpataru Of Bhatta Laksmidhara Vol 3 Niyatakala Kanda.. Sanskrit. 178 pgs. 462 pgs. Theology. sanskritdocuments. Krxshhnd-a Yajura~vedii. Shriimatsaayand-aachaara~yaa.moksakanda.. 658 pgs. Sanskrit. 401 pgs. Sanskrit. Sri Neelamanimukhopadhya. Krtyakalapataru Of Bhatta Laksmidhara Vol. Dr. 413 pgs. K V Rangaswami Aiyangar. Sanskrit. 1940. 349 pgs... 74 pgs.xiv.s. Ksemendra Studies. Sanskrit. Kurmapuranam.v. 1929. Sanskrit.. K. 1941. Unknown. Sanskrit. 1940. Unknown. Sanskrit. K. 290 pgs.. Sanskrit. Krsnavilasa Of Punyakoti. Sanskrit.v. Rangaswami Aiyangar. Sanskrit. Rangaswami Aiyangar. Religion. 1945... Sanskrit.. 1929. Sanskrit.. Theology.org/…/SanskritIIIT..… 28/167 . Krtyakalapataru Of Bhatta Laksmidhara Vol 1... Sanskrit... Unknown. Shriimatsaayand-aachaara~yaa.. Krxshhnd-ayajura~vediiyataittiriiyasan'hitaa Da~viitiiyo Bhaaga. 1997.. Ksemendra Ladrukhayasangra. Religion.s. 490 pgs. k. Religion.. 1890. Shriimatsaayand-aachaarayaa. Dr.. 322 pgs.. 1950. Rangaswami Aiyangar... Unknown. Krxshhnd-a Yajura~vediiya Taittiriiya San'hitaa Panj-chamo Bhaaga. Language. 1950. 1925. 1948... k v rangaswami aiyangar.. 446 pgs.. Unknown. k. Suru Bhatta. 1945.ayendra Sharma.. Religion. Sanskrit. Sanskrit. 1961.. Krishnajuvirdeeya Taitireeysanhitha. Krtya Kalpataru Of Bhatta Laksmidhara Danakanda Vol 5.. 1983.. 1950. 414 pgs.2/14/2011 A list of scanned Sanskrit books at III… Krishna Charitramu... 478 pgs.. Sanskrit. Pandith Sripad Damodar Sathvalekar. 1954. Krtyakalapataru Of Bhatta Laksmidhara. Unknown. 1942. Unknown. 1976. Sanskrit. 1983. 373 pgs. Religion. Kundamaalaa. 644 pgs.k.. 1848.. Sanskrit. Shriimatsaayand-achaara~yaa. Theology. Krishna Vilasa Of Punyakoti With Commentary. Rangaswami Aiyangar. Theology. 0. 372 pgs..v. 681 pgs. Religion. Theology.. Shriiding-a~naaga Mahaakavii.. Literature. Sanskrit. Linguistics. Unknown. Unknown. Krxshhnd-ayajura~vediiya Taittiriiyasan'hitaa Prathamo Bhaaga. k.. Krxshhnd-ayajura~vediiya Taittiriiyopanishhata~ Pnj-chamiiyamang-kanaavrxtti. Shivaa Chara~yaa Niilakan't'ha. Peri Venkateswara Shastri. Sanskrit. 446 pgs. Religion. 1946.. Sanskrit. 777 pgs. 1950... 436 pgs..ramshankara Bhattacharya. Vaamanashastrii Pand-d'ita. Unknown. 592 pgs... Dr. Sanskrit. 180 pgs. Religion. Sanskrit. Unknown. Krtyakalpataru Of Bhatta Lakshmidhara Vol Iv.v. Theology. 258 pgs.ramamurti. Krtyakalpataru Of Bhatta Lakshmidhara Vol X.. Kriya Svara Laksanam Or Yohi Bhasyam. Religion. Sanskrit. 234 pgs. Dr Surya Kanta. 230 pgs. Sanskrit... Unknown. Krxshhnd-ayajura~vediiya Taittiriiyaarand-yakama~ Prathamo Bhaaga.

Ladhu Ramayanam. shri achyuthananda jha. Sri Govindnath Guha. 1993. 0. 134 pgs.. Laghumaanasama~. Unknown. 65 pgs. Sanskrit. 290 pgs. 257 pgs. Sanskrit.. Laalaa Lajapatharaaya Yan'chen' Aatmacharitra Va Charitra.. 296 pgs.. 1904. 1959. Sanskrit.. Unknown... Theology. Sanskrit. Theology... 152 pgs. 0. 0. Sanskrit.. Sanskrit.. Lalleshwari Vyakyani. Unknown. Natural Sciences. Natural Sciences.org/…/SanskritIIIT. 1950. Unknown. Natural Sciences. 2000. Religion.. Dasharadhi. Sanskrit.... Religion. Sanskrit. N C S Venkatacharya. Religion. Linguistics. Unknown. 1977. Acharya Krishan Mohan Shastry.... Unknown. 220 pgs.. Sanskrit. 456 pgs. Sanskrit. 310 pgs. Sanskrit. Kulakara~nii. J P George.. 1999. Laghushabdendushekhara Napadaantasuutraanto Bhaaga. 1952. Unknown.. Sudarshanacharya Tripathi.. Sanskrit. Unknown. Sanskrit. 174 pgs. Krishnamacharya. 1998. Laghu Sabdendu Sekhara Vol I. Diiqs-ita Vaasudeva. Sri Varadharajacharya.. Sanskrit. Peri Venkateswara Sastri. 342 pgs. 1988. 1944. Kuvalayaananda. Sri Girishkumar Tagore. Laghu Parasari And Madhya Parasari. 277 pgs. Munj-jalaachaara~ya. 1944. 298 pgs. 34 pgs... 1651. Laghu Siddanta Kaumudi.. Pandit Sri Achyutananda Jha. Unknown. Kuttanirmatam Kavyam.. Sanskrit. Laghusiddhantkaumudi. Lakshmisahara. Pandith V. Sanskrit. Ladhunibandha. Lagusidhanthkoumudhi.. 133 pgs.2/14/2011 A list of scanned Sanskrit books at III… Kut't'aakaarishiromand-i.. 46 pgs. Prakash.. 394 pgs. Unknown. 514 pgs. Linguistics.. Sanskrit.. 1941. Sanskrit. Unknown. Laghuparashari Madhyaparashari. Theology. -. 1993. 1936. Unknown..... Sanskrit. Lakshmi Sahasram Part 1.. Sanskrit. Sanskrit. Laghu Kashika 1.. Laghu Shabdendu Shekar.. Unknown.. 1946. Lavangee. 1962. Biography. History. 124 pgs. Unknown. Language. alfred lord tennyson.. Saktisrm. Varadaraajaachaara~yaa.. Shriinaageshabhat't'a Mahamahopaadhyaaya. 1931. Sanskrit.. Lakshmisahasra Vol Iv. 1983.. Laghubhaaskariiyama~. Shriibhaaskaraachaara~ya. 314 pgs.. 858 pgs. Literature. Lagusidhantkomudhi. Laghu Siddhanta Kaumudii Pura~vaara~dharuupa Prathamo Bhaaga. 0. Raghunathaharya N c. Unknown.. Sanskrit. 496 pgs. Lectures On Patanjali S Mahabhasya Vol 2 Ahnikas 4 6. Sanskrit... Religion. 1917.. Sanskrit.. Unknown.. 372 pgs.. Linguistics Literature. Shriidevaraaja. Geography.. Sanskrit. 608 pgs. 1280 pgs. Pandith Nandkishore Shastri Ayurvedacharya. Laghusidhantakoumudhi. 1951 314 sanskritdocuments.. 1941.. 1974. Unknown.. Tata Subbaraya Sastri. Le Role Des Forets Dans Le Developpement Des Collectivites Locales Forets7. 70 pgs. Unknown. 328 pgs.. 162 pgs. Lalitha Madhavam Gareth And Lynette. Unknown... Sanskrit. 1978. Sanskrit. Suryakanta. Unknown. Venkatadhvari.. Sanskrit. Unknown. Varadharajacharyapranith. Laghurkatantrasamgraha And Samasaptalaksana. Shara~mand-aa Vaasudeva. Literature.. Sanskrit.… 29/167 . 684 pgs. Sanskrit. Prakash.. Sanskrit. Lakshmi Tantra A Pancaratra Agama. Pandith Sri Narayana Dutt Shastrina. 1938. 34 pgs. 1954. Language. Laghu Sabdendu Sekhara. 1940... P S Subramanya Sastri. Latkamelakamu.. 466 pgs. 130 pgs. Kutuuhalavrxtti Prathamodhyaaya. Theology. Sanskrit.. 1867. Madhusudan Kaul.

Sanskrit. Geography. Sanskrit. 146 pgs... 474 pgs. 1951. 1913. 0. Maanameyaarahasyashlokavara~tikama~ Sakalashaastrasaarasan'graharupama~. 1930. Devadhara. 491 pgs.. Maajhii vilaayatachii Saphara~. 266 pgs. Language. Philosophy. sri visvesvara bhatta.. Shriimadbhaskaraachaara~yaa. Sanskrit. Leelavathi.. Sanskrit. Bid'e Sadhaashivashaastrii.. Maanavaa Grxhayasuutraa. Unknown... 685 pgs. Sanskrit. Sanskrit. Natural Sciences. Sanskrit. Biography. Maadhaviyaadhatuvarittii. Vinayak Ganesh Aapte. Biography. Geography. Language. 326 pgs.. 677 pgs... 1931... 150 pgs. Shriibhavabhuutii Mahaakavii. Literature. History. Unknown. P S Subrahmanya Sastri. 314 pgs. Unknown. Aapat'e. Shriinivasaachaara~ya Laqs-miipurama~. Biography. 182 pgs.. Theology. Psychology. 178 pgs... 1928. Maalati Maadhava Sekand'a~ Ed'iishana~. Lectures On Patanjalis Mahabhasya Vol I I I. Philosophy. 187 pgs.. Religion. Maajhaa Sn'giita Vyaasan'ga. 1953.. 1937. Sanskrit. 1947. Sanskrit. Geography. Pandit Jagaddhar Zadoo Shastri. Unknown.. Sanskrit.org/…/SanskritIIIT. 1925. 120 pgs.. 1953.. bhogilal. Linguistics. Unknown... Maan'nd-d'ukyopanishhada~ Taittiriiyapanishhada~ Aavrxtti Pahilii. Sanskrit. Sanskrit... 0. 268 pgs. Sanskrit. Kara~ve Chintaamand-agand-esha.. Shriinivaasaachara~yaa Laqs-miipurama~. Psychology.. 501 pgs. 270 pgs. Unknown. Unknown. Ma. 1944.. Maara~ka T'a~vena. Linganusasana Of Durgasimha.. Literature. 1946. 1937. Maanavii San'skrxtiicha Itiihaasa.. History. Life of Pingali Suuranaarya. Biography. 448 pgs.… Madhavanidan Vijayarakshita And Shri kanthadatta Unknown Sanskrit 1932 792 pgs 30/167 . Tekumalla Achyuta Rao. Sanskrit. Sanskrit. Language. 1931. T'en'be Govin'da.. 86 pgs. Sanskrit. Sanskrit. Madanpalnidhantu. Shaastrii Raamaakrxshhnd-a Hara~shaajii. Bhavabhuuti. Maalatiimaadhavan' Naamaprakarand-ama~. Kulakara~nd--ii Ran'ganaatha. 1935. 1934. Literature. 104 pgs. 1952. Sanskrit. Geography. Madanamaharnava. Harsavardhana.... Linguistics. Shriimadbhaskaraachaaryaa. Gaan'dhii dara~shana~. Language. Literature. Natural Sciences. Lokaprakasha Of Kshemendra.. 1955.. Literary Circle Of Mahamatya Vastupala And Its Contribution To Sanskrit Literatute. Sanskrit. 374 pgs. 115 pgs. Sanskrit... Maalatiimaadhavama~.. Literature. Leelavathi Uttarshorupo Dwithiyo Bhagah. 1926. Pandith Ravi Dutt. 491 pgs. Chaara~yaa Vyaakarand-a.2/14/2011 A list of scanned Sanskrit books at III… 1951. History.. Language.. 314 pgs. Sanskrit. Theology. Sanskrit. Liilaavatii Pura~vara~dharupam Prathamo Bhaaga. vinayak ganesh apte.. 1924. Liilaavatii Uttarara~dharupo Da~vitiiyo Bhaaga. Linguistics. sanskritdocuments. History. Sanskrit. 1948. Geography. 277 pgs. Linganusasana. History.. Religion. Unknown. Sanskrit. 194 pgs.. Unknown. Korat'akara Vit't'alakeshavaraava.... Sanskrit.. Biography. Maanameyarahasyashlokavara~tikama~... 327 pgs. 0. Linguistics. Dattatrey Gangadhar Koparkar. 1812. Linguistics.

Madvanidhanamu. Sanskrit. 1835. 832 pgs. 162 pgs. 1953. Sanskrit. Madhvatantramukhamara~danama~. 1888. 0. Sanskrit. Sanskrit.. History. 408 pgs. Mahaabhaaratama~ Prathama Bhaaga Viraat'apara~vama~. 0... 520 pgs... Mahaapuraand-ama~ Uttarapurand-aada~vitiiyaara~dhabhuutah Trxtiiya Khand-d'a... 1986. 1931. Geography.. 92 pgs. khemraj Shri krishnadas.. 385 pgs. 1936.2/14/2011 A list of scanned Sanskrit books at III… Madhavanidan... Bhuda~bali Bhagavan'ta~. Literature. Unknown. 172 pgs. Madhavanidana.. Philosophy.. 1965. 596 pgs. sanskritdocuments. 741 pgs. Pushhpadantaa Mahaakavii. Unknown. 1956. Sanskrit.. Unknown. Unknown. Sanskrit. Madhura Vijayam.. madhakara... 104 pgs. Linguistics. 1932. 1992. Mahaabhaaratama~ Sat'iikama~ Chatura~to Bhaaga Drond-apara~va. Sanskrit. Sanskrit. Social Sciences. Mahaapurand-ama~ Da~tiiya Khand-d'a. Sanskrit.. Sanskrit. Unknown. Geography. Linguistics. Maha Bandho Vol Iii Book Iv. Literature. 0. 448 pgs. 444 pgs. Language. Unknown.. 70 pgs. Sanskrit. Sanskrit. Madhyanta Vibhanga.. Sanskrit. sri madhuvakar. History.. 1953.. Unknown. 1912. Phool Chand Siddhanth Shastry. Unknown. Saradaranjan Ray Vidyavinodha. Sanskrit. Sanskrit. Shriimanniilakand-t'ha. Maha Bhashyam. The Arts. Vipushhpadantaa Mahaakavi. Biography. 601 pgs. Unknown.. Sanskrit. 198 pgs. 1919... Mahaaban'dho Bhaaga 2.. Language. 710 pgs. 1930. 1931. Unknown.. 1924. Ganga Devi.. 406 pgs. 1940. -. Psychology. Bhagavan'ta Bhad'aaraya Bhuudabali.. Language. Theology. Linguistics. Mahaaban'dho Pustaka~ 3. Sanskrit. Sanskrit. Religion... Sanskrit. 84 pgs. Linguistics. Sri Vrajwallabh Sharmana.. Mahaanaarayand-a Upanishhada. 1992..… 31/167 . Saatalekara Daamodara. Psychology.. 792 pgs. Literature. 503 pgs. 456 pgs. Maenkavishwamithram. Linguistics. Gaddangadevi. Unknown.. Madhavnindanam. 180 pgs. Madhavanidhan. Philosophy. 1954... Unknown. Sanskrit. Raghuviiraa. Madvanidhan. 1941.. Valle poussin. Vijayarakshita And Shri kanthadatta. Keshani Prasad Chaurashiya. Shriimadappayyadiiqs-ita. 589 pgs.. Sanskrit. Pandith Sri Ramchandra Bhatt.. Language. Literature. Language... 1951.. Mahaabhaaratapraveshikaa. 590 pgs. 176 pgs. Mahaaraaja Shivaajii. Manmukundamuni. Biography. Kaand-e Pii Vii. 1984. 170 pgs. Sanskrit. Theology. 1086 pgs. Madhyama Kavatara Par Candrakirti. 454 pgs.. Pand'e Siitaaraama Vasudeva. 1969.org/…/SanskritIIIT.. Sanskrit.. P.. Madhura Vijaya Or Virakamparaya Charita.chaudika prasad sharma. Dr Hari Narayan Dixit. Madhyakaumudini Rahasyam Prashnottari. Sanskrit. Madhyakalin Hindi Sant Vichar Aur Sadhana. Sanskrit..... Literature.. Religion. Vasubhandu And Sthiramati.. Literature. 0. Mahaabhaashhyama~ Prathama Grantha. Sanskrit. Maghas Sisupalavadham Canto I I Edition V I. Mahaanaarayand-a. Sanskrit. Mahaabhaarata 13 Anushaakanapara~va. Sanskrit.. Unknown. Unknown. 1983...

0. Mahabhashyam.. -. Sanskrit. Sanskrit. 709 pgs. Satavalekar.. 1951... Anundoram Borooah. Sanskrit.. 269 pgs... 503 pgs. Swami Dwarikadas Shastri. Pannalal Jain. Mahabhasyam. G R Josyer. Majjhi Manikaya Vol 1. sanskritdocuments. 537 pgs.. 790 pgs.. H Mhpohobs. 750 pgs. Acharya Sri Ramachandra Mishra.. Unknown. Theology. 334 pgs. Sanskrit.. Mahakavi Bhasas Swapna Vasavdatta Natak.. Sri Sheshraja Sharma Shastri. . Swami Dwarikadas Shastri. 290 pgs. Biography. Pandit Guru Prasad Shastri.. Mahabhasya Praskash.. 1918. 1947. Pandith Sri Ramchandra Mishra. Unknown. Sanskrit. 284 pgs. Biography. Mahaviirachacharitaa.2/14/2011 A list of scanned Sanskrit books at III… Mahaaraashht'a San'ta Kavayitri. Religion.. 370 pgs. Mahavyutpatti. Sanskrit. 166 pgs. History. Unknown. . 77 pgs.. Biography. Unknown. Unknown.. Sanskrit. Sanskrit. 597 pgs. Unknown. Malavikagnimitram. Sanskrit. Sanskrit. Unknown. Sanskrit. Mahaarashhatra Itihaasaman'jarii. 360 pgs. Mahabharathtatvadeep.. 1954. 486 pgs. Unknown.r. -. Unknown. 0. 285 pgs. 1941. Malatimadhava.. Geography. P. 1968. Manasa Piyush Sundara Khanda. Maharajas Sanskrit College Magzine. Shastri. 420 pgs. Sanskrit. 1911.. Unknown. The Arts..... 765 pgs. Sanskrit. Sanskrit. Mahabharatha Kosha.. 1969. 1998. Malavikagnimitram A Play In Five Acts. 280 pgs. Sanskrit.. Sanskrit. Bhaavabhuuti. Sanskrit. 1951. 0.. Sri Anjani Nandan Sharan. Sanskrit. 153 pgs. Sanskrit. 354 pgs. Sanskrit. 164 pgs... Unknown.. ramkumar rai.. Sanskrit. Spiritual Experience And Mysticism. Unknown. Sanskrit.. Unknown.. 1993. Maharaja Bhojarajas Sringar Prakasha.. 1845. Mahapurana Vol Ii Uttar Purana. 1986. 1918... Sanskrit. 1931.. 0. 1929. Mahabharata Tatparya Nirnaya With Comm Anandha Thirtha. Sri Ramachandra Mishra.org/…/SanskritIIIT. 1926. Mahaviracharita Of Bhavabhuti. Mahabharathmarmagya Varnasi Subhramya Shastry. 1949. -.. 1951. 1989.. Mahaban'dho Prathama Bhaaga. Majjhi Manikaya Vol 2. 422 pgs.. Unknown. Mahaatmaajiin'che Satyaache Prayoga Athavaa Aatmakathaa. Geography.. 1955. Shri Yogendra. -. Sanskrit. 556 pgs. Mahavira Charita Of Mahakavi Sri Bhavabhuti. 0. 744 pgs. Religion. Vayu Purana.. . History. Unknown. 315 pgs.. Madhukanth. History. 378 pgs. Mahaveera Charithramu.… M h t Of Th M it i S kh R ki h H h ji S ti U k S k it 32/167 ... 0. Sri Charudevshastryna... Unknown.. Sanskrit. 1982. 0... -.. Unknown. Maitrayani Samhita. Aajagaan'vakara Jagannatha Raghunaatha. M.. Unknown.. 1990. Theology. Unknown. Unknown... Unknown.. Sanskrit. Sanskrit. Bhuutabalibattaraka Bhagavan'ta~. 670 pgs.... Sanskrit. Sanskrit. Sanskrit. Mahanirvana Tantra Vol Xiii with The Commentary Of Hariharananda Bharati.. Aapat'e Dattaatrayavishhnd-u. Malavikagnimitram.. Geography. 232 pgs. Mahartha Majari. 0. Sanskrit. Gaan'dhiijii Mohana~daasa~karama~chanda~. Mahabharathvachanamruthm. 502 pgs.. 274 pgs. Unknown. Mahabharathamu.

49 pgs. Mandukya Upanished. 1984. Vishaakhadatta. Sanskrit... 0. Raajaa Kun'haana. 174 pgs. Dr C Kunhan Raja. Language.. Psychology. V. 128 pgs. 1929. Apte. Jaya Shankar Lal Tripathi.. Mrcchakatika of Sudraka. 220 pgs.. Geography.. Kavi Shriikrxshhnd-aa. 2002. 1961. Muhatri Chintamani. Meghaduta of Kalidasa Text With English Translation amp Notes. Sanskrit. Language.. -. Kashmorey Dwij Sri Prannath Pandith. 1924. Mrxgaang-kalekhaa Naatikaa.r. Sanskrit.org/…/SanskritIIIT. Unknown. Mayurasandesa.. Sanskrit. Jaimini. 235 pgs.. Literature. Sri Harish Shankar Sharmana... Visakhadatta. Sanskrit. 0. 203 pgs. Mudraraksasa First Edition.. 760 pgs. 1944. 1970. 306 pgs.. Psychology. Mandaaramarandachampuh.. 374 pgs. Sanskrit. Unknown. Linguistics.v. Sanskrit. 1969. 1982. Sanskrit. Shalaram Dwivedi. 0. Muhoorta Depika..… 33/167 . 1879. Meghadutam. Unknown.v. Sanskrit. G. 2001... Sanskrit.. Unknown. Mayadprajaichariu. 302 pgs.. Unknown. -. 0.. Language. Mruschakatika... 330 pgs. Marcandeya Purana. Literature. Sanskrit. 540 pgs. 0.. Miimaan'saadara~shanama~. 702 pgs. 178 pgs. Sanskrit.nandargikar. 0. Unknown. 1921. Sri Mukunda Shastri.. 200 pgs. Unknown. Unknown. Mishra bandhu vinod. 318 pgs.2/14/2011 A list of scanned Sanskrit books at III… Manavagrhyasutra Of The Maitrayaniya Sakha. Sanskrit. Sanskrit. Unknown. 583 pgs. Sanskrit. Unknown.. Maunt'ast'uara~t'a Elfinst'ana Saaheba Yaan'chen' chariitra Pura~vaara~dha. Linguistics.. Mudrarakshasam. Linguistics.. Manormaratnavivek Vol Iv. Sanskrit. Sanskrit. Unknown. 0. 230 pgs. Meghavijayopadhyayas Digvijaya Mahakavya. Mudra Rakshasam. 1918... Mayuura Sandesha. Sanskrit. Sanskrit..g.. 333 pgs. -. Deva~ Shriivishvanaatha... Sanskrit. 1915.. 632 pgs. Markandeya Samhita... Unknown.. Mimamsabalaprakasha Of Sri Bhatta Shankara. 1944. Unknown. Sri Shathragna Mishra. 184 pgs. Ganesh Bihari Mishra. Philosophy.. Sanskrit.. Unknown. 1948. 1962. Mudrarakshasa Or The Signet Ring A Sanskrit Drama In Seven Acts. Religion. Sri Haridas Siddhanta Vagosha Bhatta Charya. 372 pgs.. Unknown... 2002. 1937.. 1911. -. Sanskrit. Megh Dootam. Sanskrit. 0. Language. God'abole Krxshhndaajiiballaala. Manthrardha Deepika.. Unknown. Sanskrit. History.. Linguistics. Sanskrit... Sri vidyanth Jha. E... Shukadev Bihari Mishra. Literature. sanskritdocuments. Ramakrishna Harshaji Sastri. Hira Lal Jain. Mudraraaqs-asa Prathama San'skarand-ama~. Upanishads. Literature. 335 pgs. Unknown. 195 pgs. 114 pgs. Unknown. 690 pgs. Theology.. Minorworks Of Ksemendra.. Medhdutam. Manusmruthi. 274 pgs. Dr Ramashankar Tripathi... 1926. Sanskrit.raghavacharya. 308 pgs. Unknown. -. Sanskrit.. Mimamsa Shastram. Literature. 1902.. 185 pgs.. Sanskrit. Shyam bihari Mishra. 1923. Sanskrit. Sanskrit.... Biography.. khemraj Shri krishnadas. Sanskrit.. gagaavishhnd-a shriikruushhnd-adaasa. 62 pgs. Philosophy. 94 pgs.. Literature. Saradaranjanray Vidyavinode.

132 pgs. Sanskrit.. 0. Sanskrit. Theology. Pushhpadanta Mahaakavii. Sanskrit.. Chintaamand-i. Sanskrit.... Gunasaan'dra and Raamachandra. 674 pgs. Nagananda Edition I I. Literature.. Naagakumaaracharita.. Language.. Sanskrit. Literature. Kaviatan Pandit Shiv Dutta. Dr..b. Dr Jagdamba Prasad Sinha. Unknown. Linguistics.. Linguistics. Pandith Sri Guru Prasad Shastry.dhawan. 92 pgs. Sanskrit. jyeshtarama mukandaji. 4-6. Sanskrit. Literature. Nagari Pracharini Granthamala Series No. 236 pgs. Sanskrit. Chand baradai. Sanskrit.. 0. 1469 pgs.. Unknown. Unknown. Naamalid'agaanushaasanama~. Chand baradai. 1906. Nalopakyanam Dwithiya Khandah. 135 pgs. 1933. 1927. Namalinganusasana Alias Amarakosa Of Amarasimha. Aapat'e Hari Naarayand-a. Unknown. Naathamaadhava Trot'aka Charitra va Aat'havand-ii. Unknown. 1933.. 173 pgs.. Language.. Literature. Naagarasara~vasva Kaamashaastrakaa Apuura~va Gran'thaa. History. Sanskrit. -. 1953. 1987. 358 pgs. Unknown. Chintaamand-i Ti Raa. Mund-d'akopanishhata~ Grantha 9.. 78 pgs. 276 pgs.. 1941. 206 pgs. C. 1992. Naisadhiyacharitham Canto12 22 Uttarardha. Sanskrit. Literature. 1934.. Sanskrit. Unknown. Sanskrit. Nagari Pracharini Granthamala Series No.. 452 pgs. Sanskrit. 384 pgs. Jagdamba Prasad Sinha. 178 pgs. 1907. 1927. 168 pgs. Sanskrit. 1929.. 1962. Language. Sanskrit. 1926... Bhat't'a Qs-irasvaami. Pada~mashrii.d. Dr.... 4-9. Geography. Linguistics.... 1937. Literature.. Linguistics. 290 pgs... Sanskrit.. Maadhavakaale Yaadava. 1906. Naamamaalaa... Naanaara~tha San'grah Grantha 10. Sanskrit.. Religion. Sanskrit. Sanskrit.2/14/2011 p g g A list of scanned Sanskrit books at III…gy g pg Muhurtha Chintamaani. Chand baradai. My Prayers Vol.. 1906. Unknown. Chand baradai. 0. 170 pgs.. Nagari Pracharini Granthamala Series No. Sanskrit..3. Dhanj-jaya Mahaakavi. Naaraayand-aguro San'skrxtakrxtayaa.. 1988. Sanskrit. Myths And Races Of The World. Unknown... Valle Poussin. Dr Devarshi Sanadhya Shastri.. Sanskrit.. Naagapura praan'taacha Itihaasa. Geography.. Sanskrit. Technology. 0. Sanskrit. Nagari Pracharini Granthamala Series No. Philosophy... Sanskrit. Naisadhiyacaritam Of Mahakkavi Sriharsa. Natural Sciences.. 1937. 4-8. Naishaddhiya Charita.devarshi Sandhya Shastry. 194 pgs. 210 pgs. 111 pgs. Language. Baalakrxshhnd-akulakara~nd-ii Purushhottama~. Language. 1934.. Literature. Unknown. 131 pgs. Unknown... Nagananda Natakam. Naanaathara~ San'grah. Literature. 0.. 0. Unknown.. 1985.. Mysticism And Symbolism In Aitareya And Taittiriya Aranyakas. Biography. Naaraayand-aguro. Nalopakhyanam. Literature. m m pandit sivadatta dadhimatha.. Mulamadhya Makakarikas.… 34/167 .. 790 pgs. Sanskrit.. 162 pgs. Linguistics. Naat'a~yadara~pand-ama~ Prathamo Bhaaga.org/…/SanskritIIIT.. Nagari Pracharini Granthamala Series No.chakraberti. 4-8. Psychology. 67 pgs. History. S k it 1984 554 sanskritdocuments. Chand baradai. 492 pgs. P V Ramanuja Swami. 1331 pgs. Sanskrit. Literature.. 680 pgs. 567 pgs. 4-10. Unknown. 1950. Biography.

Sanskrit.. Namamalikaa Bhojaa. 392 pgs. Language. Nareshvarapariksha. Sanskrit. Nirakttama Da~vitiiyo Bhaaga.. Unknown.. Abhinavaguptacarya. 204 pgs. Sanskrit... Sanskrit... Sri Prem Vallbh Tripatisha Thran. 300 pgs. 1986..… Nitiprakashika Vaisampayana Unknown Sanskrit 1953 135 pgs 35/167 . Dr. -.. 1926. Sanskrit. 1969. Sanskrit.. Narayankruthvruthisametamashrav Layan Shauthsutram. 506 pgs. Unknown.. 0. Sundara Pandya. 1994.. Sanskrit. 1930... Language. 1986.. 1984.. Sri Daivagyadunichandratmajapandit.. 772 pgs. 1942. 1928. Unknown. Natyashasrta Of Bharathamuni Vol I I. Natya Sastra Of Bharatamuni 3. sanskritdocuments. 1941..r...nagar. Navaratnavidhapadhathi. Nanjarajayasobhusana Of Abhinava Kalidasa. Social Sciences. 1926. Natyasastra Of Bharatamuni Vol Iv. Natyashasrta Of Bharathamuni Vol Iii. 420 pgs. Sanskrit. Unknown.. acharya hemachandrasuri s. Dr. Natyasastra With The Commentary Of Abhinavagupta Vol 3. Unknown.. Sanskrit. Unknown. Sanskrit.. 129 pgs. Language. Niteshatakam.sankara Ramashastri. 230 pgs. Unknown. Linguistics.. Sri K Vasudeva Sastri. Naradh Puraye. Sanskrit. 972 pgs. 748 pgs. Language.. Linguistics.. Sanskrit. Unknown. 222 pgs.... Literature... Sanskrit.. Niruktam. 1924.s. Unknown. Sri Kamalakar Bhatt. 146 pgs. 1949. 554 pgs. Narayaniya Of Narayana Bhatta. Unknown. Ramakantha. Unknown. Nitidvishashtika... Sanskrit. Nishkarma Siddhi..s.. Nilakanthavijaya. Literature. 560 pgs. Unknown. Hari Narayan Aapte.r. 471 pgs. Unknown. m ramakrishna kavi.abhinavabharati 1. 420 pgs. 144 pgs. 367 pgs. Unknown.. Anundoram Borooah.. Abhinava Gupta Charya. 1953. Shriimadhyaaskaachaaraya.. 1968. Unknown. Nira~nd-aya Sindhu.. Sanskrit. 218 pgs. 474 pgs.. 1934.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit. Linguistics.. Sanskrit. Nanarthasangraha Of Ajayapala. Sanskrit. 422 pgs.org/…/SanskritIIIT. 366 pgs. Niilamatapurand-ama~.. Sanskrit.. 446 pgs. Unknown.. 219 pgs. Sanskrit. 1984. Makara Bhad'aka. Nispannayogavali. 562 pgs. Sanskrit. 1917... Pandith Shivduttsharma. Natya Sastra Sangraha Vol I. K Sambhasiva Sastri. Sanskrit. 1937.. Sanskrit. T R Chintamani. Bhat't'a Kamalaakara. 556 pgs. 340 pgs.saini. 1949. Sanskrit. Unknown. Kulakara~nd-ii Ekanaatha Dattaatreya. Unknown. Nirnaysindhu Vol Ii. Sanskrit. Natyasastra Of Baratamuni.. 1984. 1955... 1961. Literature.. Religion. Sanskrit.. Dr. Unknown. Nanartha Samgraha. Unknown. Literature. Sanskrit. Literature. Niruktan' Dditiiyo Bhaaga. Natya Sastra Sangraha Vol Ii. K Vasudeva Sastri. 1994. Linguistics.ravishankar Nagar. 764 pgs. Narasinha Puranam. 0. 0. Sanskrit. 162 pgs. Abhinava Gupta Charya. Unknown. Sanskrit.. Bhattacharya.. Sanskrit. Sri Madanthram Shastry. C. Unknown. Unknown. 0.... 1983. 1954. embar krishnamacharya.. Nighantusesa. 344 pgs. 0. 64 pgs.. Theology. Rama~lala~ Kanjilala~ Yama~ Hecha~. Sanskrit.

1929. 0. Sanskrit.. Shukla Sri Raja Narayan Sastry. Unknown. 355 pgs. 1953.. 1948.. Unknown. Sanskrit. 1954. Someshvara Bhat't'a. 153 pgs..... Bhat't'asomeshvara.. Nyaayakusumaan'nj-jali. Gustav Oppert. 1929.. 118 pgs. 216 pgs. Sanskrit. Unknown. Sanskrit. Nyayadarshanamu. -. Unknown. Nyaya Kumud Chandra Vol-i. 1940. E. Religion.. Sanskrit. .. 102 pgs. 1990. Literature. 1992. Remella Suryaprakasa Sastri.. Linguistics. Nyaaya Kumuda Chandra Dditiiyo Bhaaga. Literature. 110 pgs. 1990.. Sanskrit. Sanskrit. 971 pgs. 1902. Religion. Sanskrit.… Nyayamrtatarangini 686 16383. Sanskrit. Indian Logic. Sanskrit. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Nitiprakashika.. 110 pgs. Nitya Kamya Karma Mimamsa. Sanskrit. 1909. Sanskrit. sanskritdocuments. Nyaayasudhaa Faskikyulasa~9. vallabhacharya.. Nyayadarsana. Literature.. Philosophy. Vaisampayana.8. Shriimadudayaanaachaara~yaa. 1941.obermiller. 36/167 . Tukaram Javaji. Theology... Unknown. vallabhacharya. Remella Suryaprakasa Shastri.. Philosophy.. Mahadeva Sastri. Shastrii Raamasubramand-yama~. Philosophy... Sanskrit. Unknown. 119 pgs. Nyaya Makarandaha. Unknown..... Nyaya Lilavati Viii . Psychology. -.... Sanskrit... 249 pgs. 106 pgs... 58 pgs. Psychology.. Nyayabhindu Of Dharmakirti And The Nyayabindutika Of Dharmottara. 849 pgs. Sanskrit.. Language. 236 pgs. Gopinath Kaviraj. 155 pgs... vallabhacharya.. Unknown. E. Nyayabhindu Of Dharmakirti. Sanskrit. 1916. Nitya Kamya Karma Mimamsaa. Literature. Sanskrit. Unknown. Theology. 102 pgs. Unknown. Unknown. Sanskrit. Sanskrit. Unknown. vallabhacharya. 1936. 1938. 135 pgs. 115 pgs.. Sanskrit... Psychology. 1932. 1992. Unknown. 328 pgs. 1938.. 1985. 388 pgs. Sanskrit. Psychology. Nyaya Lilavati Vi 6. 1955. Language. 41 pgs. 1919.. Aapat'e Gand-osha Vinaayaka. Padamunnur Sri Narayanacharya. Nyaya Lilavati Ii 2. 108 pgs. Sanskrit. Sanskrit. Unknown. Nrsimhtyasya Prayoga Parijatasya Sodasa Samskara Kandam Pakasamstha kanda Samksepasla. Nyaya Lilavati V 5.. Nrisinha Prasada Tritha Sara.. Philosophy. Linguistics.. . 184 pgs. 1927. 1932. 1927. Nyaayabindu. Vyallabhacharyya. Unknown. 134 pgs.. Vishwanathvritti. Nyayabhindutikatippani. Nyayamrithaha Sudha chandrika. Nyaya Lilavati I 1. 666 pgs. Unknown. Nyayabhindu. Sanskrit. Nyaya Lilavati Vii 7. Sanskrit. Nrxsin'hapuuvauttarataa Paniiyopanishhata~. 872 pgs.. 332 pgs.. Philosophy. 96 pgs.. Unknown.obermiller. 1992... Mahendra Kumar Nyaya Shastry. 1909. 2000. Nyayamritakulya. Nityotsava Vol Iii. Sanskrit. 608 pgs. vallabhacharya. 216 pgs. Nitiprakasika.. Nyasakalpalata. Sanskrit. Sanskrit.org/…/SanskritIIIT. vallabhacharya. 243 pgs. 186 pgs. Sanskrit. 112 pgs.. 1932. Shriidhara~mottaraa Chaara~ya. Psychology..... Dwaita Philosophy.. Nyaayasudhaa.. 1933. Nyay Lalavati. Sri Ananda Bodha Battaraka Charya. 0. Unknown... Goswamy Damodar Shastry.. Sanskrit. Kumaara Nyaayaachaara~ya Mahendra... Sanskrit. .. Sanskrit. Nyaayabhaaskarakhand-d'anama~. 1907. 1904. Sanskrit.

Khaad'ilakara Shrii Krxshhnd-aajii Prabhaakara. 0. Unknown.. Sanskrit. Unknown.. Linguistics. 132 pgs. Sanskrit. Unknown.b. Aara~yend-a Subrahmand-ya.r. 1957. Padhyapushhpaanj-jali. 274 pgs. Sanskrit. Unknown. Viiraraaghavaachaara~ya Mund-aluura~. K Surya Narayanashastri. 1954. Padhamanjari Pradhama Bhagamu. Shriimadamitagatyaachaara~ya.... Nyayarakshsmani Of Srimad Appayya Deekshithendra. Padukapattabhisekam Of Narayanakavi. Sanskrit. 1971. Sanskrit. 1941.. Nyayasudha Sesavakyartha Chandrika Chapter 1 Subunit 4. Padyamrta Tarangini. Sanskrit. Sri Haridatta Misra. 392 pgs. Literature... 249 pgs. Biography.. 283 pgs. 68 pgs. 89 pgs.. 83 pgs.. Literature. Nyayaratnamala Of Parthasarathimisra.... 1990. Padit Raj Jagannath Mahakavi.. Unknown. Panditaraaja Kaavyasangraha Complete Works of Panditaraja Jagannatha. Unknown. Unknown. Psychology. Sanskrit. Language. Sanskrit. Unknown. Unknown. Nyayasutra Of Goutama. Philosophy. Anantha Charyar. 702 pgs. 230 pgs. Nyayasastra With The Commentary Of Abhinavagupta. Padhamanjari Dwithiya Bagamu. Sanskrit. 1984.org/…/SanskritIIIT. 667 pgs. 1953. Om Brihat Sarvanukramnika Of The Atharva Veda. 1941.. 258 pgs. Maniantha Misra. Gajanana Shastri Musalagaonkar. Religion.s. 1953. Literature. 1953. 152 pgs. Pan'chamapushhpama~ Kaavyadvayama~. Pan'chasan'graha. Theology.. 1952. Unknown.. Sanskrit. gandanatha jha.. Linguistics. 1981. Shaunakamahaamuninaa Bhagavataa. Religion. Sanskrit..… 37/167 . Panchampushpam V.. 1934. 1981... Nyayasiddantamuktavali Of Viswanathapancanana Bhattacarya. Sanskrit. Nyayaratna... Pandit S... .. 1940. 380 pgs. Language. Sanskrit. Dr K S Rama Murthy.. P. Sanskrit. 660 pgs. 1983. Sanskrit. Sanskrit. . Panchatantram Vol Ii.. Sanskrit. Nyaysutravaidikvruthi. Palkuriki Somanatha.. 1951. Geography.. 422 pgs. 554 pgs. Pahile Mahaayudhda Bhaaga Tisaraa. Unknown. Pandit Ramgopala Shastri. Sanskrit. P i ht k Utt dh P dith S i Y t d tt t ibhi U k S k it 0 380 sanskritdocuments. 254 pgs.. Padya Mala. 210 pgs. Theology. Pancaratram. Pandit Bhanu Dattshastri. 1953. m ramakrishna kavi.. Sanskrit. Dr Smt Mudigonda Uma Devi. Paashhara~dasuutrama~.. 1927.. Nyayamrtatarangini 686 16383... Sanskrit..2/14/2011 A list ofLinguistics. Unknown. 1937.. 1973. Sanskrit... 134 pgs.krishna Murthy.. Unknown. 1939. . 1984. Sanskrit. Padakavya Ratnakara.ramaswami Sastri Siromani.. Sanskrit.. 157 pgs. 392 pgs. Sarasvatii Vaasudevaananda. 0. Haribhaskara. 434 pgs. Sanskrit.. Nyayasiddhanta Muktavali. 757 pgs. Paand-inisutravyaakhyaa. Language.. C R Devadhar.. 252 pgs. Sanskrit. Pandith Devdutt Sharmana. 311 pgs. Sanskrit.. Unknown.. Dr. Unknown. Theology. Dr. at III… 0.. Sanskrit.. Panditaraaja Jagannatha.. scanned Sanskrit booksSanskrit.. Sanskrit. 1904. Unknown... Religion. Unknown. 1958. 386 pgs. Sri P P Vasudevanand Saraswathi Tembeswami. K. Unknown. History. 1922. 534 pgs.gajanana Shastri Musalagaonkar. 777 pgs... Sri Jaya Tirtha. Sri Haridatta Misra. Linguistics Literature. Unknown.

Parama Samhitha. Sanskrit. Unknown.. Theology.. 531 pgs. Paramaanandakaavyama~. 1972.. Language. Sanskrit. Paribashendu Sekhara.. Parameshwarpitha Slokamalika.. Unknown. 0.. Unknown. 1940. Paninisutra Vyakhya Vol 1 Purvardhamu. Pashvaalambhamiimaan'saa. 0. Literature. Unknown. Sanskrit. C Kunhan Raja. Language.. Sanskrit.. Theology. Literature. Literature. Datta Nalinaaqs-a. 1947. 436 pgs. Paqs-chimottarashaakhiiyama~ Vaalmiikiiya Raamaayand-ama~ Uttara kaand-d'ama~. Bhat't'a Naagojii.arkasomayaji. Sanskrit. Persian Sanskrit Grammer. Sanskrit. 322 pgs. Praayashrvittendushekharah. Literature. 200 pgs. Prabandaha Cintamani Of Merutungacharya Part I. Language. 112 pgs. 1947.. 97 pgs. 334 pgs. Sanskrit.. Parama Laghu Manjuaha Of Nagesh Bhatt. srinatha pandita. Natural Sciences.. 323 pgs.. Theology. Pindagalachand Suthram. Religion.. Linguistics. Sanskrit. Linguistics... 1959. Linguistics. Parahita Samhita. Unknown.. 1954.. 454 pgs. Sri Pindagala Charya. T. 252 pgs.. 1990. Unknown... Sanskrit. Sanskrit... S Krishnaswami Aiyangar. Sanskrit. 1938.… 38/167 . Nrxsin'hashaastrii. Sanskrit.... Paribhashedendushekar.. 0.. 1957..2/14/2011 A list of scanned Sanskrit books at III… Panineeyashtakam Uttaradharm. Tadnujen Sri Manmadhusudansharma. Sanskrit. Sanskrit. Sanskrit. Sanskrit.. Paribhashendushekar. Sanskrit... Ganesh Shankar Shukla.. 1931. Literature. 1952. Unknown. 134 pgs. 1938. 1954. Unknown. Pandith Nityananda Panta Parvatiya.. Paniniya Shiqs-aa... Viraraghavacharya. Narendra Nath Choudari. Paramartha Prakasika.. Panini As A Variationist. Unknown.. 1933. Sri Nagesh Bhatt. Unknown... Unknown. D. Parijaat. Sanskrit. Post Independence Sanskrit Literature. 1923. Unknown. Unknown. 175 pgs. 694 pgs. 334 pgs. Sanskrit... 624 pgs. Religion.. Unknown. k r joshi s m ayachit.. 1913. pandit bapudeva sastri. Panj-chavin'shatisaahastrikaa Pranj-aapaaramitaa. Sanskrit. Unknown. Sanskrit. 245 pgs. Sanskrit. Sanskrit. 1935. Shaastri Vaamana. 0. Pandith Sri Yutagnaduttasastribhi. 247 pgs. Sanskrit. -. 0.org/…/SanskritIIIT... Jinavijaya Muni. Sanskrit. Valmiiki. 0. Praakrxtashabdapradiipikaa. Valmiiki. Poona Akhbars Vol Ii.. Unknown. Sanskrit. Ghosha Manamohana. Paqs-chimottarashaakhiiyan' Vaalmikiiya Raamaayand-ama~ Yuddha Kaand-d'ama~. Philosophy.. Sanskrit. Pandith Sri Yutagnadutt Sastry. Pandita Viswanatha Shastri.. 188 pgs. 132 pgs.. Panineeyasthakam Poorvadharm. Language. 442 pgs. Viraraghavacharya siromani. 1980. Paqs-chimottarashaakhiiyan' Vaalmikiiya Raamaayand-ama~ Kishhkindha Kaand-d'ama~. Natural Sciences. 1936. Unknown... 1916.... Language.. Sanskrit. 374 pgs. 172 pgs. Sanskrit. Pandith Sri Kapileswar Shastrina. Sanskrit. 0. Sanskrit. Harinarayna Apte.. 173 pgs.. 1946. Linguistics.. Sanskrit.. Grammer.. 1940. Pingala Acharya. 181 pgs.. Plane Trigonometry. 164 sanskritdocuments.. Unknown. 506 pgs. 70 pgs. Vaalmiikii. 497 pgs. Aan'bekara Vishhnd-ubaapujii. Unknown. Philosophy Of Poetry. 1934. 1874. 380 pgs. Religion. Literature. S D Joshi. Paraamara~sha Khan'd'a 1.. Linguistics. 172 pgs. 582 pgs. Paramaananda~. Pilibhit ka Sahitiyik Itihaas.. 252 pgs. 1944.

Sanskrit. 0. 1954. Shriigovindaamrxbhagavaana~. 1992... Prameyakamal Martand. Sanskrit. 676 pgs. Unknown. Prakrta Prakasa. 1947.. Sri Ramachandra Mishra.. 1943... 1935. 1941. Unknown. Prabandhakosha Prathama Bhaaga. Language. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… pgs. Prashnopanishhata~ Grantha 8. 1932. Unknown. 152 pgs. 0. Prakriyasarvasva Taddhita. Sanskrit.. Literature.. Shri Prabha Chandra.. Shriiprabhaachandraachara~yaa. 924 pgs. Prasadamandanam... Panditaratnam A.. P. 134 pgs.c.. 262 pgs. Vijaya Jina. 1935... Theology. Theology. Prabhu Lingaleela. 922 pgs.shantiraja Sastri. Prasaada Mand-d'anama~. Prajna Paramitha Ratnaguna Samcaya Gatha. 1931. 1955. Unknown.… 39/167 . Sutra Dharamandana. Prasnamarga. Haribhadraa. 160 pgs. Prabhodhanaachandrodayama~. 0. Literature.. Atalananda Sarasvati. Unknown. Sanskrit. Prajnaparamitasa~ Prathama Bhaaga Abhisamayaalad'a~kaaralokah.. Sri Harishanker Mishra. Unknown. 265 pgs. Sanskrit. Prabhaavakacharita Prathama Bhaaga Muula grantha.. Unknown. 94 pgs. Literature.. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Psychology. 142 pgs. Prapancha Sara Tantra Of Sankaracharya.. Unknown. Unknown. Pandit. Unknown.. Pramaand-avaara~ttikama~ Svaara~thaanumaanaparichchheda.. Pratima Natakam. 1948. 1947. Pandit sri seetaramanga Jotishaclarya. 0... K. Prachina Sanskrit Natak.. Prasnopanisad Bhasya I I.. -. gomi kara~nd-aka. Theology. Religion. Sanskrit. Psychology. 1926.. Sanskrit. 1941. Unknown.org/…/SanskritIIIT. 261 pgs. Prameykamlamartand Vol Ii. Pradhama Padyamala. 186 pgs. Mahendrakumar Shastriyna.. Sutradhaaramand-d'ana. Appayya Diiqs-ita. Linguistics. Sanskrit. 1994. Tallapally Muralidhara Gowd. Prameyaratnaalang-kaara. Linguistics. Prakrutananda. Sanskrit. Prabodhachandrodayama~.. Shriinaaraayand-a Bhat't'aprand-iitan. Mallikarjuna Shastri. Language... 128 pgs.. 239 pgs. Raghunatha Kavi. 77 pgs. Literature. Technology.. 1941... 1981. Prashanamka choodamani. Prataha Smranmala. Unknown. Philosophy. Sanskrit. 346 pgs. Unknown. Sanskrit. 484 pgs... Sanskrit... Linguistics. Religion. Unknown.. 70 pgs. Linguistics. The Arts. Religion.. Mishra Krxshhnd-a. Sanskrit. 1975.varadhachari. Sanskrit. Sanskrit. Prakrxtamand-idiipa Prathamao Bhaaga.. Tantras... Language. Religion. Prakriyaasavara~svama~. Punnasseri Nambi Neelakndha Sarma.. Prasnopanishad Bhasya. Theology.. Aanandagiri.. Sanskrit. Unknown. Shriimadabhinavachaarukiira~tipand-itaachaara~ya. Sanskrit. 394 pgs. 20 pgs.....obermiller. Language.. 107 pgs. Ramaji Upadyaiah. Sanskrit.. 186 pgs. 252 pgs.. Jinavijaya Muni. Religion. 1948.. Philosophy. 652 pgs. 1951.. Sanskrit. 441 pgs. Sanskrit. Sanskrit. E.. 1936. 176 pgs. Theology. Sanskrit. 1933. Prabhanda Chinthamani Of Merutungacharya Part 1. 1953. sanskritdocuments. Narayana Bhatta. Sanskrit. 1932. 1940. Dr P L Vaidhya. 252 pgs. 272 pgs. 722 pgs. Prameyaratnalankara.. Sanskrit.Edition. Sanskrit. Unknown. 164 pgs. 1978...

1950. Unknown.. 0.. Saradaranjay Ray. Bharatwaj. Unknown. 1952. Sanskrit. -. 302 pgs. Theology. Unknown. 1945. 1931.. 1935. Saradaranjanray Vidyavinode. 246 pgs. Unknown...org/…/SanskritIIIT.. 0. 936 pgs... 1935.. 82 pgs. Premarasayana. a s altekar. Raghava Naishadhiya. Sanskrit. 176 pgs. 226 pgs. Sri Sadanand Vidvadwirichith.subrahmanya Sastri. 1952. Yashpal Tandon's.. Sanskrit.a.. Raamaayana Of Vaalmiki Bala Kanda. Muralidhar jha. 611 pgs. A. at III… pg Pratimaa Mana Laqs-and-ama~. 1908.… Raghuvamsham.. Qs-iira Ratagd'ind-ii. Unknown.. Bosa Phanin'draa Naatha.. Unknown. Purva Mimansa Darsana. Sanskrit. 0. 112 pgs.shrikrishnamani Tripathi. Sanskrit. 451 pgs. Sanskrit. 1875. Unknown.. Proceeding And Transactions Of The Fifth Indian Oriental Conforence Vol I..2/14/2011 A list of .. Prayodhya Kavyam. Sanskrit. 154 pgs.shastry. 730 pgs. Sanskrit. Purushparthchintamani.. Purana Vishya Samnukramayaka. 492 pgs. Proceedings And Transactions Of The All India Oriental Conference. 1927. Religion. Unknown.. Raasabihaarii Basuun'che Kraan'tijiivana. Purva Kalaamrutamu. Literature. Vaalmiiki.. 82 pgs.. Unknown... 1928. Mahadeva Sastry. 826 pgs. Unknown. Suryakanth Shastri. Literature. Linguistics. Yagna Ramulu. Unknown. 330 pgs. 163 pgs.. 1979. Da~vivedii Kapiladeva.. G D Thukral.. Miimaan'saka Yudhishht'hira. 0. Unknown.. Sanskrit. A. Sanskrit.. Bhagavad Datta. 1947. 286 pgs. Unknown.. Theology. 1323 pgs. Geography. 369 pgs. 1930. Unknown. 1989. Sanskrit.... Sanskrit. Kara~mara~kara~ Epi. Purana Panchalaksana. Sanskrit. Dr.. Sanskrit.. Sanskrit. Raghuvamsam Canto V. Puranika~ En'thalojy Puraand-a Kaavya Stotra Sudha.gangaprasad. 536 pgs. Haradaasa Baalashaastrii Saahityaachaara~ya. Language.. 348 pgs. Raghuvamsam. Ranjit Sitaram Pandit... Unknown. Pratyakruttatvachintamani Vol I... 490 pgs. sanskritdocuments. History. 40/167 . 308 pgs. Pt. Unknown.... Pandit Sivadatta. Purusharth Chintamani.. 118 pgs. Sanskrit. Sanskrit. 310 pgs. Sanskrit.. 1926. Sanskrit. Proceedings And Transactions Of The First Oriental Conference Poona Vol 1. -.. 0. Religion. Sanskrit. Sri Madramkrishnabhattsunuvishnubhatt.. Dr. Sanskrit. Unknown. 828 pgs. Prem Pathanam. 1999.. 0. Purvakhandatmika Bhaktiyogaparisha. Sanskrit. Raamaayand-ama~ prathama khand-d'a. Purva Mimamsa.. Raghuvamsam (canto vi). 0. G. Unknown. Sanskrit. Ragavibodha... Religion. 1985. Social Sciences. 1985. Linguistics. Sanskrit. Sanskrit. Sri P. 1920. Sri Krishnaiah Panth Sastriye.. Theology. 480 pgs.. 1945. S. Purascaryarnava..... Sanskrit Religion. 1993. 1922. 626 pgs. Language... 98 pgs. Sanskrit.. Proceedings And Transactions Of The First Oriental Confirence Poona. Biography. Late. Sanskrit. Sanskrit. 1929. Sanskrit. Unknown.. 370 pgs. Lakshminarasimha. History. Raashht'a~ra Giitaanj-jali.. Visvanatha Pandita. Sanskrit. Sanskrit. 242 pgs.. scanned Sanskrit books . Ragatarangini. Unknown. Unknown. Unknown. Vasudev Sharma.

Ramayana Of Valmiki Vol Iv Kishkindhakanda. 1902. -. Ramayana Of Valmiki Vol Viii Index Of Verses.. Ramayana Of Valmiki Yudda Kanda... Unknown. Ramayana Ramabirama.. Satkari Mukhopadhyaya.... 681 pgs. Unknown. 1955.org/…/SanskritIIIT. Sanskrit...shrikrishnamani Tripathi. 164 pgs. 0. 1895. Shripad Krishna Belvalkar. 164 pgs.… Rasagadagdar Rahasyam Sri madanmohan Jha Unknown Sanskrit 0 60 pgs 41/167 . sanskritdocuments. 354 pgs.. Literature. Sanskrit... Bhagavad Datta. at 730 pgs.m.. Unknown. 1983. Ramas Later History Vol X X I. Satkari Mukhopadhyaya. Raghuviracharata. Unknown. 1260 pgs.. Bhudeb Mookerjee. 168 pgs. 0. Religion. Unknown. Satkari Mukhopadhyaya.. Unknown. Satkari Mukhopadhyaya.. Ramayana Of Valmiki Vol Vii Yuddhakanda. 1965. Unknown. Sanskrit. 0. Sanskrit. Ramayana Vol 3. Ramayan Valmikiye Aadikand.Vaarasree. 0. 112 pgs. 317 pgs. Dr. Ram Swayamvaram. 1944. 1983... Religion. 795 pgs. Jagannath Prasad Kayath. Unknown. 1915. Durgesh Singhal. Sanskrit. Raja Tarangini. T. Ramayana With Three Commentry Tika. Kavignar .. Di Valmici. 481 pgs. Psychology. 845 pgs. Unknown. 454 pgs... Unknown. 1992. Rajagopalachari.. Vishva Bhndhu Shastri. Temples. Raghu Vira.. Sanskrit.. 0. Ramayana Of Valmiki Vol I Balakanda.. 1983. Ras Gangadhara. 1983. 369 pgs. Sanskrit. Sanskrit. pgs. Sanskrit.... 0. Ramayana.. Unknown.. Pandit Sri Bhadarinath Jha. 193 pgs.. Ram Rasayan Ayodhyakand.. Sri P Ramachandraghna Vyakaranacharyah. Sanskrit. 588 pgs... 1983. Satkari Mukhopadhyaya. 350 pgs. Satkari Mukhopadhyaya. .. 234 pgs. Sanskrit... Unknown... 1983... 2002. Kalhana.. 2002. Ramayana Of Valmiki Vol V Sundarakanda.. Sanskrit. Sanskrit. Rangayan Vol 34 Jan-june 2001. Ramayana Of Valmiki Vol Vii Uttarakanda. . . 2001. Sanskrit. Sanskrit.. Philosophy. . 1935. Sanskrit. 164 pgs. Unknown. Ramayana Of Valmiki Vol Ii Ayodyakanda.. Satkari Mukhopadhyaya... Sanskrit. Rangayan Vol 34. 1983. Sanskrit. Ramayana Of Valmiki The Aranya Kanda. 605 pgs. Unknown. 192 pgs. 523 pgs. 460 pgs. Sanskrit. 1934. 1938. 426 pgs. -.c. Sanskrit. 427 pgs. Unknown. 1985. Unknown. Unknown. 706 pgs. Sanskrit. Sanskrit... 330 pgs. 638 pgs. Ramayana Of Valmiki India S National Epic. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Rangaayana. .. Unknown... Unknown. Satkari Mukhopadhyaya. 2001. Peeyush Darya.... Rangayan Vol 34 Jan-june 2001.ganapati Sastri.. Unknown. 1983. Sanskrit.. 700 pgs. Sanskrit. Sanskrit. Sanskrit. 1950. .. Unknown. Unknown. Ramalashiktha Jyothish. 612 pgs. Raghuvamshamahakavyam.. Rasa-jala-nidhi..2/14/2011 A list of scanned Sanskrit books III… Raghuvamsham. 1917.. Ramayana Of Valmiki Vol Iii Aranyakanda. Mishra Brahmashan'kara. Raghuvan'shamahaakaavyama~. Bagaiah .. Temples. Sanskrit.

354 pgs. 0. 220 pgs.l. Rashtriya Panchang. K.I. 1204 pgs. Sanskrit. 188 pgs. 1074 pgs. Haughton G. Unknown..org/…/SanskritIIIT.. 129 pgs. Rediscovering India Manav Dharma Shastra Vol 30 I. Ramgovind Trivedi Vedanthshastry.. Art.k. Sanskrit. Sanskrit... 332 pgs.. Linguistics..kapali Sastry.. Unknown. Theology. Rgarthasara Vol I... Rigveda Samhita Vol Iv Ix X Mandalas. Rasamanj-jari faskikyuulasa~ 3. Literature.. Vidhydhar Johrapoorkar. 1941.sastri. 2001. Sri madanmohan Jha. Biography. Rigveda Samhita. 1868. Unknown. Aryendra Sharma. Unknown. Reader I. Linguistics. Rasaratnapradiipikaa Gran'thang-ka 8.c. Sanskrit. Sanskrit... K. History. Sanskrit. Dev Raj Chanana. Unknown. Ramasastri. 1997. Rasendra sarsangra.. Ravanarjuniyamu. Dr. 594 pgs. Sayanacharya. Literature. 0... Sanskrit. Unknown. Rgveda Samhita Vol 4. 1927. Rasagangadhara. Sanskrit. Rgarthasara Of Dinakara Bhatta Vol 1... Unknown.. Vedas. Sanskrit. 152 pgs. Sanskrit. Unknown..v. Reader Iii.sastri..l. 1986. Unknown. Remarks Of Similes In Sanskrit Literature. Rgveda Samhita Vol-i. Theology. V S Venkata Raghavacharya. Unknown. Unknown. Rigveda Samhita.. 1996. Technology.p. Unknown. Shriigovindabhagavatpaada. 84 pgs. Rastrapala Pariprccha Sutra Du Mahayana.v. Rasahrxdayatantrama. Sanskrit. 128 pgs...v. 2001. sanskritdocuments... Literature. -. Rauravagama Volume I. Unknown. 1955. 0. Unknown... T. Geography. Sri Mathsainacharyavirchitbhasyasameta. 1314 pgs.. 148 pgs. 1949. Late Dr... Srit. Sanskrit. 1951. Rigved..sastri. Sanskrit. sri bhattabeem.. 241 pgs. 1965. Linguistics... 1961. 1946.. 500 pgs. Unknown. Language. Sanskrit. Philosarhy. J Gonda. Ratna Dipika And Ratna Satram. Narayana Sharma.. Language. Sanskrit.. Ravi-vichaar. 100 pgs. K. 60 pgs. 1152 pgs. Rasaviveka of Kavya Darsa. 403 pgs. Unknown. Rgvedasamhita. 964 pgs. 1992. Unknown. Bhaanubhat't'aa Shrii.. L Finot. 133 pgs. Sanskrit. Remarks On The Sanskrit Passive. 1959. 1974.. 206 pgs.. Sanskrit... 1951. N R Bhatt.s. Sanskrit. Sanskrit. 1981. 1108 pgs. Rigveda Samhita Vol Iii 6 8 Mandalas. Rg Bhasya Sangraha. Religion. Allaraaja.l. Reader Ii. 266 pgs. Sanskrit. Sanskrit.lakshman Sarup. Sanskrit. 1951. 0.. 1904. Rgvedi Purva Proyoga. Sanskrit. Unknown.v. Sanskrit. Unknown. Sanskrit.... Language. Sanskrit. 116 pgs. Sanskrit. Sanskrit. 1987.… 42/167 . Sudarsanacharya. Unknown. Budhdabhat't'a Chand-deshvara~ cha.. 94 pgs. 75 pgs. Sanskrit. Sri Rama Sharma. Ratnadiipikaa Ratnashaastrama~cha. 82 pgs. P. Unknown.. 1988. 82 pgs.. 0.. Literature..... Sayanas Comentary. Religion. 1945.. Sanskrit. 1951..v. 146 pgs..n... Rasamanjari Of Bhanudatta. Sayanacharya.. Ram Suresh Tripathi. Sanskrit. 1959.. Regved Sanhita Vol. Unknown. Sanskrit. 552 pgs. 1956.. 100 pgs. 0. 134 pgs. Srinarayan Misra. 231 pgs. -... Unknown. Sanskrit. 1961.... Dinakara Bhatta. Sanskrit. Gonda.2/14/2011 A list of scanned Sanskrit books at III… Rasagadagdar Rahasyam.

Bijapurakara Vishnd-u Govinda. Linguistics. 1951. Sanskrit.. Krishnacharya. 1955. Unknown.. Sanskrit. Rubaiyat Of Omar Khaiyam. Sanskrit. 1929. Sanskrit. 170 pgs.. Religion. 454 pgs. Shriimaadhavena Shriiven'kat'aara~yaatanudbhavena. Literature. 1950. Theology. 641 pgs. 1062 pgs. Shaastri T'i Vi Kapaali. Bhat't'ena Maadhava. 1932. 1929. . Theology.t. Religion..r. Sanskrit. 1935. Religion. Shriimadhavaa..... Rkbhasyam Tika. Literature.. Sanskrit. Pramodhini Panda. Rxgvedaa Vyakhyaa Maadhavakara~ta. 1966. P. Theology. Religion. 158 pgs. Religion. Sanskrit.. Rxgveda Sn'hitaa. Theology. Sanskrit. Sanskrit. 242 pgs. 0. .. 362 pgs... Sanskrit. Unknown. . Rxgara~thadiipika Chatura~tho Bhaaga. Raajaa Kunahaana..t. Rxgveda San'hitaa Bhaaga 2. 200 pgs. Theology.. Rigveda Samhita Vol-v Indices. 1936. Theology. Ramanand Divvedina. 32 pgs. 1242 pgs. 1955. 1931. Dr A N Upadhye. 1986. Roopdeepika. Vilsana~ Hecha~ Hecha~... Rxgara~thadipika Bhaaga 2. Shriimatsaayand-aachara~ya. Language. Religion. Rxgvedaanukramand-ii Prathamo Bhaaga Grantha 2. Sanskrit. Rksamhita... Sanskrit.. 450 pgs. Sanskrit. 1945. Sri Pandith Jwalaprasad. Rukminikalyana Mahakavya Of Rajacudamani Diksita. Kolan'gad'e Raamachan'dragovin'da... 736 pgs. 1058 pgs. Religion.. Sanskrit. 352 pgs. 1939. 1950. Sanskrit.. Rudrasthadhyayi... Literature.. 102 pgs. . 0.. Religion.org/…/SanskritIIIT. Linguistics. Ritriratna Prakash. 914 pgs. 1929.. Language. Rxgaratna Bhaand-d'aara. Rigvedasya Prathamamanadalasya Sayana Venkatamadhava Bhasyayos. Rukminikalyana Mahakavya... Theology. Religion. Theology.. Rigveda.… 43/167 .. Sayanacharya. Theology. Santavalekara~ Shriipaada Daamodara~.. 374 pgs. Sri Balayajnavedesvara.. 1940. Rudradasas Chandralekha. Sayanacharya. Theology. Rxgveda San'hiita Shashht'o Bhaagaa. Sanskrit. Religion.. Sanskrit. 1940. Rxgveda San'hitaa Trxtiiyo Bhaaga. A Narayanadas. Theology. 176 pgs. .. Sanskrit. 429 pgs.. Religion. Shriimaadhavena Shriiven'kat'aara~yaatanudbhavena.. Sanskrit. 0.. Sanskrit. 298 pgs. Rudraadhyaaya Grantha 2. 1928. 770 pgs... Riksan'graah Trxtiiya Khand-d'a. Rxgara~thadiipikaa chatura~tho bhaaga... Language. Rxgveda San'hitaa Prathamo Bhaaga.. Unknown. Sanskrit. 1058 pgs. Krishnacharya. Sri Rama Sharma. Unknown. 1219 pgs. Kamakshi.r. 0. Literature... Religion. Sanskrit. 1140 pgs. 1951... Linguistics.. Aapat'e Hari Naarayand-a. 1208 pgs. Sanskrit. . Rkbhasyam Chalari. Sanskrit. 1823. Shriipaadashara!~mand-aa Bhat't'aachayaind-a.... 249 pgs. Sanskrit. 502 pgs. sanskritdocuments. Theology.. 1986.2/14/2011 A list of scanned Sanskrit books at III… Rigveda Samhita Vol-ii 2-5 Mandalas.. 2000. Sanskrit. Sanskrit. Dharmasthala. 283 pgs. Journals. Sanskrit. Unknown. Rksamhita. Unknown.. Rukminishavijayahaha. 1823.

Sanskrit. 949 pgs. Sanskrit. Saamavediiya Taand-d'yamahaabraahmand-ama~ Da~vitiiya Bhaaga. Sanskrit. 500 pgs. Bhaagavata Hariraghunaatha. 1936. Literature. Bhaagavata Hari Radhunaatha. Theology. Theology.. Shara~maa Raamasvaruupa.… Sabdakalpadruma Kanda Ii Radhakanthadev Religion Theology Sanskrit 1976 944 pgs 44/167 .. 387 pgs. Religion. Madhavaka~ra~ta. 1922. Theology. Sanskrit. 77 pgs.. shriimatsaayand-achaara~yaa. Saamaveda San'hitaa... Sanskrit. Sanskrit.. 353 pgs... Saaraswatham (vyakaranam). Theology. Sanskrit. 353 pgs. 370 pgs.v. Theology. Sterling Publishers Private Limited New Delhi. 1947. Religion. Linguistics. Sanskrit. Saathar Upanishhatsn'grah 4 Bhaaga. Sanskrit. Sanskrit. Religion. Sanskrit. 1934. Rxgvedasan'hitaa Prathamaashht'akama~. Indology. Sabda Manjari... Linguistics.l.org/…/SanskritIIIT. Rxgvedasan'hitaa Prathamaashht akama~ Prathamo Bhaagaa. S.. Religion..... Sont'ake Esa~ena~. Language.. Sanskrit. 1941. Rxgvedasan'hitaapadapaat'hah. Rxgvedasan'hitaa Trxtiiyo Bhaaga. Unknown. Saara~tha Upanishhatsan'graha Bhaaga Sahaava. Sanskrit. Purushottam. Theology.... 1936. Religion...... Literature... 1990. 1151 pgs.. Sayanaachaara~yaa Shrii. Sanskrit. 1951.. Saamaanya Bhaashhaavijnj-aana. Unknown. Literature.oriental Journal Vol-4 Part 1 . Sanskrit. 1940.v. Saadaashivabhaashhyama~. 702 pgs. 1984. Sabda Sakti Prakasika. Saayand-aachaara~yaa... 1961. 1913. Sanskrit. Pandit Dhundhiraj Sastri.. 1947.sastry.. Religion. 208 pgs.. Sanskrit. Tippayya Parishkrit. Virachita Nanj-jund-d'aaraadhya. 285 pgs. Sanskrit. Raamaanuja Jaiyasaragomat'han. 1917. Svaruupaachaara~ya Anuubhuuti. Saamavediiyataand-jyamahaabrahmand-ama~ prathama bhaaga. L Laxminarayan. Maadhavakara~ta. 1957. Sabda Manjari. 126 pgs. Theology. Rxgvedavyaakyaa. 197 pgs. 1939.. 492 pgs. Sanskrit. Linguistics. Rxgvedasan'hitaa Prathamashht'akama~ Prathamo Bhaaga. Religion. 1935. 2002. 160 pgs. 1951.. 602 pgs.. 1950. Saksenaa Baaburaama. Matsaayand-aachaara~ya.. Shriikapaalishaastri. 1943. Rxgvedasan'hitaa Trxtiiyobhaaga.a. Unknown.. Saarasvata Vyaakarand-ama~ Uttaraaddhara~ma~.2/14/2011 . Language. Theology. 1922. Theology... Sanskrit.. Religion. Saamavediiya Chandogyopanishhata~.. 1934.. Theology. 359 pgs. Sanskrit. Religion. 189 pgs. sanskritdocuments. Religion. 238 pgs. 1938. 547 pgs. 1072 pgs. Sanskrit. Theology. 168 pgs.2. Theology. K. Rxgvedavyaakhyaaya Bhaaga 2 Ast'aka 1 Adhyaayaasa~ 5 Se 8. pg A list of scanned Sanskrit books at III… Rxgvedasan'hitaa Pdaadisuuchyaatmakah Panj-chamo Bhaaga. Religion. Language. Religion.u. Religion. 1142 pgs. 543 pgs. Natural Sciences. Sanskrit.t. Theology.. Shriikapaalishaastrii. Raghuviira~ Achaara~ya. Theology. Religion... Sanskrit. Chaara~ya Saayand-a.. Religion. Saamavediiya Jaiminiiya San'hitaa Bhaaga 3. Theology. Shriikapaalishaastrii..

. 1924. T. Pandit Bhatta Yogi Dikshit. Sanskrit. Shriibhojadeva Mahaaraajaadhiraaja. Sanskrit. 110 pgs. Sahitya Darpanam.. 266 pgs. Sanskrit. Unknown. Sanskrit. 1961. Sanskrit. Sri Durga Prasad Divyedaen... Sanskrit.... 1982. 412 pgs. 84 pgs.. Sanskrit. 485 pgs. Sanskrit. 188 pgs. 0. Nalinaksha Dutt.. 272 pgs. 1979. Theology.. 0. Sanskrit. W. Sanskrit. Hari Damoder Velankar. Aomesvara Sharma. The Arts. Sanskrit.. Sabdartha Ratnamu. Mayuram Sri M. Sanskrit. 1939. 1981. Dr B R Shastry...… Samanya Vedanta Upanishad Mahadevshatrin Religion Theology Sanskrit 1921 556 pgs 45/167 . Sahithya Rathna Kosah Thruthiya Khandamu.. Sabhasha Arthavedika Vishaysoochi.. Sanskrit.org/…/SanskritIIIT. Sanskrit. Srotaranay Tarakavachaspati abhattacharya. 1936. Sanskrit.. Sanskrit. Unknown. Linguistics. Unknown. Kaloori Hanumanthrao. Sakuntala. Saddharmapundarika. Sahitya Darpan. Sadguru sri Tyaga Brahma Pushpanjali. Literature. 1949.. Sahstra Deepika Of Partha Sarathi Misra... Literature.. 1906. Sahithya Darpan Of Vishvanatha Paricchedas I Ii X. Dr P Sri Ramachandrudu. Geography.... Sanskrit.r. 494 pgs. P V Kane. Unknown. Sahiti Jagathi.. 142 pgs.a.. Unknown. shivnath khanna.. . Sanskrit....bhatt. Linguistics. 348 pgs.. . Sanskrit. Sachurnika Srimad Bhagavatam. 1974. Sanskrit.. Language. Unknown. Sacitra Prasuti Tantra. Sabdha Koustubha. Unknown. Unknown. Khubchandraji Siddhanthashasthri. Sri Madachutaraya.. 101 pgs.. 558 pgs. Unknown. Radhakanthadev. 388 pgs.. Sahasra Yogaha.... Language.. Sanskrit.. Sri Haribhadrasiri. Biography. 1932. Sanskrit. ekanath dattatraya kulkarni. 174 pgs. Religion.. Unknown.. Sanskrit... Sanskrit.. Unknown.. 1911. Not Available. Unknown. 292 pgs. 450 pgs.. Sanskrit. Sanskrit. Samaarang-gand-asuutradhaara Prathama Bhaaga. Sanskrit Grammer. 249 pgs. -. Monier Williams... 623 pgs.ramanatha Deekshithar. Unknown. Sabhashyatatvarthadhigamsuthrah. 0. Salihotra Of Bhoja. Pushpa Srivatsan. Unknown. Sanskrit. 1973. Bhuskut'e Vi Bha. 394 pgs. 498 pgs. 1982. Theology. 94 pgs. 0. 634 pgs.. 1945. Literature. 1994.. 814 pgs. Sahitya Vimarsa. Sanskrit. 498 pgs. Unknown. M. Unknown. Sahityasara.. sanskritdocuments.. Sanskrit. 1913. 0.. Sahitya Sudhalehari. Unknown. Literature. Theology. . Sanskrit. 1981. 944 pgs. 1956. Sabhashya Rathna Manjusha. 1987. -.. Unknown.. 420 pgs.. 188 pgs. 1917. Rama Krishana Misra. Sanskrit.radloff. Religion. Bhagavata Shan'karaanan'da.. Sama Veda Rahasya Ganam.. 1953. Sahityaratnakara Of Dharmasuri Part I I I. 88 pgs. 764 pgs. Sabdanusasana. Sabdartna With Bhairavi... Sadaashivaraavabhaauu. 1802.2/14/2011 A list of scanned Sanskrit books at III… Sabdakalpadruma Kanda Ii. 1967..narasimha Charya.. Pandith Bechardas J Doshi. 1962. History. Saddarsanasamuchchaya. Sanskrit. 408 pgs. Chaturveda Shastry. Unknown. 639 pgs. 1951... Sabdapasabdavivekahaccn0 946. Unknown. 151 pgs. Sahitya Darpan (vimla)... 1976. Sagaud'a Paadiiya Kaarikaathara~va Vediiya Shhashht'hiya Khand-d'a Grantha 10. Sahityaratnakara Of Dharmasuri Part I I. 1957. Religion. Stotras. 1886 pgs. Sanskrit. Unknown.

Samskaranrusimhaha. Sanskrit. Literature.. Theology. 1965. 440 pgs. Literature. Sanskrit. Unknown.. Sanskrit. Samaveda Samhita. 104 pgs. Theology.. Language.. Sanskrit. Sriramdeen Cheturrvedi.. Samskruta Vanmaye Chandrah. 364 pgs. Samskrit Baladarsa. 1935. 422 pgs.. 384 pgs. Subbrayudu. Shrikrishanamani.. 0. Samaskrit Basha Vibushanam.. 1965. Unknown. Sanskrit.balasubramanyam. Sri Gowrishankar Sastri. .. Unknown.. Sanskrit. 84 pgs. Linguistics. Samskrita Swayam Sikshak Praba. 266 pgs...1.org/…/SanskritIIIT. Sanskrit. . Samkhyayogadarsanam. Sanskrit. 166 pgs. Literature.. 1943. 1992. . 288 pgs. Sanskrit. Sanskrit. 736 pgs. 490 pgs. Religion. Samavedasamhita. Samaveda Samhita Volume Iv.. Sanskrit. Sanskrit. sanskritdocuments. 1948.. Sanskrit.. Samgita Rathnakara Vol 1. Samskrita Akshara Siksha. Linguistics. 1963. Gosvami Damodara Sastri..krishnamacharya. V. 102 pgs. Shriibhojadeva. Religion... Pandith S Subrahmanya Sastri. Linguistics Literature. Sanskrit.. Sanskrit. Sanskrit. 0. 557 pgs. Linguistics Literature... Sridhar Bhaskar. Sanskrit. Samkalpa Suryodaya Of Venkatanatha Part 1. Samskrtu Vadumaya Kosa. Samskruth Chittah Trutiya Bagh... Samkalpasuryadaya... . Unknown. Religion. Samskara Prakasika. Satya Srinivasa Ayyangar. Samskruth Sukthi Sagar... Vidyasagar k L V Sastri. 587 pgs. Samskritha Prathibha Vol I. 0000. Trutiya Kanda.. 2000.. 0.. Jithendranath Shukla.. 323 pgs. Unknown. Linguistics. Pandit V. Ramji Upadhyaya. Literature. Unknown. Samarangara Sutradara Vasthu Sastram Mulamatram. Language. -.. C.. 0. 0. Sanskrit. 0. 1948. pandit s subramanya sastri. 0. Sanskrit. . Pandit M Suryanarayana Shastry. 226 pgs.. Samskrutha Bhakthamala.. Linguistics Literature. Samskrta Kavi Jivitam Part Ii. 0.2/14/2011 A list of scanned Sanskrit books at III… Samanya Vedanta Upanishad... 0.v.. Linguistics Literature. Art. Sanskrit. Unknown....krishnamacharya.. 0. Samgitaratnakara Vol I V Ashyaya 7. 136 pgs. 1990. 452 pgs. R. Bhavavibhuti Bhattachary. 263 pgs. Language. 634 pgs. 0... Linguistics. Samkalpasuryodaya Of Sri Venkatanatha. Samskruta Sahitya Silanam. Narayana Swamy. Sanskrit.. 1961.. Yudishtar Mimasak. Sanskrit. Samskruta Sukthi Sagar. Sanskrit.. 568 pgs. Literature.. Sanskrit. Samsara Chakram. V. Unknown.. 0. 226 pgs. 95 pgs. . Sanskrit. 0.. Sambapuranam (upapuranam). Mulchandr Patak. Theology. Samarrngara Sutradara Vasthu Sastram Mulamatram.… Samskrutha Sikshamajyarayaha Bhattacharya Sanskrit 1934 143 pgs 46/167 . Samarad'gand-asutradhaara Bhaaga 2. 1982. 103 pgs. 98 pgs. Sanskrit. Literature. Samskruth Natakome Athi Prakruth Thatv.. Literature. Sanskrit.. Sanskrit. Samsara Chakram. Dr. Sanskrit. Sanskrit... V.. 1983. Unknown. 556 pgs. Sanskrit. Sanskrit. 454 pgs. 1921.. Mahadevshatrin.. -. Satyavarata Samasarami Bhattacharyyaa. 233 pgs. 1948.. Unknown. 144 pgs. Unknown. Language. Samskruta Vyakarana Sastra Ka Ithihas Part . Krishnamacharya. 615 pgs. -. . Sanskrit... 436 pgs... 1937. 0. 0. . Literature.. . 1925. 407 pgs. 424 pgs. 1983. Unknown. Unknown...

sanskritdocuments.. 1941. Samtanantarasiddhi Vol Xix.. 80 pgs.org/…/SanskritIIIT. Sanskrit... 1950. Bhat'a~t'agopiinaathadiiqs-ita. Sanskrit.. Social Sciences. Sanskrit.. 237 pgs. Theology. Biography. 72 pgs. Mathura Prasad. Sanskrit. 212 pgs.. Vaidaya Si Vi. Psychology.. 1928. Pandit S. Linguistics. 1943. 1960.. Sanathakumara Samhita.. San'skrxtapadyavali. Language.. Samurtar Chanadhikarana: Atri Samhita.. 1931... 143 pgs. Gummaluura~yupanaamaka Sang-game Shrvarashaastrind-a. pandit s subramanya shastri.. 230 pgs. San'pura~nd-a Aagarakara Bhaaga 2.. Sanskrit. Linguistics. Unknown. History.. 1918. 173 pgs.subrahmanya Sastri. Natural Sciences. 406 pgs. 176 pgs. 822 pgs. Sara~vajnj-aatmamuni.... San'qs-epashaariirakama~ prathamaadhyaayarupa Prathamo Bhaga. 405 pgs. Samtanantarasiddhitika. 638 pgs. Samveda Vachaspathi. Sanskrit. Sanskrit. Sandesh Rasak. 298 pgs. Philosophy. 244 pgs. 1933. 1982. Rigveda Samhita. Art. Psychology. Bhaand-d'aarakara~ Raamakrxshhnd-agopala. Unknown. Unknown. Vaamana Kaane Paan'd'uran'ga.. Philosophy. Sanatsu Jatiya. Sanskrit. 1992. 455 pgs. Sri Kunda Kunda. 1955. Sanskrit. Sanskrit. Atri Samhita. 1913. Bhattacharya. Sanskrit. 386 pgs.. 603 pgs. Sri Kunda Kunda. San'qs-epashaariirakama~ Da~vitiiyo Bhaaga. V. Poonam Niraula.. Unknown. 1987.. Literature. Sanskrit. Shaastri Bhaaskara. Sanskrit.. San'skaararatnamalaa Prathamo Bhaaga. Religion.. 331 pgs.… Sangitopanisat Saroddhara vacanacharya sudhakalasa Unknown Sanskrit 1961 198 pgs 47/167 . 1947. Sanskrit. 560 pgs. Suklapandita. Atri Samhita. 0. 0000. 154 pgs. Unknown. Language. 1953. Sanskrit. Sanskrit. Sanskrit. Unknown. 86 pgs. Sanghameswara Krodam. Pandit Omkarnath Thakur. Atri Maharshi.. Theology. Samvedika Sri Subhodini Paddhati. Sanskrit... Suklapandita. 1677. Sara~jnj-aatmamuni. Unknown. Sanskrit. 0.. Others . 1899.. 1921. Sangeetanjali. Sandhi Samasa Manjusha. Others . Religion. Sanskrit.. 1982. Sanskrit. Biography. Geography. Chimnaajii Gand-esha. Sang-game Shrvarakrod'ama~. Unknown. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Samskrutha Sikshamajyarayaha.33.. 1934... 1917.. 462 pgs... Sandhi Chandrika. Religion... San'skaara Paddhati Grantha 94. Sanskrit. 1924. 406 pgs. Samyasara Of The Nature Of The Self. Sanskrit. San'skrxtamandiraantah Praveshikaa. 180 pgs. Sangitaratnakara Of Sarngadeva Vol 4 Adhyaya 7. 1918..33. Gopinathadiiqs-ita Bhat't'a. 1934.... Sanskrit. Hajari Prasad Divyedi. 439 pgs. 1953.. Sangita Chandra (a Trearise On Indian Dance)..krishnamacharya. San'qs-ipta Vaalmikii Raamaayand-a Trxtiiyo Khand-d'a.. History... 1950. Literature. 267 pgs.. San'skaararatnamaalaa Uttaraara~dama~ Bhaaga 2. Sanskrit. Sanskrit. Natural Sciences. Gand-eshaa Shaastrii Laqs-mand-a. 82 pgs.. 1899. Sanadaapatraan'tiila Maahitii. Aalatekara Maadhava daamodara.. Art. Unknown. Sanskrit.. San'skrxtavaachanapaat'hamaalaa Dvitiiya Khand-d'a. Geography. Theology. 270 pgs.. Sangita Chandra. Samyasara Of The Nature Of The Self. Sangitaratnakara Of Sarngadeva Vol I... Sanskrit.. Sri Ramachandra Jha Vyakarnacharya. 312 pgs. ..

284 pgs.s. Unknown.. Sanskrit.. Sanskrit. Language. S. Ramashankara Bhattacharya. 352 pgs. Kanta Gupta. Sanskrit Journal on Sahrudaya. Sankskrutha Gantha Suchi. Sanskrit. Sanskrit. Leidecker. Sanskrit Bhasha Bhodhini Vol I I.. vacanacharya sudhakalasa.. 266 pgs. Sanhit.. Sanskrit. Sanskrit Sahithyothihas Vol.. Unknown. Unknown..… 48/167 . Sanskrit Gadya Padya Samgraha. Krishnamachari... -. 1947. 302 pgs. Sanskrit.. 198 pgs. 1960. 0. 1940. 0. Sanskrit. Sanskrit. 1976. Sankara Bhashyalochanam. 146 pgs. . Unknown... -. Sastri. Unknown. Linguistics. Literature. Sankhya Darshan Ka Ethihas. Thibaut. 243 pgs. 1994. Sankalp Suryoday Vol I. Unknown. Language. Sanskrit Bhashamahe. Narayanacharya. 377 pgs. Sankaravijaya. 758 pgs. Sankya Darshan. 467 pgs. Gopala Bhatta.. Sangrahartha sangraha. 1953. Surendra Kumar Gambhir. Sanskrit. -. Literature. 1945. 650 pgs. Sanskrit. Linguistics Literature. Sanskrit.. Sanskrit... 131 pgs.. Sanskrit. Sanskrit. Unknown. 0. 684 pgs. Pt. Sanskrit. Unknown.. G. 102 pgs. Brahmachari Surendra Kumar. Unknown....krishnamachariar. sanskritdocuments.p. Unknown. 1985. 0.org/…/SanskritIIIT.. 1954.sriram Sharma Acharya. 1947. Sanskrit. Acharya Udhayveer Shastri. Linguistics.. Sri T K Tiruvenkatacharya... Unknown. Unknown... 0. Sanskrit. Sankhyadarsana. 1930.. Not available. Sanskrit Sopanam Vol Iv.. Sanskrit Gadhy Padhy Sangraha Vol I. 110 pgs. 2002. Unknown.. 260 pgs. Sanskrit.upadhaya. Sanskrit Drama Its Origin And Decline. 456 pgs. History. 164 pgs.. Sree Purushottam Lal Srivastav. Unknown. Unknown. Vyasacala. Sanskrit Text Book For Detailed Study 1962. 435 pgs. 150 pgs. 644 pgs. Unknown.. Sanskrit Syntax And The Grammar Of Case.. Unknown. Language... Sanskrit. Unknown. Geography. 70 pgs... P. K. Kurt F. Sanskrit.. Unknown. 0.. Sanskrit. Unknown. Sansar Sagar Manthanam Vol Ii. Unknown. 68 pgs. Sanskrit. G. Sri Brahaspati Shastry. 146 pgs... Sanskrit Text Book For Detailed Study. Sanskrit Journal Sahrudaya Part 8. Sanskrit. 1886. Theology... Unknown. I Shekhar. 1948. Sanskrit. .. 0. Unknown.. 435 pgs. Unknown. Sankshepa Sarirakasya Adhyaya I. 1976. 1963.. Sanskrit Manuscripts 2. Sanskrit Nibandhavali. Sanskrit Text Book For Detailed Study 1960.. Shri Brihaspati Shastri. Sanskrit Essentials of Grammar and Language.hansraj Aggarwal.. 523 pgs. Sanskrit. 2002.. 107 pgs. 1956. 0. Pandith Rajesh Dixit. 0. Sanskrit Saiva Kavyas Vol I. 588 pgs. Sanskrit Ratnakarmay Shigyandank... 1958... Sankhya Darshan Pravachan Bhashya. Sanskrit. -. Pandit Krishnama Charya.2/14/2011 A list of scanned Sanskrit books at III… Sangitopanisat Saroddhara.. Sanskrit.. Sri Vijnana Bhikshu.. Sanskrit. 254 pgs. Sanskrit Manuscripts Vol... Religion. 1987. Pandit Vruddhi Chandra Sharma Shastri. 50 pgs. P K Gode. Sanskrit. 1980..p. Unknown. 1961. Biography. 667 pgs.1. 1994. Sanskrit English Dictionary Vol 2. 118 pgs.. Sanskrit. Sankhyayana Grihya Sangraha. 62 pgs... Linguistics.. 207 pgs. Sanskrit.ix.. Sanskrit.venkataramanan. Hari Narayan Dikshit. Sanskrit. Literature.. Pro.. Sanskrit.. .. 1976. Unknown. 1959.

sanskritdocuments. Religion. Unknown. Unknown. Sanskrit... . 404 pgs. Pandith Jeevaram Upadhyay... Sapindya Kalpalatika. 146 pgs. 1990. 72 pgs.. Unknown. Sanskrit... Unknown. Sarasabharati Vilasa.kapildev Devedi Acharya.. 0. 0. 418 pgs. Sanskrita Shiksha 1. Sanskrita Kavya Kanthah.. Sanskrith Paath Mala Vol Ii.. -. Pandith Sripad Damodar Saatvalekar. Unknown. 1956... Sanskrith Siksha Vatika Vol Iv... 57 pgs. Sri Rurthar M Mikanal. Sanskrit. 1927. Sanskrit.. 44 pgs. Dr. 166 pgs. 60 pgs.. Sanskrit. Sanskrit. Sanskritkavicharcha.. 1927. Sanskrita Sahitya Itihasa Khunjka. 1955.. Unknown. Sanskrit. 336 pgs. 48 pgs.. Sanskrit Vyakaran Praveshika A Sanskrit Grammar For Students. Sanskrith Grammar. Sarasabharathi Vilasa... Garikapati Laxmikanthaiah. Dr. Religion.. Acharya Paramanand Shastry. Benfey T H..prabhanjanacharya.kapildev Devedi Acharya. Biography. 1930. 2002. Unknown.. 116 pgs. Sanskrit. 1868.. Chaturya Lal.. 300 pgs. 133 pgs. -. Sanskrit. Sanskrit. 58 pgs. 1928... 110 pgs. Sanskrxtavaachanapaat'hamaalaa Da~tiiya Khand-d'a. Sanskrith Paath Mala Vol I V... Pandith Rahul Sanskruthanen. 0. Sanskrit. Sanskrit. Unknown. 70 pgs. 1976. Unknown.... 366 pgs. Sanskrit. Sanskrit. 324 pgs. 133 pgs. Sarasangrahah. Unknown. 0. Unknown.. Sanskrit. Saralaayurved Shiksha. 0. Sanskrith Sopanam Vol Ii.. Unknown... Sri Vadirajathirtha. Sanskrita Shiksha 3. Sanskrita Shiksha 2. Mangesh Patkar. Sanskrite Panchadevastotrani.kapildev Devedi Acharya. -. Language. Sarasvata Home Of Kalidasa. 214 pgs.. 0. 1990.. Sanskrit. Sanskrit. Sanskrit. 0... -. Sanskrit. Sanskrit. Unknown. Sanskrit. Babu Ayodhya Prasad. Janardana Pandeya.. Lele Laqs-mand-agand-eshaastii. -. Linguistics Literature. Surendra Narayana Tripathi.. Gopinatha Kaviraja. Unknown. Unknown. Sarasvanth Vyakaranam Poorvadharma.. 302 pgs. 410 pgs. Santi Prakasa. Krishnagopal Goswami Sastri.. 1843. 40 pgs. Ramchandra Sharma. Literature. 0. Surendra Kumar Gambhir. Linguistics.. Pandith Sripad Damodar Sathvalekar.. Unknown. Unknown. Sanskrit. Unknown. Sanskrit. 0.. Sanskrit. Sanskrith Paath Mala Vol X I I. Literature. Sanskrith Siksha Vol Ii. 0. 1973.. 475 pgs. 42 pgs.. 1985. Unknown. 100 pgs.. 1951. Geography. Unknown. Sanskrit.. Sanskrit. 1982. Unknown. 1982. Sanskrit Text Book For Detailed Study 1964.. Sanskrit. 1950. Sanskrit.. -.. Sanskrit. Unknown. Sanskrit Vyakaranam.. 122 pgs. 1981. History. Unknown. 84 pgs. Santati Shastra. Sanskrit. 1996. Saradiyakhya-namamala of Harsakirti. V. Sarasvata Vyakaranam. Sanskrit. Sri Guru Prasad Shastry. Unknown. 1942. 132 pgs. Sanskrith Paath Mala Vol Ix. Sanskrit. Jagdish Kumar. 1949. 315 pgs.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit Text Book For Detailed Study 1963.. 0. Dr.... Sanskrit Text Book For Detailed Study 1967. Sanskrit. Sanskrith Kathasagar.… 49/167 . 70 pgs..m. Sarasvatibhavana Granthamala Volume X. Philosophy.. Sanskrit. Sri Naraharishastry..org/…/SanskritIIIT. 420 pgs... 1950. Unknown. Pandith Sripad Damodar Sathvalekar... 62 pgs... Unknown. 174 pgs. Pandit Ram chandra Jha.

0. pgs. Saraswathi Suhama Vol 53 Mar Dec 1998-99. 1983.. Sastra Dipika. 241 pgs... History. 226 pgs. Vedas. S R Krishna Murthy Shastry. Sanskrit. 1969. Sanskrit. Srimadvijayeendrateertha. P. Sastri Dipika. Sanskrit.. Unknown..... Sarth Jnaneswari. 1957. 382 pgs. Sanskrit. Saraswathi Suhama Vol 53 Mar Dec 1998-99. Religion. Sanskrit.. Sastra Siddhantha Lesa Sangraha.... 166 pgs. bhatta vasudeva. 1927. 1986. Satha Dushini. 1935. 182 pgs. Saraswati Sushma Vol 37 1 4. 1935. Saraswati Bhavana Texts Part Ii. 0. 233 pgs. E. Sanskrit.. 562 pgs. 694 pgs. 0. 357 pgs. 1995... Anundoram Barooah.. 0. Vaidya Shivacharan Dhyani. 1913. Language.org/…/SanskritIIIT. Sarkara Srinivasavirachita Tatvaprakasika. 1901. Sanskrit.. Satapada Brahmanam. Literature. Sanskrit.. Philosophy. 1940. Unknown. Saraswathi Sushama Vol 37 (1-4). Sanskrit. Unknown. Sanskrit. 1915. Dr. pgs. 1935. Unknown. History. Sanskrit. Unknown. Sanskrit.p.. Dr. Geography. Sarvavednta Siddhantasarasangraha. Sanskrit. Anubhavananda Swamy.m. Saraswatha Vyakaranamu Purvardhamu.shama Sastry. Sri Nanamaharaja Sakhare.. 162 pgs. 1927. . Chin'taamand-i Ti raa. Unknown. 539 pgs. Sanskrit. Biography.. Sanskrit. Sathyaashhaad'ha. Vedanta Desika. Linguistics. Unknown.. Sanskrit.. Geography. Sri Pradhacharya Vidwanandi. Unknown. Sanskrit. Unknown. Sanskrit. 185 pgs. Biography.. Sanskrit. Satha Dushini. 405 pgs. Sarvedic Prasnothari. Sarvasiddanthasara Vivechanam. Dr.. Pandit Sri Vishveswara Jha. Theology.. 120 pgs. 1916. Unknown. 206 pgs. 1951. 1973. Mangesh Patkar.... 340 pgs. Sanskrit.. Shri Nanamaharaja Joshi Sakhre. Sarva Darsana Sangraha Of Madhavacarya...r. Mangesh Patkar. 544 pgs.. 1950. Sanskrit.. .. Unknown. Sanskrit.… Satikathraya Sri Valmiki Ramayanam Utthara Kandam Sanskrit 0 2090 pgs 50/167 .shama Sastry. Sri Sankaracharya. Sanskrit. Chinnaswamy Sastri. 1952. Sardh Jnaneshwari. Sarira Kriya Vijnaniyam.. Geography. 400 pgs. Saraswathi Sushama Vol 37 (1-4)... Sanskrit. Unknown.. History. 1951.. Biography. 212 pgs. History.. Sri Amalananda... 431 pgs. 456 pgs. Gopi Natha Kaviraja. 214 pgs.r. Pandit Rama Krishna Misra. 402 pgs. Literature. Sanskrit. Sanskrit. Satha Dushini. Sastra Siddhantalesasangraha Volume I. Philosophy... Pandit Rama Krishna Kishra. Sanskrit. Philosophy. Geography. Unknown. Unknown.sastri. Religion..shama Sastry. Saraswati Vilasa (vyavahara).. Raobahadur Gangadhar Bapuraj Kate..... Sarva Siddhanta Sourabham.cowell. Philosophy. Biography. 164 pgs.b... Religion. 158 pgs. 1986.. Philosophy.. Language. Unknown. 1927. Sathya Shasan Pariksha. 1927. ..r. Sanskrit. Sanskrit.. Ramchandr Savath. Linguistics. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Sarasvatii Kand-t'haabharand-ama~ Bhojaadevaa. Sasthramuktavali. Saraswari Kanthabharana. Vageesha Sastry. Sanskrit. 241 pgs. Sathavarthmala Sampoorna.. Sanskrit.. pgs. sanskritdocuments. 401 pgs. 880 pgs.s. Sanskrit. 1937. 1912.. 1967. 0.. Theology.. 0... Sanskrit. . 80 pgs. Literature. Sarvadarshana Sangraha. Sathyaashhaad'havirachitamn' Shraotasutrama~ Shhashht'o Bhaaga.. 431 pgs. Sastra Darpana.m. 1964. ..

Linguistics.... Theology. 1908... 331 pgs. Sekoddesatika Of Nadapada Naropa. Sanskrit. Theology.. Sanskrit. Sattotravalivibhag. Satyaashhaad'a Shraotasutrama~ Trxtiiyo Bhaaga. Raghunaathasuuri. Sanskrit. Satyaashhad'ha Shraotasuutrama Trxtiiyaa Bhaaga. Sanskrit. Religion. Sanskrit. Linguistics... Satyaashhad'ha. Literature. Religion. Religion.. Seleqs-ansa~ Phrama~ San'skrxta~ Insa~kripshhansa~ Para~t'a~ 1 Tekst'a~. 370 pgs. Sanskrit. 368 pgs. Theology. Satyaashhad'ha. Psychology. 1969. Sanskrit. Saundara~yalaharii Third Edition. Vedas. 221 pgs.. 367 pgs.. Religion. Jwalaprasad Goud. Sanskrit. Sanskrit. V.n.. Theology. Satyaashhad'ha Shraotasutrama~ Da~tiiyo Bhaaga. Saundarananda Kavya Of Arya Bhadanta Asvaghosa. Religion... 1925. Theology. Satyaashhad'ha. 1907. Saudaryalahari.shri Krishnamacharyswamy. 138 pgs... Philosophy. Satyaashhaad'havirachitan' Shraotasuutrama~. Vedas. Sanskrit. Theology. 350 pgs. Satyaashhad'ha Shraotasutrama~ Chatuura~to Bhaaga. 328 pgs. Religion. Dr B R Sastry. 158 pgs. 166 pgs. Satyaashhad'havirachitaman' Shraotasuutrama~ Ashht'amo Bhaaga. 140 pgs. 1922.2/14/2011 A list of scanned Sanskrit books at III… Satikathraya Sri Valmiki Ramayanam Utthara Kandam. 1929. 1932.. Shaad'a~khaayanaarand-yakama~ Grantha 90. 1932.. Satyaashhaad'a. Literature. 0. Sanskrit. Satyashhad'ha.. Satyaashhad'ha. Religion.. Sanskrit.. Sanskrit. 0. 1939.org/…/SanskritIIIT. Sanskrit. Unknown. 51/167 ... W.. 1908.. Religion. Sanskrit. 1987.. Saurapuraand-an' Vyaasakrxtama~ Grantha 18... Theology. 455 pgs. Sanskrit. Sanskrit. 1921. Kalluri Hanumanth Rao. Language.. 406 pgs. 400 pgs.. Satprati Pancha Grandhaha. Theology.. 165 pgs. Dr. Sanskrit. Satyaashhad'havirachitan' Shraotasuutrama~ Saptamo Bhaaga. Karambelkar. 1933.. Mario E Carelli. Theology.. Philosophy. 71 pgs. 310 pgs. Satyaashhad'havirachitaman' Shraotasuutrama~ Dashamo Bhaaga. Theology. Religion.. 125 pgs. Shan'karaa Chaara~yaa. 1908.. Theology. Satyaashhad'ha. 1940. N.… Shaan'karapaadabhushhand-ama~ Prathamo Bhaaga. Select Sanskrit Inscriptions. Seethaharanam. 73 pgs. Satyashhad'ha Virachitaman' Shraotasuutrama~ Navamo Bhaaga.. 1930. Satyagrahodaya.. Language. Satyaashhad'ha. 1930. Satyaashhad'ha Shraotasutrama~ Da~tiiya Bhaaga. Unknown.. Religion. 2090 pgs.. Satyaashhad'ha. 144 pgs. Satyaashhad'havirachitan' Shraotasuutrama~ Navamo Bhaaga. Shaan'karapaadabhushand-ama~ Da~vitiiyo Bhaaga. Satyaashhad'ha.. 1927. 1953. 1941. Sanskrit. sanskritdocuments. 1975. Sanskrit. Theology. 455 pgs.. Haraprasad Shastri... Sanskrit. Theology. Psychology... Aapat'e Vinaayaka Gand-esha. Shriiraghunaathasuri. . Unknown. Diskaalkara~ Di Bii. 169 pgs.. Religion. Religion. Sanskrit... 359 pgs... Sanskrit. 1907. 212 pgs. 1975. Unknown. . Theology. Aapat'e Vinaayaka Gand-esha. Prof. Sanskrit.. Aapat'e Vinaayaka Gand-esha. Sanskrit. Unknown. Religion. Religion. Gaadi.. Swamy Ghanapathi.

Sanskrit. 340 pgs. 1979. Linguistics. Ramakanta Angiras. 278 pgs. 344 pgs. Sharushan-sar-patrika. Sanskrit. . Shastavakru Geeta. 1933.. 1822.. 244 pgs. 0. Shadgadhara Samhitha. Ramswaroop Sharma. Sanskrit. Babu Zalim Shing.. Sanskrit. -. 0.. Raja Radhakanta Deva. -. 194 pgs. Religion.. 1909. Unknown. Linguistics. scanned Sanskrit books at III… Philosophy... Philosophy. 1997. Sanskrit. Linguistics. Sanskrit... Psychology. 1950.. Shabdh Deepika. Philosophy. Shabda Kalpadrum Part I I I.. Literature... sanskritdocuments.. Shanker Vedanta Ek Annusheelan. Sanskrit. Shabdakaustubhah Da~vitiiyo Bhaaga. 1961. 1951.. Shabdakalpadruma Volume V. Unknown. Linguistics. 294 pgs. Sharirkvigyanam Vol I.. Language. Shabd Kalpa Druma Padama Kanda. Shriibhara~trxhara Mahaakavii. Psychology.. Sanskrit. 345 pgs. Sanskrit.. Tara~kalan'kaaraa Shriijagadiisha.. Linguistics. Language. Sanskrit. Language. mahidhara sharma. 569 pgs. Unknown. Diiqs-ita Bhat't'o. Shaan karapaadabhushhand ama Prathamo Shriiraghunaathasuri.. Sanskrit. 247 pgs... 324 pgs.. Shabda Kalpadrum Dwithiya Bagam. 0. 1934.. 0.. Bhat't'aachaara~ya Gadhaadara. Theology. Language. Unknown. Religion. Vyaasaachala. Psychology.. Shang Dhara Samhata. Shambhohara Prakasha.. Shatakatratama~ Bhaaga 9.. . Shabda Kalpadrum Part 5. 0.. 340 pgs. Sanskrit. Linguistics. 557 pgs.. Shang-karavijaya. Unknown. Sanskrit. 0.. 245 pgs. Sanskrit. Pandit Ramprasad Rajvaidy Patiyal. Sanskrit. Sanskrit.. Unknown. Anandagiri.. Language. Sanskrit. Language. 524 pgs. Sanskrit. Shadkar Vijay... 1984. 1961.. Shabda Nirnaya Dipikahsampadanamu. Shaiva Paribhaashha. 116 pgs. Unknown.. 147 pgs.… 52/167 . 945 pgs. Language. 1822. Religion.. Theology. 494 pgs.. 1949.org/…/SanskritIIIT. Shakttivaada. Prabhakara Prasad. 0.. 1954.. Shaastratattvavinira~nd-aya. Unknown.. Unknown.r. Sanskrit. Shamakosh sabhayanuvadh. Shabdhakapadrumaha Thruthiyakandaha. 485 pgs. 2003... 289 pgs.. 1961. Literature. 1961. Raja Radha Kanta Deva. 519 pgs. 1946. Theology. Kaatare Sadaashiva Laqs-midhaaraa. Sanskrit. Literature. Sir Raja Radha Kanth Dev Bahadur. Sanskrit. 802 pgs. Vedas. . Shabda Kaustubha Prathamo Bhaaga... Shabda Kalpadrum Part I V. Literature... raja radha kanta deva. 8798. Religion. Shabdashattkiprakaashika... Linguistics. 0. 592 pgs.. 265 pgs. Shabdhakapadrumaha Chaturthakanda.... Chara~yaa Shiva. 0. Sanskrit. . Unknown.. Shankara Bhashya Sametha. Sanskrit. Unknown. Shabdakalpadruma Volume I.... Raja Radha Kanta Deva.. Unknown. Theology.. Shabd Kalpa Druma Chaturthi Kandam. Pandith Madhusudhansharamamaithila. 573 pgs. Sanskrit. . Sanskrit. -. 170 pgs... 1927. Bhat't'ojiidiiqs-ita. Sanskrit.. Sanskrit. 1929. 430 pgs. Unknown. 790 pgs. Kantha Dev. Sri Madhusudhan. Sanskrit. Sanskrit. 438 pgs. Sanskrit. Literature. Literature. 818 pgs.. Unknown. 1988. Literature. 1949. Sir Raja Radha Kanth Dev Bahadur. Sanskrit. 652 pgs. . Shareerak Vignanamu Dwithiya Bagamu.. 1932. Dr B R Shastry. Literature. Sanskrit. 558 pgs.2/14/2011 A list ofBhaaga. Shabdhakapadrumaha Panchamakandaha. Unknown. Sanskrit.

Shri Anka Kavya. Theology. Theology.. Theology. Religion. 1847. 360 pgs. 105 pgs. Religion.2/14/2011 A list of scanned Sanskrit books at III… 212 pgs.. Sanskrit. 1997. 254 pgs. P. Aapat'e Hari Naaraayand-a.. Sri.madannatkrishnshastrikrut.. Shraotasuutrama~ Panj-chamo Bhaaga.. Narayana Ram Acharya. Unknown. Sanskrit. Unknown. Theology. Vedas. Sanskrit.. Shraadhdamanj-jarii. Srimat Travibhashyakar Sayanacharya.. 1930.. Shraota Suutrama~ Shhashht'ho Bhaaga Grantha 53. Shriimachchhan'kaarachaara~ya.. History. Pandit Sreemathru Prasadha Pandeya.. Unknown. Sanskrit. 317 pgs. 288 pgs... Sanskrit. Sanskrit.. Theology.. Religion. Biography. Biography. 1893. Viiraa Raghu. 1927. Unknown. 893 pgs. Theology.. Religion.. 152 pgs. 1927. Sanskrit. Sanskrit.. Social Sciences. Shraotasuutrama~ Panj-chamo Bhaaga. Religion... Shri Ramacharanpurikruth.. Shrimat Trayibhashyakar Sayanacharya. Sanskrit. Shraotasutrama~ Chatura~tho Bhaaga. Religion. Shri Hari Swami. Satyaashhaad'ha. Theology. Shatpath Brahmanam. Shatpath Brahman. Theology.. Unknown. Unknown. Unknown. Unknown. 0.... Theology. 1928.. 1928. History. Sanskrit. Satyaashhaad'ha. Unknown. Shatpath Brahmanamu Part Iii.Brahmanam Part Ii. Religion. 1907. Shiva Samhita.. 936 pgs. Shilpa Shaastrama~. 84 pgs. 1929. Shiksha Patri. Vaasudevananda Pa Pa. Sanskrit. Theology.. 404 pgs... 1940. 909 pgs. Religion.. 160 pgs. Theology... Unknown. Sanskrit. 438 pgs.org/…/SanskritIIIT. Shraotasuutrama~ Ashht'ama Bhaaga.. 0. Unknown. Sanskrit. Shrautapadarthanirvachanam.. Shatbhushni Vol-1. Sanskrit. Krishna Kaura Mishra. 200 pgs. 302 pgs. Sri Vasudeva Brahma Bhagwat.. Theology. Aagesh Ithyupavedattatreyashastry. Aapaat'e Da Vii. Sanskrit. Joshii Shankara~naaraayand-a..... Satyaashhaad'ha.. Sanskrit.. Sanskrit. Sanskrit. Satyaashhaad'ha. 1972. Shraotasuutrama~ Saptamabhaaga. Shraota Suutran' Dditiiyo Bhaaga Grantha 53. Religion. Theology. 1940. Satyaashhaada. 1908.. Theology. 52 pgs. 225 pgs. 127 pgs.. 1935. 1939. Geography.. Shiqs-aatrayama~. 1927... 0. 168 pgs... Shivacharitra Saahitya Khan'da 3 Ra.. Sanskrit.. Sanskrit. Geography. Sri Guruprasad Shasrti. Shatashlokii Aavrxtti tiisarii. 221 pgs. Vedas... Shatgidhara Samhitha. Satyaashhad'ha.. Unknown. 1957.. Sanskrit. 816 pgs. sanskritdocuments.jetendriya Charya. Sanskrit.. 1908. Shradhamanjari. Satyaashhaad'ha. Religion. Religion. 337 pgs. 1982. 135 pgs. Shatpath . Shivajataka. Religion. Sanskrit. Sanskrit... 1854. Shraotasutrama~ Prathama Bhaagah. 1909. Shivacharitra Pradiipika. Sanskrit.. 1907. 0. Shraotasutrama Bhaaga 2. 1951. Sanskrit.. Sanskrit. Sanskrit. 404 pgs. Religion. Shatpath Brahmanam Part V. 1868. Sanskrit.. 1940. 400 pgs. 608 pgs. Sanskrit. Vishwanath Shastri. Bosa~ Phaniin'dranaatha~. 360 pgs.… Shri Madbhagvadgeeta Vijay Chandra Varmanujya Unknown Sanskrit 0 340 pgs 53/167 . Satyaashhaada. Shivaraj Vijay.. Srimathi Urmila Devi Sharma. Satyaashhad'ha. 209 pgs. Shatapatha Braahmand-ama~ Dditiiyo Bhaaga. Shishupalvandh. 315 pgs. Sri Narendraprasadji Maharaja Sri Ni. 62 pgs.. Sanskrit. Religion. 310 pgs. 1919.

Psychology. 1874. Aapat'e Hari Naaraayand-a.. 1923. Social Sciences. Paramadiishvaraa..2/14/2011 A list of scanned Sanskrit books at III… Shri Madbhagvadgeeta. 473 pgs.. Literature.. Language. Natural Sciences. Sri Narayana Charya. Shrii Mada~ddaipaayanaprand-iita Brahmasuutraand-i Grantha 21. Bhat't'a Shriinaagesha. Gautamamunii. 1958. Linguistics. 1851. Shri Ram Charit Manas. 680 pgs. 517 pgs. Sanskrit. Sanskrit. 611 pgs. 1918. Sanskrit. 0. Theology. Shrii Aashchara~yachud'aamand-i. Religion. 0. Shrii Paribhaashhendushekhara. Sanskrit. Raghunaathaprasaada~ Pand-d'ita~. Jayakrishna Misra. Unknown. 2001.. 1932. Sanskrit.. Maarulakara Shan'kara Shaastri. Literature. 1933.… 54/167 .. Unknown.org/…/SanskritIIIT. Sanskrit. Unknown. Theology. Shriimadramaanujaachara~yaa... Sanskrit... Sanskrit. Linguistics. Sanskrit. Shrii Lat'akamelakama Trxtiiyo Bhaaga. Shrii Bhaashyama~ Da~vitiiyo Bhaago Vivrxtyaatmaka. Unknown. Aapat'e Vinayaka Gand-esha. Shriishang-khadhara. 112 pgs. 294 pgs. 1237 pgs. 278 pgs. Social Sciences. Language. Shriimanniilakand-t'haa.. Literature. Sanskrit. Language. Shriddisarah. 612 pgs.. Sanskrit. 1933. Language... 1916. Language.. 1947... Shriinivaasaachaara~ya Laqs-miipuran... Sanskrit. 1903. Sanskrit. Goswami Tulasidas. 1978. 642 pgs. Sang-gameshvarashaastrii Gummaluurii... Theology. Literature. 373 pgs... Religion.. Unknown. Sanskrit.. Linguistics. 1922. Shri Vidrananya Muni.. 50 pgs. Shrii Ashht'adashasmrxtayaa. Shrii Madaara~yabhat'iiyama~. Vishvabandhu Shaastrind-a... Shrii Puraand-a San'hitaa Grantha 89. Kara~nd-apura Kavii. 82 pgs. 1917. Linguistics.. Shrii Panj-charaatran. Philosophy. Theology. Sanskrit. Sanskrit.. 458 pgs. Sanskrit. 1933. 167 pgs. Shrii Madabhagavadagiitaayaa Prathama Dditiiyaadhyaayau. Religion. Shrii Chitraprabhaa.. Psychology. 1934. Shri Pacchadashi Pitambhari Bhashya... Language. -. 808 pgs. Religion. 1846. Shrii Sang-gameshvarakrod'ama~. Shrii Alang-kaarakaustubha Da~vitiiyo Bhaaga. Sanskrit. Theology. Philosophy. 219 pgs. Theology. Social Sciences. Linguistics. 340 pgs.. Shaastri Mukundaraama.. Shrii Gautamamuniiprand-iitanyayasutrani. Shri Manmahabharathamu Vol 3.. 161 pgs. Shriihariishaastrii Pand-d'itavara. Chaara~yand-a Shrii Krxshhnd-a Priyaa. Sanskrit. 1951. Literature. Shrii Madabhgavadagiitaa Grantha 44.. Shrii Paraatrin'shikaa Grantha 18. Sanskrit.. 326 pgs. 378 pgs. 384 pgs. 1644. 357 pgs... Shrii Manmahaabhaartama~ Shhashht'hobhaaga Anushhsanapara~va... Philosophy.... Shrii Giitaamrxtataran'gind-ii. 1933. Sanskrit. Vijay Chandra Varmanujya. 131 pgs. Literature.. Sanskrit 1933 89 pgs sanskritdocuments. Sanskrit. Sanskrit. Religion. 1938. Sanskrit. Sanskrit. Psychology. Psychology. Linguistics. Shrii Dayaananda Mahaavidhaalaya Vol 25.. Mumbayyaan. 1927.. Shrii Dara~shanodaya. 239 pgs. Literature. Shri Raghavendra Vijayah... Philosophy. Mahaakavii Shriishaktiibhadraa. Religion. Shriibhaasa Mahaakavi..

Theology... Religion. Shrii Sara~vadara~shanasan'graha. 1933. 1945. Philosophy. Sanskrit. Sanskrit. Bhat't'aachaara~ya Gadaaghara. Shrii Svachchhandatantrama~ Grantha 31... 1924. 344 pgs. 297 pgs.. Sanskrit. 1906. 94 pgs. 761 pgs.. 1943. 1924... Shriikrxshhnd-ayajuravediiyataittiriiyasan'hitaa Panj-chamakaand-d'arupa Saptamo Bhaaga. Theology. 1933. Religion. Abhinavaguptaa. Theology.. Shaastri Kaashiinaatha. Sanskrit.… Shriimadand-ubhaashhyama~ Faskiikyuulasa~ 8 Shriishriivallabhaachara~yaa Philosophy 55/167 . Religion. 619 pgs. Shriimadaachaara~yadand-d'i.. Shrii Vedaara~thasan'graha. Theology. Shriimadabhagavadagiitaa Dditiiya Khand-d'a Grantha 34. Shriimatsaayand-aachaara~yaa. 288 pgs. Shriimadabhagavadagiitaa Grantha 112. Kaula Madhusuudana. Geography... 1906... 1939. Theology. History.. Theology. 1929. 110 pgs.. Theology. 348 pgs. Kand-t'ha Raajaanakaraama. 1954.. Sanskrit. 443 pgs. 1927. 1921. Shriimanmadhvaachaara~yaa. Shrii Madabhinavaguptachaara~ya. Shriimatsaayand-aachaara~ya.. Shriikrxshhnd-ayajura~vediiyataittiriyasan'hitaa Trxtiiyo Bhaagah. Qs-emaraaja. 215 pgs.. 168 pgs. Shriishriivallabhaachaara~yaa. Psychology. 330 pgs. Shriimadand-ubhaashhyama~ Faskiikyulasa~ 13. Theology.. Religion.. Theology. Theology. Vallabhaachaara~yaa Shriishrii. Theology. Qs-emaraaja. Sanskrit.. Religion. Shrii Tantraaloka Shhashht'ho Bhaaga... Sanskrit. Religion. Shriishriivallabhaachaara~yaa. Sanskrit.. Shriigand-eshaathara~vashiira~ra~shha Sabhaashhyama~. Sanskrit. Theology. Religion. 393 pgs.. Theology.. Theology.org/…/SanskritIIIT. 1921. Sanskrit. 264 pgs. Theology. Shriimadand-ubhaashhyama Faskiikyulasa~ 8. Sanskrit. 291 pgs. Shriimadabhagavadagiitaa Grantha 64. Sanskrit. Shriimadand-ubhaashhyama~ Faskiikyulasa~ 9.. Sanskrit. 111 pgs. 1948. Shrii Shaakttivaadah. Theology. 1906.. Sanskrit. 42 pgs. Shriimatsaayand-aachaara~yaa. Qs-emaraaja. Sanskrit. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit.. Philosophy. 219 pgs.. Religion. Sanskrit. Shriimadagand-eshagiitaa Grantha 52. Raamaanujaachaara~yaa Shrii. Niilakand-t'ha.. 1919. Shriimadaachaara~yadand-d'ivirachita Kaavyaadara~sha. Sanskrit. 1952. Religion.. Sanskrit. Shrii Svachchhandatantrama~ Chatura~tha Bhaaga Grantha 47. Religion.. Psychology. Religion. Sanskrit. Shrii Svachchhaandatantrama~ Grantha 52.. Religion. Religion.. Psychology. Shriivaasudevaanandasarasvatii Pa Pa.. Sanskrit.. Religion. 1923. Natural Sciences. 1924. Biography. Shriikrxshhnd-ayajura~vediiyataittiriyasan'hitaa Ashht'am Bhaagah. Chaara~ya Madraamaanujaa. 1951. 1930. 112 pgs. Sanskrit. Shriigurucharitama~ Da~visaahastrii. 326 pgs... 374 pgs.. 89 pgs. 299 pgs. Religion. Vaamanashaastrii Pand-d'ita.. 1947. Taad'apatriikara Shriinivaasa Naaraayand-a. 1927. Shrii Tantraaloka Bhaaga 7. Religion. 215 pgs. Theology... Sanskrit.. Religion. Shriikhachchhandatantrama~ Panj-chamo Bhaaga Grantha 53. sanskritdocuments. Shriimadabhagavadagiitaa Grantha 92. Philosophy.. Psychology. Philosophy.

Theology.. Shriishriivallabhaachaara~yaa. Shriisvachchhandatantrama~. 1906.. Sanskrit. Shriimadand-ubhaashhyama~ Faskikyulasa~ 10. 851 pgs. Kalanda~ Viillemena~. Shriishriivallabhaachaara~yaa..2/14/2011 A list of scanned Sanskrit books at III… Shriimadand ubhaashhyama Faskiikyuulasa 8. Shriishan'karabhagavatpaadaachaara~yaa. Shriishang-karaachara~yaa. Philosophy. Linguistics. Sanskrit. Sanskrit. Religion. 1926.. Geography. 1906.. Vaad'hdivasa.… Sh ii h hh d t t G th 31 A h M h h h R li i Th l 56/167 . Sanskrit.. 29 pgs. Philosophy. Sanskrit. Religion. 1368 pgs. Psychology. Religion. Shriimaddevii Bhaagavatama~ Mahaapuraand-ama~. 395 pgs. Theology. Language. Religion. Shriiraamaayand-ama~ Prathama Khand-d'a Baalakaand-d'ama~. 212 pgs. Shriishuklayajura~vede Shatapathabraahmand-ama~ Bhaaga 2. Sanskrit. Theology. Shriimatsaayand-aachaara~yaa. sanskritdocuments.. Literature.. Paramaananda Kaviindra. Shriimadbhagavadadgiitaa. Theology. Psychology. Shriishriivallabhaachara yaa. Shriimadbhagavadgiitaabhaashhyaara~tha. Sanskrit. 1849. Sanskrit. Religion. Shriipurshhasukttama~. Sanskrit. 517 pgs... Sanskrit. Theology. Sanskrit. Shriimadand-ubhaashhyama~ faskikyulasa~ 4. Shriishriivallabhaachaara~ya. Shriimada~vallabhaachaara~yaa.. Sanskrit. Philosophy. 110 pgs. Shriimadand-ubhaashhyama~ faskikyulasa~ 5. Shriishriivallabhaachaara~yaa.. 1952. 1923.. Shriisvachchhandatantrama~ Bhaaga 5... Theology. 350 pgs. Theology. 112 pgs. 110 pgs. Religion. Sanskrit. History. Shriiqs-emaraaja. Literature. 1931.. 1933. 324 pgs.. 1953. Shriipaarameshrvarasan'hitaa...... Govindaachaara~ya.. Shriimadgand-oshagiita. 1905. 1906. Sanskrit.. Religion. Religion. Religion. Theology. 1933. 110 pgs.. Philosophy.. Paand-d'eyena Raamateja. Vallabhaachaara~yaa Shriishrii. Vallabhaachaara~yaa Shriishrii. Theology. 1921. Psychology. Sanskrit... 1939. Sanskrit. Shriimadand-ubhaashhyama~ Faskikyulasa~ 14. Shriimadand-ubhashhyama~ Da~tiiyo Bhaaga Baalabodhinii. Philosophy... 639 pgs. 1930.. Theology. Sanskrit. Psychology. 165 pgs. Psychology. Religion. 1906. Aapat'e Hari Naaraayand-a. Qs-emaraaja. Religion... 112 pgs. Shriisvachchhandatantrama~ Dditiiyo Bhaaga Grantha 38. Shriisayaajiigauravagran'tha. 1963. 1935. Shriivaalmiikimahaamuni Aadikavi. Sanskrit. Shaastrii Pi Pi Subrahmand-ya. 102 pgs. 874 pgs.. 700 pgs. Shriishivabhaarayama~. 1875. Psychology.... Baapat'ashaastrii Vishhnd-uvaamana... Theology.. 138 pgs. Paramaananda. 297 pgs.org/…/SanskritIIIT. 377 pgs. Psychology. Sanskrit.. Language. Shriimadbhagavadagiitaa Trxtiiye Khand-d'a Grantha 34. Biography. Shriimanmahaabhaaratama~ Prathamo Bhaaga..... 1926... Sanskrit. Sanskrit.. 1936. Theology. 110 pgs. Philosophy. 110 pgs. Philosophy. 626 pgs. Philosophy. 1953. Religion. Qs-emaraaja~. Sanskrit. Sanskrit. Upaadhyaaya Shrii Baladeva. 483 pgs. 1905. Linguistics. Social Sciences. Psychology. Shriimadand-ubhaashhyama~ Faskikyulasa~ 6.. 1906. Psychology. Shriimadand-ubhaashhyama~ Faskikyulasa~ 12. 1906. Sanskrit. Aapat'e Vinaayaka Gand-esha. Sanskrit. Shriishivabhaarata. Philosophy..

290 pgs. Gupta Abhinava. Philosophy. Theology. Shriiraamabhadradiiqs-itaa.. Shrutikalpalata. Sanskrit. 1924. Shriramanageetha. Philosophy.. 282 pgs. Aachara~ya Maaheshvaraa. Shukasaptati.. Sanskrit. 1912. Shrutisaarasamuddharand-ama~. Gupta Abhinava. 1931. Shriisvachchhandatantrama~ Trxtiiyo Bhaaga Grantha 44. Sanskrit... Sanskrit. 93 pgs.. Guptaa Abhinava. History. Sanskrit. Theology. 161 pgs.. Mulkaraj Sharma. 1936. 1940.. Unknown. K. Religion.. Sanskrit.. 1935. 1938. 111 pgs. Unknown. Theology.. 279 pgs. 1926. Religion. Sanskrit. Gupta Abhinava. Gupta Abhinava..org/…/SanskritIIIT... 185 pgs. Shriitantraalokah Shhashht'ho Bhaaga.. 1922. 1921. Shriitantraalokah Chatura~tho Bhaaga. Psychology.2/14/2011 A list of scanned Sanskrit books at III… Shriisvachchhandatantrama~ Grantha 31..… Shukla Yajura~vediiya Kaand-va San'hitaa Saantabalekara Vasantashriipaada Religion Theology 57/167 .. Theology. Aachara~ya Mahaamaaheshvara.. Literature. 280 pgs. Shriitantraloka Dvadasho Bhaaga. Pandit Ramachandra Shastri Kinjawadekar. Shrii Mumbayyaam.. Religion. Gupta Abhinava. Sanskrit... 78 pgs. Sanskrit. Jeevanrama Lallurama.. Theology. Religion.. Gupta Abhinava. Religion.. 844 pgs. Sanskrit. 262 pgs. 232 pgs. Unknown. Shastri. 1946. Gupta Abhinava. Sanskrit. Shriitantraalokah Bhaaga 2. Shriitantraaloka Navamo Bhaaga.. Unknown. Sanskrit. 1910. Sanskrit. Theology. Qs-emaaraaja Shrii. Sanskrit. 1938. Theology. 105 pgs.. Religion... Aachara~ya Maaheshvara. Shriitantraaloka. 177 pgs.. Abhinavaaguptaa. 304 pgs. Theology. Shriivaasishht'adhara~mashaastrama~. Niranjananda Swamy. Religion.. Theology.. 287 pgs.. 1927. Sanskrit. Religion.. Theology. Geography. 1922..... Sanskrit. Sanskrit. Shriisvachchhandatantrama~ Shhashht'ho Bhaaga. Theology. Sanskrit. 342 pgs. 1930. 340 pgs... Sanskrit. Language. Sanskrit. 594 pgs. 300 pgs.. Shriitantraloka Saptamo Bhaaga.. Philosophy. Sanskrit. 1936. 93 pgs. Unknown. 1921. Shriivaasishht'hadhara~mashaastrama~. 1921. Dr Abhaya Nath Mishra. 1922.. Shrimad Bhagvad Geeta. Sanskrit.. Biography. 237 pgs. Religion. Theology. Religion. Sanskrit.. Shrxn'gaaraa Prakaasha Prathamo Bhaaga Grantha 1... Shriitantralokah Panj-chamo Bhaaga. Religion.. sanskritdocuments. Raaghavana Vi. Shriitantraalokah Ashht'amo Bhaaga. 301 pgs. Shriman Mahabharatam Part 4 7 Dronaparvan.. 1922.. Theology. Religion. Shubh Santhathi Yogaprakasha. 1984. 287 pgs. Sanskrit. Ant'ona~fuha~rera~. Shriisvachchhandatantrama~ Grantha 48. Linguistics.. Gupta Abhinava. 321 pgs. Unknown. 370 pgs. Shriitantraaloka Chatura~tha Bhaaga. Chaara~ya Madaabhinava. Sanskrit. 2001. 1930.. Theology. Religion. 1956.. 548 pgs. 1926. Religion. Theology. Theology.. Religion. Sanskrit. Sanskrit. Sanskrit.. 1926. 1975. Sanskrit. Aloiisa~ Ant'ona~ fuha~rera~. Srimadvaman Pandith Virchita. Ram Prasad. Shriitantralokah Navamo Bhaaga. Shriitantraaloka Ashht'amo Bhaaga Grantha 47. 351 pgs.. Shrimad Bhagawatam. 1930.. Religion. Theology. Religion. Chara~yaa Tot'akaa. Religion. 262 pgs. Shrotriyas Of Mithila. Theology.. Shrxng-gaaratilakama~ Da~vitiiya Vrxtti..

1991. Sanskrit. . Shukla Ysjuhu Shskeysksrams kanda Pradeepa. sanskritdocuments. Sanskrit. Chandra Sekhara.. Sanskrit. Sanskrit.. Unknown.. Sisupalavadham. Language. 317 pgs. Siddanta Muktavali Dinakari Ramarudra.. M. 1962. Anantha Charya. Diiqs-ita Bhat't'o.. 1916.. 942 pgs.kesavarao Musalgaonkara.s. Sanskrit. History. Theology.2/14/2011 A list of scanned Sanskrit books at III… Shukla Yajura vediiya Kaand va San hitaa. 1916. Sanskrit. 1929. 166 pgs. 1005 pgs. Siddantakaumadyam.. Sanskrit. Unknown. Sanskrit. -. 404 pgs. 235 pgs. Sanskrit. kumudranjan ray. 1937... Literature. Sanskrit. Diiqs-ita Shriibhat't'oji. Siddhaantakaumudii.. Siddanta Chandrika. 2002.bhatt. Msk Shasthri. Language... Unknown. 679 pgs. Indian Astrology. Siddhanta Tatva Viveka Of Sri Kamalakara Bhatta. Sidghnithryam. 0.. Jagannatha Shastri. 215 pgs. 0. Literature . Sinjiniyam. Siddantha Sidda Gnanam. Siddhanta Siddhanjana. Sindhi Jaina Granthamala. Biography. Sanskrit.. Sri Vallabhacharya. Sanskrit.. Sanskrit. Philosophy. Sanskrit.. Siddhanta Kaumudi Or Bhattoji Dikshit S Vritti On Paninis Vyakarana Sutras. 416 pgs. 0. Sri Anantaviryacharya. 1906.. 1862... Sanskrit. Dr D Arkasomayaji. Vedanta. Sanskrit. 1998. 1937.. Unknown. Dr. Sanskrit.shastri... Sanskrit. Sanskrit Grammer. Literature. Unknown. Sanskrit.. Sanskrit. Yudishtara Mimamsak. 234 pgs. 1893. Shvetashvataropanishad.org/…/SanskritIIIT. Siddhanth Kaumudhi. 96 pgs... Unknown.. Jagannatha Shastri. M.. 1929. Theology..venkata Rao. Linguistics.5... A C Subbukrishna Srowthy. 155 pgs. Language. 1959. .. Pt. Siddhitrayi And Prthyabhijna Karika Vritti.. Sidhdaantamuktaavalii. 142 pgs.. . 142 pgs.g. 40 pgs. Bahadur Simhaji Sindi. Sanskrit. Philosophy. Language..h. 1980. Siddhivinishchayatika. 1877. Shukraachaara~yaa Shriimada~. Language.. Sanskrit. Unknown. Psychology.. Siksha Sutrani. 134 pgs. Linguistics. Linguistics. Sidhanthkalpavalli. 580 pgs. 434 pgs. 534 pgs. Diqs-ita Appayya. Linguistics. Shukraniiti. 235 pgs. 690 pgs. 1921. 1997. 2002. 1925.. 112 pgs.sri Sudhakara Dvivedi.. 1910. Sri Chandiprasadshuklashastrina. Unknown..… 58/167 .... 249 pgs. Bhat't'aachaara~yaa Jiivaananda Vidhaasaagara. Technology. Siddhanta Kaumudi Vol 3 Part 1. 1219 pgs. 360 pgs. Literature. Geography... Sanskrit. 325 pgs. T. 130 pgs. Unknown. wasudev laxman sastri pansikar. Religion. Religion. Sanskrit. 932 pgs. Unknown. G. Shulkayaju Praatishaakhyama~ Dditiiya San'skarand-a. Bhat't'oji Diksita. Siddhaantalesha San'graha Bhaaga 2. Sanskrit. Sanskrit.. 1949. 1990... Sanskrit.. Sibrasutra Nrubhatrayam. 1942. 1938. Sanskrit. Siddhanta Kaumudi.. 565 pgs.. 1960... Philosophy. Philosophy.. Literature.. Philosophy.... Siddhaanta Kaumudii Trxtiiyo Bhaaga Grantha Maalaa 136.. Sanskrit. .. Sanskrit. 0. Sri Ramasram. Philosophy. Siddhanta Kaumudii Bhaaga 2.. 0. Siddanta Siromani Of Bhaskaracharya. 1499 pgs. 474 pgs. Saantabalekara Vasantashriipaada. Sanskrit.. Siddhanta Rahasyam. Linguistics. Pan'chaananabhat't'aachaara~ya Shriivishvanaatha.. Literature.

. 198 pgs. Sivadvaita Nirnaya. 156 pgs. Smritichandrika Ahnika Kanda. Smrxti Chandrikaa Khand-d'a 3 Dditiiyaa Bhaaga. krishna Das. Skanda Purana Part Ii. Sanskrit.… 59/167 . 379 pgs. 1912. Unknown. 1914. Linguistics. Theology.. . Nag Sharan Singh. Unknown.. Theology. Skanda Mahapuranam Nagara Kanda. Literature. Sanskrit. Language. Sanskrit. Sanskrit. sanskritdocuments. 410 pgs... Smrxtichandrikaa Samskaarakaand-d'ah Prathamah. Sitaramaviharakavyam Of Orient Laksmanadhvari. Religion. devana bhatta. Sreenivasacharya. 1965. Language. Smrutyartha Sagara. Appayya Diksita. Smrxti Sandara~bha Trxtiiyo Bhaaga.. Dharaachaara~ya.. 119 pgs. A B L Awasthi. Somraj Krishna Das. Literature. Sanskrit. 1875. Sanskrit. 328 pgs. Gand-apatin' Naathaadigurutrayan. Unknown.. Smrxti Chandrikaa Shraaddha Kaand-d'a. 437 pgs. Skanda Purana Kasi Kanda. Unknown.. Sanskrit. Smrxti Chandrikaa. 1949. Skanda Purana Avantya Kanda Vol7. D. Religion.. Smriti Chandrika Sraddhakanda.g. Religion.. Smavadamala. Sanskrit.. Skanda Puranam Brahma Khanda. 1978. Philosophy. Smritichandrika.. Smritichandrika Iii Vyavahara Kanda Part I. .. 1966.. Narasimhachar. Sanskrit.. 478 pgs. krishna Das. Religion. Sotara Siddhanth Kaumudi Prayogsoochi Vol Iii. 412 pgs.. Sanskrit. . 0. Unknown. Sreenivasacharya. Literature. Linguistics. Language. Sanskrit. Theology. Sanskrit. 1965.. 423 pgs. 1905.. 0. Sanskrit. L... Smrityartha Sarah. 661 pgs.. Sanskrit. 375 pgs. Philosophy.org/…/SanskritIIIT. .srinivasacharya. Smrxtyara~thasaara Grantha 70.. 0. Bhat't'opaadyayaa Shriiyaajnikadevand-a~. 252 pgs. R. Sanskrit. .. 1899. Smritichandrika. 1914... Hari Narayana.. 673 pgs. Smritichandrika Part Ii. Skanda Mahapuranam Vaishnava Khanda.. 470 pgs.. Skanda Mahapuranam Vol Iii. Bhat't'aa Devaanaa.. Sanskrit. Sanskrit. 122 pgs. .. Philosophy. Sanskrit. 1921.. Unknown. 1982. Srimadananda Theertha. Sanskrit... Sanskrit. Unknown. Linguistics.. Sanskrit. 1914. Literature. Bhat't'aa Devand-a. 787 pgs. Skanda Purana Volume 1 Index.. Sanskrit. 336 pgs. Sanskrit. Theology. Sanskrit... 1912.k. Theology. 502 pgs.. Religion. . Smruthi Chandrika. 474 pgs.. 1952. 262 pgs. Linguistics. 1918.2/14/2011 A list of scanned Sanskrit books at III… Sita Ravana Samvada Jhare.. Sanskrit. Sanskrit. 486 pgs. Bhat't'a Devand-a. . Religion.. L. Sanskrit. 1916.. Language.. Unknown. ... 102 pgs.. 0.. Theology.. Sanskrit.... 334 pgs. Skanda Purana. 1959... 179 pgs. 1914. Devana Bhatta. Aapat'e Hari Naaraayand-a.padhya. Pandith Sri Ramchandra Jha. A Ramachandra Ratnaparakhi. Philosophy.. Somraj Krishna Das.. Bhat't'aa Devaanaa. 1914.. 1916. Theology. Religion. 170 pgs. Religion. 144 pgs. Art. Sanskrit.. Sanskrit. 301 pgs. 1916. 480 pgs. Smrxti Chandrikaa Prathama Bhaaga. 232 pgs. L. 1966...k. 1929. Smrxtiinaan' Samychchaya Grantha 48.. 1962. Social Sciences. Sanskrit. devana bhatta. 944 pgs. 1918..

Srauta Prayascitta Vidhi. Sanskrit. Unknown. 1948. 110 pgs. Sanskrit... Sradha Martanda. A Ramulu. g somayaji. . 0. Sri Bajothsav Chandrika. Sr Madradbagavathgeetha. Sri Ath Madhvanidaanvishayanukramnika.. Sanskrit.. Sanskrit. 1907. Unknown. 110 pgs. Sri Bashyam. 372 pgs. Sanskrit.. 1917. Sree Lakshminarayan Samhitha.. Sanskrit. 130 pgs. . Sramana Bhagavan Mahavira Vol 1 Part 1... Unknown. Raghunatha Patak. 0. Vedanta. 682 pgs. Spanda Sandoha Of Kshemaraja. Pandith Sri Ramchandra Jha. 1992. 46 pgs.... 46 pgs.. Linguistics Literature.. Sanskrit. 580 pgs. Muni Ratna Prabha Vijaya. Sanskrit Mimansa.. Sree Mrgendra Tantram. 158 pgs.org/…/SanskritIIIT. Sri Ascharyachudamani. . . 1956. Sotthara Prashnavali Vol I. Sanskrit. 1989. Unknown. Sri Sundaracharya. Sphot'asiddhi Grantha 6. Unknown.. Sri Bagavathgeetha.. Linguistics Literature. Sri Bashya Vimarsana Pariksha. 1065 pgs. Sanskrit. Literature. V Krishnamacharya. 0.. Sphutartha Abhidarmakovyakhya. 598 pgs. 0.. S Kuppuswami Sastri. Madhusudan Kaul. Sanskrit. Sanskrit. Unknown. Sri Krishna Das. V. 166 pgs. 0. 1946. Sri Ramachandr Jha. 416 pgs.. -. Literature.. 341 pgs.. Swamy Vishnu Thirdha. Krishnamacharya. 142 pgs. 490 pgs. Sanskrit. Language.. 1956. Literature.. Sanskrit. Sanskrit. Unknown... 0. Southara Prasnavali. Unknown. Unknown. . Sanskrit. 1927.. Sphotavada.. Unknown.. Southara Pradhama Prasnavali.. Language. . Unknown.. 244 pgs. S Levi... Linguistics. 0. sanskritdocuments. Linguistics Literature. Unknown. Sanskrit. Psychology. Govindacharya. 1952.. Linguistics. Sree Skande Mahapurane Panchama Avanthyakhandye. 188 pgs.. Unknown. 225 pgs. Mishra Aachara~ya Mand-d'ana. -.. Unknown.. Sanskrit. Sanskrit. 1919. Sanskrit. Soundarya Lahari. Naageshabhat't'a. Sraddha Marthandam. 439 pgs. Unknown. 1997. Sakthism. 1927. 270 pgs. Unknown.. Sri Bashya Vartikam.. Spota Darsana. Swamy Sri Krishnavallabha Charya.. 1927. 1931. Vallabhacharya. 234 pgs. 1930... Philosophy. Sri Acaranga Sutram Part3.. Unknown. Sanskrit. 0. Linguistics..... Unknown. 1956. 0. Literature. 1949. Sanskrit. Madhusudanacharya. Ramayanam. 40 pgs. Mahamahopadhyaya Pandit Mukunda Rama Shastri. 108 pgs.. Sanskrit.. 0... Sanskrit. 701 pgs. 0. 1933... Unknown. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Unknown. Unknown. Sanskrit. Sri Bashya Vimarsana Pariksha. 214 pgs. Sree Madbhagavathgeetha.… 60/167 .... Unknown. Sanskrit. pgs... Soundarnand Mahakavy. 0. Sri Anubhashyam. 126 pgs. 258 pgs. 0. Sanskrit. Unknown. Sanskrit. Sphotavada Of Nagesa Bhatta. Sree Subhodhini...... 0.. 220 pgs. Sanskrit. Sanskrit. Sphot'avaada..2/14/2011 A list of scanned Sanskrit books at III… Sothara Prashnavali Dwithiya Kandamu. Krishnananda Natha.. Sril Narayan Bhattagoswami.. 1946. 374 pgs. Ramdin.. 1887. Krishna Datta Shastrin... Sradda Viveka. 136 pgs.. 163 pgs. Sanskrit. Language. Sanskrit. Sri Bashya Vimarsana Pariksha. Sri Ramachandra Jha. 194 pgs. 1946. 392 pgs.

Srivasudevanandsaraswathikruthm. 408 pgs. 228 pgs... . Sri Dommraj Narsinghraj.. Sri Brahma Sutriya Vedanta Vrtti. Sri Daandeepika.. Unknown. 2000. History. 616 pgs. Unknown. Unknown. Sanskrit. Chakravarthy Acharya Swamy U V P M. M.. Swami Jagadisvarananda.. 580 pgs. Unknown. 0. 694 pgs. Pandith Jwala Prasadji Mishra. Sri Gurugovind Singh Bhagvat Padh Jeevnetivratham.. Sanskrit.. Sri Vasudevanandsarawathiswamikrutha. Sri Fakkikartanmanjusha Vol I. Sanskrit. Sri Devipuja Kalpa. Sanskrit. 569 pgs. 886 pgs... Sanskrit.. Linguistics Literature. Sanskrit. 504 pgs. Unknown.. Narayana Bhatta Goswamy. Unknown. Sri Brahnidhanturatnakar Vol Iv. Sri Datta Puranamu. Sanskrit. 536 pgs. Sri Jayapura Raja Vamsyavali.. Sri Bhava Prakasa.org/…/SanskritIIIT. Vasudeva Vidyabhushan. Sanskrit.. Acharya V R. Unknown. Sanskrit.. Sri Brahmasutrani. 1930. Pandith Duttram. Sanskrit.. Sri Bhavaprakasa Of Bhavamisra. Sri Hikmath Prakasha.. Sri Vasudeva Nandasaraswathi Tembeswami. Sri Bhattikavyam. Badhiri Das. 1943. 1237 pgs.. Sri Brajotsava Chandrika. Sanskrit. Swami Sri Raghuvaracharya.. Sanskrit. Unknown. 1947. Sanskrit. Sri Bhavishya Mahapurana... 1942.. 532 pgs. 154 pgs. Sri Bhasya Sariraka Mimamsa Bhasya Vol I. Literature. 202 pgs. V. Sri Jathi Bhaskar... Geography. Unknown. Sanskrit... Sri Devi Poojakalp.. 0.. Unknown. 0. Somraj Krishna Das. 1935. Philosophy. 1954. Unknown.. 1867. Sanskrit. Sanskrit. 242 pgs. 1958... 334 pgs.. Sanskrit.. Sanskrit.. Sri Bhasya Vol I. Khem Raj Krishna das.. Sanskrit. Language. 128 pgs.. Sanskrit.ranganadhacharya. 473 pgs. 1939.. Unknown. Sri Harithsanhita. 1955. Sanskrit... 1970. Sri Geetha Jnanmarg. Sri Yashodanandanayen.. 1935. Sanskrit. 506 pgs. Ramanatha Nanda Sarma. 294 pgs.… 61/167 . Sanskrit. 70 pgs. Unknown. Grammer. Sri Bhasya Or Brahmasutrabhasya Vol Ii. 1966. Sri Durga Saptasati.. 252 pgs.ananthchary.. Biography. 1938... -. 128 pgs.. 624 pgs. Theology.. Sri Gurusanhita. Sanskrit. Sri Brahtstotraratnakar. Srikanth Sharma. Pandith Sri Sudama Mishra. Sanskrit.. 0. Unknown. Linguistics. sanskritdocuments. 243 pgs. Sri Ranga Ramanuja Charya. Linguistics Literature. Sri Gurucharitam Vol 2. Shes Raj Sharma. 0.. Sri Bhasya Mahapuranam. 1941. Sanskrit. Pandit V. Unknown. Unknown. 1954. Philosophy. Sri Bhrthurisubhashitam Vairagya Shatak. 362 pgs. Unknown. Sanskrit. 588 pgs. Sri Geethardha Prabodh... Unknown. Sanskrit. . Pandith Sri Kankalalasharma Thakur. Unknown. 22 pgs. Sri Bhagavata Dashamaskandha part.. Venkat Rao Raysam. Unknown.. 1953.. 1960. Sanskrit... . 569 pgs.. Unknown... Bhavamisra.. Unknown. Sanskrit. 268 pgs. 290 pgs. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Sri Bashyam. Sri Chaitanayalilamratsar. 1910. 538 pgs.. 1950.ananthacharya. Sri Ramanuja. 1962. Sanskrit. 1954...ityanen. Sri Bhasya Or Bhramasutrabhasya Vol 3. Religion. 1240 pgs. Khem Raj Krishnadas . 1953. Sanskrit.. 312 pgs. 1917. 2000. 1938.. sribhavamisra.. 1993. Sri Mahadev. Unknown..

.. . 252 pgs. 306 pgs. . Sri Mad Bagavadgeeta Sri Mahabharath Antargath. . 145 pgs. 784 pgs.. Sri Laghu Siddhanth Kaumudi. 151 pgs.. Sanskrit. 1956. 1976.. Sanskrit.. Ganga Vishnu Sri Krishna das. 353 pgs. 1976. Theology.. 1957. 855 pgs.. Sri Madhevibhagavatam Mahapuranam.. 283 pgs. 262 pgs. Literature. Sri Mad Bhagavatam Trutiya Kandam. Sri Madbhagavad Gita Sri Mahabharathantargath. Unknown. 0.. Sanskrit. Sri Laksminarayanasamhita Vol... Unknown. 0. 393 pgs. Language..... Linguistics... Sanskrit. Sri Laghu Bhasyam. 0. Sri Krishna Janmaskanda. Sri Mad Bhagavad Gita. S Vshwanathan.. . Unknown.b.. sanskritdocuments... Unknown. 1953. . Sri Madbhagavathe Prathamaskandhaha.. 1956.. Sri Mad Bhagvadgeeta. 792 pgs.. Sri Ramanuj Bhasyen. Sanskrit.. Unknown... Sri Madbagavath Sridaritika. 1985. 246 pgs. Unknown. Chintamani Gangadhar Bhanu.1. Sanskrit. Unknown. 192 pgs. Sanskrit.… 62/167 . Sanskrit.. Language. Somraj Krishna Das. . Linguistics.. 0. Dr. Swami Srikrisna Vallabhacharya Shastri. 1971. 0. Sanskrit. 515 pgs. 1985... Sanskrit. 0. Sanskrit. Pandith Sri Shobhakanth Jha... Sanskrit. 468 pgs.. Sanskrit.. 412 pgs. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… Sri Kanta Charitam Of Munkhaka. 0. Sri Madhandra Maha Bhagawatakathah. 1963. Sanskrit. Sri Madbhagavatham Vol 7. Shivnarayan Shastrina. Sri Laxminarayana Samhitha Of Sri Svetayana Vyasa Vol 1 Part 2.raghunathacharya. Unknown. 802 pgs.org/…/SanskritIIIT.. Sanskrit. 1976. ..s. Sri Karbhashyam Vol.. Sanskrit. -.. Sanskrit.. Sanskrit. 362 pgs. G Laxmikanthaiah. 422 pgs. . 1164 pgs. . Sanskrit. 578 pgs. Pandit Ramtejpandeyan. Sri Mad Bhagavatam Ashtamaskanda. 0. 0. 352 pgs. 1972. Sri Madhusudhan Sharma Maithli. 384 pgs. 1921... Sri Madbhagvadgeeta.. 546 pgs. Literature.. Dr. Unknown. 1957. 1956. 1567 pgs. Unknown. Mahakavi Sridhara Acharya Virchit... Sanskrit.... Sanskrit. Sri Madbhagvathgeethaya Vigyanbhashyam. . Sanskrit. 0.. Sri Madbhagavathy Thiruthiya Skandhaha. Unknown. 278 pgs. Literature. Sri Kavyardash. 466 pgs. 0. 0. 845 pgs. Sri Raghunath. Linguistics.. Unknown. Sri Madbhagavathy Panchama Scanda. Sri Chidirematiyeveerchandrasharma.. Sanskrit. Srimannarayanramanujjeeyswamini. Language.I V. Sanskrit. Sri Ramanujbhasyen. Unknown. Sanskrit. Sri Laghu Bhasyamu.. Unknown. Sanskrit. Jona Raja. . ..sankaranarayanan. Linguistics.. Khemraj Krishnadas. Unknown. Abhinava Gupta. . Literature. Sanskrit... Literature.. Sri Madbhagavadgita Gitarthasangraha Of Abhinava Gupta. Unknown. Sri Kavyadarsa Of Dandin Edition Iii... Swami Vireshwarananda. Unknown. 0... Sri Mad Bhagavatam.. Sanskrit. 0. Sri Madbhagavatam Pradama To Dvadasakandaha Full With Sanskrit. Sanskrit. 383 pgs. 746 pgs. 0. Unknown. Sri Laghushabdendulkala. 415 pgs. Religion. Sri Maaliniivijaya Varttikam. 122 pgs. Swami Srikrsnavalla Bhacarya Shastri. Sanskrit.. Sanskrit. Sri Madbhagavatham Vol 5. Sanskrit. Sri Lalthasahasranama. . 854 pgs. 1976. Unknown. Sri Madbhagavathe Akadhasaskandhaha. Unknown. .. 1971. Language. 1957.

Unknown. Sri Natakatha Sangraha Abridge Stories Of Sanskrit Dramas.. . Unknown. 1987. Sri Nyayamrutha Kaladharaha. Pandit Madhusudan Kaul Shastri.. 370 pgs.. Sri Madhvas Tattva Vada. Sri Nimbarkvrathnirnay. Sri Madvalmiki Ramayanam Vol.. 0. 334 pgs. Literature. 94 pgs. Sri Thulasi Das. T. Sri Manoramashshabdartan Prashnouttarvali Part I I. 0.. Religion Theology. Unknown. Sanskrit... Jai Krishna Das Haridas Gupt. Sanskrit. Linguistics. Sri Madwasiddantasarasangraha. Sanskrit.. . Sanskrit.. 780 pgs. 1950. 0.. Sanskrit. sanskritdocuments. Unknown. 0.. 148 pgs. 540 pgs. 900 pgs. 1968. Sri Rajnarayan Shastry. 130 pgs. Unknown.r. Unknown. Sanskrit. Hariprasad Bhagirathi Ityesham.. Unknown. Religion.. Anandtheertha Bhagavatpadacharya. Unknown.org/…/SanskritIIIT. Yoganarasimha. K Ramachandra Shastri. 328 pgs. Sanskrit. Theology. Unknown. Language.. 1922.. Religion... 1948. Sri Madhvacharya Brahmasutra Bhasya Vol Iii. Unknown. Pandit V Ananta Charya. Ganaga Vishnu Sri Krishnadas. 665 pgs. Sri Nirnaysindhu. 1366 pgs. Unknown. 1322 pgs. 1944. 1907.. Religion. Sanskrit. 82 pgs. 498 pgs. 0. Sanskrit. 1985. Sri Madvalmiki Ramayanam Vol. Unknown.I I I. Sanskrit. 1940. 1867. 1948.. Sri Manoramashabdaratn Prashnouttarwali Vol I.. Unknown. Sanskrit. 572 pgs... Sanskrit. Sri Malavikagnimitra Of Kalidasa. Language... Sri Madramayanmimamsa. . Sanskrit. Unknown. Sanskrit... Sri Mahabharatham Shanthi Parvan. Ganga Vishnu Sri Krishna Das.. 0. 0. Sri Mahabharatha Tathparyyanirnaya Satikas. Sri Nilakanta Bashyam. 0. Unknown... Religion. 816 pgs. 1955. Sanskrit. 0. 43 pgs. . Sri Manmaharaj Sanskrit Mahapatashala Patrika. P P S Sastri.. T R Krishnacharaya.. Pandith Shivdutten. 288 pgs. Dattavathari Sri Manik Prabhu Yanche.2/14/2011 A list of scanned Sanskrit books at III… Sri Madhragra Sanhitha. Sanskrit. Sri Man Mahabharatam. 368 pgs.. Sri Malinivijaya Varttikam. Linguistics. .. Sanskrit... 240 pgs. Unknown. Sanskrit. 939 pgs. Language. Sri Markandeyapuranam. 259 pgs. . 956 pgs.. Sri Madvalmiki Ramayan Vol I..I. Language. Religion. Sanskrit.. 1992. 98 pgs... Sanskrit. 1043 pgs.. 1922. Sanskrit. Ganagavishnu Sri Krishnadas.. C Sankara Rama Sastri..krishnacharya. 1992.. . 459 pgs. Pandut Madhusudan Kaul Shastri. Sri Nilakanta Bagavathpada. Sri Madhwa Mantrartha Manjari Of Vaishwanathi Narayanacharya. Vedavyasachar. Unknown. Sri Maha Bhagavatam. Literature. Sri Madvalmikiramayaname Sundharakandam.. Sanskrit. 1994.. Dr Malladi Gopal Krishna Sharma. Literature. Sri Mani Charithamruth. Sri Manmanas Namavandana. 1995. 0. Sanskrit. Sri Malinivijayottara Tantram Vol Xxxvii. 0. Sri Mannyayasudha Prarambha. 1935. 534 pgs... 402 pgs.. Sanskrit... Sri Mahabharatham Ashravmedhikparv Vol X V I I I.. T Srinivasacharya.… 63/167 . Sanskrit. 226 pgs. 1921. Sanskrit. Unknown.. . Nalachakravarthy K... Sanskrit.. Sanskrit. Sanskrit. 215 pgs.... Sanskrit. Literature. Linguistics.. Linguistics.

47 pgs. 0. Sanskrit. Sri Paninivyakarne Vadartanam Vol I. Sanskrit.. V.. Sanskrit. Subramania Sastri. 500 pgs.. Unknown. 416 pgs. Sanskrit. P Srirama Chandrudu. Unknown.c. Sri Sarvasiddhantasarasara Vivechanam. Unknown.. Literature... Literature. Sri Saaraswatham. Narasimha Charya A. Sri Ramanujas Theory Of Knowledge.. Language. Sanskrit.. 2000... Sanskrit. 1954. Sri Parasara Bhatta's Sri Ranagarajasta .Upanishadvani. 1965. 818 pgs. Pandith Surya Narayan Shukla. Philosophy. Literature. 0. Language.. Sri Valmiki Mahamuni. Literature.. Sri Paribhashendu Shekar.. Acharya Pandit Sri Sotharam Chaturvedhi. 1976. 81 pgs. Sanskrit. Sanskrit. 230 pgs.Vol 2. Vedanta.. Madhvacharya Gangur. Ram Balak Shastri. 1920. Religion. Sri Paramahamsah. Sri Ramanuja Campu. M. Unknown.. Theology. History. 0. 1956. Sri Shabdharthchintamani Kosh I Vol I I I. ... Rambalashastri. Sanskrit. Sanskrit. Sanskrit. 0. 1954.. -. Pandith Sri Ramchandra Jha. Geography.... Unknown. 232 pgs... Unknown. Sri. 600 pgs. Sri Ramayanamu Pradhama Khandamu Balakhandamu.. Sri Sanskruthalok Vol I I I. Sanskrit. Sri Sankara Grandhavali Upanishadvani..org/…/SanskritIIIT. 394 pgs. Prabhakara Rao M. Sri Sankara Vijaya Makaranda.... Sanskrit.. 382 pgs. Sri Sarvamoola Granthah Of Sri Anandatirtha Bhagavatpadacharya I. 656 pgs... Sri Raghuvamsam Pakyanam. Literature. 635 pgs. Sanskrit. Linguistics.. Sri Nyayasudhatipani Srinivasathirthavirachita Prarambyathe... 2001.. Sanskrit. 1987.. Pandit Sri Mayaram Sangrahit. 1933.... Sanskrit. 1952. Sanskrit. 1988.. Dhinanathasharma. Sri Sukhanandnathen. 1999...varadachari. Sanskrit. 1661. Language.. Not Available.. Sanskrit. 570 pgs... 242 pgs. Sanskrit. Biography.. Sanskrit. Sanskrit. Unknown. Sri Sanskrithalok Vol I I. . 128 pgs. -. Unknown.. 0. Sri Ramayan Valmikiye Ayodhyakand.. Unknown. Tirumazisai Alwar. Sri Sathpurush Charitra Prakash. Sanskrit. 160 pgs.. Unknown. 0. Linguistics. sanskritdocuments. 558 pgs.. 0. Unknown. Sanskrit. Sri Rama Sahasra Namastotram Sri Tyagaraja Nama Stotram And Namavali. Unknown. Unknown. 533 pgs. Sanskrit. Unknown.. Unknown. . Sanskrit. Sri Sanatana Dharma Lokaha Part Iv. Sri Raga Ratnakar Tatha. Teekadutt Dhikal. 1661. Religion. Literature.2/14/2011 A list of scanned Sanskrit books at III… Sri Nyayasudhatipani. 1998. 70 pgs. Sharma V A. 1942.. Sri Madnubhutiswarupacharyapranitham. Krishnamacharya V. Sanskrit. Vijayeendrateertha. 0. Sanskrit. 86 pgs. 0.. Pandith Sri Ramchandrabhakt. Unknown. 378 pgs.… 64/167 . Unknown.. Sri Pithrakarm Nirnay. Sri Sankara Grandhavali . 1949. Sri Satika Threemuthrrasagara Nam. 88 pgs. K. Sanskrit. Sri Paribhasendushekhara.. 724 pgs. Linguistics. 1980. 235 pgs... 210 pgs. Sanskrit.. 592 pgs. Sanskrit. 605 pgs. 1054 pgs. 1978. K Srikrishna Das. 1958. pgs. 0. Sri Sahityanushasanam. 100 pgs.. 52 pgs. Sri Sandhichandrika.. . Dvaita Philosophy. Theology. Literature.. P Sri Rama Chandrudu. Sri Sareeraka Meemansa Bashya. Sri Rasayoga Satakam Part Ii. Unknown.

.. Sanskrit. Sri Srinivas Vilas Samskruth Kavyam. Sri Tukaram Charitra. 192 pgs. 406 pgs. Unknown. Dvaita Philosophy.. Sri Sri Chantayan Chandramurthy. Sri Shankatrashdarbhashyvimarsh. Religion. 728 pgs.. 0. 374 pgs.. Sanskrit. Sri Vayustuti. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Sri Shagdhara Pragadvitha. Sanskrit.. Sri Tantraloka Vi. 1963. 1867. Unknown. 78 pgs.. Sri Srimad Alankara Koasthubha Accn0 589. Sanskrit. 108 pgs. Sanskrit. Khem Raj Krishna Dasane. Unknown.. 1064 pgs. Unknown. Linguistics. Sanskrit.. Sri Sri Vishnu Purana. 1889.. Sri Subodhini. 210 pgs. 1947. -. Sri Srinivas Makhi Vedanth Deshike. Sanskrit. Acharya D V N.. 402 pgs. 1993. Sri Shivamahapuranam Vol Ii. 255 pgs. Sanskrit. 1979. Sri Sivagitabhashyam. Sri Siddhhemchandrashabdanushasanam.. Sanskrit. Sanskrit.. Language. 0.. Sri Siva Samhita. Goswamy Sri Krishnaiah Chautan. Sri Munilal Gupta. 0. Nrusimha Bharathi. Sri Sudarshana Shathakam. Sri Vallabhadigvijaya. Ganga Vishnu Sri Krishna das. Unknown. .. Sri Vaikhansagruhasutram. Tantras. 0.. Sri Sri Gandhi Katha.. Unknown.. Sri Valmiki Ramayanam Sundara Kandam. 696 pgs. Bellankondopnamkaramaraykavindren. Unknown.. Sanskrit. Kulkarni G V..… 65/167 . Unknown. Sanskrit. 610 pgs. Philosophy. Theology.. Religion. 804 pgs.. G H Bhatt. 1998. Unknown. Haridas Shastri. ... 0. Sanskrit. Sanskrit.. Unknown. Sri Sita Ramayanam. Pandit Taradatta Panth. Sanskrit. Unknown. Unknown. Sanskrit. 0. Unknown. 216 pgs.. . Sanskrit. 355 pgs...... Sanskrit... Language. Literature. 1960. 82 pgs.. 0. Literature. Vedas.. Literature. 0. Unknown. 673 pgs. 1952. Sri Valmiki Ramayanam Ramabiramatikayitham.. Sanskrit. Sanskrit. Sri Srinivasamkhivedanth Deshike. 148 pgs. 1980. Unknown. Sanskrit. Sanskrit. 72 pgs. Unknown... 0. 1959.. Sri Skandamahapuranam Saptmaprabasakandam Prarambyathe. 418 pgs. Sri Vallabhacharya And His Doctrines.. Shri Madhava Charya. Sanskrit. 218 pgs. 1973.. 236 pgs. 423 pgs. 1985.. Sri Valmiki Ramayanam Mahabyas.. 1830 pgs.. 1889. Garikpati Laxmikanth. Sanskrit. Literature. 0. G Sri Yadunathaji Maharaj.. Late Prof. Sri Svathsvrutham Vol I.. Sanskrit. .. Dr Palle Poorna Pragnya Charya.. A S Mahaskar. Tiruvenkatacharyana. Sri Shaligramoshdhshabdh Sagar... 1996. Laxman Ranchandra Pangarkar. 1939.. Sanskrit. Unknown. Sanskrit... Chilukuri Ramabhadra Shastri... Sri Srishukadooth Mahakavyam. Dr Parama Hamsa Mishra. 1966. 1940. K Krishna Das. 545 pgs. 184 pgs. 112 pgs. Unknown. Sanskrit. Sreemuralidhar. 1985. Sri Suryacharit Mahakavyam. Sanskrit. Unknown. 262 pgs. Pandith Ramchandra Sharma.. sanskritdocuments.org/…/SanskritIIIT. 0. Lanka Sita Ramanshastrin. Sri Vaikhanasa Paitrumedhika Prayogaha. Sanskrit. Sri Vaikhansagruhasutram Vol Ii. Sri Srigandgiri Sri Jagadgur Charitra Sangraha.. 672 pgs. 660 pgs. 1116 pgs. . 1953. Maheshwar Shastry... Sri Veerkrishnavijay Mahakavyam.. 0. 108 pgs.... Unknown. Sanskrit.. Linguistics. Chandraji Goswami Mahodayan.

1959. 130 pgs. Bhagavadgita... Belvalkar S K.. M Ranganadhacharya. Unknown... 1974. Unknown. Sri Venkatachalammahatmayam Vol-i.. Religion.. 1867. 1959. 441 pgs. Sri Vishnu Dharmottara Mahapuranam. 846 pgs. 606 pgs. 1987. Sanskrit. Shri Math Srinivasa Parasmay Brahman. -. Unknown. Unknown. 1954. Srimad Bhagavad Gita. Sanskrit. 123 pgs. 208 pgs... 1959. 349 pgs.. 714 pgs. 1943. Sanskrit. Srilakshminaryanasamhita Of Sri Svetayana Vyasa Vol Iii. Sanskrit. Unknown. Sri Venkatachalam Mahatmay Vol Ii... 340 pgs. -.. Sanskrit. 1960. Unknown. Srimath Srinivasay Parasmay. 460 pgs. Srimadvallabhacharya.. 500 pgs. Literature.... Unknown.. Sri Ram Chandra Jha. Sri Vrindaranya Kshetramahatyam. Sri Venkatesa Kavya Kalpaha.. 1982. Religion.. -.... Sanskrit. Srimad Almiki Ramayanamu Thruthiya Bagamu... 1961. Sanskrit.I I.. 1973... Unknown. Sri Vyasa Panini Bhavanirnaya. Sri Viswanatha Shamran. Sri Vishnu Puranamu. Sri Venkatachala Mahathyam Dwithiya Bagam. Srimath Srinivasay Parasmay Brahman. Unknown. sanskritdocuments. Sanskrit. 510 pgs. Srima Brahmasutra Bashyam Part 3 2 Pada. Sri Yogtarangini. Unknown. 1959. Unknown.. 584 pgs. Religion. Sri Parashar Rammaharshi. 1000 pgs. 1953. Madhusudhanacharya... Sanskrit. S Sethumadhavacharya. 1930.. Sanskrit. 448 pgs. 1963. Unknown. Swami Bramahananda. 0....m. 0. Sri Venkatachala Mahathyam Pradhama Bagam.. 1926. 1959. Dr. Philosophy.. Srimath Srinivasay Parasmay Brahmane. Unknown. 1972. 0. 1915... Sri Venkatachalamahatyam. 1944. 1960. Sanskrit.… 66/167 . Dinker Vishnu Gokhale.org/…/SanskritIIIT.. ... Unknown. Srimath Srinivasay Parasmay Brahmaney.. Sanskrit. Unknown. Unknown.. Sanskrit. P. Srimad Bagavad Geetha. Sanskrit. Sriharshas Naishadha Darshanaparamsha. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… Sri Vemageeta Prathama Sahasram Part Ii. Unknown. 250 pgs. Unknown.. 0. -. Sanskrit. Sanskrit. Sri Venkatachala Mahathyamu.. Srikrsnavallabhacarya Sastri.jayaseeta Rama Sastry. Sri Krishna Das Sathmaj Gangavishnu. Sri Venkatachalam Mahatyam Vol I. Sanskrit. Gandham Sri Rama Murthy. Sanskrit. Somraj Krishna Das. Tatacharya D T.. 552 pgs.. 1941. Sanskrit. Unknown. Sanskrit. Sanskrit. Sri Venkatachalam Mahatyam Vol. Srimad Bagavathgeetha. Sanskrit. Tippal Samalad. 498 pgs. Sri Vidvadwibhooti. Sri Vimanacharya Kalpaha. 294 pgs.. Sri Venkatachalam Mahatmayam Vol I. 1960.. 202 pgs. Sanskrit. Sanskrit. Someswara Sharma Y. Sri Yogvashista Bhasha Vol I I. Sri Vichara Dipika. 105 pgs. Sanskrit. Srikhaudar Khanda Granth. 584 pgs. Unknown. Sri Vrath Raja. Unknown... Sanskrit.. 582 pgs. 578 pgs. -. 1993.. Sanskrit. 559 pgs. Unknown. Sanskrit. 280 pgs. Unknown. 0...vargranth Bhattacharya.. Sri Venakatachala Mahatyam.. 1959.. Sri Venkatachalam Mahatmay Vol I. Sanskrit. 276 pgs. 416 pgs. Sanskrit. Sri Prayoga Dasji. 360 pgs.. Ramlagna Pandey.. 1244 pgs. Unknown. 584 pgs.

Sanskrit. Srimadvallabhacharya. 0.. 1980. 1961. Hanumantha Rao K..… Srimadbhivishgarvgadadhartanyavadgnasen Vidhusha Virchitaha Khemraj Sri Krishna Das Srehthina 67/167 . Ramayanam. Bhagavadgeeta. 327 pgs.. Unknown. 650 pgs. . -. 120 pgs. Srimad Brahmasutranu Bhasya Of Srimad Vallabhacharya. Religion.. Srimad Valmiki Ramayanam: Aranyakandamu Kishkinda Kandamu. Sanskrit. 1911.. Sanskrit. 1985. 1997. Bhagavadgeeta. Mahadeva Gangadhar Bakre.. Srimadbhagavatam Ekadasaskanda. Srimad Vallabhacharya. 1998. Srimad Bhagavata Mahapuranam Of Maharsi Vedavyasa Vol 1 Skanda 1... Srimad Bhagavata Mahapuranam Vol I. 1980. Jwalaprasad Misra. 1997. Srimadbhagavatam Navamaskanda.. Srimad Valmiki Ramayana Part 2.. 1936. 308 pgs. 1913.. Unknown. 744 pgs.. 1989. Religion. 605 pgs. Srimadbhagavatam Pradamaskanda. Sanskrit. Unknown. Srimad Vijayindratirtha. Wasudev Laxman Shastri Pansikar. Hanumantha Rao K. Sanskrit.. Sanskrit.. Theology. .. Unknown. .. Srimad Brahmasutranubhasya Of Srimad Vallabhacharya... 1969.. Sanskrit. 292 pgs. Sanskrit... Prof. Sanskrit. P Radha Krishna Sarma... 1006 pgs. Sanskrit. Srimadbhagvata Aur Tulsi Sahitya Tulnatmaka Anushilana. Brahucharya.. Sanskrit.. 276 pgs. Sanskrit. 75 pgs.. 1984. 1961. Srimad Brahmasutra Bashyam Part 3 4 Pada. Religion.. Religion. Srimad Brahmasutra Bashyam Part 2 2 Pada. 355 pgs. 92 pgs. 1270 pgs. Brahucharya.. 126 pgs. Sanskrit... 286 pgs.. 291 pgs. 1982. 1997. 0. Srimad Brahmasutra Bashyam Part 3 1 Pada. A V N Acharya. Unknown. Srimadbhagavatam Astamaskanda.. Sanskrit. . Srimad Jayatirthas Tattvasankhyanatika. Unknown. . 358 pgs..org/…/SanskritIIIT. Dr N C V Narasimhacharya... Srimad Valmiki Ramayanam Saralagadyatmakam. Bhagavadgita. -. Sanskrit. Theology. Sanskrit. 212 pgs. .2/14/2011 g A list of Sanskrit books at III… g scanned g pg Srimad Bhagavadgeeta. Srimad Brahmasutrani Part Ii. Sanskrit.. 1987.. 1992. 426 pgs. Bhagavad Gita... Sanskrit. 1983. Maganlal Ganapatiram Shastri. Srimadvallabhacharya. Srimad Bhagvad Geetha.. 720 pgs.. Srimad Valmiki Ramayanam Part 2.. Sanskrit. Srimadvallabhacharya. Sanskrit. Srimad Valmiki Ramayanam. 148 pgs. Srimad Brahmasutra Bhashyam Vol I Part Iii. Srimad Valmiki Ramayanam Balakandam Ayodhya kandam. Religion. 1997. Srimadbhagavatam Shashtamaskanda. Sanskrit. Sanskrit. Religion. Brahucharya.. Srimadvallabhacharya. Unknown. Religion. 242 pgs. 0. Sanskrit.. Maganlal Ganpatiram Shastri.. 1961. 428 pgs. Religion.. Srimad Bhagavath Dashamaskanda Subhodini. Art. D Harishankar Mishra. Anandtheertha Bhagavatpadacharya. Srimad Bhagavadgita. 291 pgs. 1875. Religion. 341 pgs. . Sanskrit..... 1954.. Sanskrit. K Hanumanth Rao. Srimad Brahmasutra Bashyam Part 1 1 Pada.. K Hanumantha Rao. 1982... 370 pgs. sanskritdocuments. 956 pgs. Sanskrit. Sanskrit.

Linguistics Literature. 1868. Sanskrit.. . Philosophy. 1983. 1981.. .. ... Sanskrit. Sriman Nyaya Sudha Vol .. . . Sanskrit. .9. Sriman Nyaya Sudha Vol . 130 pgs. 171 pgs... 186 pgs. 1983. Sriman Nyaya Sudha Vol . Sanskrit.... Srimat Sitaramajaneyam. 1983. Sriman Nyadudha Vol . Philosophy. 1984. sanskritdocuments. Unknown.. 171 pgs. Philosophy. 184 pgs. Philosophy. 1983. 1933. 166 pgs. Sanskrit. Philosophy.. Philosophy. Venkata Reddy K. Philosophy.. .. G Laxmikanthaiah.. Philosophy. Sanskrit. 0. 1980. 1983. Philosophy.2. Srimadhandra Mahabharatha Kathah. 160 pgs.1.. 1918. . . Sanskrit. .2. pgs.. 1982. Sriman Nyaya Sudha Vol Ii. Sriman Nyaya Sudha Vol . Srimadhya Mahapuranam. 1110 pgs. Sanskrit..8. Philosophy. 1997.. Sriman Nyaya Sudha Vol . Srimahedantdesika Grantha Malaya. Sriman Nyadudha Vol V.. Sriman Nyaya Sudha Vol . B N K Sharma. Sriman Nyadudha Vol . Sanskrit. .. Sanskrit. Srimat Tatparya Chandrika Volume Iii... .. pgs. 164 pgs. Sriman Nyayasudha part 1. 1982. 1983..arka Somayaji.. Philosophy. 183 pgs. . Srimath Vedantadesika Granthamala. 1982. Sanskrit. 167 pgs. 266 pgs. 723 pgs.. Sriman Nyaya Sudha Vol . Sanskrit. Dr.2/14/2011 A list of scanned Sanskrit books at III… Srimadbhivishgarvgadadhartanyavadgnasen Vidhusha Virchitaha.1.. Sri Kanchi P B Annangaradharyar. Sanskrit.. Philosophy. 1982. Sanskrit..... 1983. P P S Shastri.8. Sanskrit. Sriman Nyadudha Vol Ii. Gadi Srikrishnmacharyaswami. 1981.. 842 pgs. Philosophy. Philosophy. Philosophy. Philosophy. Sriman Nyaya Sudha Vol .d. 160 pgs. Philosophy... Sriman Nyayasudha part Ii. Sanskrit.10. Philosophy.. Sriman Nyaya Sudha Vol .… 68/167 .. 1983. . 1982.. 316 pgs. Sriman Nyaya Sudha Vol . 1983. 1982.1. Sanskrit. Sanskrit. Language.. Sanskrit. 384 pgs. Philosophy.10. 1982.. Philosophy. . Vayu Purana. Sanskrit. . Khemraj Sri Krishna Das Srehthina. Sanskrit. 1983.. Sanskrit. Unknown.. Sriman Nyadudha Vol I.. Sriman Nyadudha Vol Iii. 171 pgs.... Sriman Nyaya Sudha Vol . 1983. Sriman Nyaya Sudha Vol . Sanskrit. Ramayanam. Sanskrit. G. 1983. 1061 pgs. 163 pgs. Jayatheertha. Sanskrit. pgs. 1983.. 163 pgs...... Philosophy. 1941..9.guru Venkatacharya. Sanskrit. Sriman Nyaya Sudha Vol X... Jayatheertha. Venkata Reddy K. Sanskrit. 1998.. . 1981. Jayatheertha.3. Sriman Nyaya Sudha Vol Viii. 160 pgs.. Linguistics.. Sanskrit. 1981..8. 164 pgs. ..2. Sanskrit. 1982.. 1156 pgs. .. pgs. Sriman Nyadudha Vol . Sanskrit. Philosophy. pgs. Venkata Reddy K. Sanskrit.. 167 pgs.5.org/…/SanskritIIIT. Sanskrit. Unknown. 336 pgs. Literature. Sanskrit. ... Sriman Nyaya Sudha Vol I.. Sriman Mahabharathamu Aranyaparvan. . 166 pgs. 1981. Sanskrit. 186 pgs. Philosophy.. pgs. 198 pgs. Sriman Nyadudha Vol .. Philosophy. Sriman Nyaya Sudha Vol Ix. Linguistics Literature. Sanskrit. Philosophy. Unknown.9. Unknown.

2/14/2011

A list of scanned Sanskrit books at III…

Sriramakirti Mahakavyam... satya vrat shastri, Unknown. Sanskrit, 1990. 582 pgs. Sriramyansar Kanya Tilakam... B.ramraj, Unknown. Sanskrit, 1972. 243 pgs. Sritattvacintamani... Chintamani Bhattacharya, Tantras. Sanskrit, 1937. 123 pgs. Srngara Sekhra Bhana... Dr B Rama Raju, Unknown. Sanskrit, 1969. 76 pgs. Srngaraprakasa... P P Subrahmanya Sastri, Language. Linguistics. Literature. Sanskrit, 1939. 100 pgs. Srngaraprakasa Part I... Maharajadhiraja Sri Bhoja Deva, Art. Sanskrit, 1939. 101 pgs. Stava Chintamani... Bhatt Narayana, Art. Sanskrit, 1918. 165 pgs. Sthotramala... K Prathivaadi Bhayankar, Art. Sanskrit, 1942. 112 pgs. Stotraadisan'grah... T'embe Shriivaasudevaa Nanda Sarasvatii, Religion. Theology. Sanskrit, 1952. 474 pgs. Stotrasamuccaya... Dr.v.raghavan, Unknown. Sanskrit, 1969. 332 pgs. Studies In Buddhism And Sikhism... Harcharan Singh Sobti, Unknown. Sanskrit, 1986. 116 pgs. Studies In Skanda Purana Part 3 Vol 1... A B L Awasthi, Unknown. Sanskrit, 1983. 182 pgs. Subhaashhitaratnabhand-d'aagaarama~ Parivara~dhitamashhtaman' San'skarand-ama~... Raama Naaraayand-a, Language. Linguistics. Literature. Sanskrit, 1952. 528 pgs. Subhashitasudha Ratna Bhandagaram Or Treasures Of Sanskrit Poetry... pandit shivadatta kavirathna, Unknown. Sanskrit, 0. 876 pgs. Subhasita Ratna Bhandagara... Narayan Ram Acharya, Kavyas. Sanskrit, 1952. 525 pgs. Suddhadvaitamartanda... Ratna Gopala Bhatta, Kavyas. Sanskrit, 1954. 116 pgs. Suddhadwita Pushtimaargiya Samskut Vagnmaya Part I... Prof Kantamani Sastry, Religion. Theology. Sanskrit, 0. 268 pgs. Sudhasharachhandhramu... Chilakamurthy Laxmi Narasimham, . Sanskrit, 1927. 180 pgs. Suklyajurveda Samhitha... Wasudev Laxman Sastri Pansikar, Unknown. Sanskrit, 1929. 658 pgs. Sulabasutram... P Venkataramaiah, Kavyas. Sanskrit, 1984. 74 pgs. Sulabasutram... Niccolao Manucci, Kavyas. Sanskrit, 1984. pgs. Sulabasutram Katyana... P Venkataramaiah, Kavyas. Sanskrit, 1984. 70 pgs. Sulabasutram Katyana... Niccolao Manucci, Kavyas. Sanskrit, 1984. pgs. Sulbhavykaranamu Part I... kambamupathi gopalakrishnamurthy, Unknown. Sanskrit, 1959. 46 pgs. Sundari Meghasamdesa Or Dakshinatya Meghasandesa... Veluri Subbarao, Unknown. Sanskrit, 1999. 122 pgs. Sundarkandam... Dr.chandra Prabha, Unknown. Sanskrit, 1981. 284 pgs. Supplement To Purana Vol Ii No 2... Dr Ganga Sagar Rai, Religion. Theology. Sanskrit, 1963. 40 pgs. Surjan Charita Mahakavyam... Sri Chandrashekhar, Unknown. Sanskrit, 1952. 264 pgs. Surya Dandaka... Mayura Kavi, Unknown. Sanskrit, 1989. 46 pgs. Surya Siddhanth... -, Religion. Theology. Sanskrit, 0. 358 pgs. Sushruta San'hitaa Muulamaatraa... Sushruta, The Arts. Sanskrit, 1945. 1261 pgs. Sushrutasamhita Of Sushruta... Jadavi Trikumji Acharya, Unknown. Sanskrit, 1915. 778 pgs. Sutrarthamrta Lahari... Dr. R. Nagaraja Sarma, Unknown. Sanskrit, 1951. 112 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Sutrutham

Sri Jovanand Vidhyasagar Bhattacharya Unknown Sanskrit 1983 908 pgs

69/167

2/14/2011

A list of scanned Sanskrit books at III… Sutrutham... Sri Jovanand Vidhyasagar Bhattacharya, Unknown. Sanskrit, 1983. 908 pgs.

Suuktimuktaavalii... Harihara~, Technology. Sanskrit, 1949. 186 pgs. Suuta San'hitaa Dditiiya Khand-d'a Grantha 25... Chaara~ya Maadhava, Religion. Theology. Sanskrit, 1950. 441 pgs. Suutasan'hitaa Grantha 25... Aapat'e Vinayaka Gand-esha, Religion. Theology. Sanskrit, 1924. 374 pgs. Suutasan'hitaa Trxtiiya Khand-d'a... Aapat'e Hari Naaraayand-a, Religion. Theology. Sanskrit, 1929. 380 pgs. Suutasn'hitaa Bhaaga 3... Aapat'e Gand-osha Vinaayaka, Religion. Theology. Sanskrit, 1929. 390 pgs. Suvarnaprabhasa... C.e.marobz, Unknown. Sanskrit, 1992. 758 pgs. Suvarnaprabhasa Das Goldglanz Sutra... W Redloff, Unknown. Sanskrit, 1992. 270 pgs. Svabhaava Chitren' Prathamaavrxtti... Divekara Dinakaravaasudeva, Philosophy. Psychology. Sanskrit, 1934. 180 pgs. Svacchanda Tantram... Kshema Raja, Literature. Sanskrit, 1923. 345 pgs. Svachchhan'da Tan'trama~ Vol V... Shaastrii Madhusudhana Kaula, Religion. Theology. Sanskrit, 1930. 297 pgs. Svachchhandatantrama Bhaaga 2... Qs-emaraaja, Religion. Theology. Sanskrit, 1923. 348 pgs. Svapnavasavadattam... C R Devadhar, Language. Linguistics. Literature. Sanskrit, 1946. 169 pgs. Svara~nd-a Kirana~... Shrii Sumitraanan'dana Pan'ta, Philosophy. Psychology. Sanskrit, 1947. 197 pgs. Svetasvaradyupanishad Purushasuktha Bashya Part 1... Veera Raghavacharya T, Upanishad. Sanskrit, 1955. 445 pgs. Svetasvataradyu Panishad Purushasukta Bhasya Part 1... T Veeraraghavacharya, Unknown. Sanskrit, 1955. 448 pgs. Svetasvataradyupanishad Purushasukta Bhasya... T Veera Raghavacharya, Unknown. Sanskrit, 1955. 446 pgs. Swapravasavadatta... Haradayalu Singh, Art. Sanskrit, 2003. 47 pgs. Swetha Swatharaghupanishatpurushasukthabhashyam Prathama Bhagah... Sri ranga rananuja murthy, Unknown. Sanskrit, 1944. 448 pgs. Taan'trika T'eksat'a Khand-d'a 11... Raavaa Bhaaskara, Religion. Theology. Sanskrit, 1922. 117 pgs. Taittiriiya Praatishaakhyama~ Grantha 10... Maahishheya, Religion. Theology. Sanskrit, 1930. 262 pgs. Taittiriiyaarand-yakama~ Bhaaga 2... Krxshhnd-ayajura~vediiyan, Religion. Theology. Sanskrit, 1927. 471 pgs. Taittiriiyaarand-yakama~ Dditiiyo Bhaaga Grantha 36... Aapat'e Vinaayaka Gand-esha, Religion. Theology. Sanskrit, 1927. 479 pgs. Taittiriiyabraahmand-ama~ Dditiiye Khand-d'a Grantha 37... Krxshhnd-ayajara~vediiye, Religion. Theology. Sanskrit, 1937. 570 pgs. Tajika Neelakanti... , Language. Linguistics. Literature. Sanskrit, 0. 280 pgs. Tamara Parinayam... , . Sanskrit, 0. 448 pgs. Tandyamahabrahmana... Pandit A Chinnaswami sstri, Unknown. Sanskrit, 1935. 510 pgs. Tantra Sara Sangraha... M Duraiswamy Aiyangar, Indology. Sanskrit, 1950. 566 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Tantra Trutiya Samputam

Sri bhagavad ramanuj Unknown Sanskrit 1951 380 pgs

70/167

2/14/2011

A list of scanned Sanskrit books at III… Tantra Trutiya Samputam... Sri bhagavad ramanuj, Unknown. Sanskrit, 1951. 380 pgs.

Tantraaloka 57... Abhinavagupta, Religion. Theology. Sanskrit, 1936. 374 pgs. Tantraaloka Dashamo Bhaaga Grantha 52... Gupta Madabhinava, Religion. Theology. Sanskrit, 1933. 400 pgs. Tantraaloka Ekaadasho Bhaaga Grantha 57... Gupta Madabhinava, Religion. Theology. Sanskrit, 1936. 377 pgs. Tantraaloka Grantha 30... Madhusudana, Religion. Theology. Sanskrit, 1921. 314 pgs. Tantrasara... , . Sanskrit, 0. 495 pgs. Tantrik Tests... Swamy Trivikrama Tirtha, The Four Vedas. Sanskrit, 1937. 132 pgs. Tarad'aga... Saagarikaa, Philosophy. Psychology. Sanskrit, 1940. 132 pgs. Taranatha's... Albert Grunwedel, Unknown. Sanskrit, 1914. 222 pgs. Tara~kataand-d'avama~ Chatura~tho San'put'ama~... Vyaasathiira~tha Shrii, Philosophy. Psychology. Sanskrit, 1943. 409 pgs. Tara~kataand-d'avama~ Da~vitiiyan' San'put'ama~... Vyaasatiira~tha Shrii, Philosophy. Psychology. Sanskrit, 1935. 417 pgs. Tara~kataand-d'avama~ Prathamasamput'ama... Shriivyaasatiira~ta, Philosophy. Psychology. Sanskrit, 1932. 564 pgs. Tarka Tandavam Vol I... D.srinivasacharya, Indology. Sanskrit, 1932. 557 pgs. Tarka sangraha... Acharya kedharnadh tripati, Religion. Theology. Sanskrit, 1974. 204 pgs. Tarkabhasa Of Moksakara Gupta... Embar Krishnamacharya, Unknown. Sanskrit, 1942. 140 pgs. Tarkabhasha And Vedasthana Of Mokshakaragupta And Jitaripada... H.r. Rangaswami Iyengar, Religion. Theology. Sanskrit, 1944. 144 pgs. Tarkasamgrahah... Shri Guru prasada shasthri, Unknown. Sanskrit, 1939. 308 pgs. Tarkasan'graha... Annambhat't'a, Philosophy. Psychology. Sanskrit, 1930. 225 pgs. Tarkatandava... , . Sanskrit, 0. 331 pgs. Tarkatandavam Of Sri vyasa Tirtha Ii... V Madahvachar, Dvaita Philosophy. Sanskrit, 1935. 407 pgs. Tarkatandavam Of Sri vyasa Tirtha Iv... V Madahvachar, Dvaita Philosophy. Sanskrit, 1943. 402 pgs. Tarkatandavam Of Sri vyasa Tirtha,3... V Madahvachar, Dvaita Philosophy. Sanskrit, 1938. 373 pgs. Tathava Teeka... Mahadesika, Geography. Biography. History. Sanskrit, 1934. 538 pgs. Tathvaprakasika Chapter1... , Language. Linguistics. Literature. Sanskrit, 0. 451 pgs. Tatparya Chandrika Part 2... Krishnacharya,t.r, . Sanskrit, 1913. 2011 pgs. Tatparya Chandrika Vol Ii Part Ii Iii Iv... Sri Vyasateertha, . Sanskrit, 1982. 213 pgs. Tatparya Chandrika Volume I... Sri Vyasateertha, Unknown. Sanskrit, 1981. 182 pgs. Tatparya Chandrika Volume Ii... Vyasateertha, Geography Biography History. Sanskrit, 1981. 211 pgs. Tatra Pratham Samputam Vedratha Geetabhasya Gadyatrey... Sri Mannarayanramanujayteendranamagya, Unknown. Sanskrit, 1980. 292 pgs. Tattva Pradipika With Citsukha Commentry... , . Sanskrit, 0. 294 pgs. Tattva Samkhyanam... Ramamurthy Sharma R, Philosophy. Sanskrit, 1980. 77 pgs. Tattva-kaustubha-kulisa... Dr.rnaga Raja Sarma, Unknown. Sanskrit, 1956. 324 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Tattvaara~thasuutrama~

Svamii Umaa Religion Theology Sanskrit 1944 324 pgs

71/167

Tatuabodhini Uttaraidha Gnanendra Saraswathi. 1939. Sanskrit. 314 pgs. sanskritdocuments.. Thathvaprakasika Kavyankya Sharkara. 1953. Sanskrit. Psychology. Vedaantaachaara~ya Shrii. Texts On Courtezans In Classical Sanskrit.. -. Telugu-savara Dictionary. Tattvamukttaakalaapa Da~vitiiyasan'put'ama~. 347 pgs... Tattvamukttakalaapa Trxtiiyasamput'ama~. Sanskrit. . 754 pgs. 1980. Unknown.. Unknown.. 382 pgs. History.. Linguistics.. 157 pgs.. 342 pgs. -. Sanskrit. 1940. Sri Madhvacarya.. Religion. Tattvamuktakalpa. Theology.. The Alanka Asa Vasva Of Rajanaka Ruyyaka. Theology. The Abhijnana Sakuntala Of Kalidasa. Linguistics Literature. 1936. 1954. The Akhyata Chandrika. Raghava Bhatta.. bhattamalla. 0. Sanskrit. Psychology. The Abhidhana Sangraha. Krishnacharya.. Veng-kat'anaatha. Language. Sanskrit. kalan'kadeva Bhat't'aa. 748 pgs.r. Sanskrit. The Abhijnana Sakuntala of Kalidasa. Thaithariya Brahmanamu Dwithiya Bagamu. 72 pgs. Tatvaprakasika Bhavdiya. 1938. 0. R S Panchamukhi... Veeraraghavacharya. Sri Jayatirtha. Sanskrit. Vdaantaachaara~yaa. 1980. Sanskrit. 99 pgs. 1938. Unknown. Sanskrit. Philosophy. 110 pgs. 1940. .t... Religion. .org/…/SanskritIIIT.... . Sanskrit. Tatvamukttaakalaapa Prathamasanput'ama~. Geography. 0.. 1927. Geography Biography History. Sanskrit. 554 pgs. 461 pgs. 811 pgs.. Sanskrit.. Tattvatika. Sanskrit. Unknown. Literature. Svamii Umaa.… 72/167 .. Sanskrit. Biography. Tattvaraya Rahasyam. . Philosophy. Pandit Girijaprasad Dvivedi. Unknown..... Sanskrit. Tattvasamkhyanam. 1953. 0. 1981.. 1914. 0.. Sanskrit. 1953. Sanskrit. Nigamaantadeshika~.. Unknown.. Geography Biography History.. Tatvodyota. 0. Philosophy. 324 pgs. Vidya Manyatirth Swami. Sanskrit. The Alankaramasekhara. . Psychology. Sanskrit. 1954.. Ramanuja.. 1936. Wasudev Laxman Sastri Pansikar.. Sanskrit. 1943. Sanskrit. Sanskrit. Sanskrit. Unknown. Tattvasankhyanam. 528 pgs. Prof. Unknown. 462 pgs. 367 pgs. Tatva Prakasika Bhavadipa Volume I to Ii.. Linguistics. Linguistic. 406 pgs. Unknown.. 117 pgs. 1999.. Tattvatika. 22 pgs. A B Gajendragadkar. G V Ramamurti. Language. Sanskrit. .. Tharkasangraha... Unknown. kshitish chandra chatterji. Philosophy.. Sanskrit. 1934. Tattvarthavartik Of Shri Akalank Deva. 152 pgs. 554 pgs.. Philosophy. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Tattvaara thasuutrama ... Sanskrit. 1964.. 551 pgs.. . 1303 pgs.. 0. . 1940.. 198 pgs. Sanskrit. 329 pgs. Tatva Marchand Vimarja. Literature. Tatvapradipika Nyaya Prasakdika Vyakyanamu. 692 pgs.. 1948. 602 pgs... Mahendra Kumar Jain.. Literature.. Tattvamukttakalaapa Da~vitiiya San'put'ama~. Anantarama Sastri Vetal. D Sreenivasachar. Technical Terms And Technique Of Sanskrit Grammer Part 1. Tattvaara~thavaara~tika Bhaaga 1.. ludwik sternbach. Sanskrit. Linguistics Literature.. 1944... 1933. Unknown... Unknown.. The Amarakosha. 289 pgs. 106 pgs. 375 pgs.. Sanskrit. 538 pgs. Sanskrit. Mahadesika..

The Ashtanga Hridaya Kosha With The Hridaya Prakasha. Jiva Natha Jhi. Charudeva Shastri. Sanskrit.... Unknown. The Arthsastra Of Kautilyavol I. Unknown. Literature. Unknown. 76 pgs. pgs. Unknown.. Pandit Harisankara Sastru Vedabta Visarada. 216 pgs.. The Balamartandavijaya. Sanskrit. The Bhrngasandesa Of Vasudeva. Sri Narayancharya Atreya. 644 pgs.. 494 pgs.. 1936. Unknown. Ramakantha. 1922. 1934. Bhagavadgita. The Aranyaparvan Part 2. Pandit Durga Prasad. Sanskrit. 96 pgs.. Sanskrit. 630 pgs. The Brahmavada Sangraha. 1963.. Sanskrit. Linguistics Literature. P. The Bijaganita Elements Of Algebra Of Bhaskrachrya... Sanskrit. Unknown... 521 pgs.. The Brahmasutra Bhashya Volume I.org/…/SanskritIIIT. Sambasiva Shastri K. Bhagavadgita. 538 pgs. 1940. R.. 1943. The Bhaminivilasa Of Jagannath Pandit. G Raghavendracharya. Sanskrit. 560 pgs. Sanskrit. 243 pgs. Sanskrit.. G Rghavendracharya. 1928.. Sanskrit. Diavanji. The Bhagavadgita. 1920. Literature. Unknown. Sanskrit. 1943. Ramakantha. Sanskrit.. Unknown. Sanskrit. 290 pgs. 350 pgs. 1967. Unknown... Sujitkumar Mukhopadhyaya.. 433 pgs... Raghavendracharya. Sanskrit. 1937.. Aryabhatacharya. The Anargharaghava Of Murari Edition V. Unknown. k m vaidya.. Sanskrit. The Atmatattvaviveka Of Sri Udayanacharya.. 260 pgs. The Brahmasutra Bhashya Volume Iv.. Sri Madhwacharya. The Balamartandavijaya.I I I.. Unknown.. 1963.. Sanskrit. The Bhattikavyam Of Bhatti. Sanskrit. 1943... 1949.2/14/2011 A list of scanned Sanskrit books at III… The Amarakosha. Religion.. Wasudev Laxman Sastri Pansikar. Linguistics. Dhundiraja Sastry. Sanskrit. 162 pgs. 0. The Bhaskarodhyam The Rising Sun. 1938.. 674 pgs. Sanskrit. Indology.. 466 pgs. The Atmatattv Aviveka. Pt. Govinda Swami.. 1940. Bhagavadgita Sanskrit 1928 140 pgs sanskritdocuments. The Arthasastra Of Kautilya. The Bhagavadgita. 396 pgs.. 162 pgs. The Bhagavadgita. 1940. 1933.. The Brahmasutra Bhashya Volume Iv. Sanskrit. 1961. Literature. Sanskrit.. 534 pgs. T Ganapathi Sastri. 160 pgs.. 550 pgs. The Aryabhatiya..... Theology. Vishnu S Sukthankar. Literature. 1942. Sanskrit. 1930. The Brahmasutra Bhashya Vol-3.... K Smba Siva Sastry. 1937... Ramakantha R. The Antagonist In Sanskrit Drama.. Linguistics Literature.. Govinda Shankara Shastri Bapata. Sanskrit. 1956. The Bhakti Candrika. Abhay Mithra.. 1984. Philosophy. Unknown. Unknown. 400 pgs.... The Art Of Sanskrit Translation Or A Mirror To Sanskrit Usage. Unknown. Sanskrit. Sanskrit.. 139 pgs. Sanskrit. Unknown. Unknown.. Rajanaka Ramakantha. 1960. Sanskrit. The Asokavadhana.. Sanskrit. 648 pgs. 1887. K.. 1984. 1931. Unknown. Unknown. 394 pgs. 440 pgs.. pgs.. Sanskrit.anant Shastri Phandke Vyakaranacharya. The Andhra Pradesh Pension Code 1960. Unknown. Unknown. Brahmasutras. Harihara Sastri. 423 pgs. Sanskrit.. The Boudhayana Dharmasutra. 183 pgs. . 1930. 442 pgs.. Sambasiva Shastri.. Dr Jatindra Bimal Chaudhri. The Brahmavada Sangraha And Suddhadvaitapariskara..… 73/167 . The Aranyakanda Vol. T Ganapati Sastry.c. Sanskrit.. 1922. Kasinath Pandurang Parab. The Bhagavad Geeta Vol Lxiv. Sanskrit. 1943. Language.

. Sanskrit. Unknown. 1934.. The Ganapatha Ascribed To Panini. Kasinath Panduranga Parab.. 394 pgs. Mangal Deva Shastri. Sahib Kaul. Unknown. Sanskrit. Unknown.s. 1949. Unknown. 1936. Unknown...k. Sanskrit.. Unknown. Sanskrit. 1900. 1936. 1987.. The Ganitha Koumudi Part Ii.s. Pandit Anantaram Dogara Sastri. P Sathyavrata Samashrami. Literature.. The Grihaya Sutras Of Gobhil. The Chhandogya Upanishad Vol Iii.. The Dhatuvritti Vol I Part I. Social Sciences. Duncan Greenless.. Unknown.. Unknown. Sanskrit. Sri Gagabhatta. pgs.. The Catapatha-brahmana. Sanskrit.… The Harasastra Sastri K S Unknown Sanskrit 4008 394 pgs 74/167 . Unknown.. Ganapati Sastri. Sanskrit. 1519 pgs. The Charaka Samhita Volume 5.. Narayana Pandita.... Upanishads.... Duncan Greenless.rocher.venkata Charya.. 1890. Dr. 1941. Sanskrit... Sanskrit.. Sanskrit. Unknown. Unknown. 1949. 30 pgs. The Harasastra... Sanskrit. 436 pgs.. Unknown.k.org/…/SanskritIIIT... sage agnivesa. sulapani.. Sanskrit. The Dharma Sastra Vol I. 0.. 1932.. 170 pgs. 516 pgs. sage agnivesa. 1942. 1942. Manmatha Nath Dutt. Sanskrit. 126 pgs. 1938. The Dasarupaka Of Dhananjaya. 400 pgs.. 680 pgs. Sanskrit. 426 pgs. The Durghatavrtti Of Saranadeva. 4008. The Charaka Samhita Volume 4. 1942. suryakanta. 140 pgs.. Sanskrit. Sanskrit. Dr M Jaya Seetha Rama Sastry. 4008. 1938. The Devinamavilasa. 1936..kanakalal Sarma. 68 pgs. Unknown. Unknown. Sanskrit. Unknown. Unknown.... The Danadipika With Tha Bhavabodhini Hindi Commentary. L. 1949.. Sanskrit. Albrecht Weber. Religion. Yugalakishora Vyasa. Ganganath Jha. 1908. 340 pgs. The Danadipika. Unknown. Unknown. 1936. Unknown. The Gospel Of Advaita. Sanskrit. Sanskrit.. 1112 pgs. Sanskrit.. Sanskrit. Sastri... The Charanavyuha Sutra Of Saunaka. Pandit Sri Sudama Misra. sage agnivesa. The Dasrupaka of Dhanamjaya. 344 pgs. The Elements Of Darsanas Of Shriharshas Naishadha. pgs. 661 pgs. Sanskrit. Unknown. The Gospel Of Advaita. 426 pgs. Unknown. Sanskrit. The Dharmasindhu By Kasinath Upadhyaya.. 1986.. Unknown. T. Unknown. Sanskrit. The Ganita Kaumudi Part 1. The Ganitha Kaumudi. Literature. 264 pgs. 430 pgs. 1924. 1942. 184 pgs. Sanskrit..jayaseeta Rama Shasthry. The Commentaries On The Prajnaparamitas Vol 1. 1969. Sastri.2/14/2011 A list of scanned Sanskrit books at III… Bhagavadgita. The Elements Of Darsanas Of Sriharshas Naishadha. 296 pgs. The Charaka Samhita Volume 1.. 1176 pgs. Unknown. 1889. Unknown. The Dipakalika. 296 pgs. 1987. Pandit.. The Gobhilagrhyasutra.. Pandit Sri Sudama Misra.. Giuseppe Tucci. Sanskrit...... Sanskrit. Literature.. 160 pgs. The Chandraloka Of Shri Jayadeva. A Mahadeva Sastri. T.. Sanskrit.. 56 pgs. 1953... sanskritdocuments. 332 pgs. Sanskrit. 1928. The Collection of Sikshas by Yagna Valkya and Others.. 283 pgs.. 140 pgs. 252 pgs. Sanskrit. Pt. The Harasastra.. padmakara dvivedi jyautishacharya. 668 pgs. M. M M Sri Mukunda Jha Bakshi. 1939. Sanskrit. 1969. Sanskrit. 1953. The Dhatupatha Of Panini. 1000 pgs. Unknown..

The Kamsavadha Of Sesakrisna Edition I I I. Sanskrit. Sanskrit. 94 pgs. 1023 pgs. The Holi Gita. Sanskrit.. 1918. 195 pgs. 4008.. Sanskrit. Sanskrit. The Kashi Sanskrit Series. 70 pgs. Unknown. Raghu Vira. Unknown. Sanskrit.j. Literature. 281 pgs.. 638 pgs.. Sanskrit. Sanskrit.. Spiritual Experience And Uysticism.. Unknown.. The Kadambarikathasara Of Trivikrama. Srish Chandra Chakravarti. Sanskrit. Mukunda Rama Shastri.. . 0.. 1940. Sastri. Spiritual Experience And Uysticism.... Unknown.. 1944... B C Benerjee. The Kama Kala Vilas Of Punya Nanda. 626 pgs. The Karna Sundari Of Bilhana. The Ishvarra Pratyabhijna Vimarshini of Utpaladeva. Unknown. Not Available. Pandit Durga Prasad. 1943. 130 pgs. The Harasastra.. 186 pgs. Sanskrit. J. 160 pgs.. Abinava Gupta.. Unknown. Sanskrit... Sanskrit. 1933.. 1938. 178 pgs.. 446 pgs. Pandit Madhusudan Kaul Shastri. Sastri K S. Dr Hendrik Kern. Pandit Durgaprasada. Unknown. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… The Harasastra. Sanskrit. 539 pgs. Rama Deva.. The Kasika Vivarana Paniyaka. 4008.s. The Janakiharanam Of Kumaradasa I X. Sanskrit. The Ishvara Pratvabhijna Vimarshini Vol I.. Sanskrit.k. 1943. The Jaiminiya Or Talavakara Upanishad Brahmana. Abhinava Gupta. vrddha jivaka. 396 pgs. Benerjee. Unknown..pandya. Sanskrit.. pandit bhavadatta shastri. Unknown... Gopal Raghunath Nandargikar. Abhinavagupta.org/…/SanskritIIIT. 394 pgs. Pandit... Madhusudhan Kaul Shastri... Dakshina Murthy K.. Sanskrit.. 394 pgs.. The Journal Of Oriental Research Madras. Unknown.. Sanskrit. 1957. 1934.. Sanskrit. 312 pgs. Unknown. Unknown. Sanskrit.c. Sanskrit. 1932. 446 pgs. Sanskrit. 307 pgs. The Isvarapratyabhijna Vivritivimarstni Vol Ii. 1941. sanskritdocuments. 64 pgs.. 538 pgs. 1933. Sanskrit. Sanskrit. 280 pgs. 1921. Sanskrit. Unknown. The Isvarapratyabhijna Vivritivimartni. Unknown.. Sanskrit.. Unknown.. 1933.. 349 pgs. The Isvarapratyabhijna Vivritivimarsini. Unknown. Mahamahopadhyaya. The Isvarapratyabhijna Vivritvimarsini Vol Iii..... 90 pgs. Spiritual Experience And Uysticism. The Kalatattvavivechana. The Isvarapratyabijna Vivritivimarshini. Upanishad. 1907. The Kasyapa Samhita. Sri Bopadeva. 1918.. The Harililamrtam. Pandit Sri Nanda Kishore Sharma.... The Kadambari Kathasara Abhinanda. Pandit Durga Prasada.. 349 pgs. Gudharthatattvaioka. The Kalatattvavivechana. 422 pgs. Sanskrit. Sanskrit. 1902. pgs. 1930. 1941. Unknown. 1867. Unknown. 1941. 446 pgs. 195 pgs. Unknown. The Isvarapratyabhijna Vivriti Vimarsini By Abhinava Gupta. Vrdddha Jivaka. Upanishad. 1918.… 75/167 .. Unknown. 1953. B. The Jayantavijaya Of Abhayadeva.... 413 pgs.. 1925. 1935. Abhinavagupta.. K Dakshina Murthy. The Kasyapa Samhita. 1957. Sanskrit. The Journal Of Vedic Studies Volume 1 No 1. General... Abhinava Gupta. The Kadambari Kathasara Of Trivikrama. Unknown. The Harsha Charita First Uchhvasa. 1943. Sanskrit... 1925. General. 190 pgs. Unknown. The Jataka Mala.

r p kangle. 1936. The Mahabharata An Epic Poems. 1915... The Kavyarathna Of Arhaddasa..... 486 pgs... Pandit Ananta Sastri. Sanskrit. 676 pgs. 587 pgs.. 1935.. Unknown.. Sanskrit.. Sanskrit. Pandurga Parad . Sanskrit. Mangesh Ramakrishna Telang.. P P S Shastri. The Mahabharata Vol 9 Drona Parvan Part 1.. 696 pgs. Sanskrit. 298 pgs. 1917. The Mahanaya Prakasha Of Rajanaka Shiti Kantha..org/…/SanskritIIIT. 1931. Sanskrit. Sanskrit. The Mahabharata Vol Viii Bhisma Parvan.. Unknown. The Khadira Grihyasutra. Sanskrit. The Kavya Mimamsa... Sanskrit. 1936.. Rajashekhara. 1936. The Kirtatarjuniya of Bharavi.. 974 pgs. The Mahanaya Pkasha O Rajanaka Shiti Kanta. Unknown. Pandit Mukunda Rama Shastri. Sanskrit. Sanskrit. 268 pgs. 1931. 154 pgs. Unknown.. 1934.s. Sanskrit. Unknown. E B Cowell. 106 pgs. 1913. The Krityasaravol 1. 557 pgs. Kashinath Pandurang Parab. 442 pgs... Sanskrit. 1918. 362 pgs. Mangesh Ramakrishna Telang. 1953. 1960. Unknown.. 1934. Sanskrit.. Vidhyasagara Vidhyavachaspati..l. Unknown. P P S Shastri.. Sanskrit. Vaidya. 1935. Unknown. 388 pgs. 1918. 390 pgs. 318 pgs. Literature. The Celebrated Vedavyasa Rishi. 1961.. sanskritdocuments. Literature. The Mahabharatha Santi Parvan Vol X V Part I I I.. Unknown.. 0. The Laws And Practice Of Sanskrit Drama Vol X I V Vol I.-2. 609 pgs... 444 pgs..… 76/167 . Literature.. Sanskrit. Sanskrit. The Mahabharata Vol 10 Drona Parvan Part 2. Unknown. P P S Shastri. The Krityasara Samuchchaya Of M M Pandit Sri Amritanatha Jha.. 184 pgs.. 1935. 822 pgs. 114 pgs. Sanskrit. 96 pgs. The Kavyakalpalata Vrtti... The Celebrated Vedavyasa Rishi.. 1968. Unknown. Sanskrit.. 1954. The Mahabharata An Epic Poem Vol 4.. Sanskrit. 154 pgs. The Mahabharata Vol 9 Salya Sauptika And Stri Parvans.. Unknown. P P S Sastri. Unknown. Sanskrit. Sanskrit.. The Madhaviyadhatuvritti Of Sayanacharya. Surendra Nath Shastri. K Sambasiva Sastri. Unknown. Pandit Mukunda Rama Shastri.. Unknown... The Kavyalankara Sangraha Of Udaha Bhatta. The Kautiliya Arthasastra Part 1.. 1100 pgs. Sanskrit. Amara Chandra Yati. Unknown. 1944. The Kausitaka Grhyasutras.2/14/2011 A list of scanned Sanskrit books at III… The Katyayan Srauta Sutra Part Ii. Unknown. P.. 154 pgs. The Malatimadhava Of Bhavabhuti. T R Chintamani. Unknown. Pratap Singh. The Mahabharata Santi Parvan Vol Xviii Part I. Gopal Sastri Nane. The Kausitaki Brahmana Upanisad. The Mahanaya Prakasha Of Rajanaka Shiti Kantha... The Mahapurana of Puspadanta Vol. 186 pgs. Unknown. 1939. Unknown. A. Unknown.. Unknown. 1940.. P P S Sastri. Sanskrit..mahadeva Sastri. Sri Gangadhara Misra. Unknown. 640 pgs.. 0.... Sanskrit. 1934. 152 pgs. Sanskrit. 210 pgs. Sanskrit. Sanskrit. 1935. Sanskrit. The Madhvamukhalankara.ramashastri. 676 pgs. Unknown. Unknown. Misra V.Revised By T Srinivas Venkatarama. 728 pgs. 1935. Vidan N. The Mahabharata An Epic Poem Vol 3. The Malavikagnimitra Of Kalidasa Edition V I I I. The Celebrated Vedavyasa Rishi. Sanskrit... Unknown. 1918. Literature.. 0.

. The Nareshvaraperiksha. The Mimamsa Slokavartika. 1936. Kamalakar Bhatt. 906 pgs. 1924. Unknown.. The Nidhipradipa Of Sri Siddha Srikanthasambhu. Johannes Hertel. 542 pgs. 1921. Literature. 1925... The Megha Duta Of Kalidasa. Unknown. Sanskrit. P R Subrhmanya Sarma. Mahamahopadhyaya Gangdhare Sasatri Tailanga. K Sambasiva Sastri. Linguistics.. Language... 1957.. Language. The Nirukta Of Yaska Part Ii.... Sanskrit. Sanskrit. . 1942. 1982. Sanskrit.. Ramakantha. 195 pgs. The Namalinganusasana Amarakosa Of Amarasimha. Unknown..2/14/2011 A list of scanned Sanskrit books at III… The Mandaramaranda Champu Of Sri Krishna Kavi. Religion Theology. The Mirichchhakatika Of Sudraka. Unknown. 471 pgs. The Memorial Verses Of Appaya Dikshita's Kuvalayananda. Unknown. Sanskrit. 1933. The Nirnaya Sindhu... The Niruktam Of Yaska Muni. 60 pgs. sanskritdocuments. Sanskrit.. 1953. Unknown.. 212 pgs.. The Nyaya Darsana. Franklin Edgerton. T Ganapat Sastri. 135 pgs. 128 pgs... Shovona Devi. 1934. 1898. The Nyayavarttikat Paryatika Of Vachaspati Misra Vol Xiii.. Sanskrit. Sanskrit. Unknown... Sanskrit. The Muhurtachintamani. 1903. Pandit. Unknown.. 52 pgs. Sanskrit.. -. Unknown. Gopi Natha Kaviraja. Sanskrit. Sanskrit.org/…/SanskritIIIT. Sanskrit. 1917. The Minimum Wages Central Rules 1950. 1940... Sushil Kumar De. Sanskrit. Dr V Raghavan. G A Jacob. The Nareshvaraperiksha.. Dalapati Raja. The Mimasa Kaustubha... Pandit Harihara Sastry. Sanskrit. Unknown.. 475 pgs... 1017 pgs. 1981. Pandit Sri Hariram Shukla. 158 pgs. Sanskrit. Sanskrit. 1926. Unknown. Ramakantha. The Pancharatra Of Bhasa. A. Sanskrit... Unknown. Unknown. Late M R Kale... 1954. The Nirsinha Prasada Tirtha Sara. The Orient Pearls Indian Folklore. Unknown. Linguistics. Sanskrit.. The Nirnayasindhu. sri kamalakar bhatta.. The Nyayaa Lilavati. Linguistics. The Manidarpana. Jaimini Sutras.. The Megha Duta Of Kalidasa Edition I I. 484 pgs. The Paippalada Samhita Of The Atharvaveda. Unknown. 1916. 676 pgs. Sambasiva Sastri.… The Parama Laghu Manjusha Pandith Nityananda Panta Parvatiya Unknown Sanskrit 1946 133 77/167 . The Padyacudamani Of Buddhaghosacarya. . 297 pgs. M Ranga Acharya. krishnaji govind oka. Pandit Kedarnatha. Literature. Sanskrit. Sanskrit. Sanskrit. Literature. 1912. 138 pgs. Sanskrit.. 1926. Sanskrit.. 142 pgs.. The Panchatantra 1 To 5. Dipak Bhattarcharya. Chinnaswamy Sastri. 1957. 380 pgs. 200 pgs. 1925. 297 pgs. 1930.. Sanskrit. T Ganapati Sastri... 529 pgs.. 1913. 416 pgs. Sanskrit... 134 pgs. Ambadas Sastry. Unknown. narayana ram charya.. 126 pgs.. 310 pgs. 66 pgs. 1930. 0. Literature. The Nirsinha Prasada. 342 pgs. Unknown... Sanskrit. 0.. Mukund Jha Bakshi.. Unknown.. 780 pgs.. 0... 1924. 331 pgs. The Panchatantra Text Of Purnabhadra. Literature. Language. Sanskrit. 194 pgs. Sanskrit. R G Bhadkamkar. Unknown. Sanskrit. The Naiskarmya Siddhi. Sanskrit. 80 pgs. Unknown. The Mathuri Panchalakshani. Unknown.. 1966... 1984. Unknown.

. 1938. 1934. 855 pgs. 545 pgs.. 1926. 122 pgs. The Prakriya Prayoga Suchi.. The Patanjali Charita Of Rambhadra Dikshit.. The Pranjnaparijata Kavyam. Unknown.. Pandith Nityananda Panta Parvatiya. The Prakriya Kaumudhi of Ramachandra Vol iii. 1950. Sanskrit. 72 pgs. The Rig Veda. Sanskrit. 133 pgs. vaman shivaram apte... 64 pgs. 1926..... The Parijataharana Champu. 274 pgs.. Unknown. Sanskrit. The Queset Of Enlightenment. 518 pgs. The Rasarnavasudhakara Of Simhabhupala.. Sanskrit. E B Cowell. The Ram Charitha Of Bhatti.j. The Prakrta Prakasa Or The Prakrt Grammar Of Vararuchi. 1911. 150 pgs. The Principle Of Opposites In Sanskrit Texts.. The Rekhaganita Or Geometry Sanskrit.. Unknown. Philosophy. sri nagendra narayana misra... 264 pgs. 259 pgs... Unknown.. 1902. Sanskrit. The Philosophy Of Vallabha. Vishva Bandhu Shastri. The Queset Of Enlightenment. Pandit Ram Labhaya. 1922. Sanskrit.. Sanskrit. Linguistics Literature. 260 pgs.. 1980.. Unknown. 553 pgs. maithil pandit sri kanakalal sarma. Mahamahopadhyaya Pandit durgaprasada.. The Parijataharanachampu Of Sesha Srisrishna. 1950.. Geography. Chandeswara. Sanskrit.. Kunhan Raja C.. 321 pgs. 1946. 1889.. Sanskrit. Johnston D Litt. Sanskrit. Vasudeva Laxman Shastri Paniskar. 580 pgs. Dr. 1950.. The Sabda Kaustubha.. Sanskrit.... Sesha Srikrishna. Sanskrit. Sanskrit. T Venkatacharya. 1931. The Rupavatara Of Dharmakirti Part I I... Dharmasthala.. Unknown.2/14/2011 A list of scanned Sanskrit books at III… The Parama Laghu Manjusha. Sanskrit. The Phakkikaratna Manjusa. Unknown. Sanskrit. 1935. 54 pgs. Sanskrit. The Phakkika Saralartha. Biography. Sanskrit.. sanskritdocuments. The Ratnagotravibhaga Mahayanottaratantrasastra. The Prasannaraghava Of Jayadeva Edition I I I... The Ramayana Of Valmiki Ayodya Khanda... 1928. History. Radharani Sukhawal. K Sambha Shiva Shastri. Unknown. 1986.. The Rajaniti Ratnakara.. 1936. Sanskrit.. 565 pgs. The Rasopanisat. The Pratyabhijna Hridaya. E. Unknown.h. Unknown. Unknown. E. Unknown. 94 pgs. 1923. 94 pgs. 150 pgs. 1928. Sanskrit. Philosophy. Sanskrit.. Rao Bahadur M.. Kamalasankara Pranasankara Trivedi. 1936. Sanskrit. Thomas. 1960. E J Thomas. Pandit Shiva Datta.… 78/167 . 154 pgs... A Mahadeva Sastri. Unknown. Unknown. 118 pgs. 100 pgs. 100 pgs. 108 pgs.. Dr Juan Miguel De Mora. 1929..org/…/SanskritIIIT. Sanskrit. The Rgvedabhasya Of Skandavamin. Sanskrit. Kavi Ratna Pandith Shiv Dutta. Sanskrit.. Unknown. Unknown.rasik Vihari Joshi. Bhana Bhatta. 1979. pgs. Bhattoji Dikshit. 136 pgs.. Literature.. 560 pgs.... 1935. 1928.. Unknown... Pandith Ramacharitra Tripathi. The Purvamimamsa Darsana With Khandevas Bhatta Dipika Vol I I. Sanskrit. 395 pgs. 1950. Unknown. Unknown. Sanskrit. Sanskrit. Sanskrit. 1911. 1982. Unknown. Sanskrit. Kshemaraja. Unknown. Kamalashankar Prana Sankhar Trivedi. Sanskrit. 660 pgs. The Practical Sanskrit English Dictionary Volume First. Unknown. 1962. Unknown. The Parvati Parinaya. Unknown..

1935. Shripad Krishna Belvalkar. Sanskrit. Sanskrit. 2002. The Sarasvata Vyakaranam. The Sajjanendra Prayogakalpadruma. 554 pgs. Vidtasudhrakara Dr Har Dutt Sharma. m m sri gadhadara bhattaocharya. Art. 524 pgs. Sanskrit. 1929. Sanskrit. 315 pgs.. Linguistics Literature. pandit nityananda panta parvatiya. Sanskrit. Sanskrit. 132 pgs.. The Samanyanirukti. Sanskrit. 1933... Pandit A Mahadeva Shastri.. 1925.. Linguistics. 146 pgs. 1950.. Unknown. 563 pgs. 1930. Sanskrit. Upanishads. 880 pgs. Unknown. 272 pgs.. 1960.. The Samnyasa Upanishads. 265 pgs. Sanskrit. The Sahridayananda Of Krishnanada.. Unknown. Sanskrit. pandit nityananda panta parvatiya. 1938. 1930. Sanskrit.... T. 1938. 1929. Pandit Durgaprasad. The Saktivada. Sanskrit. Literature.. Theology. . 1929. Sayanacarya....chintamani Dikshit. Unknown. Unknown. The Samnyasa Upanishads Vol Xii. 1948.. 159 pgs. Unknown. Unknown. Sanskrit.org/…/SanskritIIIT.. Upanishads. Upanishads. 903 pgs. 1936.. The Samayamatrika. Upanishads. 1950.. Unknown. Unknown. Mahadeva Sastry A. Sanskrit. T R Krishnacharya.. The Santiparvan Part 3. Sanskrit. The Samgraha Chuda Mani... 510 pgs. 88 pgs. 1954. Unknown.r. 90 pgs. The Sanskrit Third Reader. Gopala Sastry N. The Saiva Upanisads With The Commentary Of Sri Upanisad Brahma Yogini. Sanskrit. 894 pgs. Unknown. Sanskrit. The Saiva Upanisads. The Sarasvata Vyakarana Part Ii.. Sanskrit. Sanskrit. Rangaswamy Iyengar H R. Pandith Anantharam Sastri Vetal. The Sahitya Darpana.. Gopinath Kaviraj.. 2002.. The Samskara Dipika Part 2. Unknown... 300 pgs. . 1933. Sanskrit. Sanskrit. 1950.. Sanskrit.. 410 pgs. 438 pgs. 376 pgs. Durgaprasa. 1951.rangaswamy Iyengar. Pandit Sri Krishna Mohan Thakur. Unknown. Unknown. 558 pgs. sanskritdocuments... 1935. The Sangita Sudha.. Unknown.. Pandith Nava Kishore Kara Sarma. The Samskara Ganapathi.. Sanskrit.. T.. 1938. Sri H. 268 pgs. The Samgraha Cuda Mani.d. Language. The Santiparvan Part Ii Apaddharma And Concordance.. Major B. 1243 pgs. Unknown. The Saiva Paribhasa. 1940. Sanskrit. Unknown.… Th S t th b h A di T Th M dh di R i U k S k it 0 694 79/167 . Sanskrit. Sanskrit. 1954.chintamani Dikshit. 1921. Literature. Unknown. Pandit A.. The Satapathabrahamana. Sanskrit. 1950. Shripad Krishna Belvalkar... Unknown. 348 pgs. Pandith Nava Kishore Kara Sarma. Unknown.. The Satapathabrahmana. 1947. The Sandilya Samhita Bhaktikhanda. The Samanya Vedanta Upanishads.. Venkata Kavi.basu. Sanskrit. 366 pgs. 270 pgs... The Samskara Dipika Part 3. 334 pgs. dhareshvara bhojadeva... Pandit A. 400 pgs. 546 pgs.. 216 pgs.. 1921. Religion.... Sanskrit. 288 pgs. Unknown. The Saktivada. P S Sundaram Aiyar.r... 1938. Mahadeva Shastri. The Sakta Upanisads. Sanskrit. Mahadeva Sastri... Sanskrit.subrahmanya Sastri. 64 pgs. A. The Samanya Vedanta Upanishads.. 671 pgs. S. The Sacred Books Of The Hindus Vol Viii.... 1929.. Sanskrit.. Unknown. 241 pgs. 1934. Sanskrit.r. Dhundhiraja Sastri.. The Saiva Paribhasa.mahadeva Sastri.2/14/2011 A list of scanned Sanskrit books at III… The Sabdha Kausthuba. The Samkhya Karika. The Saraswathi Kanthabharana. Sayanacarya. 1950..

Wasudev Laxman Sastri Pansikar. The Siva Sutra Vartika Vol Iv And V... 385 pgs. 360 pgs. Sanskrit.. 0. M M Shri Gangeshopadhyaya. Utpaladeva...... Social Sciences. 1931. 809 pgs. 282 pgs. 1958. Sayanacarya. 1937. K Sambasiva Sastri. Unknown. 694 pgs. Unknown. 830 pgs. The Sidhant Shiromany. Sanskrit. 1901.. Sanskrit... 182 pgs. The Srinivasavilasa Champu Of Venkatesa Kavi Edition Iii. 1909. Sanskrit. . 848 pgs..… 80/167 . The Spandakarikas Of Vasugupta With The Nirnaya. Pandit Madhusudan Kaul Shastri. The Satapathaprahmana. 1972. 0. 622 pgs. Unknown.org/…/SanskritIIIT. 98 pgs. Sanskrit. Unknown. 412 pgs.. Sanskrit. Kavyas. The Shantakuti Vedic Series Vol X I I I. Sanskrit. Sanskrit.. Philosophy. Vishva Baandhu. Unknown. The Satapathabrahmana According To The Madhyandina Recension Vol V. Unknown. 352 pgs. Chatterji J C. The Srauta Sutra Of Apastamba. The Siddhitrayi And The Pratyabhijna Karika Vritti Of Rajanaka Utpala Deva. -. The Shantakuti Vedic Series Vol Xv. The Sriharicarita Mahakavya Of Srihari Padmanabhas Astrin.. 1963.. 64 pgs sanskritdocuments. Sanskrit.. The Shantikuti Vedic Series Vol X I V. 240 pgs. K Balarama Panicker. 139 pgs.. The Silparatna Of Sri Kumara.. Vishva Bhandhu.. The Spanda Karikas With The Vivriti Of Ramakantha.. The Srauta Sutra Of Apastamba. The Sri Bhramara Gita. S S Surya Narayana Sastry.. Sanskrit... 260 pgs. Social Sciences... 1913. Unknown... Sanskrit. Sanskrit. Unknown. 1921. Sanskrit. Unknown. 240 pgs. Sanskrit. Sanskrit. The Srautasutra Of Apastamba.. Narasimhachar. 963 pgs. Philosophy. 156 pgs. Pandit Udai Narayan Singh... The Srungara Tilaka Bhana Of Amabhadra Deekshita. Unknown. Sanskrit. 480 pgs.venkatacharya. The Sivadristi Of Srisomanandanatha With The Vritti. 1948. 206 pgs. The Sraddhaviveka. 884 pgs. 1925. Kshemaraja. Sanskrit. 1944. Sanskrit. Sanskrit.. Narasimhachari. Unknown. Sanskrit.. Sanskrit. Sanskrit.. Unknown. Viswabhandu.. 1910.. Unknown. 1983. Sanskrit. 1965... The Shiva Upanisads. 324 pgs.s. Unknown. 1950... M M Sri Rudradhara. Unknown. Sanskrit... 652 pgs. 1944. 809 pgs... 2002. 1933.. 1937. The Siddhanta Kaumudi With The Tattvabodhini Commentary. Sanskrit. Gita Devi Joshi. Sanskrit. 182 pgs. 1944.... Unknown. Unknown. Philosophy.. Jayakrishna. 1929. 1934. The Sri Mrgendra Tantram. 1971.. J C Chatarji Vidhyavaridhi. Pandit Durga Prasada.. pandit sivadatta shastri. The Shantakuti Vedic Series Vol V I I I. Unknown. Sanskrit.. Sanskrit. Unknown. The Siddhantalesasangraha Of Appayya Dikshita. 1930. Philosophy.. The Smriti Kaustubha Of Anantadeva.. Sanskrit. pgs.2/14/2011 A list of scanned Sanskrit books at III… The Satapathabrahmana According To The Madhyandina Recension. -.. Viswabhandu. Unknown.. T. Sanskrit. Unknown. 440 pgs.. Unknown. Narasimhachari. Pandit Madhusudan Kaul Shastri. 1962. The Siddanta Kaumudi Of Bhattoji Deekshit.. 1916. A Mahadeva Sastri. Pandit Kedarnath. 201 pgs. The Savyabhichar Prakaranam.. 780 pgs.. 1940. The Sree Narayana Vijayam.

1939.. Sanskrit. Mangal Deva Shastri. 142 pgs. The Trikanda Cesha.. Sanskrit. The Tantraloka Of Abhinava Gupta. Unknown. 1932. Madhusudan Kaul Sastri.. 1950. The Tantraloka of Abhinava-gupta vol Xii. 142 pgs. 48 pgs.. Kshem Raju. Jagaratha.. The Stava Chintamani Of Bhattacharya.. Unknown. 1936... The Tautatitamatatilaka Part I. Mahadeva Shastri A. Unknown. 327 pgs. Madhusudan Kaul Sastri. I S Pawate. Madhusudan Kaul Sastri. Philosophy. The Trantraloka Of Abhinava Gupta Vol 3. Sanskrit. Sanskrit. Seelakkhadha Maha Thera. Religion. The Students Guide to Sankrit Composition... Pandit Mukund Ram Shastri.. Sanskrit..rajanaka. Unknown. Sanskrit.. Unknown.. K Sambasiva Sastri. Madhusudan Kaul Sastri. The Ujjwalanilamani Vol 2.. 356 pgs. A Collection Of Sanskrit Nouns.. 366 pgs. Sanskrit. Sanskrit. 913 pgs. Rajanaka Jayaratha. Jadavji Trikumji Acharya. Unknown. The Tattvartha Deepa-nibandana.. Madhusudhan Kaul. 678 pgs.. 1921... The Sushrutasamhita Of Sushruta. A.. 624 pgs. Unknown. The Tantraloka. Sanskrit. 694 pgs. Sanskrit. T R Chintamani. Rajanaka Jayaratha. 1938. 1881. 1913. Unknown. Sanskrit. Unknown. Pandit Bhavadatta Sastri... The Tandyamahabrahmana Part-ii. The Tantraloka Of Abhinava-gupta Vol 5.annambhatta. The Svacchandatantra With Uddyota Of Ksemaraja Vol Iii.. 306 pgs. A list of scanned Sanskrit books at III… The Stapathabrhmana. 1986... Vaman Shivaram Apte. Unknown. 1932. Sanskrit. 1936. Chinnaswami Sastri. The Structure Of The Ashtadhyayi... 0. . Unknown... Unknown... 1986. Sanskrit. Sanskrit. 1928. 1986... 695 pgs. The Svacchandatantra With Uddyota Of Ksemaraja Vol I.. Sanskrit.. 566 pgs. Unknown.. The Students Sanskrit English Dictionary. Jayaratha R. Harishankar Onkarji Shastri... 1963. The Udayavarma Charita. The Tilaka Manjari Of Dhanapala.2/14/2011 pgs...... 266 pgs. Philosophy. 1942. The Svacchandatantra With Uddyota Of Ksemaraja Vol Ii. The Unadi Sutras. Sanskrit. 392 pgs. 1918. Unknown. 788 pgs. The Tantraloka Of Abhinava Gupta Vol I. 1992. Shri Rupagoswami. 1933. Jayaratha R. 1918. The Tripurah Rashya. 253 pgs.org/…/SanskritIIIT. The Unadi Sutras In Various Recensions 2. 1928.. The Tantraloka Of Abhinava Gupta Vol X. Sanskrit. Sanskrit... Sanskrit. Religion. 1936.. 1938. Sanskrit. 136 pgs. Madhusudan Kaul Shastri. 350 pgs. Unknown.. The Taittiriya Brahmana Part Ii. Linguistic. 1986. 1943. Unknown... Unknown. The Tantraloka of Abhinava vol Ii. 444 pgs... 170 pgs. Pt. Unknown. Unknown. Sanskrit. Religion. The Tattvatraya. 1916.m.. Sayanacarya. Sanskrit. 630 pgs. 1921. Sanskrit. Sri Ramachandra Panasikara Sastri. 1936.. The Svacchandatantra With Uddyota Of Ksemaraja Vol Iv. 441 pgs.. Sanskrit. 508 pgs. Sanskrit.. 232 pgs sanskritdocuments. Unknown. 502 pgs. 242 pgs..guruprasad Shastri. Sanskrit. Sanskrit. 2002. The Tautatitamatatilaka Part Ii. vaman shivram apte.. Philosophy. Sanskrit. 368 pgs. Sree Mukunda Bala Sastry. Unknown. 363 pgs. The Tarka Sangraha Of M... 412 pgs. 0. Sanskrit. 265 pgs. Sanskrit.. Sanskrit. Chinnaswami Sastri A.… 81/167 .

. 1096 pgs. G K Bhat. Linguistics Literature. The Vikramorvasiyam Of Kalidasa Edition I. Vaidyasastranipunah. 279 pgs.. T R Chintamani. 1989. Sanskrit.. Pandit Mukunda Rama Shastri. Sanskrit... Unknown. The Vivadhachintamani Of Vachaspati Mishra.org/…/SanskritIIIT. 587 pgs. 1942. 400 pgs. Sanskrit.. 1893. 374 pgs. The Upanishadbhashya Vol. Unknown. The Vidusaka. Sanskrit. 1932. The Unadisutras In Various Recensions 1 Of Svetavanavasin.. Unknown. Sanskrit. T R Chintamani. 1992. The Vajasaneyi Samihita. 307 pgs. Sanskrit. Unknown. 244 pgs. The Vakyapadiya... The Vizianagram Sanskrit Series Volume Ii Part I.... Language. Madhusudhan Kaul. Unknown. Pandit Sivadatta. Sanskrit. Literature. Unknown. Sanskrit. Sanskrit.. Unknown. Sanskrit. The Vikramorvasiyam A Sanskrit Play Edition Iii. Linguistics. Dr Albrecht Weber. The Vrishabhanuja Natika Of Mathuradasa Edition Ii. A list of scanned Sanskrit books at III… The Unadisutras In Various Recensions. Sanskrit. Art. 1928. 1985.l..… 82/167 . Hari Raghunath Bhagavat.. 1961. Pandit Sivadatta.atreya. Sir Ganganatha Jah. 338 pgs. 1984. Unknown.. Prof. The Vatulanatha Sutras.. Unknown. 642 pgs. Unknown. The Vikramorvasiya Of Kalidasa. 236 pgs. Sanskrit.. 64 pgs.. 1918. The Vijnana Bhairava.. Upanishads. The Vikramorvasiyam Of Kalidasa.. 1932. Sanskrit.I I Part. The Upanishad Bashya Vol Ii Part I. 1959. Literature. 1942. Unknown.. 472 pgs.. Sanskrit.. The Unadisutras In Various Recensions. The Vidyaparinayana of Anandarya Makhi. Language...I I.. 400 pgs. Pandit Sivadatta. Literature. The Vishnu Purana A System Of Hindu Mythology And Tradition.2/14/2011 pgs. K V Sarma. 764 pgs. Unknown... B... Linguistics Literature. Linguistics. The Vamana Purana. Sanskrit. 1942. 296 pgs. 1933... 66 pgs sanskritdocuments. Hari Raghunath Bhagavath. Unknown. Sanskrit. H H Wilson. Unknown. 1927. 1972. Unknown... The Unadisutras In Various Recensions Vi. The Varaha Mahapurana. The Varshakrityadipika With Kalanirnaya And Vratodyapan. 414 pgs. pandit nityananda panta parvatiya. H D Velankar. 104 pgs. Sanskrit. pgs. 1980. 91 pgs. The Vishnu Bhakti Kalpalata Of Purushottama... 560 pgs.. Unknown. ganganatha jha. Sanskrit.. 1923. Unknown.. 1891. Acharya Baladeva Upadyaya. The Unadi Sutras. 244 pgs. Sanskrit. The Vivadachintamani Of Vachaspati Mishra.. T R Chintamani.... Anand Swarup Gupta. Sanskrit. Language. Sanskrit. The Vasistha Darshanam. Sanskrit. Arthur Venis. Sanskrit. 1917. Pandit Kedharinath Sarma... 1927... Linguistics. Sanskrit. Upanishadas. 474 pgs.. Sanskrit.. 1933. The Vrishabhanuja Natika Of Mathuradasa.. Pandit Surendra Nath Shastri. Pandit Shankar Pandurang. Unknown. Sanskrit. Svetavanavasin. 122 pgs. Sanskrit.. S B Athalye. 1927. 58 pgs.. Sanskrit. The Veda Bhasya Bhumika Samagraha. 1993. 388 pgs. 1942. 307 pgs. 1968. Unknown. 1901. 285 pgs....

2/14/2011 pgs... 1883. 602 pgs. T. Tittriyopanishat Atharaiyopanipancha. Language. History... 1952. Geography. Sanskrit.. The Works of Sri Sankaracharya Vol Xvi. 1912. Chaara~ya Yativrxshhabhaa. The Yadhavabyudaya Of Sri Vedanthacharya. Tirthacinthamani Vol Ii.. Literature. Sanskrit.. Sanskrit.. Tirthacinthamani Vol Iii. 305 pgs. 1931..org/…/SanskritIIIT.. Sanskrit... 1948. 0. 1994. Linguistics. 1931... Sanskrit. Unknown.. Sanskrit. Sanskrit.. Linguistics. Mahamahopadhyaya Pandit Sivadatta.. Sanskrit. Sanskrit. 1993. . Unknown. 100 pgs. 474 pgs.. Sanskrit. Theology. 1911. Sanskrit. 1951. The Works Of Sri Sankaracharya Volume Iv. Niharranjan Ray. 1950. 622 pgs. 524 pgs. Thomas Hardy. S C Sen Gupta. Unknown. Literature. 451 pgs. History. Burke A Hinsdale. Unknown. Tiloya . Sanskrit. 1983. The Works of Sri Sankaracharya.. Unknown. 68 pgs. 634 pgs. Theravada Buddhism In Burma. Unknown. Tirthacintamani. Sanskrit.. 1911.. The Works of Sri Sankaracharya.. pgs. Mahdeva Sastri.. Unknown. 98 pgs. Art. 202 pgs.srinivasagopalachar. Tilakamanj-jarii Da~vitiiyaavrxtti.. Philosophy. Tinantarnavatarani. Religion. 516 pgs. 1961. W Redloff. 639 pgs. 272 pgs. 350 pgs. Tiloya Pand-nd-attii Dditiiyo Bhaaga.… 83/167 . 654 pgs. Sanskrit. 0. 1920. 327 pgs. Biography. Geography Biography History. T.. 1965. Bhagavat Patanjali.Pannatti Part Ii. Kamalakrishna Smrititirtha. Biography. Sanskrit. The Unadi Sutras.. Sanskrit.. The Vyakarana Mahabhasya Part 2. 1944. Unknown. Archicture. Kamalakrishna Smrititirtha. The Yudhishthiravijaya Of Vasudeva.r. Sanskrit. The Yadavabhyudaya Of Sri Vedantacarya. Geography. Unknown. Sanskrit. The Unadi Sutras. Pandith Ramchandra Jha.. Sanskrit. 252 pgs. Vishrug. Sanskrit. The Yadavabhayudaya Of Sri Vedantacharya.. Brahmadattaji Jigyasu.. 190 pgs. Geography. Dr P L Vaidya. T T Srinivasa Gopalachar. 305 pgs. History. 162 pgs.. 426 pgs. 0. Geography Biography History. Unknown.. Sanskrit. 1948.. 1910. Tisastvustik.. 1936. Samarapungava Dikshita. 1815... Sanskrit. Bhagavat Patanjali.. Thrastadyayi Bhashya Vol I. Sanskrit. A C Woolner.. Art. Chit'and-iisa Malhaararaamaarava. Tirthacinthamani Vol 1. Sanskrit.. Biography. Sanskrit... 99 pgs. 1944. Sanskrit.. . Kamalakrishna Smrititirtha.. Pandith A. The Yatra Prabhanda. Literature.. 700 pgs. The Unadi Sutras... Thrikalavachedhikavadhaha.. The Yoga Upanishads. Thorale Shaahu Maharaaja Yaan'chen' Charitra Aavrxtti Da~vitiiyaa... 116 pgs.. Unknown.. 1938. Language. T T Srinivasa Gopalachar. Shriidanapaala... 234 pgs. A list of scanned Sanskrit books at III… The Vyakarana Mahabhasya Part 1. Sanskrit. Sanskrit..chintamani.. Linguistics. Unknown. 1930. sanskritdocuments. 126 pgs.. Language. Thruhan Sutr. Thirteen Trivandrum Plays Attributed To Bhasa Vol Ii. Subrahmanyakavi S. 0.

1929.. Sanskrit. Language.. 1933.... 1941. rajendra swarup gupta. 1929.. Unknown. 1936. 1941. Tristhaliisetu 78. Chintaamand-inaa Ti Raa. Upanisad Vakya Maha Kosa Vol 1.. Sanskrit. Theology. Literature. Sanskrit. Gajanana~ Shambu Sadhale Shastrii. Sanskrit. Sanskrit. Naaraayand-a. Two Plays Of Bhasa. 194 pgs. P. Chintaamand-inaa.. 238 pgs. 1929. Psychology. Agama Prabhakara Muni Punyavijaya....m. Kumham Raja. Unknown. Sanskrit. 1934. Krishnaswamy Iyer. Trikonamithi. Upanishhada~vaakyamahaakosha Uttaraara~dhaha~.. Religion. Two Vajrayana Works.. 1953. A. Unknown. Und-aadisuutraand-i. 1966. Unpublished Upanishads. 283 pgs. Linguistics.. Sanskrit. 256 pgs. 122 pgs.... Art. 1995. Shriinaarayand-ashan'karaananda. Linguistics. Veeraraagaya... 638 pgs. Sanskrit. 544 pgs. Und-aadi Suutraand-i Ditiiyo Bhaaga Grantha 7. Tripurabhaaratiilaghustava granthaan'ka 1. 1959. 1929. Sanskrit... K M Munshi.. 0.. 94 pgs. Sanskrit. Dinakar Krishna Gokhle. Unknown. shastri gajanan shambhu sadhale. Sri Sankaracharya. 147 pgs. C. 210 pgs.. Theology. Religion. Trin'shachchha~lokii Grantha 104.org/…/SanskritIIIT. 284 pgs. Unknown.. 1961.. Sanskrit. 675 pgs. Jagadgurvo Vijaynante Taramah. Sanskrit. 1933. Umas Mirror... Theology.. Sanskrit.. Unknown. 1982.. Unknown. 158 pgs.. Religion. Itaruka.. Literature. 1925. Sanskrit. Upanishhadaan' Samuchchaya Da~vitiiyoyamang-kanaavrxtti. pgs.. Aapat'e Hari Naaraayand-a. Chintaamand-inaa. Unknown. Dr. Linguistics. Unknown. V Krishnamacharya. Und-aadi Suutraand-ii Bhojiiyaani Shhashht'ho Bhaaga. Upanishhada Samuchchaya. 1934. 1952. Unknown.. Unknown. 1946.. 1923. A S P Ayyar. 316 pgs. Linguistics.. Language. 1933. Naaraayand-a Dand-d'anaatha. 308 pgs. Upadesha Sahasri.. Linguistics. Theology. 1953. Sanskrit..… 84/167 . Philosophy. Toegyehak Libery Part I Vol 4. 1933...2/14/2011 A list of scanned Sanskrit books at III… Toegyehak Libery Part I Vol 4.. Linguistics Literature. Sanskrit. Und-aadi Suutraand-i Grantha 7. Damodhara Pand-d'itavara. Sanskrit. Triddnimathvibhodhini. Religion. 1984.. 62 pgs. Sanskrit...sudhakar Malaviya.. Vasudeva Lakshmana Sastri... Ullagharaghava Nataka.. Literature. 665 pgs. Sanskrit. 532 pgs. Upakarma Paddhathi. Shaastri Shan'kara. Udaya Vadantha Granthamala. Unknown. 302 pgs.. Theology. 1933. Upadeshasahasri.. Und-aadisutraand-i Prathamo Bhaaga. 52 pgs. 720 pgs. Sanskrit. Udararachavam of Kavimalla Mallacharya. Literature. Language. Language. Theology.. Sanskrit. Sanskrit. Unmattaraghava. 60 pgs. Religion. Sanskrit. Literature. 237 pgs.. sanskritdocuments. Ukttivyaktiprakarand-a. 1952. 403 pgs. 508 pgs. Sanskrit. The Arts.. 1925. Upanishads. K. Theology.. Sanskrit. 97 pgs. Sanskrit. Theology.. 1937.. Religion. Sanskrit. Religion. Chintaamand-ii Ti Ra.. Benoytosh Bhattacharyya. Sanskrit. Und-aadisuutraand-i Bhojiiyaani Shhashht'ho Bhaaga Grantha 7.modi. 330 pgs... Sanskrit. Translation Of Siddhanta Bindu. Pandith Sri Durgadutta Tripathi. Sanskrit. 1940.. Art. Somatilakasuuri. 314 pgs. Language. Religion. Simhavira Dura~ga. 201 pgs.. Sanskrit. Upadeshasahasri Part I. 233 pgs.

Vaiiyakarana Siddhant Laghumanjusha. Vaidyakiyasubhasitasahityam. 1949. 516 pgs... 450 pgs. Psychology. Vaijayanthi Kosa Volume Ii.. Religion Theology. 172 pgs. Vaidik Vadgamya Ka Itihas Vol I I.. Dr Gaurishnakar Mishra. Philosophy.2/14/2011 A list of scanned Sanskrit books at III… Upanishhadbhashhyama~ Dvitiya Bhaaga Dvitiya San'skarand-ama~. 1941. Religion. Theology.... Sanskrit. Sanskrit. Bhagva Dutt. Unknown. 296 pgs. Sanskrit. Sanskrit. 1935. Vedas. 444 pgs. Vaaraahagrxhma Suutra Bhaaga Xviii. Sanskrit. Religion.. Pandit Pannalal Jain. Srinivasamakhi Vedantadesika. 106 pgs. Usaniruddha.. Vaalmiikii.. 411 pgs. Vaalmiikiiya Raamaayand-ama~ Baala Kand-d'ama~ Paqs-chimottarashaakhiiyama~. Shriishan'karaachaara~ya. Sanskrit. 348 pgs.. Uttararamacharitra. Narayan Ram Acharya.. 541 pgs. Bhid'e Sadaashivashaastrii. 66 pgs. 1934. Sanskrit. Sanskrit. Vaishmavism.. 375 pgs. 376 pgs. Gajaanana Shambhuputro. Vaidik Avem Vedottar Bharatiy Sanskruthi.. Srinivasamakhi Vedantadesika. 1997. Unknown.. Pandarinathacharya. Unknown. Theology. Urubhangam Breaking Of Thighs. Balakrishna Misra. 766 pgs..org/…/SanskritIIIT. Vaidik Sathya Prakasha. 0. Advaitam. Sanskrit.. 1932. Vaidik Sahitya Ka Itihas. Utsarjano Pakarmapaddhatih. Unknown. Vaidika Padanukramakosa Vol 2 Part 1... 1976. W.caland. Sanskrit. Unknown. Subramanyamu V. Unknown. Sanskrit. Sanskrit. Sanskrit. Philosophy. Vaikhamsa Gruhya Sutram vol Ii. Sanskrit.. 309 pgs.. Sanskrit. 659 pgs. 1954.. Sanskrit. Vag Vallabha Of Sriduhkhabhanjanakavi. 1940. 420 pgs..Srautasutram.… 85/167 . Sanskrit. 1933. Sanskrit.. 1931. Upasakadyayan. Unknown. Philosophy. Shriimadahobalasuuri. Psychology. Sanskrit. 1945.. 1932. 64 pgs... Vadanakshatramala... Sanskrit. Gruhya Sutras. Unknown. Tirunoymozhi. 2001.. Unknown. Religion.. Upanishhaddaakya Mahaakosha Prathama Khand-d'a. 1930... 1933. sanskritdocuments. Natural Sciences. 1921. Theology.. 1912. Vadavali. 639 pgs. Sanskrit. Vidwan Satyadhyanacharya. Literature. 1981. 693 pgs.. 44 pgs. Veng-kat'araamashara~maand-an. 1940. Sanskrit.. Dr Ram Murthy Sharma. Vaikhanasa Gruhya Sutram vol 1... 161 pgs.. Vada Varidhi.. 1928.. Vaikhanasa . Sanskrit. 1943. Vaajasaneyipraatishaakhyama~ Kaatyaayanaprand-itama~... 200 pgs. Visva Bhandu Sastri. Sanskrit. S Subramanya Sastri. Psychology. Sanskrit. M M Pandit Deviprasada Ravichakravarti.. Sanskrit. Shaastri Shamaa. 1987. Sanskrit.. Theology...... Sri Somadev Suri. Unknown.. Sanskrit. Unknown.. Unknown.. Sanskrit. 210 pgs. 1971. Religion. 408 pgs. Appayya Dikshita. Sanskrit. Subramanyamu V. Upanishhadratnaprakaasha Ratna Chhaandogyopanishhada~... Unknown.. 391 pgs. Sanskrit. 672 pgs. Pandith Madhava Sastri Bhandari. Paridath Kalarama Shastri. Vaidhyachandrodaya Vol Ii. Bhishkakavi Sri Rashachandra. 1997.. Upanishhadratnaprakaasha Ratna Chhaandogyopanishhada~. 1925. 1949. 1943. Vaakyaara~tharatnama~... 142 pgs. Sanskrit. 1954. 576 pgs. 355 pgs. 605 pgs. Bhid'e Sadaashivashaastrii. Uttara Purana Of Acharya Gunabhadra. C R Devadhar..

1960. Linguistics. 1929. Sanskrit. 1961.. 1927.. Sanskrit.. 1993. Vaiyakarana Siddhanta Laghu Manjusha No 228.. Linguistics. 360 pgs.. 1925. Vaishampaayana. Literature. Vanamala.. 326 pgs. Vaiyakarana Siddhanta Laghu Manjusha No 227.. govindlal hargovind bhatta... Religion... 222 pgs.. 1938. Varaang-gacharitama~ Prathama San'skarand-ama~. Unknown. Vyakarnopadhyaya And Sahitya Tirthac. Language. Pandari Krishnacharya. The Arts. 110 pgs. 104 pgs. Sanskrit.org/…/SanskritIIIT. 0. Valmiki Ramayana Volume One. Sanskrit.. Unknown.... Sri Achyuta Krishnananda Tirtha. 1925. 108 pgs. Sanskrit. Indian Logic. Sanskrit.. 1961. 1928.. 292 pgs. 1929. Vaiyakarana Siddhanta Laghu Manjusha No 237. 1929. Sri Nagesa Bhatta. 0. Unknown. Vaiyakarana Siddhanta Laghu Manjusha No 253. 508 pgs. 110 pgs. Sanskrit. Sri Nagesa Bhatta. Sanskrit. Unknown. Religion. Vaiyakarana Siddhanta Laghu Manjusha No 328.. Sanskrit. 96 pgs. 1953. Unknown. Vanshabhaskar.2/14/2011 A list of scanned Sanskrit books at III… Vairagy Shatak. Unknown. The Arts. Sanskrit. 1172 pgs. 104 pgs. Sri Ananta Sastri. 104 pgs. Unknown. Sanskrit. Vaiyakarana Siddhanth Laghumanjusha. 227 pgs. sanskritdocuments. Sanskrit. venkatrao rayasam. Sri Nagesa Bhatta. 1954. 190 pgs. Sri Nagesa Bhatta. . Sri Nagesa Bhatta. Dr Dhanurdhara Jha.... Sanskrit.. Sanskrit. Sanskrit. Vaiyakarana Siddhanta Laghu Manjusha No 212. 1913. Sri Nagesa Bhatta. Sanskrit. 102 pgs. Unknown.... Literature. Vaiyakarana Siddhanta Laghu Manjusha No 238. Sanskrit.. 0. Vaiyakarana Siddhanta Laghumanjusha No 213. Vaiyakarana Siddhant Laghumanjusha. Unknown. Vaiyakarana Siddhanta Laghu Manjusha No 211.. 114 pgs.. Literature. 1984.. Unknown. Psychology. 1929. Pandith Madhava Shastri. 106 pgs. Pandith Sri Sitaram Sastri. 314 pgs. Muni Sri Jambuvijayaji. Kand-ada Mahara~shhi.... Vamanapurana... 1913. 1929. Vaiyakarana Siddhanta Laghu Manjusha No 192.. Sanskrit. Literature. Philosophy.. Sanskrit. Sri Parameswardin Pandey. Vakyartha Vivechanam. Pandith Sri Sitaram Sastri. 144 pgs.. Sanskrit. Sanskrit.. Vaisheshhika Dara~shana. 106 pgs. 1924. 376 pgs. 88 pgs. Vakrokti Jivita Of Raja Rathnakara. 1928. 1924. 186 pgs.. Vaisakha Mahathyam.. Vanamala A Commentatory On The Taittiriyopanishad Bhashya. Unknown.. 0. Sri Nagesa Bhatta.. Literature. Sanskrit... 1974. Vaishampaayananiitiprakaashikaa.. 414 pgs. 354 pgs. Vamana Suktam. Unknown. Linguistics. 106 pgs. Unknown... Sri Achyuta Krishnananda Tirtha. Language. Vaiyakarana Siddhanta Laghu Manjusha No 191. Sanskrit.. .. 2002.. Sanskrit.… V h h L Li i ti Lit t S k it 0 502 86/167 .. Theology. Unknown. Vaiyakarana Siddhanta Laghu Manjusha No 214. Shriijat'aasin'hanandi. Sanskrit. Unknown. Sanskrit.. Language.. Unknown. Sanskrit. Vaisesikasutra Of Kanada. Unknown.. Sri Nagesa Bhatta.. Sanskrit. Krishna Singh ji. Sri Nagesa Bhatta. 112 pgs.

Varahi(bruhat) Samhita. Sanskrit. 413 pgs. Mishra B N. Unknown... Sanskrit. 215 pgs.. Vedanga Prkasa.srinivasaraghava Aiyangar. Vaishmavism. Vedanta Sara Cintamani. Unknown. 1942. Vedas. 2000. 236 pgs. Kaviraj Nagendra Nath Sen. 1967. Vararuchasanghrahar. Sanskrit. 1976. Unknown. Language. Unknown. Pramodini Pandu. 1986. Sanskrit. Sanskrit..e. Sanskrit. 1998. Religion... Ganga Prasad Upadhyay.. Sanskrit. 272 pgs. Philosophy. 1942. Sanskrit..r. Sanskrit. 1992. Sanskrit. Kaat'adare Maadhavakeshava. Unknown. 106 pgs. Unknown. 1964.. 440 pgs. 237 pgs. 1991. sanskritdocuments. 2004... 0. Sanskrit... . 130 pgs.. Sanskrit. B. Sanskrit. 190 pgs. Dr B Rama Raju. Vedakhasarodhar. Vedaanta Tattva Viveka. Vedantanayabhushanam. 1984. Sanskrit.a. 0. Unknown.. Vedakalija Narisiksha.. Pandit Harilal Jain..org/…/SanskritIIIT.. Literature... Vasunandi Shravakachara. Sanskrit... Sociology. 2000. Religion.2/14/2011 A list of scanned Sanskrit books at III… Varahamahapuranam. Narayana A. Vasantatilakabhaand-a. Shriinrxsin'hashrami. Veda Praveshah.… 87/167 . Language.. 1965... Ramananda Saraswati Swami. Vasu Caritram. Vedandak. Vedanta Sutramu Mdravali. Narayana. 548 pgs. 81 pgs. Sanskrit. 234 pgs. 1838. 504 pgs. Vararuchi Avam Hemachandra Virachitha Prakrutha Vakarna 2739. Unknown. Sanskrit. Sanskrit.n. Unknown. 456 pgs. Vedaantasutramukttaavali. 340 pgs.. Psychology. Psychology. . Unknown. Philosophy.. Linguistics. 1984. History.sree Krishna Sarma. Sanskrit.. Unknown. Veda Pravachana. Shri Brajnath Sharma... 1971. Sanskrit. Vedanta Darsana. Vedanta Sutramu Mdravali. Psychology. Sanskrit. 249 pgs. 1955. Kaviraj Nagendra Nath Sen. 1986. Sanskrit. Sanskrit. Vaydyak Sabdasindhu. Vararuchasangraha.. Philosophy. Religion... 1986.. Baladeva Prasad. Biography.. 425 pgs. 1270 pgs. Philosophy. Dr. Shivasahaaya. Dr.. Ganga Prasad Upadhyay.. Veda Samiksa. Unknown... 522 pgs. Sanskrit. Literature. S S Suryanarayana Sastri... R K Prapannacharya. Sanskrit Samhitas. pgs. 238 pgs. 1948. Vedanta Prakasa. A. 872 pgs. 1872. 101 pgs. 1973. 62 pgs. Sanskrit.pandey.. 81 pgs.. Unknown. Psychology. Veda Bhasya Bhumika Samgraha. Varahamihira Horasastram. Chenna Reddy. Sri Giridhar Sharma Chaturved. Unknown. Vedaantaparibhaashaa. Vatsaraaja Udayand-a. Bhagavadraamaanujama.. Vedanta. Sanskrit.. 363 pgs.... 1969.. Geography. Varivasya Rahasya Accn0 1281.. Theology..venkatesacharya. Sanskrit. Aadhvrina~ Dhara~maraaja. 1952. Sri Yudishtara Mimansa.. Unknown. Unknown.n. 193 pgs.. Philosophy.. Vedaanta Raamaayand-a Bhaashhaat'ikaa Sahita. Vedantakaustubhaprabha Accn0 478. Sarasvatii Bramhaananda. 292 pgs.. Vedanta Sutramu Mdravali... Sanskrit. 1951. Sanskrit. Namitha Garg. Sanskrit. 82 pgs.. 1911....j. Subramanya Sastri S. Sanskrit. Linguistics. Sanskrit. 460 pgs. 80 pgs. 0. 92 pgs. Vedaantasaara.. 1953... Sanskrit. Shriivaradaacharayaa. 1915... 502 pgs. Unknown. 1998.

1988.. 1998. Sanskrit. Sanskrit... 1992. Unknown. Unknown. Unknown. 1910. Venkateswari Thatkruthinam Adhyayanamu.. 150 pgs. Literature. vishva bhandu. Vedic Padhanukrama Kosah Vol 5 Part 1. 362 pgs. Literature.. Sanskrit. Unknown. 366 pgs. Vema Bhupala Charitam.. Sanskrit. Unknown. 700 pgs. Vedanthanamaratnasahasram. Sanskrit. 1970. 1945. 892 pgs.. 238 pgs. 338 pgs... 1945. Sanskrit. Philosophy. Language. 1964. Sanskrit. Sanskrit. Sanskrit. Sanskrit. 1939. 500 pgs. Sanskrit.. Venkatasuris Nauka Charitram In Sanskrit. 1864.. Wasudev Laxman Sastri Pansikar. Sanskrit. Vedic Padhanukram Kosah. S. 117 pgs. Sanskrit. Vaman Bhattacharya. Vedavyasaparampara.. 290 pgs. 115 pgs. Krishnamurthysahastryvarya.. 1984. Vedic Hymns. 758 pgs. Sanskrit. 76 pgs... sanskritdocuments. 1945. Vedanthasindantha Mukthavali.r. S N Srirama Desikan. Unknown.. 1955. 666 pgs. Srimithra Mishra. Unknown. 1961.. Vedharya Sangrahah Geetha Bashya Gadyayatra. 998 pgs. Visva Bandhu. Unknown. Art... 704 pgs.. visva bandhu sastri. Sanskrit. Sanskrit... 258 pgs.. Sanskrit. 1959. Veeramitrodaya. 209 pgs. 292 pgs. Unknown. Unknown. Vedhaththa Suthra Mukthavali. S S Suryanarayana Sastri. Unknown... Jambhaladatta... Linguistics.. Vedic Padhanukrama Kosah Part 1.. Vemanapadyamulu In Sanskrit Slokas.. Srimath Paramahamsa Parivrajakacharya. Vishva Bhandu... P Sambamoorthy.krishnamurthy Shasthry. 2001. Sanskrit.... -.... Vedastuti Volume Iii. Unknown... Unknown. Dr G Swaminath Charyulu. Vedic Hymns.. 1969. Sanskrit.. Vemabhupala Charitram. Sanskrit. Sanskrit.. 1989. Panchanana Bhattacharya Sastry.. 1971. Vetaalapanj-chavin'shati. 1962. Sanskrit.... Pandit Mitra Misra. .. Pandit Shada Shiv Sharma. 390 pgs. Dr Kunwar Lal. visva bandhuu sastri. 644 pgs. Unknown. Venkatachala Ithihasamala Anantarya.k. Vedic Padhanukrama Kosah Vol 3 Part 2.. 806 pgs. Sanskrit.. Sanskrit. 1947... Sanskrit. 1942. 1969. Sanskrit. Linguistics. 55 pgs. Vedic Kosha.. Krishnamurthysahastryvarya. T. Visva Bandhu Sastri. Vedantha Paribashaa. Vede Ashvinau Asvins In The Vedas. 1969.. Unknown. Sanskrit. Philosophy... Unknown.org/…/SanskritIIIT. Sanskrit. Vedic Padhanukrama Kosah Part 2. 201 pgs. 1992. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Vedantaparibhasa Accn0 583. Unknown. Prakasanamba. 1979. Vedic Padhanukrama Kosah Vol 1 Part 2. Sanskrit.. 1988. Unknown. Somraj Krishna Das. Language. 846 pgs.. Veershaivendru Shaker. vishva bandhu. Vamana Bhatta Bana. vishva bandhu.. 1952. Vedic Padhanukrama Kosah Part 3. Vedardhasamgraha Geetha Bhashya. Unknown. 1867. 240 pgs. G Swaminadhacharyulu. .. 0. Sanskrit. Vedantnamaratnasahasram. vishva bhandu.… V t l P h Vi h tih S N Sh ti U k S k it 1949 66 88/167 . Brahmanadha Saraswathi.. 290 pgs. Sanskrit. 500 pgs. 1975. Vedic Padhanukram Kosah Vol 1. 362 pgs. Vedhantha Paribhasha.. 1959. Venkatadvari Tatrkuthinam Adhyayanam. 1958. 892 pgs. Vedic Padhanukrama Kosah Vol 4. Sanskrit. 260 pgs. Literature. Sanskrit. Veeramithrodaya.. 261 pgs. Unknown. P Bhagaddatta amp Hamsaraj. 520 pgs. Unknown.krishna Swamy Aiyar.. Philosophy...

Bhat't'a Shriinrxsin'ha. 1964. Language. Dalshuk Malvania. Vimarshamruthamu. Sri Giridhara Bhattacharya. Unknown. shriramavathara sharma. 0. Biography. Unknown. Sanskrit. Shriikaalidasa~. 194 pgs. 168 pgs... 123 pgs. Mahaprubhu Lal Goswami. Biography... Giridhara Upadhy. . Linguistics. 230 pgs. Sanskrit. Vichara Ratnakara Kirtivijana. Vishnu Prasad Sharma. Vikramorvasiyam Of Kalidasa. 66 pgs. 101 pgs. 1966. Sanskrit. Vishnupurana With 2 Commentry amp Tika Vishnucitta amp Sridhara... 110 pgs. Sanskrit. Sanskrit.dalsukh Malvania. Shri Ram Sharma Acharya. 1954. 304 pgs. 94 pgs. Sanskrit. Vishnu Dhrmoattara Puranam. Sanskrit. Sanskrit. Vibhaktyarthanirnaya Iii. Unknown.. Sanskrit... 0.. Virodha-varuthini.... Giridhara Upadhy. Geography. 106 pgs. Sanskrit. V. Unknown. Jyotira~vichchhridayaanaatha. Vidhyaamaadhaviiyama~ Trxtiiyasan'putama~ 11-15 Adhyaayaa. R Shama Sastry.. 400 pgs. Visakhadattas Mudraraksasa Edition I I. Vidhiviveka. 124 pgs. Venkat Ramana Reddy. Unknown. Nanuji Bhatt.. Visheshik Darshan. Sanskrit. 1987.. Vidhura Nithi. Vimand-d'alavakravichaarah..2/14/2011 A list of scanned Sanskrit books at III… Vetala Pancha Vimshatih.. 382 pgs. Unknown. Somraj Krishna Das. Unknown. Sanskrit. Vidhyaamaadhava. Vidhaanamaalaa Grantha 86. 1926. Unknown. Deshapaan'd'e Ga Vi. Sanskrit. .. 1966.. 1901. 106 pgs... 1926. Dr B R Shastry...... Literature. Vishnu Prasad. Unknown. Sanskrit. 1901. Literature. Shriidhara~madaasasuuri. Literature. 364 pgs.. Unknown. Sanskrit. 1987. Vikramarkandeva Charitram. 202 pgs... Virodha Varuthini. Vishampadh Vakya Vritti. Vibhaktyartha Nirnaya. Unknown. Sanskrit. Sanskrit. 1948. 67 pgs. 1867. 1986. Sanskrit... Sanskrit. Theology. 0. Literature. Sanskrit. Geography. 428 pgs.. Vibhaktyarthanirnaya Iv. Religion..... Vikrantabharatam.. Unknown. 1901.. 170 pgs. Religion. Giridhara Upadhy... Unknown. Sanskrit. 419 pgs. 108 pgs.. 1920. 330 pgs. Vidagghamukhamand-d'anakavyama~. 1925.. Visesavasyakabhasya With Srikotyaryavadiganis Vivarana Part Iii. 0. Jagannath Sastri Hosinga. Sanskrit. Unknown.org/…/SanskritIIIT. Sri Paripurna Prakashnanda Bharathi Mahaswamin. Sanskrit. 151 pgs.. Pandit Mukunda Shastri. Sanskrit. 290 pgs... 1997.. Unknown.. 172 pgs. History. 1901. 0. Sanskrit. Unknown. 58 pgs. 1645. . Vidyamadhaviyam Of Vidya Madhava. 240 pgs. 1901. Vidura-niti... 106 pgs. Viramitrodaya Vol Xx. Unknown. 1986. 0. Sanskrit. Sanskrit. Vibhaktyarthanirnaya V. Vikramora~vashii trot'akama~ Chatura~tha San'skarand-ama~. Pandit Madhava Prasad Vyasa. Viira Vinaayaka. 1952. 257 pgs.... -. 1949. Unknown.. 677 pgs. Pt. 1916.. Visesavasayakabhasya Part 1. Sri Giridhara Bhattacharya. Natural Sciences. 334 pgs. Natural Sciences. Unknown. sanskritdocuments. Vishnu Prasad Sharma.… 89/167 . Unknown. Viramitrodaya Samaja Prakasha Vol X. Unknown. 156 pgs. 1923. Sanskrit.. Sanskrit.. Sanskrit. Somraj Krishna Das. Vibhaktyarthanirnaya. Sanskrit. Sanskrit.... Sanskrit. 1939. Viramitrodaya Bhakti Prakasha Vol Xi. 390 pgs.. R R Deshpande.. 1978. Vidhi Rasyana. History. S N Shastri... V Venkataramana Reddy.. Sanskrit. Swamy Vivekananda... Theology..

541 pgs. 115 pgs. 1981. Religion. Anant Ram Shastri. Vividha tiira~thakalpa. Sanskrit.. Theology. Unknown. Unknown.. 1935. Visvamitra Samhita. Unknown..k... Viwahsopangvidhi. Sanskrit. 1891. Literature. Sanskrit. 506 pgs. Pt. Visnuvilasa. Vyakarana Siddhanta Kaumudi.2/14/2011 A list of scanned Sanskrit books at III… 1967. 246 pgs. Sanskrit... Unknown... Visukipuranam.aryendra Sharma. Sanskrit. Literature.. 1983.. 1942. 336 pgs. Vyavahaaramayuukha. 1957.. Sanskrit.. Unknown.. Sanskrit. Sanskrit... 1951. Unknown. Sanskrit. Sri Ramachandra Kavi Bharati.. Unknown. Sanskrit. sanskritdocuments.krishnamacharya. 1993.. Vyavahara Nirnaya Of Varadaraja. Vyakaranabhushanasara. Philosophy. Sanskrit. 240 pgs. Vritharatnakaram.. Pt.. Vyakaran Maha Bhasyam. 605 pgs. 304 pgs. Visnudharmottara Mahapuranam. 1942. . 668 pgs. 562 pgs. 166 pgs. Unknown.. Sanskrit.shiv Dutt Mishra. 430 pgs. 0. 81 pgs. Psychology. 1929. Theology. Vivahapatlam Sarasamuchaya. bhattoji dikshita.. 228 pgs. Visuddhimaggo Prathama Bhaaga. Ramasastri Bhagavthacharya. P Gopalachandra Vedanthashasri. 284 pgs.. Eluu Eluu. Vyasasidhanta Marthandam. Vishyanukramanika. B V Narasimhacharya. Sri Rudradharajha. Unknown. Vrataraja. Sanskrit. Sanskrit.. Unknown. 245 pgs. 1921.. 1926..shiv Dutt Mishra. 616 pgs. 1991.… 90/167 . Sanskrit. Vyakarana Koumudri. Sanskrit. . Religion. Sanskrit. Sanskrit. 0. 146 pgs. Sanskrit. Viveka Chudamani Of Sankaracharya... Dr.. 865 pgs... Literrature.... Sanskrit. Bhat't'aachaara~ya Gadaaghara. Vyutpattivada Of Gadadhara Bhattacarya.. Acharya Madhusudhan Shastry. 1994. 1818. Vyutpattivaadah Lakaaraara~thavichaarah. Unknown.org/…/SanskritIIIT. Linguistics. 909 pgs. Sanskrit. Sanskrit. Vrttaratnakara. Vyaakarand-amahaabhaashyama~ Tatraang-gaghikaara Da~vitiiyo Bhaaga. 338 pgs. Psychology. 535 pgs. 1948. Theology. Vyakarana Mahabhasyam Of Patanjali Muni. 1948. Religion.. Vrttaratnavali. Sanskrit. 168 pgs. Unknown. 610 pgs. 234 pgs. Somraj Krishna Das. 339 pgs.. Vyayasasidhanta Marthandam. Vizianagaram Sanskrit Series. 1964. Language. Mohamahapadyaya Kapisthalam Desikachariar.. sri vasudev dikshit.. Unknown. Sanskrit.. Veng-kat'araamashara~maa Ve.. V Rangaswami And Krishna. Unknown. Ganga Vishnu Sri Krishnadas. 362 pgs. Jinaprabhasuuri. Pandit V. Sanskrit.. Natural Sciences.. Undemane Shankara Bhatta. 0. 1988. 1929.narayana Pillai. 1934.. 645 pgs. Sri Giri Sharma Chathurved.. 1969.. .. . Srinivas Ayyangar... 1940. Visnusmrti Ii. Sanskrit... Sanskrit. Unknown. Unknown. ... Unknown. 624 pgs. Vrittaratnakara Edition Vi. P.. Swami Madhavananda. 1954. 1943. 837 pgs. 1957. Sanskrit. 1983. Sanskrit. Vyavahaaramaalaa.. -. Mahadev Chimanaji Apte. Vyakaran Siddhanta Kaumudi Balmanorama Pradhamabagamu.. Buddhaghosaachariya. Philosophy. Somraj Krishna Das. 277 pgs. Sanskrit. 1914. Sanskrit.. Sanskrit. 312 pgs. 1954. Shriibhagavatpatan'jala.. Vyutpattivada. 538 pgs... Religion.. Religion....

Yajura~veda San'hitaa Dditiiya Vaaran. Sanskrit.… 91/167 .. Religion. Unknown.. Yadavabhyudayam Sargas I To I V. Unknown.. 0. . Philosophy. 196 pgs. 1924. 716 pgs. 162 pgs.. Sanskrit.org/…/SanskritIIIT.. Unknown. Philosophy. 119 pgs. 2000. -. .. Sanskrit. Yatiindramatadiipikaa.. Sanskrit. 1864. sanskritdocuments. Sahibji Maharaj Sir Anand Sarup. Appayya Dikshita. Saan'tavalekara. Parashuram Shastri. 101 pgs...... Sanskrit.. 360 pgs. Sanskrit. Damodar Bhattasununa. Theology... Yadnyavalkyasmriti Of Yogishvara Yadnyavalkya Fourth Edition. . 529 pgs. Sanskrit. Philosophy. .. Yagavasista Vuthu Paryay Prakasika Part 1. Sripad Damodar Saatvalekar. 266 pgs. 1934. 548 pgs. 0. Maiva Ram Kattara Padka. Sanskrit. Sanskrit. Yatindramatadipika. ..2/14/2011 A list of scanned Sanskrit books at III… Word Index To Taittriya Samhita.. Yekankavalih. Sanskrit. 1953.. Acharaya Ram Kishore Misra. Sanskrit.chinnaswami Sastri. 124 pgs. 132 pgs. 176 pgs.. 183 pgs. Kesava Rao Sarma.. Saatavalekara~ vi esa~. Philosophy. 204 pgs. Umesh Chandra Pandey. 506 pgs.. 1950. Yashodhara Mahakavyam. Dhamodar. Sanskrit. Mukunda Sharma.... Yagavasista Vuthu Paryay Prakasika Part 3... Sanskrit. Shriinivasadaasa. Yajura~vediiya Kaat'haka San'hitaa.. Bhat't'a Daamodara. 246 pgs. Yajurvedha Maithrayani Samhitha. Theology. 746 pgs. 1953.. Yagavasista Vuthu Paryay Prakasika Part 4. 1956. 1868. 1904.. . Sanskrit. Yoga Karnika.. Literature. 89 pgs. Yatidhara~masan'grah Grantha 60. Yajura~vediiya Maitraayand-ii San'hita... 439 pgs.. Sanskrit. Yajnavalkyasmrti. Yajhu Shakiyasanthikanda Pradeepa. Sanskrit.. Sanskrit.. 1951. Yajnavaikya Smrti... Sanskrit. Sanskrit. 1953... Sanskrit. Psychology.. Theology.. 1976.. Sudarsanacharya. Yathara Prakasa Part 1. Philosophy-22. . Wasudev Laxman Sastri Paniskar. 1927.. Sanskrit. 1930. Paraaditya. Philosophy. 251 pgs.v.k. 1949. Parikshit Sharma. Narayana Shastri Khiste. Srinivasadasa. Literature.. 0.... Sanskrit. Philosophy. Unknown. Yaanj-avalkya Smrxti Granth 46. 0. Sanskrit.o.. Theology. Yayathi Aakhyaan. Sanskrit. Yathiraja Vijaya Natakam. Unknown. . 1977. 258 pgs.. Theology. Religion.. Unknown. 2003.. Yajna Valky Smtuthi.. Language. Aapat'e Vinayaka Gand-esha. 748 pgs. Yoga Vedanta Dictionary. Yoga Chikista... 2000. 1936.. 0. Yekankastakamu. Linguistics.. Yekanki Saptakam.. Philosophy. 162 pgs. 202 pgs. 1998. 0. 331 pgs. Sri Swami Sivanandh. 635 pgs. Religion.t. Religion. 1980. 508 pgs. Sanskrit. . Pandit A. Sanskrit. Yajurvediya Kataka Samhita. 152 pgs. Sanskrit.. Unknown. Religion. Sanskrit. 0. Sanskrit.. Yogachintamani Ki Anukramanika. 598 pgs.. Yajna Tattva Prakasa. 196 pgs. Philosophy. . Narendra Nath Sharma. 600 pgs. 0. 186 pgs. Unknown. Unknown. Sanskrit.. Sanskrit. .. 136 pgs.. Philosophy. 0. . Unknown. Sanskrit. Sanskrit. Yatinder Matdipika. 1981. 1954. Yajurvedasanhita Vol Iv. Philosophy. Yagavasista Vuthu Paryay Prakasika Part 2.... Sanskrit. Taitriya Samhita.. 1164 pgs. 1945. Girish Chandra Sharma.

1987. Unknown.. aachaarendu... 346 pgs.. Sanskrit. Literature. Language. 1888. 0. Yogini Jatakam. shriidharaachaarya.... Yuddhakandam Part Ii. Kesav Srinivasulachari Kati.. 456 pgs. charles rockwell lanman. aachaaramayuukha dvitiiya. Vasu Deva. Yogi Nihrdayam. gurucharana. 100 pgs. Religion. Linguistics. 740 pgs. Literature. Sanskrit. 268 pgs. Yogavasista Vol 1. Sanskrit.. Theology. aadipuraanama. 906 pgs.. Sri Madra Namikmaharshi. aagamashaastramu gaud'apaadiiyamu. Language.. Sanskrit. 172 pgs. miimaan'sakashriiniilakan't'habhat't'a... aadaitabrahmasid'i. aanandaashramasn'skrxtagranthaavali gran'nthaang-ka 70. aanandamaalaa. aahnikapaddhati... khemraj sri krishna das. Sanskrit. aagamapraamaand-yamu.. Literature.. 1500. 1950.. Sanskrit. aagniveshyagrxhyasuutramn.. Language. 0. 1908. LANGUAGE.padmanaabha. 1961. Yogavasisht Bhasha. Linguistics.. Language. 40 pgs. 0.. Yogavasishtu Dwithiya Bagamu.. 1979.k. Literature. Theology. . Sanskrit. Bannanje Govindacharya. Sri Krishnupanthshakina. sanskritdocuments.. Gopinatha Kaviraja... Sanskrit. Literature. Social Sciences. Sanskrit. Literature. 1979.. Pandit Navya Chandidasa.. 0. Art. LITERATURE. Linguistics. Linguistics. Sanskrit. Yudhishthira Vijaya.. aabhaarapradashainamu. 1970. 1915. Sanskrit.m. Sanskrit. L. Sanskrit. Literature. Social Sciences. Religion. bhat't'aachaaryend-a vidhushekharend-a. Sanskrit. Linguistics. Unknown. Linguistics.. 1932. Pandit Dinanad. Sanskrit.. 0. p. aanan'dalahari No.. Linguistics. LINGUISTICS. Linguistics. Language. Language. 1917. 288 pgs. 142 pgs. 244 pgs.. Ganga Vishanu Sri Krishana Dasini. Sanskrit.. Sanskrit... Literature. Language. 1964. Yukthi Mallika Guna Saurabham. 319 pgs.2/14/2011 A list of scanned Sanskrit books at III… Yogavashishtahah Panchama Bhaga. 1940.. Philosophy. Language. aagamarahasyamu vaatulashuddhaaravyamu. a consolidated glossary of technical terms. Literature. Sanskrit.. Language.. 105 pgs.. 370 pgs. Shriibhoja Mahaaraaja~.. Sanskrit. 1983. Unknown... Shri Krishna Patna Shasthri. Philosophy. 98 pgs. Philosophy. Philosophy. Literature.. Jaggu Venkatachari.org/…/SanskritIIIT. Sanskrit. Sanskrit. Sanskrit. Sanskrit.. 183 pgs. Linguistics. Literature. Unknown. 172 pgs.m. 0. Youginithantr. Linguistics. Sanskrit.. edward delavan perry. 1912. 440 pgs.. Gandhi. 1929. Bhagavadgita. 1932. 220 pgs. Yukttikalpataru. Linguistics.a. Sanskrit... 248 pgs. Linguistics... Language. 1067 pgs... 1614 pgs. Sanskrit. Sanskrit. a sanskrit primer. raamajii upaadhyaaya. 854 pgs. Ravi Varma. 1953. 352 pgs..m... aadunika san'skrxta naat'aka nae tathya nayaa itihaasa bhaaga 1. 1089 pgs. 1909. Linguistics. Literature. Literature. Unknown. Language. Language. a sanskrit reader. 392 pgs. Sanskrit. 0. Language. Sri Pahvadatthareya Sastri.. 1937.… 92/167 . 576 pgs. Sanskrit. appayyadiikshita.. Not available. pandit sarada prasad bidyabhushan. yamunaachaarya svaami. Yougachikithsa Indication Of Drugs. 321 pgs. a sanskrit composition and translation manual..2. Unknown. 408 pgs.. 1943.. Aathrideva Vidhyalanker. Sanskrit. 0. 526 pgs.

1922. 236 pgs. Literature. Language.. Religion.. 278 pgs. Sanskrit. Language.. Linguistics. aapastambasulbasuutran' kapaaradibhaashhyend-a karavindi sundararajavyaakhyaabhyan' cha sahitan... 370 pgs. aapastambiiyam' shraotasuutram. Sanskrit. 402 pgs. d srinivaasaacharya. Philosophy. kapardisvaami. 0.. Narasimhachar. Natural Sciences.. 814 pgs. aaryemanju qs-imulakalpa ddhitiiya bhaaga. 318 pgs. 76 pgs. 1933. Sanskrit. Language. aashvalaayanagrxhyasuutran.... Literature. Religion. 1920. Language. S. aashvalaayanagrxhyasuutran' shriiharadattamishravirachita anaavilaakhyayaa vrxttyaa sametn. r. suryanarayana. Language. Sri Ganapathi Sastri. Science.. Theology. Language. 130 pgs. not availabe... Ganapathi Sastri. Linguistics. Literature.mlampalli Chandra Sekhar Sarma.. 742 pgs. Religion. 122 pgs. Sanskrit.. Sanskrit. Linguistics.viswanatha Sarma. Sri Ganapathi Sastri. Brahmasri Subrahmanya Suri. 1970. aapastambadharmasuutramanj-jarii. Yasneswara cimana Bhatta. aasechanakaraamaayand-amu. 1933. 472 pgs. Language. T. r. n. 1931. Sanskrit. Pandith Sri Seetharam Bhakruth.. aaryemanju qs-imulakalpa prathamoo bhaaga.. shriimanmuraarimishra. Sanskrit.. 513 pgs. .. Sanskrit. a n krishna aiyangar. 270 pgs... 1928. Sanskrit. . Language. aangiirasasmrxtii. Linguistics.. Theology.. Linguistics. 196 pgs. 1893. Linguistics... mahaadevashaastri. Sri Bhavani Shankara Sharma.. 228 pgs.. Sanskrit. Sanskrit. T. Sanskrit. Language. Psychology. aaryaividhaasudhaakaran. 177 pgs. aashvalaayaniiyaguhaasutraand-aa suchiipatramu. Sanskrit. Literature.… aatma kathaa prathama khand-d'a mahaatmaa gaan'dhii General Sanskrit 0 421 pgs 93/167 . aatakam. aanandananandinii. aapastambiiya dharmasuutramu.. 1931. Linguistics. Linguistics. Linguistics.. Sanskrit. 216 pgs. Language. Literature. Linguistics. Literature... Sanskrit. 1970. 307 pgs. Language.. Srinivasachar. Literature. Literature. Literature. Science. aapastambiiya dharmasuutramu. not availabe. 1940. Linguistics.. Language. aapastambaparibhaashaasuutramuu. Linguistics. Language. 340 pgs. Language... haradatta mishra.. 130 pgs. aarogyachintaamand-ii. aaryemanju qs-imulakalpa tuutiyo bhaaga. Dr. 1923. 1973. 0. Sanskrit. Language. 314 pgs.. Language. Literature.. Literature. aapastambhagrihyasuutra anakula tatparyadarshana.. Literature.. 1953.. Literature.org/…/SanskritIIIT. sanskritdocuments. 1951.. aang-agatvanirukti naama prabandha etatpustakan. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Sanskrit. 340 pgs. Linguistics. n.. Sanskrit. 90 pgs. -... 0. Linguistics. Literature. Literature. Sanskrit. Ganapathi Sastri. aapastambadharmasuutramu.. Linguistics.. Sanskrit. suryanarayana. Ganapathi Sastri. 1898.... 1932. . Sanskrit. 0. Linguistics. 373 pgs. aapastambashulbasuutramu. 0. aapastambadharmasuutramanj-jarii. 1944. T. D. aatha sankhya darshana bhashanuvaada. 1930. Bhattacharya.. 1909. 308 pgs. 1924. aaryabhadt'iiyam'of Aryabhattacarya Part 1 gaanitapaada. Sanskrit. Unknown. Literature..2/14/2011 A list of scanned Sanskrit books at III… aanandamathaadhikarand-amaaramya pradhaman' paadan. 233 pgs. e.

adhikaara kaa prashna. kalidasa. vaidha yaadavaji trikamaji aachaaryai. Not available.. 1926. abhilekhamaalaa vishvavidhyaalayapariqs-aanirdhaarita abhilekhasan'graha raama hindiivyaakhyopetaa.. 1875. abhijnana sakuntalam of kalidasa. abhinava san'skrta pravesha. 1974. 216 pgs. Sanskrit.. Sanskrit... 829 pgs. 561 pgs. aatmoduugaara. 0. Linguistics. Rajasekhara.. Literature. 421 pgs. virachitayaa. Murari Mishra. abhaavavimarsha. ven'kat'a subramand-ya shaastri. Sanskrit. Sanskrit. Sanskrit. 154 pgs. Language. soomeishvara deva.. 1926. 276 pgs.. Sanskrit. aayurveidamahoodadhau annapaanavidhi.... 1973... Linguistics. aavyamimaan'saa. Technology. adhikaarand-a saaraaval'i. pan' ramaakaanta jhaa. 62 pgs. Language. Philosophy.. Sanskrit. ma shri deshapaan'd'e. Linguistics.. 440 pgs.. Linguistics.. Literature. shrii kaasinaatha dviveidi.. LINGUISTICS. addvatatarand-i.2/14/2011 A list of scanned Sanskrit books at III… aatma kathaa prathama khand d a. abhidhaavrittimaatrika shabdavyaapaara vichaara. 0. Sanskrit... 1984. 131 pgs. LITERATURE. aatmatattvaviveka.org/…/SanskritIIIT. Linguistics. adbud vijay.. Linguistics... Philosophy.. 136 pgs... aatmatattva vivekaa.. 1973. 238 pgs. Literature. 0. Philosophy. Sanskrit. Literature. LANGUAGE. 1926. Language. Sanskrit. abhilaashhitaarthachintaamand-i prathamabhaaga aadita trxtiiyaprakarand-antamu. Kumaravedantacharya. addvatamaatend-d'a. Literature..… adhikarand asaaraavali shriivand shat'hakopashriilaqs 94/167 .. Sharma Sastri.. General. shriigovadhainaachayai.. 2000. 296 pgs. sanskritdocuments. aayaisaptashati. Sanskrit. Language. abhiraajasahastrakamu. mahaatmaa gaan dhii.. Language. Sanskrit. Religion. 1926. 385 pgs. Literature. LANGUAGE.. 242 pgs. 1926. 142 pgs.. ad'agatvanirukitan. Sanskrit. 288 pgs. LINGUISTICS. Theology. Sanskrit. LANGUAGE. 1934.. Sanskrit. Literature. Satya Nidhi Theertha. Literature. 0. abhinava chandrikaayaamu. Linguistics. Sanskrit. 1957. abhilashhitaayrachintaamand-i. adhikarand-asaaraalalin. 158 pgs. Sanskrit. Language. Language. 1630. Sanskrit.. 440 pgs. 498 pgs.. Sanskrit. 161 pgs. Sanskrit. 1969. Sri Udayana. 42 pgs. LITERATURE. Psychology. Literature. 1950. 1972. Linguistics. Sanskrit. Sanskrit. addvataamakaranda.. Lakshmidhar.. abhijnaashaakuntala.. Language. Sanskrit. Psychology. abhinava vikrutivignaana. Triveni Kavi. Religion.. mukula bhatta. 1925. 1944.. 72 pgs.. Literature.. abhilashhitaartaaryaichintaamand-in.. Psychology. someshvaradeva. 1942... diipikaa ghosha. achala meraa koii. 92 pgs. Psychology. 174 pgs. bhagavatiprasaada vaajapeiyi. 100 pgs. Sri Ananta Krishna Sastri. Linguistics. abhinana shakuntalam. Religion.. Literature. R. Sanskrit. Language. 438 pgs. LINGUISTICS. 1948.. Language.. Theology.... Sanskrit.. pandit shri bellakonda ramaraya kavindra. 268 pgs. Sanskrit. 1926. Linguistics.. Literature. Sanskrit. Sanskrit.. Linguistics. Language. vendaachanalaala. LITERATURE. 428 pgs. Unknown. Sri Natesh.. 336 pgs. Philosophy. Literature. 0.. Literature. 1895. 1916. srimad vedaanta desikulu. General. ramanath jha. Technology. Sanskrit.

Sanskrit. Language. 1987.. Linguistics. adhyaatmapat'alamam. Sanskrit. 1915. Sanskrit.. advaitaanyamatakhand-d'anamu. advaitasabhaasuvarnd-amahotsave. 1893. Pandit Anantha Krishna Sastri. Sanskrit. Ganapathi Sastry.. Not available. Literature.. 0. Sanskrit. Sanskrit. 882 pgs. shriivand-shat hakopashriilaqsmiinrxsin'vashat'hakopayatiindramahaadeshikaa.. Social Sciences. Linguistics. Literature. Literature. 120 pgs.. I. advaitasiddhi guruchanddrikaasavyakhyaayasamalang-krxtaa dvitiiyasamput'amu. advaita siddi Vol.org/…/SanskritIIIT. Literature. Not available. Language. advatatatvasudhaa prathamoo bhaaga.... sanskritdocuments. Language. Not available..... shriimunisundarasuuri.. Literature. Linguistics. Religion. 445 pgs. Linguistics. Language. advaitadiipikaa dvitiiyobhaaga. Literature. 252 pgs.2/14/2011 A list of scanned Sanskrit books at III… adhikarand-asaaraavali. 0.... advatacsiddddhaantagurucchandrikaa. Theology. advaitaaqs-aramaalikaa. Not available.. 1915.. d'i. Linguistics. 204 pgs. 44 pgs. adhvaramiimaan'saa kutuuhalavrxtti. Religion. Not available. Sanskrit. Theology.… agamakoshaa dvadasho bhaagan S k ramachandra Rao History Sanskrit 1994 402 pgs 95/167 . 1937. Sanskrit. 78 pgs.. Art. Mahamahopadyaya Hariprasad Sastri. Sanskrit. advatasiddhaantasaarasam'grah.. 487 pgs. Literature.. 1997. adhyaatmakalpadruma adhirohand-iit'ippand-isahita. Not available. Language. advatatatvasudhaa prathamoo bhaaga. Religion. 0. 99 pgs. 77 pgs. Sanskrit. shiromand-ishriimadhusuudanasarasvatii. 396 pgs. Sanskrit. Sanskrit.. Language. Language. Sanskrit.. Sanskrit. Literature. 491 pgs. Language.. Literature. 0. 524 pgs. sri Paramahamsa perivrajaka Chandrikacharya. Sanskrit. Philosophy. Psychology. Sanskrit. Sanskrit. advaitasiddhi. Linguistics. 92 pgs.. 250 pgs. Sanskrit.. advatadipikaa... Sanskrit. 92 pgs. Philosophy. 0. 1905. Sanskrit. 362 pgs. Psychology. Religion. guruchandriikaa. advatamajjarii nyaayaraqs-aamand-in. 1939. 891 pgs... 302 pgs. Linguistics. Language. advatadipikaa tutiiyo bhaagan. Narasimha Sarma. shriinivaasaachaari. 118 pgs. 660 pgs. Language. shriimatparamahan'samadhusuudanasarasvatii. Language..... advaitamanj-jarii brahmavidhyaabharand-amu. Sanskrit. Linguistics. Sanskrit. 0. 373 pgs. adhyaatmaraamaayand-amu. 1946. 1935. advaitasiddhi trxtiiyaasamput'amu... 0. Linguistics. 0. Sanskrit. 1969. Narayana Sharma. 1928.. Sanskrit. 120 pgs. advatatatvasudhaa dvitiiya bhaaga. Psychology. Philosophy. 1933. Sri Ganapathy Sastri. Literature. Linguistics. 842 pgs. Language. Sanskrit. Literature. Literature.. advatadipikaa dhvitiyo bhaagan. Religion. Not available. Theology.. Literature. Linguistics. Literature. Linguistics. Literature.. 1940.. 386 pgs. 678 pgs... Language.. advaitasiddhi mithyatvamithyaatvaanto bhaaga. advaitaamoda.. Linguistics. Chintamani. Not available.... Linguistics. d'aa bii gopaalared'd'ii. vidvan s narayanaswami shastri.... Theology. 0. Literature. adhikarand-asaraavali.. Language. advaitibhraan'tiprakaasha. advayavajrasan'graha. Sanskrit. Linguistics. 617 pgs. Literature.. Sanskrit. advaitibhraan'tiprakaasha. 1960. Not available. Sanskrit. vaasudevashaastrii. 1960. Language. 1962. Literature. Language.. 195 pgs. 1927.. Narayanasrama. Linguistics. 1984.

d'urghaprasaada. amarakoshhan. amitaa. Language... Not available. 1956. 238 pgs.. shriikrxshhnd-abrahmatantraparakaalasan'yamindai.. 0. Sri Mathsayana Aacharya. dr. Sanskrit. Language. The Arts. Language. 1898. LANGUAGE. Sanskrit. LANGUAGE.a. 1942. 1994. Linguistics. vinaayaka gand-esha aapat'e. agnihotrachandrikaa vaamana shaastri krxtaa. LINGUISTICS.. Sanskrit. Sanskrit. Sanskrit. Sanskrit. 302 pgs. yan. Sanskrit. LITERATURE.. Sanskrit. Literature. Sanskrit. Linguistics. 39 pgs.. sanskritdocuments. Language. 1973. 30 pgs. Theology. Linguistics.. Sanskrit. banerji projesh. shriikrxshhnd-abrahmatantraparakaalasan'yamindai. LITERATURE. jiivana. 505 pgs. 540 pgs... 1923. 1921. 226 pgs..k. Sanskrit.org/…/SanskritIIIT. 1916. Linguistics. Literature. Literature. Not available. parakaalasan'yamiindrai. Sanskrit. Sanskrit.aar. Sanskrit. 1898. 874 pgs.. Language.. 1940... alang-kaaramand-ihaara prathamo bhaaga. Sanskrit. 402 pgs. Haragovinda Sastri... LINGUISTICS. aitareyabraahmand-amam. Literature.. 1906.. Religion.. bhat't'a. pro laqs-mand-adata gautama.. Language. 54 pgs. Baba Sastri Padake. Language. 1958. anang-garang-ga kaamakalaa hindiivyaa gopaniiyama. vaamana shaastri. ananthakrishna sharma. Religion. Linguistics.. mahaakavikalyaand-amalla. History. Linguistics. 1917. ambikaalaapa umaalaapa. akalanka grandhatrayamu.. 443 pgs. LANGUAGE. Literature. aln'kaarakaustubhamuu. an'cdhaa yuga samiiqs-a. LINGUISTICS. alang-kaaramand-ihaara chaturtho bhaaga.. en' ... Literature.. Language. Sanskrit. shriikrxshhnd-abrahmatantraparakaalasan'yamiindrai. Sanskrit. 1944... 1977. 358 pgs. 512 pgs. 1967. Linguistics.. agniveshyagruhaasutre. r. 236 pgs. aitareyaalochanan. Sanskrit. Language..2/14/2011 A list of scanned Sanskrit books at III… agamakoshaa dvadasho bhaagan. 1921..ii. 306 pgs.. 139 pgs. Linguistics.. amarkosh. S... Not available. Language. 1957. alang-kaaramand-ihaara trxtiiyobhaaga.ramachandra Rao. ananthabharathi. 1929.. ajit' gaamaa Vol. Literature.. 321 pgs. Linguistics. Sanskrit. Language. 230 pgs. Language... 884 pgs. Vishvanatha Balakrishna Sastri. Acharya Satyavrata Samasrami. History. 0. Language. amrxtavaand-i. Sanskrit.ravi Varma. Literature. Linguistics. Literature. Linguistics. Jinvijaya Muni.. Linguistics. 732 pgs. 0. Literature. Linguistics... agnipuraand-amu vedikaa. Maharshi Vedavyas.. 386 pgs. Sanskrit. 0. 550 pgs. anargharaaghavamuu. shiivadatta.… 96/167 . an'bigara chaud'ayyana vachanagal'u. aitareiya brahmanama. Sanskrit. Language. Literature. yashapaala. Language. Literature.. Linguistics. 222 pgs. Literature. 1968.. Literature. Literature. Sanskrit. 100 pgs. Language. Sanskrit. Literature. Sanskrit.. Sanskrit. aitareyabraahmand-a. Sanskrit. Literature. Sanskrit. Language. Linguistics.. 1968... L. Linguistics.. Literature. Literature. LITERATURE.. 750 pgs. aitareyaarand-yakan. alang-kaaramand-ihaara dvitiiyobhaaga. Literature... 1921. agnihotrachandrikaa.. Linguistics.. 1937. 104 pgs. not available. Language. aitareyabraahmand-a. 312 pgs. 1937. Linguistics.

Sanskrit. aparoqs-aanubhuuti savyaaravyaa. Sanskrit. ashht'aadashasmrxtaya ang-gira aadi 18 smrxtiyon' kaa san'graha. 292 pgs. 1951.. Sanskrit. apastambagrxhyasuutran. Athridev Gupta. Not available. Literature.. Religion. Language. Language. 2002. Religion. Sanskrit. Linguistics.. arpand-a patrikaa. 320 pgs.. Literature. sanskritdocuments.2/14/2011 A list of scanned Sanskrit books at III… 399 pgs. 0. Religion. 142 pgs. 143 pgs. . Religion. Unknown. Sanskrit. anubhaashya baalaboodinii bhaaga 2.. Sanskrit...p. Linguistics. Yudishtar Mimamasat. 789 pgs. Not available. 438 pgs.... 312 pgs. Language. A. 92 pgs.. 672 pgs. Sanskrit. Sanskrit.. Linguistics. 182 pgs. Language. 1929. Sanskrit. Language. Language.. Social Sciences. Sanskrit. 1921. Sanskrit. andhra baghvath parimal. General. 88 pgs. Linguistics. ashht'adashapuraand-a darpaind-a... asatmatattvodhyotaprakarand-amu. Literature. Sanskrit. ashht'adashapuraand-aparichayan. Linguistics. 0.. Psychology. aramelakalanidi. Religion.. 448 pgs. 1980. H. Sri Krishna Tripati. ashht'aadashapuraand-a darpand-a. 459 pgs. Sanskrit. 1998. Sanskrit. 145 pgs. Literature. Language. Philosophy.. Theology. 1928.. Sanskrit. 252 pgs. 139 pgs.. vaachaspatii upaadyaaya. Language. Chinnaswami Sastri. Sanskrit.. Literature. 254 pgs.. Sanskrit. 1932. Literature... Sanskrit. ar^thashaastram' Part Iii... Sanskrit. Sanskrit. Sanskrit. 1912. 291 pgs. 1964. Theology. Literature. Psychology. 258 pgs. Language. Theology. Ramaswami Aiyar... suryanarayana shastri. 1985. 1935.. Linguistics. ashht'adashashmutuyahan. 82 pgs. ar^thasan'graha. Sanskrit. anekartha sangraha. anubhuutiprakaasha. Sanskrit. Linguistics.. 258 pgs. 400 pgs.. Sanskrit. 1925. 0. 1915. Sanskrit. Theology. Literature. 0.. 1983.. Sanskrit. Not available... Language. Lakshminarayana.. 138 pgs. Religion. raajya jyootishhi pan' devaraaja jii. H P Malledevaru. shriimadvidhyaarand-ayasvaami. 504 pgs. asalii tejii mandii sat't'aa. 1964. Literature. 1932. Philosophy. Literature. george buhler dr. 0.. ashht'aad'asagrand'aha.malledevaru.. 1950. Sri Ganapathy Sastri.… 97/167 . anubhuutiprakaasha... Linguistics. Theology. ashht'aan'gatddadayamu suutra shariira nidaana chikitsaa kalpa uttarasthaanavibhaktamu. 194 pgs. Sri Vidyaranya. Literature. shriimadvallabhaachaarya. and-ubhaashhyamu... 1990. acharya hema chandra. Sri Laugakshibhaskara. archaavaatara vaibhavam. varnasi ramamurty renu. 1844. arthasamgraha. Linguistics. Sanskrit. pandit r v krishnamaachaarya.. anuvaad kala. Linguistics.... arya san'graha. Sanskrit. 0. 432 pgs. Religion. ashht'adhyaayii bhaashhya pradamaavuti.. Religion.... Language. Theology. apastamba s aphorisms.. Religion. 1955. 1931.org/…/SanskritIIIT. Sanskrit. 346 pgs.. Athridev Gupta. Not available. shriimadvaagbhat't'a. 1926... ashht'aaadashapuraand-aparichaya pauraand-ikaprabhaaparishiilanamu.. Religion.. 1985.. anyottayullaasan.. 274 pgs. Linguistics. . charu deva shastry. 224 pgs. shri laugakshi bhaskara. 871 pgs. Literature... Sanskrit. andhradesiahasyakatha. d'aa shriikrxshhnd-amanditripaat'hii. Literature. Literature.

atha shikqs-aadiveidaang-gachatushhuta praaran'bha.... atha pradhamaadi chaturdaishaadhyaayaanaan. 258 pgs. Sanskrit.. Language.. . . ashtangahridaya. atha kiiraanya keshoyammatrasamhitaa. 1892. Sanskrit.. kaviraj shrii athrii dhev guru.. . Sanskrit. Treble.. Sanskrit. Language. Linguistics.a. sanskritdocuments. 0. atha kalikaa puraand-amu. astaangahridaya. atha jaatakaabharand-an' praarabyate.. . 0. Literature. 602 pgs. 1939. 95 pgs. ashtan'daghadhyaayam. 1858... Sanskrit.. atha kaasi khandaa dhvitiyo bhaagan..… 98/167 . 0. Theology. .. H. atha shriibhaavataat'appand-ii satyadhamayan'tikrutaa. Sanskrit.. Linguistics.. atha saamaanyakakqs-and-aa prakarand-amu. atha shriibhaavataat'appand-ii satyadhamayan'tikrutaadvadaso kandhan.. . Language.. Religion. asvasastram.. not available. atha maanasasaqs-aipaddatii.. 512 pgs.. atha shriikaalalokprakaasho ashht'avishatitaman. Sanskrit. . Theology. Somraj Krishna Das. atha krumaimahaapurand-an. Linguistics. 0. Sanskrit. 800 pgs.. 195 pgs. Theology. Theology. Somraj Krishna Das. Language. . . atha dugaipaasanaakalpadgumaavishhayaanukramand-ikaa.. . Religion. 974 pgs. Literature. Language.. 1948. 1867... Sanskrit.. Literature.. Sanskrit.. . 0. Somraj Krishna Das. vagbhatta.. 0.m. Technology. atha shraamadbhagavataan't'oppand-ii man'danan'diniisaptaman' sn'kadhan. 621 pgs. 1929. Savanur. . Ramachandra Savath. Treble. Sanskrit. 342 pgs. 348 pgs. Sanskrit.g.. 1929. Language. Literature. 177 pgs. Literature. Not Available. Literature.. 0. 0. 267 pgs. . 213 pgs. Sanskrit.a. H.. Language. Sanskrit. atha shraamadbhagavataan't'oppand-ii chet'tityaakhyaa. 0.... Literature. . 338 pgs. Literature. 1968. ashtajai bhashya pradamavruti. 1983. atha bruhjjyaatishhaand-aivaishhashht'omishhrasakandhochakaavalisan'grahaa. 46 pgs. 156 pgs... Somraj Krishna Das. 0. atha pramaand-apudvatan. 0. Sanskrit. 630 pgs. Religion. Ramalingam. Literature... 1962. Sanskrit. -. . Sanskrit. . asvaalayaana gruhama suutramu. atha shriikaashakhid'an' puvaathai.. atha haayanarantapurvaihai.. Linguistics. Religion.. Sanskrit. dr p srinivaasarao. 278 pgs. Sanskrit. Linguistics. Theology. Sanskrit. Treble. 1146 pgs.. atha gurubhavaprakaashikaa rukminishaa vijayamu. Acharya Sri Pandith Laxmanlal. Sanskrit. atha pradhamamudrand-akaalikiiprastaavanikaa. 810 pgs. Sanskrit.... 466 pgs. Unknown. 0. Sanskrit. 254 pgs. 196 pgs. 558 pgs. H.. 638 pgs.. 1929. 379 pgs. Sanskrit. 0. 146 pgs. Sanskrit. 1936..a. atha govidrchanaa chandrikaa.org/…/SanskritIIIT. vaagbhata. 1950. 0. 1917. Linguistics.. 474 pgs. not Available. . 1867. Religion. Sanskrit. Language. Sanskrit. Literature. atakam. Somraj Krishna Das.. Sanskrit. Sanskrit. 279 pgs. . Literature. Sri Krishna Das. Sri G Ramaswami Sastrigal.2/14/2011 A list of scanned Sanskrit books at III… ashht'apraasashatakatrayamu. Literature.. Sanskrit.r..... 311 pgs. ... 1960. Linguistics. Linguistics..

. Literature. Linguistics. 1957. 88 pgs. .g. Shankar Panduranga Pandit. athamn'tramahodadhigranthasyasyaivashhayaanukramand-ikaa. Linguistics.... Sanskrit. athabrahaapuraand-asithatavishhayaanukramand-ikha. Linguistics. saayand-aachaarya.. 554 pgs. Linguistics. 41 pgs. saan'tabalekarakulajena daamodarabhat't'asuununaa shriipaadasharmand-aa... Religion. 1929. Sanskrit. . atha shriimannyaayasudhaa.… 99/167 ...a. Literature.. 1929.. Sanskrit. Language. 475 pgs.. 0. bhat't'aachaarya. Savanur. 0. 1860. Sanskrit. 390 pgs. 1929. . 1093 pgs. 1860. atha shriimadhyaayasudhaat'ippand-i. Literature.. Sanskrit.. athashriibhaagavatat'ippand-ii t'ikaa shriidharaa. Treble. Sanskrit. 0. 565 pgs... Sanskrit... H. 327 pgs. Theology.. 1929. 856 pgs.. 1898. Religion. H.. 0. Surya Kantha.. Linguistics... 627 pgs. Sanskrit.g.a.. athashriibhagavathat'ippanii karmakat'ikaa vijayavaad'aa tirtaa trayodase kandan. 1898. . 184 pgs. Sanskrit. athamn'tramahodadhit'okaanokaayan'trasahita. 1858. 342 pgs. . . 460 pgs. Sanskrit. Sanskrit.. atharvaveida san'hitaa rxshhyaadi savalitaa. Linguistics. Sanskrit. Treble. 0. Treble. atha shriimadvagavate dvadashaskan'dha. atha shriimudgalpuraand-an. . Literature. krishna Das.a. .2/14/2011 A list of scanned Sanskrit books at III… atha shriimadbhagavadgiitaa. Sanskrit. Sanskrit. Literature. 0. 484 pgs. atha shriimadhbagavataa vijayadavaaja ekaadasobhaagan. 0. Sanskrit.k... Literature.. Sanskrit..r. not available.g. 579 pgs. Somraj Krishna Das. Literature. .r.a. Language. Religion. . Sanskrit. Literature. 395 pgs. Language... Sanskrit.. Savanur. . . Sanskrit.. Sanskrit.. .. atharvavedasan'hitaa bhaaga 3. 0. . 1963.org/…/SanskritIIIT. 342 pgs. atharvaveida san'hita. Sanskrit.. 0. Sanskrit. Literature.. Treble. 190 pgs. Language.. Sanskrit. 197 pgs. . Language. 0... 538 pgs. Theology. 0. atha shriimannyaayasudhaa. 600 pgs. 1959. 549 pgs. Literature. Literature.. Sanskrit.. Venkatachala Sastry. atha tatpurushhaprakarand-amu.. Literature.... athabadariimaahaatmya. 0. athaa hymaratanaa baalabhaadraa. 1939. 370 pgs. athashriibhaagavatat'ippand-ii satsadhamaikrutaa. atharvaveda san'hitaa. Sanskrit. Religion. 1989.. athaitareyopatishhatu. . atha shriimannyaayasudhaa. Language.. Sanskrit. Sanskrit. 353 pgs. Language. 203 pgs... saayand-aachaarya. 64 pgs.. Gangavishnu amp Khemaraj. Sanskrit. Not available. sadaachaara.. Theology.. H. athashriimadgagavatat'ippand-ii yadupativirachitaa chatuthai skadhan. athaaprabdhanoyaanamimaan'saa. Savanur. Linguistics.. General.. atharvaipraatishaakhayamu. H. athashriimadgagavatat'ippand-ii shriinivaasatiithaiyaa ekaadashan.. 0. saan'tabalekarakulajena daamodarabhat't'asuununaa shriipaadasharmand-aa.. 620 pgs.. sanskritdocuments. Literature. athashriimadgagavatat'ippand-ii yadupativirachitaa ekadaso skadhan. 0. atharvaveidasan'hitaa bhaaga 4. . . atha shriimadbhagavate ashht'amaskan'dhan. 0. Sanskrit.. Not available. athabrahaasutrabhaashhyan. 398 pgs. Sanskrit. 352 pgs. 206 pgs.. Sanskrit.. Literature. 0. Literature.r. Linguistics. Language. . 258 pgs. atharvaveda san'hitaa. . 1858.

. Literature. 77 pgs. Art. 0.. 1934. 26 pgs.. 1973. .. Sanskrit. Language.. 0. Sanskrit. Not Available.... 1985. aumaapatamu. shrii machchhang-karaachaarya.l. Linguistics. Sanskrit. Language. krishna Das.2/14/2011 A list of scanned Sanskrit books at III… athashriimadgagavatat'ippand-ii yadupativirachitaa trutiyo skadhan. 257 pgs. Psychology. Sanskrit. 170 pgs.. athashriimatryaayaamutodhvitiyan'parichchhaidan.. 1985.. Religion.. Linguistics.. 864 pgs. d. Sanskrit. 0. Linguistics. 122 pgs. mahaamahoopaadhyaaya shriigadaadharabhat't'achaarya.. Religion. shriigang-geshopaadhyaaya. Raghu Veera.. Linguistics. Religion. athashriimadgagavatat'ippand-ii yadupativirachitaapanchamo skadhan.t.. shriiabhinavakaalidaasa. 1977.. avachchhedakataaniruktti diidhityaasaha. 1869. Religion. 1959. Literature. athavaiveda san'hitaa. Language. Panduranga Pandit. Philosophy.. bhaamahiiya kaavyaalang-kaara udyaana vritti. Goswami.. K. Sanskrit. Shankar Panduranga Pandit. Linguistics.org/…/SanskritIIIT. 1936. Language. THEOLOGY. Language. 2000. avadaanakalpalataayaa mand-ichuud'aavadaanan' naama trutiiya pallava. Sanskrit.. Linguistics. Religion. Sanskrit.. Literature. Sanskrit.. Technology. Sanskrit. 1954. 810 pgs. athavaivediiyaa poppalaada san'hitaa navii kaandaa. 590 pgs. Religion.joshi. Theology. Literature.. baalaraamaayand-aannama. 0. . P Beniram Sarama Gaup. sanskritdocuments. tataachaarya siroomani. 856 pgs. 122 pgs. Sanskrit. 2000. Sanskrit. t.. 644 pgs. Raghu Veera. Sanskrit. 613 pgs. Acharya Mukunddevagya.. ayurveda bhashym panch khandm. Jithendra Bajaj. bhaamatii brahmasuutrabhaashya katusuutri. 171 pgs. Sanskrit. Sanskrit. Sanskrit..l.. 1901. 26 pgs. Religion.. Literature. Religion. 1957. Krishnacharya. Sanskrit. Sanskrit.. 1894. aachaarya dand-d'i. athavaivedasan'hitaa dusara bhaagan.. Not available... K Vasudeva Sastri. vaachaspati. 126 pgs.. 2000. Linguistics. Literature.… 100/167 . athavaivedasan'hitaa tisaraa bhaagan. atran' bahu kurviita... K. 284 pgs.. .. bhaagavatachampuu. . Theology. 34 pgs. Religion.. Religion. Sanskrit. Sanskrit... Sanskrit.. Technology. 1933. Sanskrit. Literature. shriimadamarachandrasuri.. 1940.joshi. 639 pgs.. Sanskrit... binod lall sen. 298 pgs. Linguistics. athavaiveda san'hitaa. 675 pgs. athashriimatsayapuraand-akramaand-ikaa.r. avantisundarii. Language.. Sanskrit. avataaravaadaavalin' pradamo bhaagan. Sanskrit... Language. Theology. avmanjari. Sanskrit. athavaivediiyaa poppalaada san'hitaa ek kaandaa. 2000. 142 pgs.. baalabhaaratamu. -. 1908. . Religion. 515 pgs. 1908. Sanskrit. avayava diidhityaa diidhitiprakaashikamu. 447 pgs. Sanskrit... govindadeva. Sanskrit. ayurveda vijnanam. Unknown.. Language. Sri Raghunathasiromani. 0. Literature.. K.l.. 1916. baadhan. 110 pgs... 0. 1929.. 727 pgs. 672 pgs. Literature. RELIGION. athavaiveda san'hitaa trutigo bhaagan. 323 pgs. Sanskrit.. 1996. bahudarmaipuraand-amu. 358 pgs. 351 pgs.k.. baalabodha san'graha. 1989.joshi. Literature. athavaiveda san'hitaa pehalaa bhaagan. 351 pgs..

Sanskrit. 1913. Literature. Linguistics... 426 pgs.. Sanskrit. Linguistics. Literature. Literature. Anantha Krishna Sastri. 0. bhaavanaaviveka sat'iika. 230 pgs.... 0. N.. Sanskrit. Language. Philosophy. History.. bhadranyaka upanishad. vaasishht'a gand-apati. bhaat't'adiipikaa shriimatkhand-d'adevaprand-iitaa... 82 pgs. Language. Sanskrit. Sanskrit. 0. 0. 70 pgs. Not available. 1280 pgs. Sanskrit. bhaashhyaartharatnamaala. bhaashhyaayairatnamaalaa. Literature. Linguistics. Psychology..… 101/167 . u krxshhnd-ashaastrii. Sanskrit. 1998. Venkararaghavan Sastri. Not Available... 1961. 310 pgs. Literature. Literature. gaanjan chintaman deo. Biography. Literature. 1955. LANGUAGE. 1921. sanskritdocuments.. bhaarata ko janagananaa 1981. 0.. shrii gn-aanaanandendrasarasvatiisvaamii. Language... 0. 332 pgs. Sanskrit.. Pachamukhi.. Language. 0. Theology... 1938. Language. 0. Language.s. bhaaratiiya raajaniiti prakaasha. 432 pgs......padmanaabha. Philosophy. 156 pgs. Linguistics. Language. bhaat't'adiipikaa uttarashhat'ahamam.. Language.org/…/SanskritIIIT. Psychology.. Sanskrit. Language. Literature. bhagavadanudhaavananaamaa champuprabandha. 387 pgs.. bhaarata ko janagananaa 1981. Psychology. 300 pgs. Sanskrit. Sri Subramanya.. 144 pgs. Literature. Language. Sanskrit. Sanskrit. Sanskrit.. laqs-mand-a sin'ha khanna. Sanskrit. Religion.. Literature. Sanskrit... 1926. 439 pgs. 584 pgs. shriijagatraaya. 708 pgs. harinaaraayand-a. Literature. 0. p. Sanskrit. Sanskrit. LITERATURE. 1936. Sanskrit. Sanskrit. Geography.. Sanskrit. Sanskrit. Sanskrit.. Dravida Rajesvar Sastri. p. 0. bhagavaan daasa. Sanskrit.. Linguistics. 560 pgs.. Linguistics. Linguistics. 902 pgs. bhaaratiiya vana adhiniyam miimaan'sa.. Literature. niilakand-t'habhat't'asuunupand-d'ita. 1999.. 430 pgs.. Language. Philosophy. Literature.. bhaarata charitra pariikqs-aa. 1914.2/14/2011 A list of scanned Sanskrit books at III… bhaamatiisamaaloochanamuu.. Hari Narayan Apte. Embar Krishnamacharya. Linguistics. Literature. Sanskrit. anantakushhnd-a. Philosophy. bhaat't'adiipikaa Part I. Language.. 146 pgs. 1894. Literature. 206 pgs. Language. bhaarata chaampuu. bhaaminivilaasan. bhagavadgiitaya luupanyaasagal'u eran'd'anaya bhaaga. bhaashhyaatheratnamaalaa. bhaaratiiyamu athaishaastramu. bhaavaprakaasha bhaavabodhiniihindiivyaakhyaayopeta. LINGUISTICS. Linguistics. Linguistics. 1921. Linguistics. -. Language. shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru. 1951. Literature. bhagadattajalhand-a virachitaa sukttimukttaavalii.. 0.. Not available.padmanaabha. bhaaskarodayaa tarkasan'grahadiipikaa prakaashasya vyaakhyaa padavaakyapramaandapaaraavaariind-a. 1915. p. Linguistics. Sanskrit. 194 pgs. Psychology.padmanaabha.. Social Sciences. bhaashhyagaambhiiyothenind-eyamand-d'anaaraye grantha. Linguistics. Language. 0. Linguistics. 156 pgs. bhaarata ko janagananaa 1981 part Iii B. bhaat't'amiimaan'sakaanaan' sarvasvamu shabdapramaand-asya vaishiptyamu.. Literature. Sanskrit. Philosophy. bhagavadgiitaa.. mand-d'anamishra. Linguistics... Psychology. 174 pgs. 624 pgs.. 90 pgs. 348 pgs.

bhavana viveka.. Not available.org/…/SanskritIIIT. 1934. bhatta bhasha prakash. Sanskrit.. 138 pgs. 1904.. 0. bhagavadgiyaanasopaanamu. Sanskrit. 670 pgs. Theology.... sanskritdocuments. 1952... Sanskrit. bhagavadgund-adapand-aakhyamu shriivishhnd-usahastranaamabhaashhyamu. bhedasaamraajyamu. Linguistics. Sanskrit. bhat't'ikaavyamu. Philosophy. Language. Language.. Literature. Psychology. Sanskrit. bhat't'ikaavyamuu. Language.. Not Available.. Religion.. Linguistics. Linguistics. shriigovindadaasa. Religion. 1983. Philosophy. bhat't'akalpataru.. Literature. 1915. shaataanandasunu. Language. bhasa svapnavasavadatta. Linguistics.. 1169 pgs. 1930. Language. 282 pgs. 1914. g k bhatt ed. 1957. Linguistics. Sanskrit. 0.. Psychology.. Literature. bhat't'achintaamand-i.. Linguistics.. 178 pgs. bharatabhasyam part 1 chapt 1 5. Linguistics. -. 96 pgs. Sri Visvesvara Siddi. Sanskrit. d. Sanskrit. Literature. Literature. Literature.. Sanskrit.. Linguistics. shriimannrxsin'gaashramamuni. Psychology. 294 pgs. naanyabhupal. Literature. 424 pgs. Language.t. Linguistics.. Language. Sanskrit.. bhasasastrapravesini.. bhaimiiparind-ayannaama naat'akamu nalavijayaaparanaamakamu.. Language.. LANGUAGE... 1934. 1964. bhakttisudhaataran'gand-ii.. Psychology. Philosophy. Sanskrit. Language. Religion.. Sanskrit. 661 pgs.. Language. Philosophy. Linguistics.. Language. 511 pgs. 71 pgs. Linguistics. LINGUISTICS. Sanskrit. Sanskrit. 128 pgs. Psychology. Sanskrit... Sri Tarkavagisa Bhatta Venidattacharya. 1271 pgs. 1900.. shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru. Linguistics. bhat't'achintaamand-estar^kapaada. Sanskrit. god'avarti shat'hakopaachaarya. 1947. 322 pgs. 0. 420 pgs.. bhedasaamrajyamuu vedaantabhaaga.. bhaishhajyaratnaavalii. Language. Sanskrit. 66 pgs. 1952. 1914. Sanskrit.. Mandana Misra. Philosophy. 1933. Sanskrit...… 102/167 .. Linguistics. mahaakavishriibhat't'i. Sanskrit. Sanskrit. Literature.. LITERATURE. bhartrxharisubhaashhitamu. 462 pgs. 580 pgs... bharatamajjari. venkata ramana sastri. 260 pgs. mand-d'ikala raamashaastriind-a. bhamahas kavyalankara. Literature.... 1961. 1938. 2000.. bhat't'ikaavyamu chandrakalaa vidyotinii san'skrxta hindii vyaakhyaadvayopetamu dvaadashaadi dvaabin'shatisarmaparyantamu.. Literature. The Arts. Sri Rama Subramanya Sastri. bhedadhikkaara upakaaramapaarkarma vyaakhyaayasahitamu. bhaktamaalaa raamarasikaavalii. shriikshemendra. Sanskrit. Language. bhedajayaqs-i. Theology. Linguistics. Literature.. 857 pgs..2/14/2011 A list of scanned Sanskrit books at III… bhagavadgiitaya luupanyaasagal'u on'danaya bhaaga. Sanskrit. 96 pgs. shrii koliyaalamu svaamina:. 252 pgs. Sri Ranga Ramanuja Desikan. jayamangalayaa. 84 pgs. 1999.. Psychology. 1912. shriimadbhat't'i. bhedojjiivana. Religion. Sanskrit. 1954. khemaraaja shriikrxshhnd-adaasa. 1942. bhiimaparaakraman. Language.. 0. Language.. Literature. Sanskrit. Theology. Linguistics. Literature. Sanskrit.. shriivatsaangkamishra. Literature. Language. 130 pgs. 0. Not available. Philosophy. Literature. tatachary siromani. Linguistics. 120 pgs. venkat'asubrahmand-ya. 74 pgs.. bhagavadraamaanujavijaya gadhyaprabandha. Literature. Sanskrit.. 188 pgs. 222 pgs. Krishhnd-akumaari. 1898. Sanskrit.

.2/14/2011 A list of scanned Sanskrit books at III… bhonsle vamsa charitra. 1918. 1951. Sanskrit.. Literature. Sanskrit. 1933. brahamiman'shatrishati. raghunaatha. bhramasuutrabhaashya bhaaga 1.l.. bhuukailaasanaat'akamu. 1901. 557 pgs. Linguistics. Sri Anantha Krishna Sastri... 1941. Literature. Literature. Sri Anantha Krishna Sastri. 0. Linguistics. Literature. 1937. Dr Sureshchandra Mishra.. Linguistics. Rangaswami. 994 pgs. 1984. 357 pgs. Sri Sankara Bhagavatpadacharya. 452 pgs. Linguistics. 100 pgs. Geography. Philosophy. Sanskrit. vi. 1956. boddhi san'skruta grandaavalii 21. Language. Theology.. Psychology. Sanskrit.. sanskritdocuments. Linguistics. Psychology. shrii madhvaachaarya. 1991.. Sanskrit. brahaasutrashaan'karabhaashhyamu dusaraa bhaagan. Linguistics. Psychology. Sanskrit.panchamukhi.. brahaasutrabhaashhyamu. 90 pgs. brahaasuutrashaan'karabhaashhyamuu Part Iii With 9 Commentaries. 649 pgs. Sri Vasudeva Brahmendra Sarasvati Swamigal. Language. 306 pgs.. 0. Sanskrit. 344 pgs. Sanskrit... Not available. 1908. 1989. LITERATURE. 269 pgs. bodhaayaniiyagrxhyasuutra.. 80 pgs. Philosophy.. baskaraachaarya.. 708 pgs.. shrii madhvaachaarya. Language. bhramasuutrabhaashya bhaaga 1.. 1927. brahaamanhikamuu. Sanskrit.… 103/167 . Language.. brahamiimaan'saabhaashhyamuu.s. bhucvaneishalaukikanyaayasaahastrii.d'i alan'kaar. Sanskrit. Literature. brahadhogatarad'ugind-i asyaan' dhvitiyo bhaagan. Literature. Sanskrit. 441 pgs. Literature. . bhoojanakutuuhalamuu... Sanskrit.. Sri Sankara Bhagavatpadacharya. aar.. Literature.. Philosophy. 1959. gokarnd-a saan'badiiqs-ita. Sanskrit.. LINGUISTICS.. Bhaskaracharya.. Linguistics. Sanskrit. Linguistics.. Language. Sanskrit. Mahadeva Sastri Bakre. Language. brahaasuutrabhashhyamuu Text with Tippanis. Language. t'haakuur. brahaasuutrashaan'karabhaashhyamuu Part Iii With 5 Commentaries. brahaasutrashaakarabhaashhyamu bhaamatiikalpataruparimalopetamu.. Psychology. 1955. Unknown. bhuddhabhuushhana... Sri Subramanya Sastri. 444 pgs. shriiballaala.. Sanskrit. Wasudev Laxman Shastri Pansikar. 1977. 324 pgs.. 646 pgs. Philosophy.. bhuhajjaatakamu... 126 pgs. gopalan s tr. 0. bhushanam. 1932. Literature. 1926. Philosophy... Sri Gnana Bikshu. Geography.p. 236 pgs. Sri Nimbakacharya. Linguistics. Language. brahaasuutrashaan'karabhaashhyamuu With Commentaries of Shri Givindananda Vachaspati Anandagiri. Sanskrit. Psychology... 524 pgs. 1929.. bhoojaprabandha. Sanskrit.... 73 pgs. 494 pgs.. hech. 354 pgs. Psychology. Sanskrit. 42 pgs. Sanskrit. Psychology. History. Linguistics. Sanskrit. Sanskrit. 1920. R. LANGUAGE. 1934.... Language. 534 pgs. Narayana. Religion. Psychology. Language. Sanskrit... Literature. Vaidya. Philosophy.. Language. Psychology. 1923.. 938 pgs. brahaasureabhaashhyamu... Brahmasutras.. brahaasuutrashaan'karabhaashhyamuu Vol I Chatussutri. 650 pgs. brahaasuutrabhashhyamuu. Literature. 355 pgs. bijn'panaya. boodhaayanaguhaya suutramu. Philosophy. Sanskrit. 1949. shaama shaastri. Linguistics. Sanskrit. Philosophy.. Biography. 106 pgs. Sanskrit. Philosophy. 0. 1984. Sanskrit.subramanyasaastri. 0. Religion.org/…/SanskritIIIT. Sanskrit.

1963. brahmasutraavabhavamu. Philosophy. brajavilaasa... brahmatatvaprakashika. Theology. 340 pgs. sanskritdocuments.. Brahmasutras.. Language. 315 pgs.. Linguistics. Sanskrit. 266 pgs.. Krishnasastri. Psychology. Linguistics. brhamasuutra vrutti. 2003.2/14/2011 g A list of scanned Sanskrit books at III… p y y gy pg brahasuutraanugund-yashiddhi.. Madanmohan Agarwal. 1937... Linguistics. gan'gaavishhnd-u shriikrxshhnd-adaasa. brahmamiimaan'saabhaashhyamu. shriividhyaarand-ya. 278 pgs.. 246 pgs. 1909. Literature.. 2000. Not available. 441 pgs. Linguistics.. Sanskrit. Literature. brahmaasuutraand-i. 1915. 1923. Language. Language. bhaaskararaaya.… bh ti ti k i i L Li i ti Lit t S k it 1941 188 104/167 . Sanskrit.t. 1927. Sanskrit. Philosophy. shriimajjayatiirtha vyaasatiirtha.. V. Literature... Sanskrit. V. Language.. Religion. brahmavidaashiirvaada. Literature. 1991. Language. Yogeswara Dutta Sharma... 416 pgs. Sanskrit.. 0. 290 pgs. brahmasutraa nimbaakaibhaashhyamu charma bhagan. brahmasutraavabhavamu vrittimit'aksaraa. brahmasutrabhasya of sri madhvacharya vol 1. shaastri. S. Literature. Philosophy. Philosophy. brahmasutraa nimbaakaibhaashhyamu.. Psychology.. hari naaraayand-a. vidhyaabhaaskara shriimand-ishang-karo vasantaraamaatmaja upaadhyaaya. 1922. brhadaarand-yakopanishhatu. Brahmasutras.prabanjanacharya.. brahmasuutrashaan'karabhaashhyamuu. Sanskrit.... 340 pgs. sri bhagavad ramaanuja. 461 pgs.. balagangadar tilak l. Literature. Hari Narayana Apte. Language. brahmaand-d'apuraand-ettarabhaagiiyan' lalitaasahasranaama saubhaagyabhaaskaraaravyabhaashhyan. 191 pgs. 441 pgs. Linguistics. vaasudevasharma. 1984. 102 pgs. Linguistics. Literature. brahmasuutrashaang-karabhaashhyamu sat'ippanan' muulakaatramu.. 30 pgs.yal. Language.. Sanskrit. 1967.. brahmasuutrabhaashhyamuu samalang-krxtamu. shriinimbaarkaachaarya. 604 pgs... Upanishads. Kuppuswami Sastri. Sanskrit. Language.. Sanskrit. Theology. 510 pgs.. Brahmasutras. Vira Raghavachaya. Sanskrit. brahmasuutrabhaashhyamu prathamo bhaaga... Linguistics. Sanskrit. Language. 596 pgs. 245 pgs. Linguistics.. 185 pgs. 453 pgs. bran'hmaan'd'a puraand-amu. 1991. 1954. Not available. je. Sanskrit. Not available.. Sanskrit. Religion. Sanskrit. Madanmohan Agarwal. Sanskrit.org/…/SanskritIIIT. 1894. Theology...... Linguistics. t'i gand-apati saastri. Literature. 1983. brahmasiddhi Of mand-namishra Vol 1 brahmakaandaa. Prof. Psychology. 1933. Religion. Brahmasutras. Sanskrit.. Sanskrit. Literature. brahma suutraand-i. 0. 203 pgs. Sanskrit. 530 pgs. Linguistics.. brahmasutraa nimbaakaibhaashhyamu. 322 pgs. 198 pgs. Literature. Theology. Language. Sanskrit.. 1984. Brahmasutras. Chandrasekharan. Linguistics. Venkataramana Reddy.. Sanskrit. Religion. 200 pgs.. brahmasutraa nimbaakaibhaashhyamu panchamo bhagan. 2000.. Sanskrit. 0.. Sanskrit. 1981. brahmasuutrabhaashhyaalochanasya prathama chatu suutrii. Literature. Sanskrit. 2002.. brahma sutra sariraka bhaaga 1. Language. 1957. T. Sanskrit.

. Linguistics. Linguistics. Sanskrit. 0. 0. Sanskrit..ma. prabhaakaramishra. King Sambhu.. trimallabhat't'a. chaalukyacharitamu. census of india 1981 series 1 part Viii. Language.. Sanskrit. Literature.. 110 pgs. Art.. P. brxhadaarand-yakopanishhatkhan'd'a. ma... Philosophy. 460 pgs. chalaraashikalanama. Language.. Linguistics. Sanskrit. brxhatakathaaman'jarii. 1901. 664 pgs. Sanskrit.. rangaswami aiyangar.. Sanskrit. LINGUISTICS. Social Sciences. Psychology. Language. 1924. Not available. Sanskrit. champuramayana kiskindha kanda and sundara kanda. Literature. 290 pgs.padmanaabha. Language. 82 pgs. Not available. Sanskrit.. 0.. Linguistics. k. brihadaranyakopanishhat'a khandarthaa. RELIGION. Language.2/14/2011 A list of scanned Sanskrit books at III… brhaspatismrti. shriibhoojaraajasaarvabhauma. 283 pgs. shriiraamachandra budheindra. Literature. 256 pgs.. Literature.. 32 pgs.viswanatha Nayak. Literature. budgat 1966-67 finance minister's speech part -a.. Linguistics. Sanskrit. champuuraamaayand-amu ayodhyaakaand-d'amu. Sanskrit. qs-hemendra. Unknown. 256 pgs.. chimand-aajii aapat'e.. Language..… 105/167 . Sri Raghavendra Tirtha. Sanskrit... brxhatstotraratnaakara sachitra.. Linguistics. 0. brxhatii shaabarabhaashhyavyaakhyaa. Sanskrit.... Linguistics. 1933. narayana raam acharya. Linguistics. LITERATURE... Literature.. 480 pgs. Literature. 158 pgs. Religion. 1941. Sanskrit. Sanskrit. 552 pgs.. Language. brxhadhyogatarang-agind-ii dvitiiyobhaaga. 1946. Literature. 122 pgs. Sanskrit. Natural Sciences. champuuraamaayand-amu kalyaand-ii san'skrxta hindiivyaakhyaadvayopetamu. Literature. shriibhojaraajasaarvabhauma. Linguistics. v. brxhaddhaan'turuupaavali. buhadaarnd-yakopanishhanmitaaqs-araa. Sanskrit. census of india 1981 series 1 part V A amp B. Sanskrit. 330 pgs. 0.. 295 pgs.sudhaakara diveidi. 1979. t.. Not available. 1246 pgs.. Sanskrit. p... 1955. Sanskrit. Language. RELIGION.. Language. 1891. Literature. Theology. 560 pgs.org/…/SanskritIIIT. kaviraj shrii athrii dhev guru. 1926. 0. sanskritdocuments.. 0. Jwalaprasad Misra. Language.. champubhaaratamu. Sanskrit. 1895. THEOLOGY. champuuraamaayand-amu yuddhakaand-d'amu vyakhyaaya sametamu. bulletin of the goverment oriental manuscripts library madras. Language.. Sanskrit. Literature. budhabhuushhand-aman. 1941.. LANGUAGE. t'i aar krxshhnd-aachaarya. 643 pgs. Language. 1843. THEOLOGY. Language. chandrashekhran. Language. Literature. Sanskrit. 1326 pgs. Not available.. 1979. hari naaraayand-a. 290 pgs.. Linguistics. Language. 643 pgs. Literature. 1875. p. 1914. Linguistics. buhadaarand-yakopanishhadushhyavaatokamuu. 650 pgs.. brxhadhdaan'turuupaavali. Linguistics. chaand-akyashatakam. Linguistics.. Literature. Language. 1943. Literature... 0. Linguistics.padmanaabha.. Linguistics.. bruhadhyaavanaajaathakama. Sanskrit. Literature.. 0.. Sanskrit. champuramayana. t'ii aara krxshhnd-aachaaryand-a.. 132 pgs. Sanskrit. bhoja. 188 pgs... 34 pgs. Linguistics.

Language. 1937. Not available. Language.. 526 pgs. shriibhoojaraaja. chan'drikaaprakaashaprasara. 394 pgs.. Linguistics. Sanskrit. Sanskrit. LANGUAGE.. champuuraamaayand-amuu baalakaand-d'amuu. Sri Vallabhacharya. Language. Not available. Literature. Social Sciences. Literature. Language. 88 pgs..org/…/SanskritIIIT. Language. chaturvaand-ii. Sanskrit. chatur^thiikar^mapaddhati.. Literature.... Literature.. 386 pgs. 184 pgs. Linguistics.... Linguistics. 106/167 . Not available. Sanskrit. Linguistics... 0. 1914. chaukhaambaa sahitya. chatushshlekii stotraratnanj-cha. Linguistics. chandraprabha charita. Language. chandra loka. Sanskrit. Linguistics. 1959. 1904. Technology. Linguistics.r. 322 pgs. chaukhambaa siiriija saahitya 1999 ii. Linguistics. Sanskrit. Sanskrit. Sanskrit.. Linguistics. Sanskrit. Theology. Literature. charakasn'hitaa by agnivesha.. 112 pgs. 190 pgs.. Not available. chatun'shlokii.2/14/2011 A list of scanned Sanskrit books at III… Language. Language. 1962. Language... Not available.. 0.. Linguistics. Literature. 112 pgs. chandraaloka savimarsha prakaasha hindiivyaakhyaya panj-chamo mayuukha. Sanskrit. 1843. Literature. 106 pgs. 1843. Sanskrit. Krishnacharya. Sanskrit. 0. 1941. Sanskrit. 672 pgs.. Not available. bhat't'oojidiikqs-ita. Literature. devakiinandana. chandrasyasaarand-iiraashyaadi 321404. LANGUAGE. 1977. chaturvin'shatiimatasan'graha. 156 pgs.. LINGUISTICS. 398 pgs. 112 pgs.. chandrakalodaahaara. Social Sciences.... Gopala Lala. 0.. chandrakaantaa santati saatavaan' hissaa. Sanskrit. Literature. Literature.. 230 pgs. Literature. shriimadyaamunamuni.... Language. shriimattaatparya.t.. Religion. chaturdandi prakaashika. 86 pgs.. Linguistics. 342 pgs. Sanskrit. Literature. 1934. Language. Sanskrit. 1962. 108 pgs. LINGUISTICS.. Religion. Linguistics. chhaan'dogyavedeshiiyat'iikaa. Theology. Literature. Literature. 1960.… chhaandogya braamhand-amu trxtiiyobhaaga. 251 pgs. 194 pgs. Language. Not available. Not available. Chakripanidatta. Language. Literature. Linguistics. Linguistics. 115 pgs. 126 pgs. Not Available. shriijayadevakavi. Sanskrit. Sanskrit. 1912. sanskritdocuments.. Not available. Sanskrit. 0. Linguistics. Linguistics. Sanskrit. 127 pgs. Sanskrit. Language. 142 pgs. Sanskrit. Sanskrit. Sanskrit. Linguistics.. devakiinandana. 37 pgs. Sanskrit. chaukhambaa saahitya 1996 97. Language... LITERATURE. chaukhambaa saahitya. chaturvaand-ii. . Literature. Not available.. subramanya shastri s. chhaan'dogyopanishhatkhan'd'aartha. Sanskrit... 0. Linguistics. Language. LITERATURE. chhaan'dogyavedeshiiyat'iikaa. 0. Unknown. 1993. 0. charudattam. Language. 0.. Sanskrit. 1861. Not available.. paurnamasi katha bhatta. 0... Sanskrit... chatur^var^gachintaamand-e Part Ii. 461 pgs. 1999.. Language. Linguistics.. 1926. 810 pgs. Language. Literature. Not available. Literature. Language. viiranandii.. Hemadri. Sanskrit. chan'drikaaprakaashaprasara... 0. Linguistics... Literature. devadhar g r tr. 112 pgs. Language. Literature. chaukhambaa saahitya 1996 97... 142 pgs. Linguistics. Literature. chandrakaantaa santati paan'chavaan' hissaa. 1907..

mahaakavikaalidaasa. LINGUISTICS. 2002. pan' harishang-kara sharmma.2/14/2011 A list of scanned Sanskrit books at III… chhaandogya braamhand amu trxtiiyobhaaga. Sanskrit. 1873. Sanskrit. Sanskrit.. 628 pgs. Sanskrit.. 1958. LITERATURE. Literature. Sanskrit. chitramiimaan'saakhand-d'anamu marmakaashena vimarshinyaa baalakriid'ayaa.. chikitsaa saahitya. Sanskrit. chidagana chandrika sanskrit commentry and english translation. RELIGION. chhandovichitin. bhiqs-u. Literature.org/…/SanskritIIIT. Literature. daarubrahaa. vord'ana d'ila.. chhandashaastramu. 470 pgs.. chitranibandhaavalin. 1965. K. 244 pgs. 645 pgs. ching-iyaaghara. 1941. chhaandogyopanishhatuu saamaveidaa. 1938. shriiping-galaachaarya. 1991...s.. 1938. 2001. Literature. Sanskrit.... 232 pgs.. Literature. 218 pgs. 209 pgs.. 0. 1937.... 125 pgs... Linguistics. 282 pgs. Religion. Sanskrit. Sanskrit. Sri Paramasivendra Saraswati. contribution of andhra to sanskrit literature. Sanskrit.. chhaandoogyabraahmand-amuu. Bhabgavata Hari Sastri. Literature.. 0. THEOLOGY. Linguistics. Sanskrit. daarshaanik pancham varshik shanaak. Linguistics... Religion. The History Of Philosophy. 208 pgs. 459 pgs. Sanskrit. The History Of Philosophy. Linguistics. Linguistics. subrahand-ya shaastrii. Language. 1956. Language. sanskritdocuments. Linguistics. Rangaswamy.. Theology.r. 1980. shriiping-kalanaaga. Literature. daanachanddrikaa. hari naaraayand-a aapat'e. Technology.. Linguistics. Sanskrit. Literature. daasacharitamu. mand-d'itaraaja shriijagannatha.. Linguistics.. 366 pgs. Sanskrit. 1943. Ananthanarayana. Linguistics.. Sanskrit. 1948. Sanskrit... LINGUISTICS. Sanskrit. Linguistics. 1932.t. Language.. Sanskrit.... Sanskrit.m.. Linguistics. 411 pgs.. Sanskrit. Language. chhandas sastra. Literature... Sharma. shriijovaanandavidyasaagarabhat't'aachaaryaa. Sanskrit.… 107/167 . Literature. Linguistics. Psychology. raamaraaju b. Language. daanakaand-d'amu panchamo bhaagan. divaakara. d'anavaara kii ghaat'ii. LITERATURE. Language. 256 pgs.. 82 pgs. Language. Literature. kalidasa.. 152 pgs... Ayurveda. 1964.. Language.. 1980. chidagaganachanddrikaa kramaprakaashikaavyaakhyaaya. 326 pgs. Literature.. Vacant. chitramiimaan'saa sudhaa vyaakhyaasamalang-krxtaa. shriitaaraanaathatakivaacha.. Language. Linguistics. Sanskrit.. Sanskrit. 1989. 1902. 120 pgs. shriimadappayadiiqs-ita. 127 pgs. chitraprabhaa. Sri Gopala Shastri Darsanakesari.v.. shivadat't'a. Literature. sri pingalanaga. 1908. Literature. chitramiimaan'saa. 213 pgs. daharavidhyaaprakaashikaa.. The Four Vedas. Sanskrit. Language. 579 pgs.. 162 pgs. 530 pgs. 212 pgs. 1971. Sanskrit. 0. 2000. Language. Language. 1932. Linguistics.. Language. 160 pgs. 0.. Language.. chhanda shaastramu mrxtasan'jiivanyaa vrxttii.. 90 pgs. chhandobhyastaa. 1962. Literature. Linguistics. Raghunath Sharma. B. shrii durgaamoohanabhat't'aachaaryaind-a. 830 pgs. 1941. Sanskrit.. Language.sharma. Sanskrit. yash dev shaalya.. LANGUAGE. chhaandogyopanishhatuu. Sanskrit. Psychology.. daanakelichintaamand-in. 322 pgs. 80 pgs. LANGUAGE. Not available. Philosophy. Banamali Biswal. chitraprabhaa. daasakuut'a... Linguistics Literature. Sanskrit.

. dhamaupadeshaamaalaa vivarand-a. 1933. Literature. B. 1924. dhananj-jaya. LITERATURE. Sanskrit.. Linguistics. 120 pgs. 131 pgs. C. Philosophy.kunhan Raja. dharma kuut'amu Vol. Kunham Raja. Psychology. Literature. 1926.. 1954. Theology.. Linguistics Literature... Sanskrit. 24 pgs. G... Linguistics. LITERATURE. Sanskrit. Linguistics. Literature. deshopadesha namaimaalaagrantho. Sanskrit. 0. 0. Linguistics.. 1936. dashainashaastrasyaitihaasan. Manmatha Nath Dutt. dhar^masaastraa Part Ii. Language. 1976. Theology. 519 pgs. Literature. Sanskrit. 545 pgs. lakshmipuram srinivasachar. dattaka chan'drika.. 352 pgs. 1983. 518 pgs. 0. 106 pgs. Sanskrit. 631 pgs. 254 pgs. Sanskrit. Sanskrit. dasharuupakamu kaavalokaaravya t'iikaa sahitamu.. 1909.. Sanskrit. Literature. Language. yashaavanth vaasudhev paatnkar. Literature. dharma shastra.. Sanskrit. 1987. Sanskrit. Sanskrit. LINGUISTICS.achari. naabaadarsgabaoaranaachaaryya.. 1998. 602 pgs. 202 pgs.. Sanskrit. Language. Iii Part Ii. 1898. 1895. 402 pgs. 1111 pgs. Literature. Religion. Sanskrit. Theology. Literature. dashaavataarastotramu. Sanskrit.. vinaayaka gand-esha aapat'e. Sanskrit. dattakamimaan'saa 1976. 126 pgs. deha prakriti vignyan. Sanskrit. Literature. 652 pgs. Sanskrit. 1996. Sanskrit. dhaaturatnaakara. 1928.. Sanskrit.. LINGUISTICS. dhanan'jayavijayan. 1998. 1949. shriivaidikasaarvabhaumai.. Sri Jayasimha Suri.. pan'd'it chamaraajanagar shriikaan'ta shaastri.. Religion.. C. Religion. mahaadeiva chimand-aajii aapt'e. ddvaitokttiratnamaalaa. shriiraama. 1924. dasha upanishhada prathamabhaaga vyaakhyaayutaa. 1934. Theology. Philosophy.ramachandra Sharma... dhaaturuupa prakaashikoopoodhghaata. 341 pgs. dashanind-aiyai. 1878.. devataadhyaaya san'hitopanishhadu van'sha braahamand-aani. Language. Linguistics. shrii upanishhadbrahmayogi. shriikaakhanaayai... Language. Not available.. dashanirnd-ayii. Linguistics. Language.. dasha upanishhadan' pradamo bhaagan. kaviraja rakhaldaasa kavyaatiirtha.. dharmaakuutamu 2 ayodhyaakaand-d'a prathamo bhaaga. Sanskrit... Social Sciences. Linguistics... Sanskrit. Kashmir.. devabhaashhaa. Language. Art. Sanskrit. 0. 1935. 1935... 352 pgs. vaad'iilaala. Religion. 976 pgs. Linguistics. Upanishads.. Upanishads.shashibala Gouda. dasha upanishhadan' pradhamo bhaagan. darsanodaya... Religion. Linguistics. Dr. 290 pgs. dasha upanishhadan' dhvitiyo bhaagan. 0.kunham Raja. Venkatanathacharya. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… dakikhanii kaa padha aura.. darshapuurnd-amaasaprakaasha prathamo bhaaga. LANGUAGE.. 363 pgs. Sanskrit. maarulkarashaastri. 1936. 575 pgs. Bhagavdgita.. C.… 108/167 .. Linguistics. Literature. sanskritdocuments. LANGUAGE... Not available. tryamn'baka raayamakhi. Sanskrit. 520 pgs. Unknown.org/…/SanskritIIIT. dharmaakuutamu 1 baalakaand-d'a. Sanskrit. Language. The History Of Philosophy. Language.. Not available. ke. 130 pgs. 98 pgs. Sanskrit. Theology... Literature... Language.. Sanskrit. 101 pgs.. 1947.. 426 pgs... 370 pgs. Language.

ravisheikhara pan'd'ita badariinaatha sharma. LANGUAGE. Theology.. 526 pgs. 390 pgs.. Religion. Language.. p. 20 pgs. Sanskrit. Sanskrit.. Literature. Sanskrit. Linguistics. Sanskrit. 1971. mahaakavishriiseqs-apivara. Language. 1914. Sanskrit. Ganesha Sastri Ghokle. Language. Linguistics. 1832. Vacant. Language. 694 pgs. Literature. Language.. shriimadaanandavardhanaachaarya. 1955. Linguistics. Sanskrit.. Literature... Language. Literature. dharmatattvanirnd-ayaparishishht'amu. sanskritdocuments. 1954. LINGUISTICS. Linguistics. Literature. Sanskrit. Literature. 1934. Linguistics. diipikaasarvasvamuu.. Literature. Linguistics. Linguistics. Sanskrit. Linguistics.. shriisubhat'a.. Linguistics.… 109/167 .. gautama.. Religion. Sanskrit. Language..... 504 pgs... Vacant. Sanskrit. Literature. shrii badhiriinaatha sharma.. 200 pgs. dhvaivajnj-abharanamu. Sanskrit. LINGUISTICS. Sanskrit.. Linguistics. Literature.. Language.. Literature. kurugan't'i shriiraamashaastri. Language. 1935. 831 pgs. 0. dharmasindhu dharmadiipiikaa vishaadahindiivyaakhyaaya sudhaat'iippand-ya. Linguistics. 1050 pgs. Literature. Language. 712 pgs. Linguistics.. p. 1922. Sanskrit. Sanskrit. 162 pgs. dharmakosha Vol I Part I. 1954. 224 pgs.... Literature. Linguistics. dutaangadamu. Language. 0. 1937.. 116 pgs. Linguistics. 114 pgs. dhvanyaa looka.. 214 pgs. Literature. Sanskrit. 1940. dhatu sagara tarani.. sripati sastry. Sanskrit. 1988. Sanskrit. dharmakosha varnd-aashramadharmakaand-d'amu prathamo bhaaga kramaanka 5. laqs-mand-a shaastrii. dhvanyaalooka. Sanskrit. .. 855 pgs. Language. Language. 1972. 120 pgs.. dharmasharmaabhyudayamu. Sanskrit. laqs-mand-a shaastrii. dhatu sagara tarani... Linguistics. Literature. LITERATURE.2/14/2011 A list of scanned Sanskrit books at III… dharmaishaastrasan'graha. 1969. laqs-mandashaastrii joshii. 270 pgs. mahaamahopaadhyaaya vaasudevashaastrii. Sanskrit. diinaarkaraajakukaarahemalekhamu.... dharmakosha Vol I Part II. Sanskrit. thakur udayanarayana singh. 1968.org/…/SanskritIIIT.. Language. LITERATURE. Language. Linguistics.. lakshminarayana. dharmasuutra. dhvanyaalokasaara. 250 pgs. Sanskrit. 1968. 1938. diipikaasaahitamuu.. Sanskrit. Language. Language.. sripati sastry. Sanskrit. Literature. gautama.. dharmasuutramu bhaashhya sahitamu. 98 pgs. 373 pgs. 601 pgs.. 107 pgs. shriikaashiinaathopaadhyaaya. 1968. pan'd'ita durveika mishraa. vaidhyamahaamahopaadhyaayashriichakrapaand-idatta. LANGUAGE. 0.. Theology. dhvanyaaloka baalapriyaadivyaanj-janaabhyaan' lochanena. 1056 pgs. Linguistics. 1937. Literature. mahaakavishriiharichandra. Linguistics... 1933. 1900. draahyaayand-agrxhyasuutramu rudraskandavrxttisahitamu. dharmoottarapradiipa volume Ii. dravyagund-asan'graha dravyagund-asan'grahat'iikaaravyakhyaaya trxtiiyavrxtti.. shriipurushhottamasharma chaturveda. draahyayaand-agrxhyasuutravrxtti. Not available. 640 pgs. Language. Literature. Literature..

gathaa bhrxgvajirasaatmakasya atharvavedasya upasthaanaamake bhrxgukhand-d'e.vindhyeswari Prasada Dvivedi. dvatadhumand-in.. Literature. Linguistics. Literature..... 522 pgs. ganesh siddi.. 202 pgs.. 82 pgs. Shadguru. . Literature... gaayatriivyaakhayaa. Religion. Aurobindo. Language. Hulagi Sripathyacharya. Sanskrit. 0. badarinaada. epika Bhavaarth Bodhini. gaathaasaptashaatii. 432 pgs. gadya bhaaratii. 1969.. gadya bhaaratii. gadhatrayamuu. Sanskrit. Language.. eitareya braamhand-aa. gadaadharapadvatau aachaarasaara. dvisan'dhaanamu. Philosophy. Linguistics. omaprakaasha.. 72 pgs. Religion. Literature. Literature. ekaviiraa. 228 pgs. 232 pgs. Religion.. gand-itaadhyaaya vyaakhyaaya samanvita. 1908. 1932. yam. 240 pgs. 134 pgs. Sanskrit. Linguistics.… giitaagn aana prathama adhyaaya arjuna kaa vishhaada pan' diinaanaatha bhaargava dinesha 110/167 .... eitareya braamhand-aa..org/…/SanskritIIIT. Literature. 1912. Sanskrit... Sanskrit. Sanskrit. Theology.krishnacharya. Language.. 0. Sanskrit.. giita goovinda aur abhinaya.pi vandeishvari.. Sanskrit. 1978. S. Linguistics. -. sanskritdocuments. Language.r. 1944.. 516 pgs. Literature.. Psychology. 380 pgs.. 1906.. Linguistics. Sri Mad Ramanuja. Munichaturvijay Pandit lalchandrsrva Bhagavan Sresthitanuj... 108 pgs... 1910. 680 pgs. Language. Linguistics. K Vasudeva Sastri. Literature. Linguistics. Language. 168 pgs.. 1950. gadaadhaarii. Sritaranath. Sanskrit. Linguistics. Sanskrit.. dvijakanyaanamu vivaahakaalivimarsha. Sanskrit.. Language. gautamaprand-iita dharmasuutraand-ii. 1998.. Sanskrit. RELIGION. c. gaathaashaptashaatii.. d. Religion. 1908. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… dvadashaaran' nayachakramu. Linguistics.yam. Anantakrishna Sastri.r... 1942.. 1978. 1940. kavisaamraat'u vishvanaatha satyaanaaraayand-a. Language. Unknown. 1929.m. Literature. Sanskrit. Language. THEOLOGY.. dalal.. Linguistics.. 1875. Sanskrit. Language. 770 pgs. 120 pgs. Language. Linguistics. shriinivaasachaarya.. 1911. 149 pgs. Social Sciences. gaadaadharii. M. Sanskrit. Pandith Gopeshkumar. 1927. eitareya taamaraaparinayamu. Sanskrit. Sanskrit... gand-akaarikaa. 1915. Language. 276 pgs. chimand-aajii aapt'e. eclipse cult in veda's bible and koran. Literature.. Religion. 554 pgs. Linguistics. 0. Literature. gaadaadharii tattvachintaamand-yaa diidhityaa cha garbhitaa. 452 pgs. Sanskrit.mathuranath Shastri. Literature. 298 pgs.. Religion. Sathavahana.. 1983. 240 pgs. giita govinda rasikapriya rasamanjari.. omaprakaasha. 1902.raghuthamacharya. B. 1970. Linguistics.. Gadadhara Rajaguru. Language.. Sanskrit. Religion. 1942. Sanskrit. Linguistics. Sanskrit. eitareyaarand-yakamu. 458 pgs. 666 pgs.. Literature. Literature. 1895. jotindra mohan chatterjee. 1920. T. Sri Aurobino. 766 pgs. mitaddara. Language.. Sanskrit. ti ve shriinivaasaashaastrind-aa. Sanskrit. Language. Art. Literature. Sanskrit. Sanskrit. 1881. 190 pgs. 1950. jayadeva. shyamasastry r. Sanskrit... Sanskrit. shriigadaadharabhat't'aachaaryachakravartti. 240 pgs. Sanskrit. 262 pgs. dvatasiddaantasaaran. Literature.. Linguistics. 446 pgs.... ekaagnikaand-d'a. Sanskrit. 149 pgs..

. 1972.… 111/167 .. Sanskrit.. Sanskrit. 1947. Linguistics.. 170 pgs. 1971. LITERATURE. guurvaarthadiipikaa dvitiiya pushhpamuu. 1948. 1956. 814 pgs. gobhilagrxhyasuutran... haaralataa... Language.. 0. gopeenauth pathuk. Sanskrit. Sanskrit... pan diinaanaatha bhaargava dinesha. 1936. Literature. gobhiliiyagrxhyasuutramuu. 0. Not Available. Sanskrit. Literature. Linguistics. 1892. h Kalpmudram. Literature. Tripitakacharya Mahapandita. Bommakanti. 186 pgs. 0. gand-eshadaivagn-aani. gootaavalii sat'iik. Literature. 228 pgs.s. gruhaasutra san'graha. 62 pgs. 0. 45 pgs.. Sanskrit. Sanskrit. M. Religion. Sanskrit. 352 pgs.. Linguistics.. Linguistics. shriimadaanandatiirthabhaagavatpaadaachaarya. 1936. sanskritdocuments.. giitopadesha. Sanskrit. 1931. 0.. Aniruddha Bhatta. Theology. guptapaashupatamu amrxtasharmishht'hamu. Not available. 390 pgs. 256 pgs. Literature. Language. Sanskrit. subrahand-ya vidushha. Sanskrit. Linguistics. Language. Social Sciences.. ma daa khare.. 38 pgs. 1869. kavisamraat'a vishvanaatha satyanaaraayand-a. Srinivasacharyulu. giitaashaastraarthaviveka. Language. Language. Linguistics. Unknown. grahalaadhavan' karand-amu t'iikaa. giitaasandesha. Not available. 1936. Linguistics.. Literature. 514 pgs. 374 pgs. Literature. 34 pgs. grxhyasuutramu grxhyaparishishht'amu grxhyakaarikaashcha. LANGUAGE. Religion.. 0. gurushushruubaa san'vargavidhyopadeshashcha. 0. Language. gitagovinda mahakavyam. Literature. 57 pgs. Literature.... svaamii raamadaasajii kahaaraaja. Linguistics. LINGUISTICS. 1955. Sanskrit. Sanskrit.. Sanskrit.. Linguistics. Not available. Linguistics.. 1995. Sanskrit. 422 pgs. Sanskrit. Literature. Bhagavadgita. Literature. goopikoonmaada. 0.. han'sasan'desha.. giitaasamiqs-aa. Linguistics. Language.. Benoytosh Bhattacharyya. Language.. Sanskrit. Literature. grantharatnamaalaa. 330 pgs. Language. Language.... Linguistics. Literature. jayadeva. 182 pgs. guurvarthadiipikaa prathamaadhyaaya. 1815.. Theology.. goobhila graahya suutra. Linguistics. Linguistics. 384 pgs. shriidevaboodha. 43 pgs. Sanskrit. Linguistics. Sanskrit.. Language.. gopurasandesaa... 1986. Language... 188 pgs.org/…/SanskritIIIT. Linguistics. Sanskrit. Language. goomiliiyaguhakarmaprakaashikaa.2/14/2011 A list of scanned Sanskrit books at III… giitaagn-aana prathama adhyaaya arjuna kaa vishhaada. Sri Rama Sharmacharya. Literature. Sanskrit.. Sanskrit. 1969.. Literature. Language.. 266 pgs. shuuranaad'uu krxnjanuu pilla. Sanskrit. Language. Sri Mukunda Jha Bakshi. 1909. giitaapadmavikaasa. 1846. 0. Marunda. bhat't'akumaarilasvaami. Language. Shambhusinghji Suthaliyadheeshkruth. Literature.. 140 pgs. Sanskrit.. 288 pgs..m. Literature.. Linguistics. Literature. Language.. Sanskrit. 504 pgs.. Sanskrit. Linguistics. Language. Not available. 257 pgs. Ramamurthi.... 662 pgs. Sanskrit. Anil Varan Roy. 226 pgs. Religion. 219 pgs.. guhyasamaajatantamuu.. Linguistics. gn-aanadiipikaa mahaabhaarata bhiishhmaparva.. Language. 1952. Sanskrit. chintaamaand-i bhat't'aa. gramaand-avaatikabhaashhyamu pradhama puraand-amu. K. Art. Literature. Literature.

s. Sanskrit. Language. 0. 1954. . parushuram lakshman vaidya.. Religion. 0. Sanskrit. aachaarya pandd'ita shriishivadattamishrashaastrii. Sanskrit. R. Bhana Bhatta.. heitriiyoopanishhadi shiqs-aavalli.. Linguistics. Language. 108 pgs. Hari Narayan Apte. Theology. 476 pgs. 1791. Literature. Sanskrit. hariharaadotabhushhand-amu.. Sanskrit. Language. 1897. shrii manimshradaamodarene. K. hat'hayogapradiipikaa dhvitiyo bhaagan. 1932. 246 pgs. Literature.. 190 pgs. 1772. Linguistics. Linguistics.samba Shiva Sastri.. 218 pgs. Bhana Bhatta. 1946.. 1964.. Linguistics Literature.. Sanskrit.. Linguistics. Sanskrit. Language. Psychology. harisowbhaagyamu.. hastalikhitagranthaanukramand-ikaa. Bodhendrasarasvati. 198 pgs. Sanskrit. 1933. hanumannaat'akamuu. goodaavaramishra. khare kulotpanna harisuunu gand-esha. Sudarsana Sarma And Sahitya Siromani. Bhana Bhatta. 1938. bodhendrasarasvati. 93 pgs.. 0. 1946.... Language. Language.. hariharaadvatabhushhand-amu. harivaasamu. Sanskrit. harameikhalaa maahukaviracchitaa sat'ikaa.. 718 pgs. bodhendrasarasvati. Language. k.. hariharachaturang-gamuu. hastalikhitagrandhavivarand-apajjikaayaan. Philosophy. hashhaicharitamu. shriidevimalagand-i. hashhacharitasan'grahan.. 1850. T P Upadhyaya.. 264 pgs. 102 sanskritdocuments. hashhaicharitan' eka saan'skrutika gradhyayana. 0. 197 pgs. Literature..org/…/SanskritIIIT. Religion. Language.. 372 pgs. Sanskrit. Language.. shriikrxshhnd-adaasaa. 38 pgs. Sanskrit. Literature. hashhaicharitan. harikavi alias bhanubhatta.. Language.. Literature. harshcharitamu. gode p k. Literature. Linguistics. 97 pgs. ramaswami shastri.. Literature.. Sanskrit. Linguistics Literature. Language. 1971. Sanskrit. Religion. hindhi patra lekhan. Language. Vasudeva Agarwal... Sanskrit. 1933. 272 pgs. 336 pgs. Linguistics. 249 pgs. Linguistics. Sanskrit. Linguistics. Psychology. Language. 1900.. Sanskrit. Sanskrit. Literature. hanumanatakam. harishrchandropaakhyaanama~. Sanskrit. hariharadvaita bhusanam with karika. Sanskrit. Religion. Sanskrit. Linguistics. Theology. 1950. 1934. Sanskrit. Language.. Hari Narayana Apte. shan'karakrutayaa san'ketaakhyayaa. Theology... 1822.. Literature... Literature.. higher sanskrit grammar. Religion.. 900 pgs. Theology. 262 pgs. Literature... Literature.. 941 pgs. harivamsa.. Sanskrit.. 268 pgs. hashhachaaratasan'grahan.. Not Available.… 112/167 .. 96 pgs. Sanskrit. 0.. haridiiqs-itakrutaa brahaasuutravt'anti. Sanskrit. Linguistics Literature. haridiqs-atakrutaa buhaasutravutin.. Philosophy. Literature. 1960. Sanskrit. 1960. Subramanya Sastry. Literature. 934 pgs. Literature. Theology. 1917.. Linguistics. ramchandra kale m. Linguistics. Hathayoga.. Sanskrit. Sanskrit. shriivibhuutibhuushhand-aabhat't'aachaarya.2/14/2011 A list of scanned Sanskrit books at III… hanumada rahasyamu hindiivyaakhyaaya vibhuushhitamu hanumatpuujaapaddhati. hayata. Literature.. 112 pgs.. Linguistics. 1967. bhanabatta. Sanskrit. Linguistics. 1935. Religion.. 1954. Linguistics.. 238 pgs... 414 pgs. 336 pgs. 196 pgs..

Sanskrit. iishvaraanumaanan. iishaavaasyopanishhatuu khan'd'aartha.. yashaavanth vaasudhev paatnkar. Linguistics.. 1932. Sanskrit. Sanskrit. Sanskrit..… 113/167 . Not Available. shrii naaraayand-a pan'nd-d'it'a.. 1825.. Language. 1981. Language. Literature. shankar bhashya. shrii shang-karaachaarya.. 0. iishaadyashht'itarashtopanishhada aadyantatatachchhaantiyuj. Literature. iishvarapratipattiprakaasha qs-imadhusudanasarasvatiprand-ita. Theology. vimuktaatma. hitopadeshan. Not available.. Linguistics. shriinaaraayand-apand-ita. hitoopadeisha. Theology. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… pgs. 1935. Philosophy. 231 pgs. 1020 pgs. Sanskrit.. 1928. Not available.. Language. Literature. Sanskrit.. Theology. 0. 1921. Sanskrit. Linguistics. 0. Philosophy. Psychology.. iishaavaasyat'iikaaraghunaathariirthiiya. Literature.. Language. Language. K . Sanskrit. Literature. Linguistics. 1908. 145 pgs. hstyaayuveda book 1. Sanskrit.. 1980. 192 pgs. 306 pgs. 1915.. Linguistics. iishaadhyaashht'ottarashatopanishhada aadhyantatattachchhaantiyuja. hitopdesh. Sanskrit. Language. pand-d'ita baladeivapraasaada. Language. Sanskrit. Language.. irishadi dashopanishada. 1933. shriijaganaathapand-d'ita. Technology. ishaadidashopanishhada bhaashhya sametamu.. Hiriyanna. iishaavaasyoopanishhada. paalakaapyamuni. ht'hayoogapradiipikaa. 1931. pandit narayanan. Sanskrit. 1972. 1917. 1916. 26 pgs.. Linguistics. Sanskrit. Technology. khemaraaja shriikrxshhnd-adaasashreshht'inaa. 335 pgs. dasharatha sharma. Literature.. Sanskrit.... 42 pgs. hitopadeshan.. Sanskrit. Religion. Language.. ishht'aasiddhi savivarand-aa. Language. 445 pgs. 163 pgs.. vasudevasharamand-aa. 103 pgs. 122 pgs.. 0. Linguistics..... iishvaradarshanamu tachchaitatu. T. 413 pgs. Literature. Religion. 574 pgs. Psychology. 456 pgs. Literature.. 1959. shriimadugadgasheipaadhpaadhhyaya. Linguistics. 1894. Sanskrit. hindi zou vacabulary... Linguistics. 62 pgs. Sanskrit..org/…/SanskritIIIT. Sambasiva Sastri. Linguistics. Language. 0. Linguistics. ishht'asiddhi.. Linguistics... pandashiikaropahvavidvadddaralaqs-kand-asharma. 166 pgs. Sanskrit. Religion. Not available... Sanskrit. Language.. Literature. Language. indraprasthaprabandha. Sanskrit. indrajaalavidyaasan'graha. 55 pgs. Literature. Vishnu Sarma.. Literature. naarayanachandra jyotirbhushan bhattacharya. 266 pgs. 1975. Linguistics. Literature. Language. Linguistics.. M. Linguistics. 1933. Sanskrit.. 238 pgs. 382 pgs. 152 pgs. Language. Literature.. Linguistics. Language. shriimatparamahan'sabrahmaanan'dasvaaminaa.. hindusthaanakaa dand-d'asn'grah. Language.. i tsin'ga aura bhaarata yaatra.. Literature. Literature. 1964. Literature. 0. Linguistics.. Philosophy. sanskritdocuments. 1963.. Language. 64 pgs. Sanskrit.. Linguistics.. Literature.. 138 pgs. Psychology. Ganapathi Sastri. jayakaanta mishra. Sanskrit. 42 pgs. hrxdayaamrxtamu.. 750 pgs. hoorabijnaanrahasyam jyotishkalpabriksha. hrxdayapriya of parameshvara. Sanskrit. Sanskrit. Literature.

Sanskrit... Sanskrit. Sanskrit.. 288 pgs. Linguistics. 295 pgs. Theology. 178 pgs. be raamachanddrasharmand-aa. Raghavendra Acharya.. Sanskrit. jayapura raja vamsyavali. Venkataramaiah.. 133 pgs... Theology.2/14/2011 A list of scanned Sanskrit books at III… ishvara pratyabhijna vimarshini vyaakyaayasahitamu bhaaga 1.. Religion.. 1947. jaa ta ka t'a ka thaa padamo bhaago. 290 pgs.. 1921. -. jaataka ratnaakara.. -. jaiminiiyasuutraand-i subodhiniit'iikaasametaani prathamamadhyaayadvayan' sat'iikamagriman. Language. Literature. Sanskrit.. 428 pgs. jyotirvidaabharand-aamu sukhabodhikaa.. Language. Language. jiivavichaara prakarand-amuu. Literature.. Vacant. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Language. iya Kunadali Vigyan. Not Available. Linguistics. Linguistics. 322 pgs. 1844. pundit ramanatha anda sarma. jaagadiishiivyadhikarand-amu. sa raajavallabha sastrigala. Linguistics. Sri Kasinatha Sastri. LINGUISTICS. 428 pgs. pn' . Literature.. shriikaalidaasa.. 1937. jyotirgand-itamu. kai jyotishhaachaarya dvaarakaanaatha naaraayand-a raaje. Sanskrit. 160 pgs. Sanskrit. Literature. jaiminiiyanyaaya maalaavi. Literature. jaatakaabharan.. 1921.. Sanskrit. Vacant. Religion. Raghu Veera. Sanskrit.. 1969. 296 pgs. v. Vacant. Sanskrit. 380 pgs. aachaarya shrii pan' lashhand-alaala bhvaa. 365 pgs. Not available. ishwarapratyabhijnaa vimarshinii. jiivandharachampun. jaagadiishiisaamaanyaniruttki (manuscript). jaambavati parinayam. Sri Meethalal Himmatram Oojha. krishnadevaraaya.. 1992. Sanskrit. 0. LANGUAGE. Linguistics. Language. Literature. 0. Language. 1938. Sanskrit. Theology. 446 pgs... Language. utpaladeva.... utpaladeva... 352 pgs.. shrii shaantisuuriisvaraji. 1969. Religion. subrahmanyashastri.. 0. Sanskrit... 397 pgs. Linguistics. 0. 468 pgs. Linguistics. shriimadvachaasa. Sanskrit. R. Language. Sanskrit.org/…/SanskritIIIT.. 1973. Sanskrit. 84 pgs. 1891.. Literature. 1980. Linguistics Literature. 1957. 1966.. Language.. jaatakaabharan. Language. utpaladeva. 0. LITERATURE. Psychology. Religion.. Linguistics. Madhvacharya.. 0. Literature. Sanskrit.. Linguistics. Sanskrit. jiind-iidvarahavanapaddatin' san'praaqs-and-avidhitra. Sanskrit. Theology. 178 pgs.. Language. Linguistics. itihaasasamuchchaya. Pannalal Jain. 82 pgs. jagadaguru shriisachchidaanandasivaabhinava nusin'habhaaratiivijayakaavyamu. Sanskrit. Literature.. Sanskrit. Dr R Latcha Raman. 1904. ishvara pratyabhijna vimarshini vyaakyaayasahitamu bhaaga 2.... A Collection Of Essays On 21 Temples Located In Tamil Nadu. jaiminiiyaarshheya jaiminiiyopanishhada braahmand-e. jaiminiiyashrotasutravrutin.… 114/167 . Philosophy. Literature. Language.. Literature.. Geography. History. 1890. Literature.. 476 pgs. 242 pgs. Sanskrit. sanskritdocuments. 434 pgs. Ramakrishna Bhatt. jauminiiyanyaayamaalaa Part I. Sanskrit. 1996. Unknown... jaanakiiparind-ayanaat'akamu. jaatakapaarijaata adhyaaya 11 15... Linguistics... Sanskrit.. 357 pgs. Literature. Linguistics. 52 pgs. 298 pgs.. jiivasaj'jivijnaat'akamu. pat't'abhiraama.. 42 pgs. maharshhi shriijaiminimuni.. 1934. Biography. 1918. Religion. Philosophy. 0. janmapatra vidhaanamu sodaaharand-a tattvaprabhaa hindiivyaakhyaaya. 1873. 405 pgs.

306 pgs. Sanskrit. shriimanmahaamahopaadhyaayavidhyaanaathapanjchaananabhat't'aachaarya. Literature. 419 pgs. shriiraamaanan'dayativara... rabhaasanan'di. kaarakasan'bandhodhyota.org/…/SanskritIIIT. Sanskrit. Psychology. Sanskrit. Religion. 0.. Linguistics. 228 pgs. Literature. shriivishvanaathapanj-chaananabhat't'aachaarya. kaalidaasakaavyasaurabhamu. Sanskrit.. Sanskrit. Language. Philosophy. Language.. Language. Sanskrit. Psychology. shrii chokkanaatha makhi. Sanskrit. Not available. Philosophy. 360 pgs. Sanskrit. kaashikaa. shriivaatsyaayanamuni. Linguistics. Linguistics. Language.. 1895. Sanskrit. Not available... Sanskrit.. Linguistics. shriichannaviirakavi. Theology. Raghunatha Bhatta. 1965. 0. Linguistics. Literature. Raghunatha Bhatta. Literature. Language. Language. Social Sciences. kaamasuutramu. 108 pgs.. kaarikaavali siddhanta muktavali. 194 pgs.. Sanskrit. kaashaakrxtsna dhaatuvyaakhyaanamu naat'akat'ikaa san'skrxtaruupaantaramu. 89 pgs. Linguistics.. daralaalasharmand-a.. shriivishvanaathapanj-jaananabhat't'aachaarya. Literature. vishvanaatha panchaanana bhatta. 286 pgs. Sanskrit. 1939. Language. Linguistics. Theology. Linguistics. Language.. Language. 280 pgs. Literature. Social Sciences. kaalatattvavivechanamam' Part I. 1924...2/14/2011 A list of scanned Sanskrit books at III… 1988. 1803. kaarikaavali siddhaantamukttaavali t'ippand-ii. kaadambarisaaraa.. 1951. Linguistics. kaalaamrxtei savyaakhyaanei. Linguistics... 0. shah. 0. Vishwanatha Panchanan Bhattacharya. Sanskrit. Not available. kaadambarii kalikaataaraajadhaanyaan. vidvaanu khan'd'avilli suuryanaaraayand-ashaastrii. Sanskrit. Linguistics.. 0. 0.. Literature. Literature. 1933.. Peterson. 516 pgs. Linguistics. Language. Literature. Sanskrit.. Sanskrit. 338 pgs. 0. kaan'timati parind-ayamu.… 115/167 . 596 pgs. sanskritdocuments. kaarikaavali nyaayasiddhaantamuttkaavalii. 1973. Literature. 1848... Linguistics.. 98 pgs.. 64 pgs.. vishvanaathapachaana. 392 pgs.. 1984. 1932. Linguistics.. Sanskrit.. kaadambarii. Literature... 1956. durgaaprasaada. 534 pgs. Sanskrit. kaamandakiiyaniitisaara bhaashhaat'iikaasahita. Language. Sanskrit. Sanskrit.. kaarikaavali nyaayasiddhaantamuttkaavalii cha chitravali. kaashiikhan'd'an' t'iikaa. kaarikaavalii muktaavalii.. Sanskrit... Literature. Language. 422 pgs. kaarikaavalii. Language. Literature. Literature. Natural Sciences. Mahadev Shivaram Apte.. Sanskrit. 90 pgs. Literature. 0. 1900.. LINGUISTICS. 344 pgs. kaalagn-aanamu bhaashhaat'iikaasametamu. Linguistics. Not available. jyotishhatattvasudhaarnd-ava bhaashhaat'ikayaa. 854 pgs.. LANGUAGE.. Not available. jyotishha shiromand-i bhaaga duusaraa drxshht'aan'ta vibhaaga 4625 janmakun'd'alike shaata nirayana chitraan'sha. Literature.. 350 pgs. 675 pgs.. 218 pgs. Linguistics.. Sanskrit. 1889. Religion. LITERATURE. Sanskrit.. manubhai s. Language.. Language. Language. 1915. Vishwanatha Panchanan Bhattacharya. 0.. kaalatattvavivechanamam' Part Ii. 374 pgs.. Literature. 556 pgs.. Sanskrit.. 560 pgs. kaarikaavalii nyaayasiddhaantamuktaavali. kaamasuutramu t'ikayaa sametamu. 1903.

si. Sanskrit. Linguistics.. 712 pgs. 1953.org/…/SanskritIIIT. Sanskrit.. 1936. Sanskrit.. kaashyapa san'hitaa.. Language. pand-d'itavaravaamana. Linguistics.. Literature. Sanskrit. 1925. Literature.. 400 pgs. Temples. Sanskrit. Not available. kaashyapasan'hitaa. gulaabaraaya... Linguistics.. Ranga Swamy. Sanskrit.. Language. Sanskrit. -. Psychology. kaashmiiragranthaavalii prathamakhand-d'amu.. 32 pgs. Literature. Not available. 1915.. Sanskrit. Sanskrit. Sanskrit.. Literature. Sanskrit. shivad'at't'a. 0... Sanskrit. Linguistics. 1958. kaavyaanushaasanamuu. 1941. durgaiprasaadena. Language. Language.. LINGUISTICS. pand-d'itavaravaamana. 220 pgs. 122 pgs. Sanskrit. kaavyaalan'kaarasuutrand-i svavrxttisamalan'krxtaani.... Not available. Sanskrit. 1908.. Linguistics. 1924.singaraiyengar. Ranga Swamy. 238 pgs.. chat'arjii. Literature. Philosophy. Linguistics. 1938. kaavyaalan'kaarasuutrand-i svavrxttisamalan'krxtaani. 1970. kaavyadarshanamulyam.. kaavyamaalaa Part X. 70 pgs. Language. shriijagadiishachandra chat't'opaadhyaaya. Linguistics.... Religion. 216 pgs. Language. LANGUAGE.. Singabhupala.2/14/2011 A list of scanned Sanskrit books at III… kaashikaa. kaashikaand-d'a grantha. kaasmiiragranthaavali Vol. vaagbhat't'aa. sanskritdocuments... Sanskrit. Language. LINGUISTICS. Sanskrit. Sanskrit. 69 pgs.. Sanskrit.. 114 pgs. durgaiprasaadena.. Sanskrit. shriiratnaakara. aachaaryadand-d'i. 1933. kaashmiirasandhaanasamudyama. Language. Sanskrit. Sanskrit.. 1911. . Linguistics.. Language... kaavyaavali ke ratnaapaanchaalikaa. 246 pgs.. Sanskrit. Literature. kaavyamaalaa haravijayamu. Language. 174 pgs. 1903. Literature.. kaavyamaalaa dashamoguchchhakan. Literature. 102 pgs. 1952. LITERATURE. S. kaashyapajnaanakaand-d'an. 1933. Linguistics. Linguistics. 0. 540 pgs. 1292 pgs. Linguistics. kaavya ke ruupa. Not Available. kaavyadapaind-an. Sanskrit. maithilashriigang-gaanandakavindra. aaryeindhra sharma. Linguistics. kaavyad'aakinii. 82 pgs.. Literature. kaavyadiipikaa. Linguistics..iii. 0. Sanskrit.. Sanskrit. 0.. Language. Theology. 0. 176 pgs. 905 pgs.. Sri Yathiraja Sampathkumaramuni. Language. Linguistics. 1911. Narayana Iyyar. Sanskrit. S. Narayana Daso Banhatti. Temples. 624 pgs... Linguistics. Linguistics.. Literature. Language. 235 pgs. Sanskrit. 1968.. Linguistics. Language. 1948.. Literature. 270 pgs.. J. 160 pgs. 1894. 1948. Linguistics.... kaashikaa dvitiiya bhaaga. Linguistics. kaasyapasan'hitaa. Econo Politics. Literature. 327 pgs. LANGUAGE. 484 pgs. je. kaavyaalan'kaarasaarasan'grahan. kaatyaayanashrautasuutramu bhaashhyasahitamu. Literature. mahaamahopaadhyaaya shriikarkaachaarya. Literature.… 116/167 . Linguistics Literature.. parameshvaraananda. 1891. 1941.. kaavyamaalaa ashht'amoguchchhakan. Language. Language. kaavyakalaapan. Banhatti N d. Sanskrit. 312 pgs. Literature. 100 pgs. Literature.. kaavyaadarsha. 214 pgs. Literature. kaavyaalaa chatudaishoo gun'chchhakan.. 1953. Language.. LITERATURE. 359 pgs. Language. Literature.

244 pgs. Not Available. Language. Literature. . Linguistics. Sanskrit. 329 pgs. Literature. Sanskrit. Language. Poems. Literature. kaavyapradiipa.. 0. kaavyaprakaashakhand-d'ana. Not available. 770 pgs. 166 pgs. Sanskrit. Literature. Sanskrit. Language.. Language.. Linguistics. Sanskrit. Sanskrit. Linguistics. 311 pgs. banabhatta. kadambari kalyanam. vinnakoot'a maadhava raavu. Language. Sanskrit. 0. 524 pgs. Language. sanskritdocuments.. 1893. kalapurnodaya... kaing-karyaratnaavali. 329 pgs. Literature. 224 pgs.. kadaliimanj-junaathamaahaatmyamuu. Linguistics. Literature. Sanskrit. Sanskrit.. kaavyashilpamu. Language. mammat'a... 2002. Literature. Language.. kalyaand-avaartikamuusiddhaantaniddddaana. Sanskrit. kanakaavalii. kaavyaprakaasha naageshvarii t'iikayaa samalang-krxta.. 1932.. Language. 616 pgs. 0. Sanskrit. Sanskrit. Not available... Language. shriibihand-a. 1968.. Natural Sciences. LINGUISTICS.org/…/SanskritIIIT. Not Available. Theology. Linguistics. . Language. Sanskrit.. 1963.. shriimammat'aachaarya. 372 pgs.. Technology.. Harishchandra Renupurakar. punyananda. durgaiprasaadena. 207 pgs. 1939. -. 1993. 1967. 608 pgs. shriimammat'aachaarya... LANGUAGE. 477 pgs. Literature. Sanskrit.. 1932.. Sanskrit. Sanskrit. Religion.. LITERATURE. kadhambari. Linguistics.. Linguistics. Sri Krupa Chanda. 68 pgs. 502 pgs. 1947.. narasimhakavi. 1838. Language. Linguistics... paravastukrxshhnd-amaachaarya. Linguistics.. . kaavyasaarasan'graha. Linguistics... Language. kamakalavilas. Sanskrit. naaraayand-aacharya. 631 pgs. 280 pgs. 165 pgs. Sanskrit. Literature. Sanskrit. Sanskrit. kar^mapradiipa. Literature.. Linguistics. 1918.. topalli ven'kat'araamadaivagn-ena. 60 pgs.. Linguistics. Language. 178 pgs. Chandrakanth. keshava. 39 pgs. LANGUAGE. kalpadrukosha Vol II. Sanskrit. suryanarayana sastri.… 117/167 .. kadambari... 1986. kaavyaprakaasha kaavyaprakaashavistaarakaaravyayaa vyaakhyaaya vibhuushhita. Sanskrit.. kaavyaprakaasha krxtayaa vivrxtti.. kaavyonmoshhan. 1980. Literature. Linguistics. 0.. Linguistics. Sanskrit.. bhaaradvaja.. 184 pgs. 1913. Sanskrit. kaavyaprakaasha. 1918. Linguistics. Literature..2/14/2011 A list of scanned Sanskrit books at III… kaavyamaalaa navamoguchchhakan.. 1895. 280 pgs. kanadasiddaantachandrika. Social Sciences. Natosa sastri. Sanskrit. Literature. 1932. Language. Literature. Language. 0. Language. 143 pgs. Sanskrit. kalyaand-apiiyuushhavyaakhyaasametaa pan'chadashii tattvavivekaprakarand-amu. Literature. Linguistics. 80 pgs.. Literature. 1812. kaavyaprakaasha naageshvarii t'iikayaa samalang-krxta.. 584 pgs. mammat'aachaarya. Literature. 268 pgs. 299 pgs. K. mahaamahopaadhyaayashriigovinda. Language. Language. LINGUISTICS.. t'i gand-apati saastri. Linguistics. Sanskrit. Sanskrit..g. kamaikaarad'akramaavalii. Linguistics.. kand-aisundarii. kalapasuutramu. Sanskrit.. LITERATURE...... Literature. 1936. Rasikalal Chotalal Parikh. Somashambhu. 1967. kalaamaadhavaa. Linguistics. karand-aratnamu subodhinii samaakhyavyaakhyaaya. 0. 1976... 0. Literature. 296 pgs.

. kavimanoranjakachampu. kathaka upanishad. Literature. Language. khaadiragrxhyasuutramu vyaakhyaayasahitamu.. 1925. Sanskrit. Sanskrit. Language. 512 pgs. 1978. acharya hemachandra. Language. pandit durgaprasada ed. Sanskrit. Literature. raamasharand-ashaastrii. Linguistics. Pt. Language. karnd-akutuhala.. Language. Linguistics. Literature. 0.. Sanskrit. Linguistics. Sanskrit.seetharam Jayramjoshi. Language. 1895. kaushhiitaki braahmand-opanishhatu diipikaa.org/…/SanskritIIIT.. sanskritdocuments.. Language.. Literature.. Theology.. d'aa en gn-aanappa naayud'u. 204 pgs. Language. Literature. sankara rama sastry c.. Sanskrit. 133 pgs. Dr. Linguistics.. kaumarabhrityam with navya balaroga.. Sanskrit. Theology. Literature.. Literature. 194 pgs. 1885.. Sanskrit. 0. 152 pgs. Linguistics.. 368 pgs. 1968.. Literature. Not available. swami satchidanandendra saraswathi. Language... kavayadarsha.. Linguistics. kenoo upanishad.. Sanskrit. Linguistics. Literature. bhat't'a someshvara. 98 pgs... 480 pgs. ubhata. Literature. 1955. 1881.. Sanskrit. Sanskrit. kavyanusasana. kavalamkara sara samgraha. kavyaprakash Rahasyam.. shang-karaananda. 57 pgs. Sanskrit. Literature. 106 pgs. Sanskrit. 78 pgs.. 1961. 1966. Language. 1913. kenopanishad bhashya.. 1925. Literature. Sanskrit. mahaakavi shriideveshvara.. khaadiragrxhyasuutramu vyaakhyaayasahitamu. 1932. khaadiragrxhyasutrama~. 1942. Sanskrit. kaumudiisharadaagamamu dvitiiya bhaagamu. 1944. Language. Linguistics. 190 pgs... 104 pgs. Linguistics. vikrama deiva varma. rudraskanda. 1911. kelikutuuhale prathamastarang-ga. Literature. Religion. keshava saahitya mein' samaaja san'skrxti evn' darshan. 140 pgs.. Literature.. Philosophy. 61 pgs. kat'hakagrxhyasuutran' bhaashhyatrayasaarayutan.k ramachandra aiyar. aar.. kathaakallolini paand-iniiyalaukikavyaakarand-asamaapaniiyaa. Linguistics.. Shriipat't'abhiramachara~ya.. 174 pgs. swami satchidanandendra saraswathi. 0. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… karnasundari. Literature. 1942. 1956. 344 pgs. 402 pgs. 1913.. Sanskrit.. Literature.. Linguistics. Language.… 118/167 . 1963. 1913.. Linguistics. 158 pgs.. kavyamala. Language. Psychology.. raghuveera prasad trivedi. rangaraamanuja. Language. Literature.anann'ta krishhana saastri. Sanskrit. 54 pgs. Religion.. Sanskrit.. 730 pgs. siitaaraaamasuuri. Literature. Sanskrit. Linguistics. t'i ara chintaamani. Sanskrit. Unknown.. Theology. bilhana. Linguistics. Language. Language. Literature. Language. 1987... Sarat Chandra Sastry. Sanskrit. Vasudeva Jnana Muni. Language.. Literature. puraatattvaachaarya jinavijaya muni. 230 pgs. Linguistics. kaun'shhiitakagrxhya suutraand-i. kavikalpalataa. Sanskrit. 1964. 185 pgs. Language. Sanskrit. Linguistics. Sanskrit.. 1950. Religion. Technology. kavalayananda.. Sanskrit. 322 pgs. kaviindraacharyasuchi patramu. kavikalpalataa. 184 pgs. Linguistics. 396 pgs... Linguistics.. karnd-aamrxta prapaa.. rudraskanda. 2000.. Linguistics.. keivalyaratnamuu. 62 pgs. Sanskrit. Linguistics. Linguistics.. 1921.. Language. T. Language. Willem Caland. Sanskrit. 217 pgs. Literature. Literature.

Sanskrit.v. Mahadeva Sastri. Literature. 1913. 584 pgs. Sanskrit.. Literature. Language.. Linguistics. Literature.2/14/2011 . Sanskrit. kriyaasaara upadeshachatushht'ayaatmaka prathamo bhaaga. A. Economics. Linguistics. Samhita. 442 pgs. kriyatmaka ausadahiparichaya vijnan.. krxshhnd-a bhakti saahitya vastu srota aura san'rachana. Sanskrit. Linguistics. kokasandesa. Linguistics.. kruushhnd-ayajuvaidiiyataittiriiyasan'hitaa_bhaaga_7. Literature. 1924. Language. 1936. Bhrga Samhita.. RELIGION. 586 pgs. 1934.. Bhrugu Maharshi. d'an' chandrabhaana raavata. Literature. rudraskanda. Literature.. khand-d'anakhand-d'akhaadya Part 1. Sanskrit. Ganapati Sastri. 204 pgs. krishhnd-a yajurveidiya taitiriiya san'hita.. Mahalinga Sastry. Sanskrit. Sanskrit.. Theology. 428 pgs.. Language.. 0. kinkind-ii maalaa. kanhaiyaalaala krxshhnd-adaasa. Language. Language. shriiniilakand-t'hashivaachaarya. Jha.. 1966. Sanskrit. Technology. kaashinaatha saastri. Linguistics.. Philosophy... Sanskrit.. Literature. hari naaraayand-a aapat'e. sri vishvanath divedi. 100 pgs. Linguistics.. hari naaraayand-a aapat'e. Psychology. THEOLOGY. kruushhnd-ayajuvaidiyataittiriiyasan'hitaa bhaaga 8. G. 0. 868 pgs. 1913. 584 pgs. Sanskrit. 1954. Linguistics. Sanskrit.org/…/SanskritIIIT. 1905. 438 pgs. 125 pgs. Literature. Linguistics.. 1964. Language. Sanskrit. khand-d'anakhand-d'akhaadhyamu. Sanskrit. Language.. krxshhnd-aayajuvediiyataittiriiyasan'hitaa Kanda Ii Part Iv.. Linguistics. 1901. Sanskrit. 542 pgs. 1954. Linguistics. kaasmiirika keishava bhat't'a.. kishhkin'dhaa kaand-d'amuu. Sanskrit. kriyaasaara upadeshachatushht'ayaatmaka prathamobhaaga. shriiniilakand-t'hashivaachaarya. Sanskrit. 434 pgs. RELIGION. khilaadhikaaran' bugusan'hitaa.. Language. Literature.. krama diipika.. kaashinaatha saastri... valmiki. Language.. 315 pgs.. 0. 1904.. 1953. chan'd'iiprasaada sukla. Sanskrit.... 1965. Sanskrit. Language. 1905. Literature.… 119/167 . 318 pgs. 580 pgs. krishhnd-a yajurveidiya taitiriiya san'hita... Religion.. THEOLOGY. 1940. kiraataarjuniyamu. Language. 1997. Religion. pg A list of scanned Sanskrit books at III… khaadiragrxhyasuutramu vyaakhyaayasahitamu. Sanskrit. Language. Religion. bhaaravi. Linguistics. kowt'iliiyan' arthaishaastramu. Literature. Literature. Sanskrit. Literature. kriyaasaara panj-chamaadichaturdashopadeshaanta dvitiiyobhaaga. 502 pgs. kiraataarjunaayamu. 522 pgs. bhaaravi.. 88 pgs. Literature. 1917. khaadiragrxhyasuutrn' rudraskandavyaakhyaasahitan. Kasinatha Sastri Agase. Sanskrit. Language.p.. 1957. Linguistics. Theology... Language. visnutrata. kriyaasaara upadeshachatushht'ayaatmaka prathamo bhaaga.. Literature. 1937... 180 pgs. Sanskrit.. 248 pgs.. khand-anakhand-akhaadhamu. sanskritdocuments... Linguistics.t. Sanskrit. 586 pgs. Linguistics.. 294 pgs.. shriiniilakand-t'hashivaachaarya. Linguistics.. 1917. kriyaadhikaaran' bugusan'hitaa.. 642 pgs. Ramanuja Swamy. 1905. Sanskrit. Language. 588 pgs. Theology.y.. shriishriiharshha. shriiniilakand-t'hashivaachaarya. 128 pgs. Sanskrit.. 217 pgs. Literature. 1954. Sanskrit. kiskindhakanda.

Language. kutuuhalavrxtti. 659 pgs.. 1922. Philosophy. 1901. Sanskrit. Sanskrit... 297 pgs.. Literature.. 1941. 566 pgs... Bhatta Lakshmidhara. Sri Kasinath Sastri.. shrii vaasudeivadiiqs-ita. Sanskrit. Language. dinnaaga.... 358 pgs.. Linguistics. Sanskrit. varadaraaja..... Bhatta Lakshmidhara.... 1961. Literature. krxyajuraveda. Language. Sri Kasinath Sastri. 0. krxtyakalpataru raajadhar^makaand-d'an' Vol 11.. Pandit Laxman Sastri Dravid. Sanskrit. krxshhnd-ayajuvaidiiya taittiriiyasan'hitaa trxtiiyo bhaaga. 390 pgs. krxtyasaagara.. Sanskrit.. bhat't'a lakshmidhara. Linguistics. 402 pgs. 0. 1943. kutuuhala vrxtti. Literature. Literature.. 1956.. kusumaanj-ajalibodhanii. Psychology. kun'damaala. 422 pgs.. 354 pgs. Literature. 1962. Religion.. Literature. 1932. 178 pgs. Sanskrit. Social Sciences. Language. Social Sciences. shriimatsaayandaachaarya. Language. Sanskrit. 176 pgs.. Sanskrit. Social Sciences. A listpg of scanned Sanskrit books at III… krxshhnd-aayajuvediiyataittiriiyasan'hitaa Part Ii. Literature. Sanskrit. Linguistics.. Literature.. Theology. krishna kumar davan.. kundmala. Sanskrit. Kasinatha Sastri Agase. 1944. Sanskrit. krxtyakalpataru daanakaand-d'an' Vol 5. Linguistics. 406 pgs. shri paa raa subrahmand-yashaastriind-aa. 268 pgs. Linguistics. 1961. Sanskrit. 1937. 58 pgs. Linguistics. 1912. Religion.. ayendra sharma gen ed. kushhnd-agiiti. Sri Kasinath Sastri.. Sri Varadaraja Mishra. krxtyakalpataru niyatakaalakaand-d'an' Vol 3. 1900. krxshhnd-ayajuravediiyaa kapishht'ala kat'ha san'hitaa.. 276 pgs. 340 pgs. Linguistics.. Language.. kumarasambhava.2/14/2011 g . 1977. Linguistics. 580 pgs. 1960. Sanskrit. Sanskrit. Literature. 1901. Linguistics. Bhatta Lakshmidhara. Sanskrit. 308 pgs. 1950.. krxshhnd-ayajura~vediiyataittiriyasan'hitaa Shhashht'ho Bhaagah.org/…/SanskritIIIT.. 478 pgs. bhakta Darshan. Theology. Language. shriiratnapaand-i. Linguistics. 0. Sanskrit. 1922. Linguistics. Linguistics. 300 pgs. 468 pgs... Linguistics. Sanskrit. krxshhnd-ollaasa champuukaavyaprakaand-d'amu. Language. 32 pgs. Sanskrit. Literature. krxshhnd-ayajuvaidiiya taittiriiyasan'hitaa ddhitiiyo bhaaga. Sanskrit. ksemendra. 1950. Literature. Linguistics. Linguistics. krxtyakalpataru shraddhakaand-d'an' Vol 4.. kumaarasambhavan' mahaakaavyamu pun'savaniivyaakhyaaya sanaathiikrxtamu. 1951. Sanskrit. kalidasa. Not Available. Language. Language. 646 pgs. mahaakavishriikaalidaasa. 1901.. Religion. kusumaanj-jali shriimadudayanaachaar^yavitachita. Language. Sanskrit. Social Sciences. Literature. Sanskrit. Language. 1908. krxtyakalpataru grahasthakan'd'aa vol 2.. Theology. kusumaanj-jalibodhani. Sanskrit. Psychology. 646 pgs... Language. Literature.. 486 pgs. Language. 1948. Theology. Language. sanskritdocuments. Linguistics.. Bhatta Lakshmidhara. Literature. Literature. Sanskrit. Philosophy.. soomanaatha. Raghu Vira. Literature. Religion... 1901. krxshhnd-ayajuvaidiiya taittiriiyasan'hitaa prathamo bhaaga. 646 pgs. 420 pgs. Literature. krxshhnd-ayajurvediiyataittiriiyasan'hitaa bhaashhyasametaa etatpustakamu.… 120/167 .. Linguistics.. 545 pgs. Language.. Sanskrit.. ksemendralahukavya sangrha. Sanskrit. Shriimatsaayand-aachaara~yaa.. ksemendra. Language.

2/14/2011

A list of scanned Sanskrit books at III…

kutuuhalavrxtti... bhakta Darshan, Language. Linguistics. Literature. Sanskrit, 1960. 526 pgs. kutuuhalavrxttisaarasam'graha... Not Available, Philosophy. Psychology. Sanskrit, 0. 368 pgs. kuvalayaananda chanddraalokasahita alang-kaarachandrikaavyaakhyaaya cha vibhuushhita... budhavarashriimadappayyadiiqs-ita, Language. Linguistics. Literature. Sanskrit, 1833. 282 pgs. kuvalayaanandachandrikaachakairan'alad'akaaratatvaj'ja... Venkatachari, Art. Sanskrit, 1943. 319 pgs. kuvalayaanandakaarikaa alan'kaaradiipikaavyaakhyaayaa san'valitaa trxtiiyaavrxtti... shriiyutaashaadharabhat't'a, Language. Linguistics. Literature. Sanskrit, 1927. 114 pgs. kyo uttaraadhai... Madavacharya Sastri, Religion. Sanskrit, 1982. 693 pgs. laayanashrautasuutramu vrxtti... naaraayand-a, Language. Linguistics. Literature. Sanskrit, 1917. 471 pgs. laghu upanishad... narayana swamy aiyar k tr, Religion. Theology. Sanskrit, 1967. 302 pgs. laghukaumudii... varadaraaja, Language. Linguistics. Literature. Sanskrit, 0. 415 pgs. laghukomudii... 0000, Linguistics Literature. Sanskrit, 0. 147 pgs. laghumaanasamuu... Gangadhar Bapurao Kale, Philosophy. Psychology. Sanskrit, 1944. 40 pgs. laghupaaniiyamu... Rajaraja Varma, Sanskrit Grammer. Sanskrit, 1911. 228 pgs. laghupaaraasharii bhaashhya... diivaana raamachandar kapuura, Religion. Theology. Sanskrit, 0. 396 pgs. laghusabendusekjara... nagojibhatta, Language. Linguistics. Literature. Sanskrit, 1927. 846 pgs. laghushabdedndushekhara vyaakarand-avibhaage saptadasan'pushhpamu napadaantasuutraanto bhaaga... mahaamahopaadhyaayashriinaageshabhat't'a, Language. Linguistics. Literature. Sanskrit, 0. 264 pgs. laghushabdendukalaa... pand-d'ita shrii shobhaakaanta jhaa, Religion. Theology. Sanskrit, 1970. 144 pgs. laghushabdendusekhara... khuhiijhaa, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1938. 264 pgs. laghushabdondushokhanamulapuvedhve... , . Sanskrit, 0. 163 pgs. laghushabdondushokhanamulapuvedhve dvitiyo bhaagaha... , . Sanskrit, 0. 163 pgs. laghusiddaantakomudii... Kaushika Venkatanarasimhachari, Linguistics Literature. Sanskrit, 1937. 186 pgs. laghusiddanta kaumudi... varda raja, Language. Linguistics. Literature. Sanskrit, 1948. 180 pgs. laghusiddhaantakaumudii anuvrxttyaadisuuchakena t'ippand-ena pratyaahaara varnd-avyavahaaragnaapaka koshht'akau... shriivaradaraajapand-d'ita, Language. Linguistics. Literature. Sanskrit, 1894. 176 pgs. laghusiddhaantakaumudii san'skrxta hindiit'iikaa... shriivaradaraajaachaarya, Language. Linguistics. Literature. Sanskrit, 1970. 382 pgs. laghusiddhaantakaumuditattvaprakaasha sottaraa prashnaavali 20 varshhaand-aan' prashnapatrasahita... pand-d'itashriiraamagovindashukla, Language. Linguistics. Literature. Sanskrit, 1974. 248 pgs. laghustuti... t'i gand-apati saastri, Language. Linguistics. Literature. Sanskrit, 1917. 63 pgs. lalitamaadhavan' naat'akamu t'ikayaa... shriiruupagoosvaamiprabhupaada, Language. Linguistics. Literature. Sanskrit, 1969. 310 pgs. lalleishvariivaakyaani... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 36 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

laqs-and-aavimashe... V. Subrahmanya Sastri, Philosophy. Psychology. Sanskrit, 0. 32 pgs.

121/167

2/14/2011 A Sastri, list of scanned Sanskrit books at III… laqs and aavimashe... V. Subrahmanya Philosophy. Psychology. Sanskrit, 0. 32 pgs.

laqs-miisahasramu... Not available, Religion. Theology. Sanskrit, 0. 813 pgs. laqs-miitantramu... vi. krishhnd-amaachaarya, Language. Linguistics. Literature. Sanskrit, 1959. 389 pgs. laqs-miitantramuu volume 87... pan'dita vi krxshhnd-amaachaarya, Language. Linguistics. Literature. Sanskrit, 1959. 391 pgs. lat'akamelakamu... shriishadgadhara, Language. Linguistics. Literature. Sanskrit, 1900. 36 pgs. laugaaqs-i grxhya suutraand-i bhaashhyopetaani dvitiiyobhaaga uttaraarthamu... devapaala, Language. Linguistics. Literature. Sanskrit, 1937. 460 pgs. laugaaqs-i grxhya suutraand-i devapaalakrxtabhaashhyopetaani Vol 2... Madhusudan Kaul Shastri, Language. Linguistics. Literature. Sanskrit, 1934. 448 pgs. laukikanyaayaanj-jali dvitiiyobhaaga... colonel g a jacob, Language. Linguistics. Literature. Sanskrit, 1925. 94 pgs. laukikanyaayaanj-jali trxtiiyobhaaga... colonel g a jacob, Language. Linguistics. Literature. Sanskrit, 1911. 158 pgs. lectures on patanjali s mahabhasya vol I... subrmanya sastry p s, Language. Linguistics. Literature. Sanskrit, 1944. 384 pgs. life divine... aurobindo, Language. Linguistics. Literature. Sanskrit, 1942. 160 pgs. liilaavatii uttaraardharuupo dvitiiyobhaaga... shriimadbhaaskaraachaarya, Language. Linguistics. Literature. Sanskrit, 1937. 180 pgs. ling-ganushaasanamam... Panini, Philosophy. Psychology. Sanskrit, 1885. 192 pgs. ling-kapuraand-amuu... mahaarshhi vedavyaasa, Religion. Theology. Sanskrit, 1885. 848 pgs. list'as aaph manuscript's... Not Available, General. Sanskrit, 1925. 106 pgs. lokaparalokakaasudhaara bhaaga 2... hanumaana prasaada, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 0. 244 pgs. lokaparalokakaasudhaara bhaaga 4... hanumaana prasaada, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 0. 288 pgs. lokikanyaayaatralin' tutiyo bhaagan... jaakobha, Language. Linguistics. Literature. Sanskrit, 1904. 169 pgs. maadava vijaya... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 457 pgs. maadhamaahaatmaya... , Religion. Theology. Sanskrit, 0. 134 pgs. maadhavanala kaamakn'dalaa... shriikrxshhnd-adaasaatmaja, Language. Linguistics. Literature. Sanskrit, 1889. 214 pgs. maadhaviiyaa dhaatuvrxtti paand-iniiyadhaatupaat'havyaakhyaanaatmikaa... shriisaayand-aachaarya, Language. Linguistics. Literature. Sanskrit, 1964. 720 pgs. maadhurii darshanamu... raayaproolu subbaaraavu, Language. Linguistics. Literature. Sanskrit, 0. 69 pgs. maadhvamukhabhad'ga... Sri Surya Narayana Shyam Sukhla, Philosophy. Psychology. Sanskrit, 0. 48 pgs. maal'avikaan'gnimitramu naamanaat'akamu... shriimatkavikulashiromand-inaa shriikaal'idaasamahaakavi, Language. Linguistics. Literature. Sanskrit, 1892. 282 pgs. maalatiimaadhavan' prakarand-amu vyaakhyaaya... mahaakavishriibhavabhuuti, Language. Linguistics. Literature. Sanskrit, 1864. 500 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 122/167

2/14/2011

A list of scanned Sanskrit books at III…

maalatiimaadhavan' prakarand-amu vyaakhyaaya... mahaakavishriibhavabhuuti, Language. Linguistics. Literature. Sanskrit, 1864. 310 pgs. maanameyarahasyalokavaatvikamu... Srinivasa Charya. L, Sanskit Sastras. Sanskrit, 1925. 672 pgs. maanameyoodaya... t'i. ganapati saastri, Language. Linguistics. Literature. Sanskrit, 1912. 133 pgs. maanasaprachaarikaa... Not available, Language. Linguistics. Literature. Sanskrit, 1885. 156 pgs. maanava dharma saara... Not Available, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1943. 285 pgs. maand-d'uukyaadhupanishhatrayii... pn'. raamadevaachaaye, RELIGION. THEOLOGY. Sanskrit, 0. 474 pgs. maatukaabhedatantramu... Pandit Amareswar Thakur, Lord Hanuman. Sanskrit, 1933. 153 pgs. maayaavaadakhan'd'anamu... Srimadananda Theertha, Art. Sanskrit, 1875. 165 pgs. madanapaamnidhant... krishna das, Technology. Sanskrit, 1954. 192 pgs. madanapaamnidhant... krishna das, Technology. Sanskrit, 1954. 328 pgs. maddhvamukhaalankaara... Vanamali Misra, Philosophy. Psychology. Sanskrit, 1936. 148 pgs. madhthasida ntakaumudii... prabhaakara, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1939. 693 pgs. madhuraan'jali... G.ramacharya, Literature. Sanskrit, 1996. 346 pgs. madhusuudanasarasvati kruti advatasiddhi... Sri Harihara Sastri, Philosophy. Psychology. Sanskrit, 1893. 344 pgs. madhuvidhyaa shriivishvakarmapaaramyaparend-a sauparnd-ena vyaakhyaanena samaalin'gitaa... durishet'i ven'kat'araamaachaarya, Language. Linguistics. Literature. Sanskrit, 0. 70 pgs. madhvanidanmu... shrii sudarshan sharma, Technology. Sanskrit, 0. 530 pgs. madhvasiddaan'tasaarasan'grahada vishhanurxmand-ii... Not available, Language. Linguistics. Literature. Sanskrit, 0. 253 pgs. madhvatantramukhamadarnamu... shriimadappayadiiqs-ita, Language. Linguistics. Literature. Sanskrit, 1940. 156 pgs. madhyakaaliina san'skrxta naat'aka... raamjii upaadhyaaya, Language. Linguistics. Literature. Sanskrit, 1974. 516 pgs. madhyamavyayoga... bhasa, Language. Linguistics. Literature. Sanskrit, 1948. 56 pgs. madhyasiddhaantakaumudii... shriimadvaradaraaja, Religion. Theology. Sanskrit, 1906. 312 pgs. madyakalin sanskrit natak... ramji upadya, Language. Linguistics. Literature. Sanskrit, 0. 522 pgs. mahaaban'dho... Sripati Sharada Misra, Literature. Sanskrit, 2001. 493 pgs. mahaabhaarata aranyakaparvam bhaaga 4... vishnu s sukthankar, Language. Linguistics. Literature. Sanskrit, 1942. 610 pgs. mahaabhaarata sabhaaparvamu gn-aanadiipikaa... shriidevabodha, Religion. Theology. Sanskrit, 1949. 55 pgs. mahaabhaarata san'skrxta muula hindii anuvaada... Not available, Religion. Theology. Sanskrit, 0. 1282 pgs. mahaabhaaratama~ shaantipar^vand-i Part I... P. P. Subramanya Sastri, Language. Linguistics. Literature. Sanskrit, 1935. 690 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

h

bh

hh

k

j hik

d

bh

d d' l

t

t'h

d'hii

i

i

d

123/167

1971. Language. maitraayand-iiyamaanavagrxhyasuutarman.. Sanskrit.. Language. Sanskrit. 48 pgs. Language. Religion. mahaabhaashhyat'iikaa chaturthaanhikaparyantaa bhaaga 1. bhat't'avaadiindra. mahaakavibhaasa eka adhyayana. 1970. mantramahaidadhigrandhahaa. 1971. 795 pgs. mand-d'ala braahmand-opanishhatuu. Linguistics. Sanskrit. 1968. shrii vii svaaminaathana. Linguistics. 0. 202 pgs. mantroddhaarakosha saubhaagya tantrashcha. goopiinaatha.… i t N t il bl L Li i ti Lit t S k it 0 350 124/167 . manu smruti. Linguistics. Literature. mantraratna manjushhaa. sheishhasharma. Literature. Linguistics... Linguistics.. Language. Sanskrit. Language.... Linguistics. king someswara. 0. raaghavan.. 112 pgs. Sanskrit. Spiritual Experience And Mysticism. Language. 163 pgs. 0.. Sanskrit. Literature. General. Literature. Sanskrit. Somraj Krishna Das. 151 pgs.. Theology. maharastriya gyan kosh sharir khand. Literature. mahaavidhyaavid'ambanamu t'ikaabhyaan' dashashlokii vivarand-a t'ippand-i. Linguistics.... Sanskrit. 110 pgs. 1964. Sanskrit. Linguistics. Linguistics. Sanskrit. Linguistics. manmahaabhaaratamu bhiishhmaparva 6. 1928. 1066 pgs. 1979. Linguistics. Literature. manoramaashabdaratna praqs-aittaraava liipradhamakhand-d'an. Language. 1982. Sanskrit. Language. Sanskrit. trivikramabhat't'aaraka. Language. 330 pgs. Sanskrit. Linguistics.. Linguistics.. shrimadhusuudanasarasvatii. mal'aya maaruta part Ii. Sanskrit. Religion. 1926. -.. Language. THEOLOGY. Literature. sanskritdocuments. Linguistics. Linguistics. 1914. V. Literature.. manusambhava.. . Theology.. Literature. 0. Sanskrit. 1920... t'ii aara krxshhnd-achaarya. 1891. mahadeva. Language. Damodar Jha. 1828... mahaapuraand-apanachamapathalakaand'aa.. Literature. Linguistics. Literature.. 190 pgs... mahabharat sahitha pradma kand. . vi. RELIGION.. Language. Literature. mantraayechandodaya. Sanskrit. 456 pgs. Sanskrit. Linguistics. Literature. shriibhavabhuti.. Literature. 1896.... 190 pgs.raghavan. malayamaarutan' dhvitiyan' spandan. Sanskrit.. Sanskrit. 1961.. Not available.. 575 pgs. 790 pgs. Literature. mahaaradha padakooshaa.. manasollasa vol Iii. Literature. Linguistics. 248 pgs. 894 pgs. Language. Not available. Not available. ... . 0.. 0. sridhar venkatesh kethkar. shriidaqs-ind-aamuurti. Language. Literature. 0.. 1901. Language. Literature.... 442 pgs.. majamuuaajaabtaa phaujadaarii. 170 pgs. Linguistics. Linguistics. Sanskrit. Language.. Sanskrit. mahaabhaashhyamuu. mahaaviiracharitamu. Language.. Ramakrishna Harshaji Sastri. 0. baladeva upaadhyaaya. mahaakaavyaa ratnaavalii. Language. Sanskrit. Language.. 302 pgs. 50 pgs. Literature. 1965. Literature. 166 pgs... mahinmastotramu madhusuudanii vyaakhyaa trxtiiyan' san'skarand-amu. 50 pgs.org/…/SanskritIIIT. 482 pgs. mand-isaara anumaanakhand-d'a. manu.. 1971. Language. shrii raajanaaraayand-a shaastri. Language... Sanskrit. Sanskrit. vyasa. Pandit. 310 pgs. Sanskrit. 1926. Literature. ke. 173 pgs. 301 pgs.. malavikamitra naatakamu. pandd'itashriiharishang-karatbhaasharmand-aa.. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… mahaabhaashhyakunj-chikaa darabhang-gaamand-d'alaantargara t'haad'hii graamanivaasinaa. Sanskrit. 1941. 554 pgs. 804 pgs. Sanskrit.. Linguistics.

. kevalaanandasarasvati. miimaan'saaprakarand-agrantha miimaan'saanyaayaprakaasha t'ippand-yaadisamalan'krxta. 638 pgs.... LANGUAGE. General.. LITERATURE. 554 pgs. manusmrxtivishhayaanukramand-ikaa. 90 pgs. manusmuuti Vol I. Sanskrit. Sanskrit. 0. 48 pgs. LINGUISTICS. 1934. 502 pgs.. 1930. Sanskrit. miimaan'saakoshha Part 3.. shriimatkumaarilabhat't'apaada. Literature. manusmrxte.... 1954. 1914.. Language.. Sanskrit. Sanskrit. Literature. 1898. Literature. mediniikosha. Linguistics. 214 pgs. Language. mimaan'saamand-d'anena mand-id'ataa. 1932. 1928. LINGUISTICS. miimaan'saashlokavaartikama.. 570 pgs. Halayudha. mimaan'saanukramand-ika. mimaan'saanukramand-ikaa. Literature... 536 pgs. 1898. 1831. Theology. Literature.. gan'ganatha jaha. mevad'a patana.. 541 pgs. Sanskrit. miimaan'saanyaayaprakaasha aapodevii. Sanskrit. maraat'i gran'thaan'chii bayaajavaara yaadi bhaaga nowlaa. miimam'saashaastrasavasve. 1948. LANGUAGE.org/…/SanskritIIIT.. Sanskrit. Sanskrit. Linguistics. 531 pgs.. 86 pgs. Sanskrit. miimaan'sasaarasang-graha. Religion. miimaan'saanyaayaprakaasha saaravivechinyaakhyaayaa. gan'ganatha. 1943. mimaan'sha darshanam pada I. .… 125/167 . kevalaanandasarasvatii...d. Language... miimaan'saakoshha Part IV. Literature. Sanskrit.. miimaan'saabhyudayan. Malkuluka Bhatta. miimaan'saanyaayaprakaasha saaravivechinyaakhyaayaa. 238 pgs. LINGUISTICS.... LITERATURE. shriimadaapadeva. Psychology. Sanskrit. 0.. LINGUISTICS.. Literature. 427 pgs. LANGUAGE.. Literature. LITERATURE. Literature. Sanskrit. Language. raamachandra. 0. 551 pgs. Sanskrit. kevalaanandasarasvatii. Not available. 613 pgs. 1909.. shrimajjaimini. Sanskrit... Philosophy.. 120 pgs.. Theology. Language. Literature. Language. Literature. LANGUAGE. Linguistics. not available.t. sanskritdocuments. Language. 0. 1961. Linguistics. 210 pgs. 1980. Linguistics. manusmaruthihi. Sanskrit. Literature. 1953. Literature.. 539 pgs. 350 pgs. Literature. 0. Not available. shriimatkrxmaarilabhat't'a. LINGUISTICS.. Not available. Language.. Language. LINGUISTICS... LITERATURE. miimaan'saashlokavaartikamu nyaayaratnaakaraaravyayaa vyaakhyayaa. Language. shriikrxshhnd-adaasaatmaja.. Ganganatha Jha. 0.. 405 pgs.. 1956. Linguistics. LANGUAGE. 645 pgs... Sanskrit.. 1948. Religion.. 1925. Sanskrit. 1948. Linguistics.. 1930. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… manuscripts. mandana mishra. LANGUAGE.. Linguistics. kevalaanandasarasvatii. Tatacharya. Linguistics. Sanskrit. Literature. 1940. Sanskrit. LITERATURE. Sanskrit. Linguistics. 740 pgs. miimaan'saadarshanamuu. 96 pgs. 1021 pgs. LANGUAGE. Linguistics. Linguistics. Sanskrit.. LINGUISTICS. Linguistics. LITERATURE. meghasandesa. Linguistics. shriishang-karabhat't'a. .. Language. 216 pgs. Philosophy. manuscripts.. Sanskrit. Language.. aapadeva. Sanskrit. shriimadaapadeva. aapadeva. LITERATURE. Sanskrit. 142 pgs.. Sanskrit. miimaan'saakoshha Part II.. 238 pgs. Language. kalidasa. Sanskrit. miimaan'saadarshani. sabhara bhaasya. 1940. 246 pgs. Language..

Linguistics. Linguistics. Sanskrit.. Literature. Sanskrit. shriiraamaachaarya. 146 pgs.. Sanskrit. General. 1948. Linguistics Literature. Linguistics. Literature. 130 pgs.. mulagadaadhariyo shabdakhand-d'an. 1904. naa mahaaraashht'ra yaatra. 84 pgs. Sanskrit. 82 pgs. Linguistics. Linguistics. LITERATURE. Sanskrit. Not available. Linguistics. 1894. Literature. K... Sanskrit.. mudraraksasa.org/…/SanskritIIIT. mugendraagaman. Sanskrit. Sanskrit. Language. mruchhakatikamu.. 0. 380 pgs. 274 pgs. 1882. General. muhurta chintaamand-i.. 138 pgs. muulavidayaa niraasa.. Sanskrit. Literature. Language.. Sanskrit. Language. 107 pgs. Linguistics. LITERATURE. Sanskrit.. saahityabhuushhand-a shriijonnalagad'd'a satyanaaraayand-amuurti. mishrabandhuvinoda bhaaga 3. . 453 pgs. mrxgendragam. Language. Sanskrit.. Linguistics. mudrakshasa.. Language. 336 pgs. Language.2/14/2011 A list of scanned Sanskrit books at III… miman'sadarshanei. Sanskrit. 394 pgs. LINGUISTICS.. mishrabandhuvinoda bhaaga 1. 580 pgs. Astrology. Language. shrudrakavi. Literature. Literature. LANGUAGE. mulaavidhaa bhaashhyavaartikavirudva. Theology. 1986. Literature. 156 pgs. mukttipradiipa. Mimamsa Shastram.. Literature. Language. 228 pgs.rangaswami. 1970. Language. mundaka upanishad. Sanskrit. muhutairatnamu. Language. 30 pgs. LINGUISTICS. 0.. . Not available... Linguistics... not available. muhuurtachintaamand-i pramitaaqs-araat'iikaasameta.. 1999.. -. Language. swami satchidanandendra saraswati..... Julius Jolly. Religion. 0.. 490 pgs.a... Not Available. varashudrakaraaja. Literature.. Sanskrit. 433 pgs. Literature. 1962. Literature.. Literature... Sri Gadadara Battacharya. LITERATURE. Language. Sanskrit. Sanskrit. mumuksu savasvaasaraa sangrahaa. mudraaraaqs-ase pradhamo kand'khaha. Literature. Sanskrit. 1970.. mukundaanandabhaand-an. Linguistics. LANGUAGE. mitralaab. 382 pgs. Linguistics.. 1943. 0. 386 pgs. Not Available.. 382 pgs. Language.… 126/167 . mitaaqs-araat'iikaayaa. Linguistics.... Not available. Linguistics.. Sanskrit. Language. Literature. Kastnath Trimbak Telano.. Sanskrit.. 1961. 278 pgs.. 466 pgs. 320 pgs.. Visakadatta.. 433 pgs. bhatta naaraayand-akaant'a.. 128 pgs..v.. 0. mudraaraaqs-ase. Sanskrit. Literature. Visadhadatta.. Literature. Sanskrit. Language. 1925. muulaavidyaniraasa. Sanskrit. 798 pgs. 2000.. 0. Language. Linguistics. Sanskrit. 1882. subramanyasharmand-a. mrxchchhakat'ikei. 1962. Language. mnut'iikaasad'gahan. 390 pgs. Sanskrit. LINGUISTICS. Literature. Sanskrit. 1975. moqs-akaand-d'amu chatudaisho bhaagan..... shriikaashipati. 1893. Sripada Bhat. Linguistics. Sanskrit. 330 pgs. ke e krxshhnd-asvaani ayyara. Not Available. Sanskrit.. Linguistics. 0. Literature. Linguistics. 1918. 1945.. 1937. Sanskrit. Linguistics. sanskritdocuments.. LANGUAGE... na ii hindii rachana pahalaa bhaaga. muuhuurtamaartan'd'a maartad'avallabhaaravyavyaakhyaasahita. 1850.. 501 pgs. visakhadatta. muchchhakat'ikan. ramnaraya lal beni madhav. Not Available. naaraayand-araam aachaarya. Literature. Language. N R Bhatt. 1918.

Linguistics. Language. Literature. 724 pgs. 1817. Language.. 0. narakasuravijaya vyayoga. Sanskrit. 676 pgs. Literature.. Linguistics. naushada charitam. Linguistics. Linguistics. 135 pgs. namalinga sasanam. Language. Linguistics. naishhadhakaavyam vyaakhyayaa sameitam. Not available.. kheimaraaja shriikrxshhnd-adaasane. Language. Sanskrit. 220 pgs. Literature. Linguistics. 270 pgs. naat'akachandrikaa. Sanskrit. 1966. Sanskrit. Biography.. Language. 216 pgs. Literature. 1940. Narayana Sastrigal. Language. Literature. 90 pgs. Linguistics.. Sanskrit. naat'uuyadarpand-amu prathamoo bhaaga. Literature. . naanaartharnd-avasan'qs-eipa.. naaraayand-abhat't'a.. Theology. Sanskrit... 267 pgs. 612 pgs... 1925.. naishkarmya siddhi. 350 pgs.. 1956.. Linguistics. Sanskrit. Sanskrit. Sanskrit.. nandisuttram. Sanskrit. Sanskrit.. Literature..krishna Das. Literature. natyasastra with the commentary of abhinavagupta vol-iii. c.. Language. naishhakarmya sidhdhi. K. 1964.. Literature. naishhadhakaavya. 274 pgs. dharmasuri. 518 pgs. m.. Literature. 1929. Sanskrit.. -. naat'yashaastramu vivrxtisametamu bhaaga 1.. Literature. Sankara Rama Sastri C. Linguistics. Linguistics. bharata. Language. sri bharatamuni. 252 pgs. Sanskrit.. Linguistics. vyasa. 242 pgs.. Language... narasin'gapuraand-amu. naasikeita paakhyaanamu.. 0. nanj-avaada nanj-avaadasan'gn-akayinaddigajatna t'ikayaa. bharatamuni. sanskritdocuments. Literature. mahaakavi shriiharshha. Linguistics. 265 pgs. navagiitaakusumaanj-jali. Linguistics.. Literature. Sanskrit. Literature. 0.. Literature. shriimachchhiromand-isudhii. 204 pgs. Linguistics.. 1506 pgs. Language. raamachandra.2/14/2011 A list of scanned Sanskrit books at III… Language. 1911. 0. naat'yadarpeind-amuu volume 1. nalooparavyaanamuu. Geography.. ta gand-apatishaastrii. 1954. Linguistics. Literature. nalopakhyanam. 1903... 1943. Language. 292 pgs. naaraayand-iiyan.. Sanskrit. Literature.. Language.. Literature. shriimadvedavyaasa.ramakrishna kavi. Sanskrit. 84 pgs. 0. Sanskrit. Religion. 1932.. Literature. Linguistics. Sanskrit. shriimannarapatikavi. Sanskrit. 1951.. Literature. Sanskrit. Language. 2005. Linguistics. Language.. 1962. Language. narapatijayacharyaasvarodaya jayalaqs-miit'iikaasameta. raamachandra. 18 pgs. 54 pgs. 184 pgs. baabulaal shukla. 1912. Sanskrit. Linguistics. Sanskrit. Sanskrit. naaradapancharaatran. -.org/…/SanskritIIIT. 396 pgs. Language. Language. Sanskrit. Language. Linguistics. The Arts. naageshaashayanind-aiyan' pradhamo skandhahan. Language. Literature. Linguistics. 380 pgs. Literature.… 127/167 . Linguistics. natyasastra. naatyashaastram. 1965. naaradhiya mahaapuraand-amu.. venkataramaniah. 366 pgs.. Linguistics. 1961. Linguistics. Sanskrit. Sanskrit... 1927.. 0. 460 pgs. 1956. 550 pgs. Sanskrit. Sanskrit. Literature... 584 pgs.. chan'drika... History. Literature... Sanskrit. Language. Linguistics.. 1929. Language. Literature. The Arts. 1899.. nalacharitranaat'akamu. amarasimhudu. nagananda.. shri suresvaracarya. 254 pgs. -.. 77 pgs.. shri devavaccaka. Language.. Sanskrit. 0. 1913. Literature. Language..

viraraghavacharya. Psychology.. nagesha bhatta. niruktan' nighand-t'upaat'hasamupetan' dvitiiyobhaaga..v.. 133 pgs. pan' prabhunaaraayand-a tripaat'hii sushiila. Brahmanandaji.. 1925. Sanskrit. shriimadhyaarakaachaarya. nayaayakusumajjalii. Linguistics.. Thallahtanath Pandit. 482 pgs.. 85 pgs. Language.. Sanskrit. Narasimha Vajapeyin. 1940. 768 pgs. LANGUAGE.. niitimaalaa. Philosophy.. shrii kamlakar bhatt. Linguistics. niilakand-t'havijayan. Language.. nityaachaaradapaind-an. swetaranyam narayana sastriar. 746 pgs. ng-aapakaasan'grahamuu. 1926. Srimad Appaya Diksita.... nir^nd-ayaamrxtamam. 86 pgs. 248 pgs. Sanskrit.... Literature.. niruttkalaghuvivrxti panj-chapaadikaa. 1941.. 1950. 1956. meighanaadaarisuuri.mahadeva Sastri. Sanskrit. Sanskrit. Pandith Priyanath Vidyabhushan. 76 pgs. Linguistics... niitimayuukha. Language. 1918. sanskritdocuments. Literature. Sanskrit. . Linguistics. Sanskrit. 1942. 127 pgs. Linguistics. bhaavanaatha mishraa. Sanskrit. 226 pgs. Sanskrit. Sanskrit. Literature. LITERATURE.. neetisataka.. P V Ramanujaswami. 1937. LINGUISTICS. Literature. Psychology. nityotsavan. Religion. Linguistics. Mahamuni Vyasakcharya. 1941. 1940. Literature. 179 pgs. 456 pgs.. jvaalaapraasaada mishra. niitipaat'han.. Mahesvara... Sanskrit. Literature. Linguistics. 91 pgs. Religion. 321 pgs.. Literature.. Vasudeva Sarma. Sanskrit. Linguistics. Theology. neiminirvaana. K. Sanskrit. 76 pgs. Language. kuu. Language. T. 283 pgs. 1951. Someswara Sarma. niruttkmn. Literature. Sanskrit. Bhavanatha Misra.. Narasimha Vijapeyt Vol Ii. Literature.org/…/SanskritIIIT. Language. 1949. Sanskrit. Linguistics. nidraa vign-aana kyon' kahaan' kaise aura kaba sonaa chaahiye. 1912.. Language. 1972.. Linguistics Literature.. Sanskrit. 1926. Linguistics. 86 pgs. nayamanjarii.. 1930. Sanskrit. 1967.rangaswami. 140 pgs.. Natural Sciences.. raamanaathashaastri.t. Linguistics.. 1967.r. Literature. Sanskrit.. nir^nd-ayasindhau. Bhatta Nilakantha. se . 768 pgs. niruttk bhaashhyat'iikaa. 1928. Sanskrit.. 0. vaagbhatta.... Language. 1927. 1937. Sanskrit. Narayanarya. 246 pgs. Language..shankara Rama Sastri. Literature. Social Sciences. A.. Philosophy. 68 pgs. Language.. Literature.. 0. Sanskrit. Language.. nayadviveka. Sanskrit. Sanskrit. Linguistics.... 365 pgs. nayaviveka. niyatakaalakaand-d'amu trutiyo bhaagan. nityaachaarapradiipa Part I. Literature. Sanskrit... nayaviveika. 1936. Literature. 158 pgs. Sanskrit. 320 pgs... Philosophy. 1937. 286 pgs. nipaataavyayopasagaivuttin. nipaataavyayopasagraivuttin' t'ilaka. Sanskrit. 480 pgs. 1951. nayachandrikaa praaramyate. 545 pgs. Language. 649 pgs... Psychology. Social Sciences.. Philosophy. 625 pgs.. 1827. Literature. Social Sciences.. Linguistics... 1908. Krishnacharya..… 128/167 . 1951. Psychology. Sanskrit. Linguistics Literature. nayadhyumand-i. .. nirnayasin'd'hu. 1907. 166 pgs. Sanskrit. Literature.2/14/2011 A list of scanned Sanskrit books at III… nayaayaamrutamu dhvitiyo bhaagan. Language.. Linguistics. Sanskrit.. A. nirnayasindu. Literature. Sanskrit. C. Sanskrit. 174 pgs. nityaachaarapradopan. Social Sciences. 330 pgs. shriimanmaharshhivarayaaskiiya. Language. nrxgamooqs-aprabandha. Theology. 1955. naaraayana bhat't'aa. Sanskrit.

1912. LANGUAGE.. nyaaya jaagadiishiivyadhikarand-amu. nyaayakulishamuu. Philosophy. nyaaya muktaavali raaghavendra yati. Language. Sanskrit.. Language. Viraraghavacharya.. 1941. nyaayaashiddhaajnaamuu.. Sanskrit. Linguistics.. 1941. Language. Sanskrit. Sri Kamakshi Amma. Philosophy. Linguistics. Literature. Saktism. 68 pgs. Theology. Not available. Linguistics. Philosophy. shrii vallabhaachaarya..... LITERATURE. shriiseneshvaraaryai.. T. Language.. Sanskrit. 1931. Literature. 1941. 204 pgs. Theology. nyaayaparishudin.. 299 pgs. Sanskrit. 218 pgs. 168 pgs. Sanskrit. nyaayarakqs-aamand-i. Psychology. Linguistics.. Linguistics. Psychology. Theology. 222 pgs. nyaayanibandhaavalii. Psychology. Sanskrit. Theology. Parthasarathi Misra.. nyaayaprakaasha nyaayashaastra. Sanskrit. Sanskrit...2/14/2011 A list of scanned Sanskrit books at III… nrxtta san'grng-aha.. 524 pgs. Philosophy. Religion. ti ... Sanskrit. 1938. nyaayaratnaakarakhyaavyaakhyaasahite shlokavaartike. 291 pgs.sambashiva Sastri. nyaayabodhinii vaakyavrxtti nirukti. 432 pgs... Language. 0. nyaayadarshana suutras bhasya.. Language. Sanskrit. Philosophy. Sanskrit. K. Religion. 1970. Philosophy. 0. Language. Venkatanath Sri Vedantacharya. Linguistics. 1925. Philosophy.. 91 pgs. nyaayakulishamu. Sanskrit. 350 pgs. Athreya Ramanuya.. nyaayakaalaapasang-agraha. 0.. Not available. nyaayakalaapasan'graha. 0. 1940. Sri Senesvaracharya. Sanskrit. 1937. Atreya Ramanuja. nyaayakusumaanj-jali Part 2. 379 pgs.. 444 pgs. Sanskrit. 90 pgs. 1962.. Linguistics. Sanskrit. Language. 1934. Sanskrit. . Satyapramotheertha sripada. Linguistics. nyaayaratnamaala. Literature. Sanskrit.. nyaayabodhinii niilakan't'hiiya vishhauamaalaa. Literature. 461 pgs. Philosophy. Sanskrit... 118 pgs.. 1010 pgs. Language. 592 pgs. Religion. 1953. Sanskrit. nyaayabindu qs-idhamakiirti prand-iita.. anuruddhaachaarya.. Literature. gautama.. Sanskrit... 315 pgs. nyaayaliilaavati. Sanskrit....… nyaayasudhaamand-d'anamu. 94 pgs. Philosophy. Literature. Not Available. Literature. paarthasaarathimishraa. Sanskrit. nyaaya parishuddii.. 1919. 0. 1937. Literature. chidaghanaanandagiri. Nyayasar. .. Literature. 1956. LINGUISTICS.. nyaayabhaashhyavaarttikataapyarya vivarand-apanj-jikaa 2 5. Psychology. 1915.. Linguistics.. 1969. Sanskrit. si. Linguistics. pat't'aabhiraama. nyaayakusumaanj-jali Vol 1. Sanskrit.. 0000... 426 pgs. Language. Sanskrit. 96 pgs. shekhara.. 534 pgs. Viraraghavacharya. nyaayadarshanamu bhaashhya vrxttisahitamu.. Literature. T.. Psychology.. 0. 363 129/167 ... d'aa priyabaala shhaa. Psychology.. 1923. Linguistics. 622 pgs. Not available. Religion. sanskritdocuments.. 426 pgs. nyaayakusumaanj-jali Vol I. nyaayasaara shrii bhaasar^vagn-aprand-iita. nyaayaboodhini baakyavrxtti.. Dwaita Philosophy. 432 pgs. Chandrashekhar Shastri. Psychology. Sanskrit.. Sanskrit. 421 pgs. 1938. nuutanadhrmmaniyamasya. Psychology. Psychology. Sanskrit. 178 pgs. 1918. 1935. lakqs-mand-aachaaryand-a. Sanskrit... viiraraaghavachaayaund-a. 298 pgs. 0. nyaayaratnamala. Philosophy. vaatsayaayanamuni. Literature. Psychology. Sri Appayah Dikshita. Language..org/…/SanskritIIIT. 1924.

Linguistics. panchatantramu 1. 1953. Not available. Psychology. 1902. Sri Koliyalam Swami. Dwaita Sanskrit.. pancharatnakaarikaa.. padasan'grahan' bhaaga pahilaa. khemaraaja shriikrxshhnd-adaasa. Language. sanskritdocuments. Language. 363 pgs. panchasiddaantikaa. Literature. 1954. LITERATURE. . 342 pgs.. paaia sadda mahand-nd-aavo praakrxta shabdamahaarnd-ava.. saishasrikrishna. 338 pgs. Sanskrit. 324 pgs. palitipitakasassanukkamanika part 2.. 1941. Language... shriivaasudevaanandasarasvatiit'embesvaami. 1104 pgs... Philosophy. Chintamani. trinaatha sharma.. 175 pgs. ruupalaala kapuur.. Vacant... Linguistics. 0. Linguistics.. Literature. 56 pgs.. paarijaatahrnacampa.. Language. Sanskrit. Ramakrishna.k.. Vamana Daji Oka. Linguistics. 1200 pgs.. Linguistics. Literature.. at III… nyaayasudhaamand d anamu. Literature.… 130/167 .. Linguistics. nyaayatatvaalokan. 1818. Sanskrit. Language.. paaribhaashhikapadaaryasan'graha. 0. pan'chaadashi bai vidyaarand-ya. Sanskrit. 88 pgs. 1900. Sanskrit.. 1874... Not available. LINGUISTICS. panchadashii.... Psychology. Sanskrit. 568 pgs. Vidyasekharalu. 1973. Sanskrit. nyaayasudhaamand-d'anamuu. Rama Murti. Literature. Linguistics. Sanskrit.. 1926. Sanskrit. paat'hakamukhavispot'akamu. 579 pgs. nyayakhosh. Sanskrit. Psychology. Linguistics. Sanskrit. 1896.. Literature. Literature. 1983. Linguistics.. Sanskrit.. Language.. Natural Sciences. Satyapramotheertha sripada. Psychology. not availabe. LANGUAGE. Sanskrit. 1918. Linguistics. Literature. panchaman' pushhyamu. 0. History. 1893. 0. Literature. Language.. Language. depatment of pali.r. Sanskrit. Sanskrit.. Sri Mad Ramakrishna. 1930. 408 pgs.. Linguistics. panchadashagiitaa. paat'hashodhanamuu.. Linguistics.. 1889. 77 pgs. Language... Linguistics Literature. Psychology.. Literature.u. Philosophy. Sanskrit. Literature. Sanskrit. Sanskrit Grammer. Sanskrit. pan'chamapushhpamu shriiguruchartrikaavyan' shriidattachan'puu sat'iikaa. pan'chaprakriyaa. Sanskrit... padmapuraand-amu tatraadimamaadikhand-d'an' dvitiiyan' bhuumikhand-d'an' chetyetaddvayaruupa prathamabhaaga. paarijaataharanachampu. Sanskrit. Sanskrit. 538 pgs. vishvabhandhu.. 118 pgs.. varaaha mihiraa. Sanskrit. Language.. shriibaand-abhat't'a. Sanskrit. 1992.. Sri Sadasiva. Linguistics. Literature. 64 pgs. Language. kielhorna. Kishore Nath Bha. 1894. Linguistics. Language. Sanskrit. 1939. 716 pgs. Philosophy. vishhnd-u sharma. Literature. pajjadashii. Sanskrit... 144 pgs. 1944.. pandit durgaprasaada. 0. Language. bhimacharya jhalakikar. Biography. 172 pgs. T. paand-iniiyavyaakarand-ebhinavavaarttikaani. paavaitiiparind-ayamu.org/…/SanskritIIIT. 64 pgs. Language. 204 pgs. 1953. 0. Literature.. paarijaataharand-achampu.s. Philosophy. Sanskrit. 258 pgs.. 390 pgs. paadukaapat't'aabhishhokamu. Sanskrit.. Language. Philosophy. Literature. kurugand-t'i suryanaaraayand-ashaastri. Linguistics... Literature. pachchatantrakamuu. 1962. Geography.. Literature.2/14/2011 A list of scanned Sanskrit books Philosophy.. 38 pgs. 1972. 364 pgs. 60 pgs... 54 pgs. mahaamunishriimadvyaasa. 654 pgs. paarabhaashondradipikaa. 1946. 487 pgs. Sanskrit.

Linguistics.. 136 pgs... .s. 282 pgs.a. 0.. 202 pgs... paqs-ataaprakarand-amuu. Language.. 60 pgs. Sanskrit. paramasan'hitaa. 1926. 1934. paraasharadharmasn'hitaa vyavahaarakaand-d'amu practhamoodhyaaya. 1995. Sanskrit. Linguistics.. Sanskrit. 1923. Sri Venumadhava Sukla. LITERATURE. panj-chatantramu. 1940. vaamanasharma.. 234 pgs. LANGUAGE. sayana madhvacharya. Language. Linguistics. 1946.. maadhavakaravirachitaa. Sanskrit. paribhaashheindu sheikhar 1938.. vinaayaka gand-eish. Language. 1923. 0. Sanskrit. Language. paribhaashheindu sheikhar vyaakarand-a vibhaagamu. parishhkaaradarpand-a saastraarthakalaasahita. paribhaashendusekharaa. Linguistics. 1916. 344 pgs. 1958. Sanskrit. Language. Sanskrit. parishhkaaradapaind-an. Linguistics. 1959. Literature. 56 pgs. shrii viiraraaghavaachaaryaind-a. Philosophy. Abhinava Gupta. 140 pgs. 434 pgs... Sanskrit. Language. Sanskrit. not available.. veind-imaadhava shaastri. shriimadhdighaarand-yamuni. 1105 pgs. parayaayaratnamaalaa. Sanskrit.. Saktism. 60 pgs. shriiraamashaastriind-aa. Sanskrit. sanskritdocuments. 412 pgs. Linguistics. Literature. Philosophy.. 518 pgs. 144 pgs. Linguistics. Linguistics. panj-chatantramu. Sri Bhagavad Adesesha.. Padmanabhan.. shriibhagavadaadisheshha. parijataharanachampu. Dr. panj-chalaqs-and-iisarvasve. Sanskrit. paramaayesaaran. 162 pgs. 114 pgs. Literature. Language.. 2000. Sanskrit.. Sanskrit. paramaarthabhuushhand-amuu... Sanskrit. jayadeivasharma mishra.. 1833. Linguistics.. Religion.. 1923. Literature. sesha srikrishna. paramaarthasaaramu vivarand-ena sametamu. Sanskrit. parasara dharma samhita vol 2 part 1. 1306 pgs.. 1911. Linguistics. paribhaashheindu sheikhar. Language. Theology. Sanskrit. parashuraamakalpautramu.. 1989. Literature. Literature. Language. Krishnaswami Aiyangar.. pashht'aalambhamiimaam'saa. 1935. kumaratatacarya.. Mahadeva sastry. 0000. 389 pgs. Linguistics.. 1938.. Abhinava Gupta. Sanskrit.. Psychology. Linguistics. vinaayaka gand-esha aapat'e... Sanskrit. Language. 200 pgs. 1898. Philosophy Psycology. Sanskrit. 1900. 505 pgs. pashavalaan'ba mimaan'sa. Sanskrit. Literature. Sanskrit. Language.. S.. Theology. 1923. Linguistics.. Literature.. Language. Linguistics.. Literature. Language. Sanskrit.. vaiyaakarand-ashiromand-i sukla shrii vendiimaadhavashaastrii. Parasara Samhita.... Language. Literature. Sanskrit. Sanskrit. 581 pgs. Ropahavvamana Sastri. LINGUISTICS. Not available. 216 pgs. Sanskrit. 0.. Literature. 370 pgs. 578 pgs.. paribhaashhendrashokharan. shivadatta. 1943. Psychology. 1114 pgs.. Sanskrit.. vishhnusharmaa. Literature. Sanskrit. Literature. Literature. 1949. 1868. Philosophy. 62 pgs. Language.. Linguistics.… 131/167 . parijata natakam.. 1916. Language. pashvaalambhamiimaan'saa.. Literature. Literature. 280 pgs. Literature. Literature.. paramaarthasaara. 68 pgs. Psychology. Linguistics. paraashara san'hitaa. Religion. Language..2/14/2011 A list of scanned Sanskrit books at III… panj-chadashii. nagojibhatta. Language.. paramaarthasaara.. 1992. Linguistics...org/…/SanskritIIIT. Linguistics.

0. patanjali yoga sutrani. 1908. prabodhachandrodayamuu. 252 pgs.... T..chinatamani. Sanskrit. Sanskrit. 0. praaryavidhaanamuu. Linguistics. pand-d'ita vishveishvaranaaya reit'ha. Sanskrit. Sanskrit.. pracya pascattyam. Sri Ramnath Sastri. 1935. prakaasha shriimadbhaagavatadashamaskandha. LANGUAGE.. Literature.. Sanskrit. d'aakt'aru jagadiishachandra jaina. Literature. Language. prakrita sarvasva. Philosophy.. Theology. Literature.. Sanskrit. pradhikaara kaa prashna. 285 pgs. Linguistics. 280 pgs. prakrita sarvasva. pand-t'itapravara shriiraamaavataarasharma. Sanskrit. phaladiipikaa adhyaaya 1 28. Sanskrit. 1915. praayashvattamayuukha dashaman. Language. sanskritdocuments. 71 pgs. 1932. B.... 132 pgs. Kasi Nath Sastri. 670 pgs. Literature. raamadaasa. 134 pgs.srinivasagopalacharya.. Psychology. Philosophy. Literature. Sanskrit. 0. 1949. 160 pgs. Sanskrit. LITERATURE. praathamika san'giita. 1974.org/…/SanskritIIIT. 230 pgs. mukunda.. 308 pgs. Linguistics. Sanskrit. LINGUISTICS. Sanskrit. shriimatkrxshhnd-amishrayati. pro shan'kara gand-eisha vyaasa. Language.. Literature. 1961.. shriipurushhottamajiisahaaraaja.. Psychology.. prabodhachandrodayamu chandrikaavyaakhyaa prakaashaakhyavyaakhyaabhyaan' shhashht'haavrxtti. swmi vivekananda. Literature. Bhattacharyya. 365 pgs. Language. prakat'aathaivivarand-amu.. Literature.. krishna chandra acharya.. shriinaaraayand-abhat't'apaada. praakrutamand-idipan. Language. Language. prakriyaasarvasvan' dvitiiyo bhaaga. 116 pgs.. shriimaddidhaarand-yamuni. 292 pgs.. Literature. laqs-minaadabhat'a. praakrxtasarvasvamu. Linguistics. 1953. 1956. Sanskrit. Literature. Linguistics. 585 pgs. bhattacharya.… prakriyaasarvasvan' savyaakhyamu prathamo bhaaga. Language. 256 pgs. Philosophy. Linguistics. Sanskrit. Sanskrit. Sanskrit. Linguistics. Sanskrit.. bhagavatiiprasaada vaajapeiyii. 257 pgs. -. Philosophy. Not available. 1932. praakrxta pushhkarind-ii prastaavanaa sahita..2/14/2011 A list of scanned Sanskrit books at III… patanj-jalayogasuutraand-i vaachaspatimishravirachita t'iikaavyaasabhaashhya sametaani.. 612 pgs. Linguistics.. 1940. Buddhism. yas n shriiraama deishikana. Vaishnavism. 470 pgs. pragnaapaaramitaasa pradhamo bhaagan. Philosophy. Language. praakrutapingalasutraand-i. Psychology... Psychology. prajnapaaramitaas abhisamayalankaaralooka bhaaga 1. Literature. LITERATURE. Language..r. Linguistics. 1968. 430 pgs.. shriibhat't'aniilakand-t'ha. 246 pgs. 174 pgs... 1973. Linguistics. The Arts. mantreshvaraa. Language. Language. T... 674 pgs. Sanskrit.. 259 pgs. 1904. 1935..... prakiirnd-aaprabandhaa prathama khand-d'a. Literature. b. 119 pgs. pattuppaat't'u san'skrxtaanuvaada. Language. Sanskrit. Sanskrit... Linguistics. 0.. Linguistics. Linguistics. prabhakaradijaya. krishna chandra acharya. Language. 101 pgs. Sanskrit. Literature. Linguistics... shriinaaraayand-abhat't'apaada. 292 pgs. 1972.. 1968. Religion. Language.. Sanskrit..t... Literature. Linguistics. 1862. LANGUAGE. 1894. Literature. LINGUISTICS. 1937.. Sanskrit. Psychology. Sanskrit. 1935.. Sanskrit.. 132/167 .. Sanskrit. Language. Language. 1968. prakarand-apajjikaa. patyadarshii.

. 194 pgs. Linguistics. Sanskrit...2/14/2011 A list ofbhaaga. Religion.k. pramaand-ayavaada. prashanj-aanamu. Sanskrit. Linguistics. 1963. Linguistics... 1979. 223 pgs. Sanskrit. Theology. Literature. . 1984. 668 pgs. pramaand-a vachana sadgahan' tutiyan'samput'amu. Language. prasnopanishhatuu.. Language. Linguistics. Literature. vidhyaanaatha.. Sanskrit. Literature. 1896.. prasannaraaghavamu sat'iikamu. 1964. Theology. maheindrakumaar shaastri.org/…/SanskritIIIT. Language.… 133/167 . Literature. . Sanskrit. prasannaraaghavaa. Linguistics. Sanskrit... 858 pgs. pramaanavaartikabhaashyam vartikalankaarah. pramaand-ayavaada.. Sanskrit. prapan'chasaara saara san'graha bhaaga 2. 694 pgs.. Literature. Language. shriividhyaanaatha. prajnaakaragupta. Theology. 160 pgs.. 106 pgs. Linguistics... raghunaatha kavi. Sanskrit... 123 pgs. 529 pgs. Vaishnavism. Linguistics. . 146 pgs. Not Available.. Sreenivasachariar. prapannaparijatam. 1950. prameyakamalamaarataand'aa. Sanskrit.v. Sanskrit. Literature. LITERATURE. 350 pgs.. Language. 0.... Pattabhiram Sastri. Bellokoth Ramachandra Sharma. Anandagiri. Literature. Jinaviya Muni. Sanskrit. 1915. prameiyakamalamaarttaand-d'a. 48 pgs. 1954. 1945. Language. Sanskrit.. pramaand-amajjarii.. 140 pgs. 121 pgs. Sanskrit. Language. 1909. Language. Literature.shastri. 690 pgs. 0. ... Literature. 1999. Linguistics. Sanskrit. Sanskrit. Sanskrit. 1954. Sanskrit. Sanskrit. Literature. Language.. 73 pgs.. 1896. 360 pgs. Linguistics.. prapatrapaarijaatan. 390 pgs.. 0.. Not available. Jayadeva.. pramaand-amajjarii granthaan'ka 4. The Arts. Language. Language.. prashropanishhatan't'iikaasan'valita san'karabhaashhyasametaa. K... Sanskrit. Linguistics.. Literature.. Sanskrit. LINGUISTICS. Tantras. Language. 1942. 121 pgs. 126 pgs... 1992... Not available. 342 pgs. Linguistics.. Sanskrit. Literature. hari naaraayand-a. Philosophy. prakrutaananda. Sanskrit. sanskritdocuments. LANGUAGE... prashnootararatnamaalikaa. Sudara Chary. pramaand-avaattaka bhaashhyamuu. T. scanned Sanskrit books at III… prakriyaasarvasvan savyaakhyamu prathamo shriinaaraayand abhat t apaada. Religion. Not available. 1949. Jayadeva. prasthaanaratnaakara.. prataaparudriiyamu alan'kaarashaastramu vyaakhyaaya. girvanendra saraswathi. 82 pgs. Language. Literature. Sanskrit. T. 0. 916 pgs. 215 pgs. Literature.. prashnashiromand-i bhaavaarthabodhiniibhaashhaat'iikaasahita.. Literature.. Sanskrit. THEOLOGY.. Sanskrit. 1894. Literature. Linguistics.v. Sanskrit. pramaand-aprameyakalikaa. 1953. 391 pgs. ratna gopala bhat't'a. Sanskrit. 1973. Linguistics. 1964. 1950. san'kara bhagavatpaada. Language. Linguistics. subramand-ya saastri.n. 104 pgs. prasang-kavign-aanaatsiddhamu. Literature.. Sanskrit.. H. prameya kaamalamaarthanda prabhaachandraan. 0. Linguistics. Linguistics. 106 pgs. pratidvarasutramu. 0. pan'd'itarudramund-i.. sri vatsya vardacharya... Pandurangacharya Srinivasacharya Waiker. 323 pgs. 1953.. RELIGION. Language. Sanskrit. Language.. 426 pgs. prataaparudrayashobhuushhand-an' ratnaapand-aaravyat'iikayaa... 1973. Religion. . Pandit. prand-avavaadan' pradhamabhaagan.

346 pgs. prayaaga mahaatyamu. krxshhnd-adatta maithila. Sanskrit. Sanskrit . purushhaathaisudhaanidhin.. pratyabhijnahrdayam.. 392 pgs.. 488 pgs. Linguistics.. Language.. Psychology. Literature. 679 pgs. Linguistics. 138 pgs.. Linguistics.. T. Unknown. Linguistics. 1928. 319 pgs. not available. 1955. visvanaatha pandit.. Literature. Linguistics. Sanskrit. Unknown. shriikushhnd-amand-itripaat'hii. 324 pgs. 596 pgs. Sanskrit. Language.. 1938. Language.org/…/SanskritIIIT. Sanskrit. Sanskrit.… 134/167 . Pandit Ramlal. Literature. Sanskrit.. 1975. No. pratyakatvachintaamand-i Vol 2. Linguistics. 0. 1914. puurvamiimaan'saadarshanamu dvitiiyasamput'amu. pratistaa sangrahn.. puraand-amu. Literature. preimavijaya. 1991. Linguistics. 1961.. 0. 646 pgs. purushhaarthachintaamand-isthavishhayaanukrama.. . shriikushhnd-amand-itripaat'hii. 17 pgs... Sanskrit. purajjanacharita naat'akamuu.. 388 pgs. Linguistics Literature.. 140 pgs. Language.. Sanskrit. Unknown.. Sanskrit. Theology. sayaana kaarya. puraand-aparyaloochanamu bhaag Ii.. 454 pgs. Sanskrit.. 64 pgs. Literature. Sanskrit. Linguistics. purushhaathaichin'taamand-o. Linguistics. Literature. Linguistics.. 1942. Language... Not available. purushhaarthasudhaanidhi. 174 pgs.. 674 pgs. Vasudeva Sarma.. Sanskrit. purushhasitramu. 0. 1955... Literature. Sanskrit.. puurvamiimaan'saadarshanamu trxtiiyasamput'amu.. purushhaarthachintaamand-i.. 1943. Language. 1935. shriikhand-d'adeva. Literature. 35 pgs. 1911. emil baer ed. 248 pgs. Religion. Linguistics. purchryarnav. 1956.. Sanskrit.. 1917. sanskritdocuments. 0. 1955. Linguistics. Literature. puraand-akaavya stootra sudhaa. prodamanoramaa. Sanskrit. 626 pgs.. Linguistics. Language. K.. . e pi karmaarkara. Language. 608 pgs. Language. 1976. Hanumacharya. 0.. prayogaratnamaalaa. Sanskrit. Language. .... 1922. Sanskrit. praud'hamanooramaakhand-d'anagranthasya. 1941.. hari naaraayand-a.. Sri Sadanandha Vidyadhar. 432 pgs. Literature. 134 pgs. 1962. Sanskrit. Language. pratap singh. 109 pgs. 0. Linguistics. Literature. Literature.. 608 pgs.. Philosophy. si ar deivadhar. Language.chandrasekharan.ramanuja Tatacharya. Sanskrit... shriikund'akund'aachaarya. Literature. Sanskrit. Religion. 0. Sanskrit. Literature.... Literature. Language. Language. Sanskrit. Sanskrit. Shaacharya Shidarajamaloki. Sanskrit. N S Ramanuja Tatacharya. Language. Literature. Sanskrit. pratyaqs-attvachintaamand-ivimashain. priitilataakusumopetaa vrxttamaalaa. 320 pgs. sundareisha sharma. ... 443 pgs. pravachanasaara.2/14/2011 A list of scanned Sanskrit books at III… pratijnj-ayaugan'dharaayand-amu... Linguistics.. Sanskrit. 100 pgs. 1992. Language. puraand-aparyaloochanamu. Sanskrit.Religion. shrikhand-d'adeva. premarasaayana. Linguistics.. Sanskrit Grammer.

2/14/2011

A list of scanned Sanskrit books at III… puurvamiimaan'saadarshanamuu chaturthasamput'amuu... shriikhand-d'adeva, Language. Linguistics. Literature. Sanskrit, 1916. 428 pgs.

puurvamimaan'saa darshanamu Vol.i... e mahaadeiva saastri, Language. Linguistics. Literature. Sanskrit, 1908. 372 pgs. qs-airatarad'agnd-ii... Kshira Swami, Sanskrit Grammer. Sanskrit, 1955. 417 pgs. qs-i bhagavadraamaanujavirachite qs-ishaarirakamiimaan'shaabhaashhye Part 1... Sri Lakshmi Narasimhakumar, Philosophy. Psychology. Sanskrit, 1936. 434 pgs. qs-i bhuvanadevaachaayevirachitaa aparaajitaprachha... Popatbhai Ambashankar Mankad, Religion. Theology. Sanskrit, 1950. 791 pgs. qs-ibhaashhyamuu chatushuutribhaaga... Maha Mahopadya Sudarshana Vyasabhatta, Philosophy. Psychology. Sanskrit, 1916. 290 pgs. qs-iimada naarand-yamuniprand-iitaa panchadashii... Narayana Ram Acharya, Philosophy. Psychology. Sanskrit, 1949. 580 pgs. qs-imaddhekhaanasekaasyapajaanakaand-d'a... Parthasarathi Bhattachar, Philosophy. Psychology. Sanskrit, 1948. 214 pgs. qs-imadraamaanujaachaayeprand-iitan' qs-ibhaashhyamuu Part Ii Introduction And Notes... Vasudev Shastri Abhyankar, Philosophy. Psychology. Sanskrit, 1916. 368 pgs. qs-imatsanatsujaatiiyamuu... B. Gururaja Rao, Religion. Theology. Sanskrit, 1940. 144 pgs. qs-inad'apaadavirachitaa seikodheshat'iikaa... Mario E. Carelli, Religion. Theology. Sanskrit, 1941. 148 pgs. qs-ivanamaalivirachitaabrahaasuutrasiddhaantamuktaavali... Not Available, Religion. Theology. Sanskrit, 1942. 252 pgs. qs-utiratnaprakaasha qs-itimateudyota... Tryambaka Sastri, Philosophy. Psychology. Sanskrit, 1910. 102 pgs. raadhaaparind-aayamuu mahaakaavyamuu... Not Available, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1931. 304 pgs. raagaratnaakara... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 706 pgs. raagaratnaakaraa... khemaraaja shriikrxshhnd-adaasane, Language. Linguistics. Literature. Sanskrit, 1966. 702 pgs. raagatattvaviboodha... shriinivaasa, Language. Linguistics. Literature. Sanskrit, 0. 84 pgs. raaghavanaishhadhiiyamu savisheshhavimarshinii prakaashasan'skrxta hindiivyaakhyopetamu... shriiharadattasuuri, Language. Linguistics. Literature. Sanskrit, 1969. 95 pgs. raaghavanaishhadhiyamu... shriiharadattasuri, Language. Linguistics. Literature. Sanskrit, 1896. 74 pgs. raaghavapaand-d'aviyamu... shriikaviraaja, Language. Linguistics. Literature. Sanskrit, 1897. 216 pgs. raajadhamaikaand-d'amu... K.v. Rangaswami, Language. Linguistics. Literature. Sanskrit, 1944. 117 pgs. raajadhamaikaand-d'amu ekaadasho bhaagan... K.v.rangaswami, Language. Linguistics. Literature. Sanskrit, 1943. 410 pgs. raajatarangind-i... durgaprasada, Language. Linguistics. Literature. Sanskrit, 1892. 393 pgs. raajatarangind-i Ii... durgaprasada, Language. Linguistics. Literature. Sanskrit, 1894. 308 pgs. raajatarangind-i Iii... durgaprasada, Language. Linguistics. Literature. Sanskrit, 1896. 410 pgs. raama charchaa... premachanda, Language. Linguistics. Literature. Sanskrit, 1948. 168 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

d

kh

j

h iik

hh d d

L

Li

i ti

Lit

t

S

k it 0 920

135/167

2/14/2011

A list of scanned Sanskrit books at III… raamaayand-a... khemaraaja shriikrxshhnd-adaasa, Language. Linguistics. Literature. Sanskrit, 0. 920 pgs.

raamaayand-a baalakaand-ad'a... tulasiidaasa, Language. Linguistics. Literature. Sanskrit, 1886. 553 pgs. raamaayand-a sampuurnd-a qs-epaka... khemaraja shriikrxshnd-adaasa, Language. Linguistics. Literature. Sanskrit, 1827. 753 pgs. raamaayand-amajjari... shriikshemendra, Language. Linguistics. Literature. Sanskrit, 1903. 519 pgs. raamaayand-amu ayoodhyaakaand-d'amuu... shriimayaakavishrivaalmiiki, Language. Linguistics. Literature. Sanskrit, 1923. 316 pgs. raamaayand-amu baalakaand-d'amuu... shriimayaakavishrivaalmiiki, Language. Linguistics. Literature. Sanskrit, 1867. 224 pgs. raamaayand-amu kishhkindhaakaand-d'amu... shriimadvalmiiki mahaamuni, Religion. Theology. Sanskrit, 1915. 318 pgs. raamaayand-amuu arand-yakaand-d'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 0. 342 pgs. raamaayand-amuu baalakaand-ad'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 1912. 426 pgs. raamaayand-amuu sundarakaand-d'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 1916. 354 pgs. raamaayand-amuu uttarakaand-d'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 1920. 362 pgs. raamaayand-asan'qs-eipasagrarasasvaada... Not Availble, Language. Linguistics. Literature. Sanskrit, 0. 124 pgs. raamakarnd-arasaayanamu prathamo nishhyanda... Not available, Language. Linguistics. Literature. Sanskrit, 0. 74 pgs. raamakathaa... vaasudeva, Language. Linguistics. Literature. Sanskrit, 1929. 66 pgs. raamasandesha padaarthaprakaashaakhyayaa t'iikaayaa sameta... shriiraajaraajeshvarapuujyacharanda, Language. Linguistics. Literature. Sanskrit, 1917. 140 pgs. raamasvayan'varsya vishhayaanukramand-ikaapraarambha... mahaaraaja shriiraghuraajasen'hajii deiva, Language. Linguistics. Literature. Sanskrit, 1822. 1006 pgs. raavand-aarjuniyamu... shriibhat't'abhima, Language. Linguistics. Literature. Sanskrit, 1900. 218 pgs. raghunaathavilaasamu naama naat'akamu... yagn-anaaraayand-adiiqs-ita, Language. Linguistics. Literature. Sanskrit, 1958. 174 pgs. raghuvan'shamuu... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 576 pgs. raghuvan'shavimarsha... ra. krxshhnd-amaachaaryend-aa, Language. Linguistics. Literature. Sanskrit, 1908. 168 pgs. raghuvansh... kalidasa, Language. Linguistics. Literature. Sanskrit, 1944. 360 pgs. rasa mitra... tryambak nath sharma, Technology. Sanskrit, 1965. 276 pgs. rasa mitra... tryambak nath sharma, Technology. Sanskrit, 1965. 382 pgs. rasachandrika... pande v, Language. Linguistics. Literature. Sanskrit, 1913. 110 pgs. rasachandrika... parbatiya pandita vishweswara pandeya, Language. Linguistics. Literature. Sanskrit, 1926. 108 pgs. rasadiirdhikaa... kavi vidhyaaraama, Language. Linguistics. Literature. Sanskrit, 0. 102 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 136/167

2/14/2011

A list of scanned Sanskrit books at III… rasadiparigyan... jaganath prasada shukla vaid, Natural Sciences. Sanskrit, 0. 174 pgs.

rasagan'gaadharahrudayamu... jnj-aanachandrastyaagii, Language. Linguistics. Literature. Sanskrit, 1964. 138 pgs. rasagangadhar... jaganath, Language. Linguistics. Literature. Sanskrit, 0. 430 pgs. rasamajjarii... bad'ri natha, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1929. 222 pgs. rasamiimaan'sa... aachaarya raamachandrashuklaa, Language. Linguistics. Literature. Sanskrit, 0. 516 pgs. rasasadanabhaand-an... yuvaraaja, Language. Linguistics. Literature. Sanskrit, 1893. 70 pgs. rasavilas... bhudeva sukla, Language. Linguistics. Literature. Sanskrit, 1952. 162 pgs. rasen'drasaarasan'graha bhaashhaat'iikaasahita... mahaamahopaadhyaaya gopaalakrxshhnd-abhat't'a suuri, Religion. Theology. Sanskrit, 1844. 528 pgs. ratiratna Pradiipika... liilaadhara sharma, Language. Linguistics. Literature. Sanskrit, 1930. 148 pgs. ratna samuchchaya... not availabe, Language. Linguistics. Literature. Sanskrit, 1928. 504 pgs. ratnaavali kii kathaavastu... Not available, Language. Linguistics. Literature. Sanskrit, 0. 366 pgs. ratnaavalinaat'ikaa... shriiharshhadeva, Language. Linguistics. Literature. Sanskrit, 1953. 216 pgs. ratnaavalinaat'ikaa... shriiharshhadeva, Language. Linguistics. Literature. Sanskrit, 1953. 270 pgs. ratnakiirtinibandhaavalii volume Iii... anantalala t'haakuura, Religion. Theology. Sanskrit, 1957. 220 pgs. rattamatam... h. sesha iyengar, Language. Linguistics. Literature. Sanskrit, 1950. 174 pgs. rauravaagaamaa Vol.i... yan.aar bhat't'a, Language. Linguistics. Literature. Sanskrit, 1961. 277 pgs. rauravaagaamaa Vol.ii... yan.aar bhat't'a, Language. Linguistics. Literature. Sanskrit, 1972. 366 pgs. rig veda samhita volume Iv mandala X... max muller f ed, Religion. Theology. Sanskrit, 1892. 732 pgs. rigbhaashhya bhuumika... vi. kapaali saastri, Language. Linguistics. Literature. Sanskrit, 1952. 284 pgs. rigveda samahita (manuscript)... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 830 pgs. rigveda samhita... f max muller ed, Religion. Theology. Sanskrit, 1890. 974 pgs. rigvedasanhitoupanishadchatakam... -, Religion. Theology. Sanskrit, 0. 490 pgs. riitikaalina kavitaa men' abhivyaan'janaa evan' shilya... Not available, Language. Linguistics. Literature. Sanskrit, 1966. 491 pgs. rudraadhyaaya bhaashhya etatpustakan... saayand-aachaaryabhat't'a, Language. Linguistics. Literature. Sanskrit, 1976. 186 pgs. ruupamaalaayaamu bhaage Iii... not Available, Language. Linguistics. Literature. Sanskrit, 1982. 70 pgs. rxgbhaashhya... Not available, Religion. Theology. Sanskrit, 0. 73 pgs. rxgbhaashhyasan'graha... sva d'aa devaraaja chaananaa, Language. Linguistics. Literature. Sanskrit, 0. 440 pgs. rxgveda prathamos-shht'aka chatuthes-shht'ake shhashht'os-dhyaaya... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 952 pgs. rxgveda san'hitaa Part I... daamodara bhat't'a, RELIGION. THEOLOGY. Sanskrit, 0. 776 pgs. rxgveda san'hitaa Part II... daamodara bhat't'a, RELIGION. THEOLOGY. Sanskrit, 1940. 978 pgs. rxgvedaanukramand-ii... kunjanuu raajena, RELIGION. THEOLOGY. Sanskrit, 1932. 160 pgs. rxgveida bhaashhyamu volume 15... udgita aachaarya, Language. Linguistics. Literature. Sanskrit, 1935. 124 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 137/167

. Indology. saahityadarpand-amu. Literature. Theology. 939 pgs. 1024 pgs. Linguistics. Literature.. Literature. Sanskrit... Sanskrit. 1858.. Sanskrit. Language.. 1867. 180 pgs. 234 pgs. Religion. Sanskrit. Sanskrit.… 138/167 . Sanskrit.. rxgveidasan'hitaa panchamoo bhaaga. Linguistics. Language.. saahityaratnamanj-jushhaa.org/…/SanskritIIIT. 362 pgs. saamaveda uuhauuhyagaanamu anubandhasahita trxtiiyo bhaaga san'put'amu 2. 1982.. Sanskrit. prof. Linguistics Literature Sanskrit 1973 327 pgs sanskritdocuments. LANGUAGE. Literature... 1933.v. 500 pgs. saamaanyaniruktti.j. Linguistics.. shrisaayand-aachaarya. Not available. 426 pgs. Religion. Sanskrit.. rxgveidasan'hitaa trxtiiyoo bhaaga. 299 pgs. 20 pgs.. Literature. Literature. Language. Linguistics. C. Sanskrit. Linguistics. Sanskrit. shriimatsaayand-aachaarya.. 1863.. Language. 0.. 1955.. 217 pgs. Sanskrit. Language. t'iikaachatushht'ayasanaathii.. saahityavimarsha sakalasaahityaan'shasang-grahatmaka. durlabhaa.. Linguistics. Not available.. 0. rxtuvarnd-ana vyaakhyaaya. saamavedasan'hitaa.. Linguistics.. Language.. Sanskrit. Literature. 1147 pgs. shriikrxshhnd-asuurind-a.. 1148 pgs. Sanskrit. Not available... 2002.. Language. Linguistics. 630 pgs. rxktantran' saamapraatishaakhyam. 772 pgs. saamaveda uuhauuhyagaanamu anubandhasahita trxtiiyo bhaaga san'put'amu 1. madhava. saamavediiya ashht'a braahmand-e taand-d'yamu pad'avin'shabraahmand-an' prathamo bhaaga... Language. Not available. 193 pgs. LITERATURE. Sanskrit. Literature. Language. Sanskrit. Prof. Literature. Linguistics. Language. shriimadhvaachaarya. Not available. Language. Language. Linguistics. 1951. Sanskrit. 1933. Literature. Sanskrit... saahityadarpand-amu vyaakhyaamavalambaa samudbhaasitamu panj-chamasan'skarand-amu. Theology. Linguistics. 313 pgs.. shrii vai raamamuurtishrautii. 1941. 1897. 0. 1981. Language. 639 pgs. Religion. Linguistics. Sanskrit. LINGUISTICS.. 1062 pgs. Sanskrit. Literature.chenna reddy. Language. saahityakaumudi. Not available. Language. vidhyabhushand-a. Not available. 1900. Literature. 100 pgs. Linguistics. Language... Sanskrit. 1958. Language.. 1947. Linguistics. Language. saahitya darpand-a. Literature.. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… rxgveida prathamoshht'aka. Literature.. Theology. rxgveidasan'hitaa prathamoo bhaaga. Sanskrit. 1908. s. 516 pgs. raamachandravinaayaka pat'avardhana. saamavediiya ashht'a braahmand-e saamavidhaanan' aarshheyan'cha gn-iiqs-aadi san'valitamu dvitiiyo bhaaga. Not available. Surya Kanta Shastri. Literature. uppalla someshvarasharma. Linguistics. rxveda san'hitaa bhaaga 1. Linguistics.. shriivishvanaathakaviraaja. rxkuusuuchii.u oriental journal vol-1. 1111 pgs.. Linguistics. rxgveidasan'hitaa chaturthoo bhaaga.. Literature. 0. Language. 1056 pgs. Kunhan Raja. Linguistics. Language. Literature...... 64 pgs. 1969. Sanskrit. Literature. 0. Literature... 2002. krxshhnd-amoohan shaastri. saamaveidasan'hitaa aagneiyakaand-akamuu prathamoo bhaaga. Sanskrit. 644 pgs.. Sanskrit. shrii vai raamamuurtishrautii. rxvedavyaakhyaa bhaaga 2 ashtaka 1 adhyaaya 5 8. rxgveidasan'hitaa dvitiiyoo bhaaga. 1873.

Language. Language. 370 pgs. sabhaashhyarxksan'hitaayaa varnd-anukramasuuchii. Sanskrit.. Sanskrit.. saan'khyaakaarikaa. Linguistics.. Language. Literature. shriimatkalyaand-avarma. Linguistics. saaraavalii. sahityaratnakosh abhilekha sangrha. saarasvatavyaakarand-amuu. Sanskrit..s. Literature.. sachitra jyotishha-shiqs-aa. Linguistics... Religion.. Literature. Religion. 96 pgs. Language. Religion.. 310 pgs.. Sanskrit. Sanskrit. LINGUISTICS. Theology.. 1913. Literature. 1937. 194 pgs.v. shriisachchidaanandashivaabhinava. Guruswamy. 1908. saarasiddhaantakaumudii raakaa san'skrxta hndiivyaakhyaaya dvitiiya khand-d'a. Linguistics. Theology.. Language. 0. saang-kaadarshanamu.. naaraayand-a raama aachaarya. Not available.. kai pan' vishhnd-u naaraayand-a bhaatakhan'd'ei. Linguistics. 430 pgs. LITERATURE.. 0.. 62 pgs.. saayand-iiyargvedabhaashhyabhuumikaayaa vaadashiinaathii t'iikaa. saang-khachaayanagrxhyasang-graha. 140 pgs.. Literature. Literature. Sanskrit. Psychology. sahityaratnakosh pradama kand.. Language. Language. Sanskrit. 1992. Sanskrit.. Sanskrit.. Psychology. Literature. Literature. sahaavein' pustaka. 208 pgs.. Philosophy. Language. Not available. d'aa bii aar sharmaa. baabuu raamachandra. 327 pgs. Linguistics.. 1983. Sanskrit. Language. saambapuuraand-amu upapuraand-amu. 138 pgs. bhadhur chand chhabra. 0. saaravyaayanagrxhyasang-graga kaushhiitakigrxhyasuutrand-i. Linguistics. Sanskrit.. sachithra yogaasan. not Available. Language. t'haakura jyotishhaachaariyaa. Literature. Linguistics. sanskritdocuments. LANGUAGE. Sanskrit.. Sri Amalananda. Religion.2/14/2011 A list of scanned Sanskrit books at III… Linguistics. Linguistics.. sadaashivendrastuti. 476 pgs. 272 pgs. LANGUAGE. Sanskrit. Sanskrit.. 1973.. Sanskrit. Sanskrit. 0.. Language. Literature. brahmha charya raam... saamyavaada.. Sanskrit. Sanskrit.… 139/167 . shriivaasudevavidvadvara. 511 pgs. saata inakalaabii itavaar bhaaga tiisaraa. 572 pgs. Sanskrit. Language. laqs-and-a. 1907. 342 pgs. 1890.. T. saastradiipikaa.. saastradapend-amuu. Linguistics. shriipataraaya. 98 pgs. kausun'varavaastavyapand-d'itavara vaasudeva. saarasvatiikand-t'haabharand-amu. saaraavali kaantimati hindii vyaakhyaa sahitaa. 1908. saamavidhaana braahmanamuu.r. 1941. Language. Language... Language. 1966. Sanskrit.. Literature. 1919. LITERATURE. d'aa shriikrxshhnd-amand-i tripaat'hii. saariirakavyaaravyaaprasthaanaani. 0. Philosophy.. 266 pgs. pan' shriitrilokanaathamishra. 1939. Sanskrit. 414 pgs. saariirakanyaayasan'graha By Prakasatmayati. 222 pgs. Philosophy. Sanskrit. Linguistics. thibaut'a. 751 pgs. shriimatkalyaand-avarmaa. Sanskrit. Sanskrit.. Sanskrit.. 580 pgs.. Psychology... Linguistics. V. 208 pgs. vishva bhandu ed. ji. Linguistics. Literature. 252 pgs.chintamani. Theology. 1964. 1930.. Literature. 108 pgs. Linguistics. LINGUISTICS.. Literature.. Linguistics. shriimadvaradaraajaachaarya. 1906. 1989.org/…/SanskritIIIT... 164 pgs. Language. 202 pgs. Sanskrit.. Theology. Literature. Literature. 1916. 1942. Literature. Linguistics. 0.. 1940.

Literature. Sanskrit. Language. Language. shriiraamadaasabhupatiprand-itadhaa.. Language. Literature.. 644 pgs. 1896. LINGUISTICS. Linguistics.. Sanskrit. Sanskrit. Language. 1917. Linguistics. 1973. 75 pgs. Linguistics. Sanskrit..4. 1938.. Language.. 84 pgs. Literature. 1864. 460 pgs. Not available. 1897. Sanskrit. Literature.... Religion... jaiminii. Sanskrit. Psychology. raajen'dranaatha pan'd'ita. shriini shang-kashaang-giideva. 1930. krishnamacharya. Kasinath Sastri. Language. shrii vein'kat'anaatha. Social Sciences. Sanskrit. shrii a vi narasin'haachaarya.. Philosophy. Literature. Sanskrit.. Philosophy. samskruthapadamaala trutiiya kusumam. Linguistics. Literature.. Linguistics. shrii kuruganti veinkataramand-a shaastri. Linguistics. 1899. 82 pgs. Sanskrit g .org/…/SanskritIIIT.. samayasaara bhaaga 8. san'qs-epasaariirakamu vyaakhyaasamalang-krxtamu prathamobhaaga. 1948.2/14/2011 y p A list of scanned books gy at III… . Linguistics. Literature.. Sanskrit... krishand-amaachaari. Sanskrit.. Sanskrit. 417 pgs. 1936. shriinirang-kashaang-giideva. Linguistics. 1910. Sanskrit.. shriimatsarvagn-amuni. 820 pgs.. pg saitubandhamu. 1955... san'kalpasuuryodayanaat'akamuu Part I. Language. LITERATURE. Literature. 143 pgs. 1912. Literature. Literature. 1974. sakalapuraand-aabhyarhita shriibhaagavata dashamaskandha puurvaardhamu. Srirama Krishna... 1919. 202 pgs. san'giitaratnaakara etatpustakan' kalaanidhyaaravyat'iikaasan'valita. 110 pgs. Linguistics. Literature. Language. 600 pgs. san'qs-epashaarirakamuu with Thatvabhodini Part 3. Linguistics. Sanskrit.. Language. 1971. shri kunda kunda acharya. Linguistics. Psychology. Sanskrit. Language... 1953. Language. 855 pgs. Language. sam'skaararatnamaalaa Part Ii. Social Sciences.. Language... Language. 508 pgs. Sanskrit. vimand-d'alavakra. Sanskrit. 1899.v. Sarvajnatma Muni. Language. Mahamahopadhyaya. Linguistics. 490 pgs. 1948. mahaamahopaadhyaaya pan' raamashaastribhaagavataachaarya svaamii. sanskritdocuments. sakalaagama saara sang-graha shaiva aagama. Literature... Kasinath Sastri. san'kalpa suuryoodaya. Sanskrit. samraat'uu shubhaagamana.. samasyaasamajyaa. Linguistics. san'karshha kaand-d'amu shhod'ashaadhyaaya sheshhachaturadhyaayiisvaruupamu. sampaadhya prakaashataan' niita. adi sankaracharya.… 140/167 . Social Sciences. sam'skaararatnamaalaa Part I.. gangadhara krishna draavida. sam'skaaragand-apati Kandika Xii Of Kanda Ii.. Language. 296 pgs. Sanskrit. Sanskrit. Sanskrit. san'qs-epa shaarirakamuu Vol 2 Adhayas 2 . Literature.. 514 pgs. Sanskrit. Yajnika Srirama Krishna Sarma. Linguistics. sakhyakarikaa. Literature. 236 pgs.. Sanskrit. Theology. 194 pgs. 255 pgs.. san'giitaratnaakara kalaanidhyaaravyat'ikaa prathamo bhaaga. Sanskrit. LANGUAGE. sam'skaaradiipaka Part I. Linguistics.... Linguistics. 830 pgs.. Literature. samayochita padamaalika.. 250 pgs. Literature. 1895. samkalpa suryodaya part-2. Literature.. 0. sam'skaaragand-apati Fasciculas Vi and Vii. 48 pgs. Sri Ramnath Sastri Vaidye. 263 pgs.. 1937... 1932.

Language. Language. 0. 430 pgs. Literature. Sanskrit.. 1926. 498 pgs. 1950. Linguistics. san'skaaravidhi shhod'ashasan'skaarai... san'skrutakaadambarikathaa. Sanskrit. Theology. 432 pgs. Linguistics. isvara karikas. Sanskrit. sankaravijaya.. LITERATURE. 630 pgs. 0.. 0. 1954. miimaan'sakashriinilakand-t'habhat't'a. Literature.. 0. 340 pgs. Sanskrit. Language. shriiveng-kat'aramand-aaryend-a. 1965. Sanskrit. 370 pgs..… k it lf t h t2 d t l k L Li i ti Lit t S k it 1971 60 141/167 . 1947. Sanskrit. LANGUAGE. 100 pgs. Literature. 1984. Not available. suuryanaaraayand-a shaastri. Literature. savanjatma muni. Linguistics. Literature.. LINGUISTICS. Not available... Philosophy. Language. san'skrxtaan'dhranighan't'uvu. Psychology. Literature. Sanskrit. 858 pgs. Language. san'skruta saahitya itihaasan. sankhya karikas. a. Linguistics.. san'skrxta naat'aka udabhava aura vikaasa siddhaan'ta aura prayoga. Religion. Venkataramana Sastri. Linguistics. 127 pgs. 650 pgs. Linguistics.. san'skuuta kal'aapuurnd-odaya. san'skrxta vyaakarand-ashaastra kaa itihaasa prathamabhaaga. Not available. san'skrxta vyaakarand-a shaastra itihaasa trxtiiya bhaaga. 1934. 1934. Vijnana Bhikshu. 1977. 1941. Linguistics. Sanskrit. malliyan' raamaachaaryasuununaa. Pandit Sri Rama Krishna. 0... 1959. Language. san'skrutaavataaran. Language. 292 pgs. Sanskrit. san'skrxta vyaakarand-a shaastra kaa itihaasa dvitiiyabhaaga.. Literature.. Literature. anjinyea murthi. Sanskrit. sanaatana vign-aana samudaya.. 1933. 1958. Sanskrit. Language.. Literature.. 528 pgs. 248 pgs. Linguistics. Linguistics. san'skaaramayuukha ekaadasha. Language.. Religion. Sanskrit. 338 pgs. 48 pgs. Linguistics.. Sanskrit. Literature. vyasacala. sanskrit pravaahini shabd kosh. Literature. Language. 1913.. sankshepa sarirpaka. sanskritdocuments. Philosophy.. 308 pgs. Language. san'qs-epashaarirakamuu with Thatvabhodini Part 4. 1979. Linguistics. Sanskrit. Theology. sanshipt mahabharath dritya kand.. san'skrxta kavi jiivitamu.. sangeethgnan ke sansmar. 126 pgs. General. Literature..2/14/2011 A list of scanned Sanskrit books at III… Sanskrit. Sarvajnatma Muni.. shriisholataataachaayaind-a.. Sanskrit. Literature. Linguistics. 76 pgs. Philosophy. san'skaaragand-apati. berriedale keith. Sanskrit. sankhya sara. 1939... 68 pgs. Sanskrit.. vyasa. Sanskrit. yagn-adatta. 1946. 264 pgs. 1955. Not available... 439 pgs.org/…/SanskritIIIT.. Language. 172 pgs... Linguistics. Sanskrit.. Sanskrit.. san'skrxtadvitiiyapaat'ha san'skrxtabhaashhaayaan' san'bhaashhand-ashiqs-aka. 86 pgs.. 770 pgs. san'skrxta saahitya men' saadrxshyamuulaka alan'kaaron' kaa vikaasa... d'aa brahmaananda sharmaa. 274 pgs. Language. Language... not availabe. Psychology.. sang-aameshar krodamu. san'qs-epashaarirakamuu with Thatvabhodini Part 5.. 1996. Sanskrit... 1938. Sanskrit. vilayat hussian khan.. Literature. Sarvajnatma Muni. yam. Sanskrit. Sanskrit. 1884. 1956. mallikaarjuna raavu. Linguistics. Sanskrit. Psychology. Literature.. Sanskrit. Literature. Linguistics. Language. Language. 522 pgs. Literature. Neelakanta Shankar. Linguistics. Literature. The Arts.... 183 pgs.

. sarakaara tumhaarii aan'khon'men'. LANGUAGE. paand'eya bechana sharma. -. Linguistics. Literature. Language.2/14/2011 A list of scanned Sanskrit books at III… sanskrit self teacher part 2.. Sanskrit... 130 pgs. Language. Language. 60 pgs. LITERATURE.. 1962.… 142/167 . 724 pgs. Literature. Literature.. 1927... sarvadarshanasan'graha prasthaanabhedashcha. 537 pgs. Sanskrit... LINGUISTICS. Sanskrit. 88 pgs. Sanskrit. Literature. sarangadhara samhita. Linguistics. Psychology. 930 pgs.. Literature. 1965. Language. 150 pgs. Sanskrit. Sankara Sastri Marulkar. 426 pgs. Literature. bhiqs-ugauriishang-karend-a. Linguistics. 1971. Language. satyashhaad'havirachitan' shootasuutran. Language. 1937. Linguistics. 438 pgs. Not available. 1927. 0. Biography.. Literature. 1912. -. Linguistics. Linguistics. Unknown. Sankara Sastri Marulkar. sri sarangadhara acharya.. 52 pgs.. Sanskrit.. Linguistics. sarvaveidaan'tha sidhaan'ta saara san'graham. 0... arya bhadanta asvaghosa. 150 pgs.. Literature. Literature. Literature. Sanskrit. saundarananda kaavya. Linguistics. satyaashhaad'haavirachitan'shrotasuutran' panchchadashashhod'ashaprashraatmaka shhashht'amo bhaaga. Sanskrit. Not Avaliable. Shankara Sastri Marulkar. LANGUAGE... Language. Not Available. Literature. s d satwalekar. Literature. 162 pgs. -. 1908.. -. saral sanskrit shikshak bhag 4. Literature.. satyaashhaad'haavirachitan'shrotasuutran' saptadashaashht'adashaa prashraatmaka saptamo bhaaga. 396 pgs. Psychology. Linguistics.... Sanskrit. Sanskrit. 62 pgs. 1997. Not Available. Literature.. 1927.. Language.. Language. Literature. shriiprataaparudramahaadevamahaaraaja. History. sarala kahaaniyan' bhaaga 2. Sanskrit. Sanskrit. Sanskrit. Language. 394 pgs. 60 pgs. 60 pgs.. Language.. Linguistics. 155 pgs. sapal jiivan ki mahatvapoorn gatnaaye. Geography..... Sanskrit..chennareddy. LINGUISTICS. sarasvatiivilaasa vyavahaarakaand-d'a. m.. saral sanskrit sikshak baag 8. satyaashhaad'haavirachitan' shrotasuutran' tatraas-s. Literature. Linguistics. harinaaraayand-a aapt'e. 1942.. 0.. satyaashhaad'haavirachitan'shrotasuutran' dashamo bhaaga. Language. 1970. Sanskrit. satyaartha prakaasha. Sanskrit. Language. sanskritdocuments. satyaashhaad'haavirachitan'shrotasuutran' ekaadashaadichatudeshaantaprashraatmaka panchchamo bhaaga. 1928. Literature. 1907. Sanskrit. -. Sanskrit.. Language. Sri Kasinatha Sastri Ahhore. 0.. LANGUAGE. Sanskrit.. Language.. 0. 600 pgs. Sri Shankaracharya. mahtma gandhi.. satapathabrahmana. Not available. 204 pgs.. 308 pgs. Language. 1994.. 0. 372 pgs.. Linguistics. Philosophy... 166 pgs. Sanskrit. Literature. Sanskrit. Philosophy. 1939. LITERATURE. Linguistics. Language. jayantkrishna h dave. 222 pgs. Sanskrit. Linguistics. sarvalaqs-and-asang-graha hitachintaka. LINGUISTICS. Linguistics. Language. 1928. shriimanmaadhavaachaarya. satyaatheprakaasha. LITERATURE.. 202 pgs. Vacant. Sanskrit. satya shodhanam.. Linguistics. Linguistics. 1932. saral sanskrit shikshak bagh 2. 468 pgs. Linguistics. 0. 0. Sanskrit. sat'iikaamarakoshasya. saral sanskrit bala bhodh.. Linguistics. sarvavedaanta siddhantasaarasan'graha.. 1965.. santhrajshakunam.. Sanskrit. Shankara Sastri Marulkar. Literature. Sanskrit.org/…/SanskritIIIT. Language. Sanskrit.dhaprashratrayaatmaka prathamo bhaaga. 60 pgs.

shrii shriisachchidaanandendrasarasvatii. shaastradiipikaa. Not available. Philosophy. 1896. 1935. 1921. Sanskrit. 320 pgs. 1974. 0. Sanskrit. Language. 1913. Language. Social Sciences... Sanskrit. shaan'karapaadabhuushhand-amuu. sri shankaraacharya.. 51 pgs. 0. Sanskrit. Language. Sri Radhanath Suri. sanskritdocuments. shaastradarpand-amuu. 1917. Language. 1937.. LINGUISTICS. 141 pgs.. 296 pgs. 238 pgs. Linguistics.. sautasuutramu san'kalitaprayokachandrikaa. 510 pgs.. shaang-karn' vedaantamiimaan'saabhaashhyamuu kramaang-ka 1. Sanskrit.. 356 pgs. savyaakhyonind-aiyasindhoo pradhaman' parichchodan. Literature. shriimadden'kat'anaatha vedaantadeshikulu.. shaastrasiddhaantaleshasan'graha. Sanskrit.. Sanskrit.... Sanskrit. Language. Somanatha. Linguistics. 394 pgs. 476 pgs. LITERATURE. 294 pgs. Linguistics.. Language. Theology.. 563 pgs. Linguistics. Language. 2258 pgs. 1969... Literature. Literature. Sanskrit. 1915. Sanskrit. Linguistics... Language... 240 pgs. shaarirakanyaayasadgagrahan' pradhamodhyaayan. Not Available. Not Available. Literature. 1938. Language. Appaya Dikshita. Sanskrit. LANGUAGE. Sanskrit. shriimadven'kat'anaatha vedaantadeshika. .. 0. shabdakaustubha Vol II. Linguistics. Not available... 1982. 1822. 1992. shaastradiipikaa. shaastrasiddhantaleshaasan'graha of Appaya Dikshita. gand-apati. Sanskrit.. Literature.. 560 pgs. Psychology. shaatpit'akamu. Sanskrit. Linguistics. Sanskrit. Philosophy.. Sanskrit. mahaakaal'isubbaaraaya. Literature. 400 pgs.. 98 pgs. 383 pgs. vyaasa.. Sanskrit. Sanskrit. Linguistics. Religion. 1933. Language. 1074 pgs. Literature.… shabdashaktiprakaashikaa shriijagadosha takailadkaara Language Linguistics Literature Sanskrit 143/167 .. Linguistics. LANGUAGE. Sri Venkatraman. 1052 pgs. LITERATURE... shaastrarambhasamarthanamu. 1971. LANGUAGE. savesamavrxttaprabhaava. Literature. 1281 pgs. Literature. Language. Linguistics.. satyashhaad'ha. LINGUISTICS.. bhagavadamalaananda. 1971. Literature... shabdaarthachan'drika aan'dhranighan't'uvu.org/…/SanskritIIIT. Sanskrit. shabdakaustubha trxtiiyobhaaga. Psychology. Linguistics. shriimadabhat't'ojiidiiqs-ita.. 1913. Psychology. seshvaramiimaan'saa miimaan'saapaaduke miimaan'saapaadukaa parittraand-amu. sevantikaaparind-ayamuu. LINGUISTICS. Theology. Lokesh Chandra. Literature. Linguistics. shaastradarpand-amu. bhat't'ojiidiiqs-ita... Language. Literature. shaastramuktaval'ii.. 152 pgs. Religion. Philosophy. Sanskrit. saurapuraand-a. Sanskrit. shabdakaustubhe. Sanskrit. seshvaramiimaan'sa miimaan'saapaaduke. 386 pgs. Linguistics. 0. 1930... Literature. gn-aastradarpand-amu. Not available. 0. 414 pgs. pat't'abhirama. Language. 174 pgs. Linguistics. 1924.. Language.2/14/2011 A list of scanned Sanskrit books at III… saundaryalahari bhaavanopanishad devi panchastavi vyakhyaaya sahita... Linguistics. Literature.. shaastrashuddhapan'chaan'ga ayanaan'sha nirnd-aya. Language.. Sanskrit. Sanskrit. LITERATURE.. 0. Linguistics.. laqs-mand-a shaastri. 307 pgs.. Language. Literature. Literature. Sanskrit.

Language. 421 pgs. 186 pgs. Linguistics. Sanskrit. 194 pgs.. shhad'ashiiti. Linguistics. 1929. Sri Gadadhara Bhattacharya.. Sanskrit. Sanskrit. Philosophy.. Not Available.. shrii sridahara venkateshakrutha. Literature.. 334 pgs. 0. 1956. 104 pgs. 260 pgs. Language. Language. 124 pgs. Literature. 100 pgs.. 226 pgs. Linguistics. appayya diiqs-ita. shiddhitaryamuu. shishhyadhiivrxddhidamu vivarand-a. Sanskrit. Literature. 1951. Sanskrit. shaindravilasa. shatapathabraahaand-a Part 3. aanandagiri. 182 pgs. Literature. Religion. 218 pgs. shriijagadosha takailadkaara. Linguistics.. Sanskrit. 68 pgs. Literature. 90 pgs. 188 pgs. Sanskrit.. Language. 0. shishupaalavadhamuu. Linguistics.venkata Raghavacharya. Linguistics. Literature. shriimadiishvarapratyavitgnakacharyachakravarthi. Linguistics. Language.. shatapathabraahaand-a Part 5.2/14/2011 A list of scanned Sanskrit books at III… shabdashaktiprakaashikaa.… hi t ttik bh k R li i Th l S k it 1970 210 144/167 .. shivastotraavalii. shiroomand-iikutadiidhitya anumitigrantha... Sanskrit. Sanskrit. Linguistics.. shivasan'hitaa. shabdashittkprakaashikaa. shiqs-aamanovinj-aanamu. Sri Barthruhari. Sri Uttamur Viraraghavacharya. Linguistics. Sanskrit. khemaraja shriikrxshnd-adaasa. Sanskrit. V. shriilallaachaarya. 567 pgs. Language... Literature. Sanskrit. jagadiish. 0. 1340 pgs. Language. Literature. sanskritdocuments. 185 pgs... shevan'tikaaparind-aya naat'akamu. Sanskrit.. Sri Yamuna Muni. Philosophy.. Literature. Literature. Linguistics.. 1927. Theology.. shabdendusudhaa. A Sreeenivasa Iyengar. Sanskrit. Language.. 1956. aadityaachaarya. Literature. Psychology. Sanskrit. Religion. 1935.. 249 pgs... 1981. Religion. 1973.. 1961. shattlivaada. shrii chokkaanaatha. 1904. 29 pgs. Sanskrit. pan' raamalochanashaastrii. shhrii aniirud'ha samn'hita. 484 pgs. 1900. Linguistics. shang-karavijaya. Sanskrit.. 1960.. 1971. Sanskrit. Language. khemaraaja shriikrxshhnd-adaasane shreshht'inaa... Language. not available..org/…/SanskritIIIT.. shhood'asa raamaayand-a san'grah a. Theology. Sanskrit.. Sanskrit. Sanskrit.s. Literature. Philosophy.. shabdashakttiprakaashikaa krxshhnd-akaanti t'ikayaa prabodhinii vyaakhyaaya tippand-yaa. shatakataryam shrii bhatrxharivitachitam.. Motilal Sharma Bradwaj. shaktivaada manjusha vivrxtti vinoodhini. 264 pgs. shivaadvaita nirnd-ya. S N Sriramadesikan. Sanskrit. Language.... shhrii an'daal tiruppavai.. 148 pgs.. Linguistics. shishht'aprayegasn'graha. Psychology.. 1984. 0. Literature. Sanskrit. shriimajjagadiishatarkaalang-kaarabhat't'aachaarya... 0. Literature. 169 pgs. Language. Philosophy. Language. 1911.. Narasimhacharya. 1825.. 239 pgs. Language. Literature.. Language.. Linguistics. Language. shhrii vishnusahasranama. Sanskrit. Literature. Literature.. Psychology. Language. Linguistics.. Psychology. 1947. Literature. Literature.. 1952. Linguistics. 240 pgs. Linguistics. 1958. Sanskrit.. 1881. 1927. shrii dattakasuunumahaakavi shriimaaghaprand-iitan. Linguistics. Linguistics. 386 pgs. Linguistics. Sanskrit. Language.. sri gadadhara bhattacharya. Language.

0.2/14/2011 A list of scanned Sanskrit books at III… shivasuutravaarttikamu. 176 pgs. shrii harikathamrutham. shrii ramakrishna maha kavayam. Literature.. aar krxshhnd-asvaami ayyar. Venkata Raman. Literature. Linguistics. Sanskrit. Theology. Sanskrit. Theology. The Arts. Language. 1939. shlokavaar^tikat'iikaa shar^karikaa. Linguistics. shrii prabhudev vachanamrut. s. shrii guruvaayupureishvara. Linguistics. Linguistics. Language. 1956. Rangaswamy. Sanskrit. Linguistics.. 0.. 64 pgs.. 1920.. Literature. 253 pgs. 210 pgs. shrii bhaaskaroodaya. Theology. sethumadhavaacharya. shraaddhamayuukha chaturtha. 212 pgs. Language. shrii mahaabhaaratamuu. 616 pgs. 200 pgs. Language. Literature... Religion. Sri Bhattaputra Jayamishra. 1970. Linguistics. 528 pgs.. Linguistics. shrii phakkika ratna manjusha. Not available. 256 pgs. Literature. Sanskrit. 322 pgs. Language. Psychology.. amrxtaanandayogivaryand-a. 1942. 1968. Linguistics. Not available. 99 pgs... shrautasuutramu devayaagn-ikapaddhati. Sanskrit. shrii raamakrishnavachanaamruth.. Sanskrit. san'patkumaar. Literature. Linguistics. 1955. Sanskrit. Sanskrit.. 300 pgs.. Language.. ramtej pandeyan.. 34 pgs.. Sanskrit.. 0. The Arts. shivatatvaratnaakara. 1959. 232 pgs.. 77 pgs...org/…/SanskritIIIT. Linguistics. shrauta sutras and prayogas. 96 pgs... shrii raajaratnakaamaachampuu. Sanskrit... ramaswami shastri. shrii dgargaachaaryasan'hitaa dashakhand-d'atmikaa mahaatmyasametaa.. Linguistics. Linguistics. Sanskrit. Linguistics. Language. Sanskrit. shri deisikaashatakamu. Philosophy. Literature. Sanskrit. Literature.. 1939. Language. Literature. 0. madhuravaand-i. Language.. shrii hanumat shahastri naamaan'jali. Sanskrit. 1946. Linguistics. Religion. Sanskrit. Sanskrit. Sanskrit. Sanskrit. shrii raamaayand-aasaar kaavya tilakamu.. narayanadasa adi bhatta. shraadvakaand-ad'amu chatutho bhaagan. shriimanmaharshhikaatyaayana. shri vyaasa paanini bhavanirnaya. bhaaskaraa. sanskritdocuments. Sanskrit. Language. 421 pgs. Literature. Religion. 530 pgs. Language. Sanskrit. Linguistics. 1942. 1927.v.. 266 pgs... styanarayana raju.. Religion. 1972. shrii paanj-charaatre mahoopanipadi utsava san'graha prathama bhaaga. 500 pgs. Literature. Literature.. Sanskrit. narayanadasa adi bhatta. s. shivatatva ratnakaramu. not availabe.. 242 pgs. K. Language.. ramarayakavi bellamkonda. Linguistics. 1960. Language. shrii harikathamrutham.. 244 pgs. suryakant tripathi. Sanskrit.. 0. Sanskrit. Theology.r. shriiniilakand-t'habhat't'a. 475 pgs. Language. Sri Pasupathi Sastri.. Literature. Sanskrit. Literature.. Literature. shivavilaasakaavyamuu.… 145/167 . 0. Linguistics. Not avilable. 1933. Sanskrit. Sanskrit. 132 pgs. 0. K. Theology. 566 pgs.. Language. ubhayabhaashhaasanaatha dvibhaashhi somanaatha. 1972.. Language. k... Literature. Language... Religion. 188 pgs. Literature. 1962. 1950. gopinath kaviraj. Linguistics. 1946. Language. 0.. not available. 104 pgs. Literature....... shrii krishna leela tarangini. daamoodara. shonakiiyamn' rxgaveda pratishaakhayamn. Literature. Language.. Sanskrit. Linguistics.

shriibhagavannaamakaumudii miimaan'saa prakaashat'ikayaa sahitaa. Language.. shriibhagavadraamaanuja. shriivaasudevaanandasarasvatiit'en'besvaami. 145 pgs. Literature. 266 pgs. 1917.. 170 pgs. Sri Padmaprasad Sastri.. 727 pgs. bhagiirathaatmajena. shriiyuta raa raa mootiilaala ravishan'kara ghood'aa. 240 pgs. madhuravani.. 0. Linguistics. shrii vyaasa panni bhavanaaraayand-a. shrii yatipativaibhavadiipikaa cha. Language. 564 pgs.. Religion. Literature. 1989. Sanskrit. Literature. Language.. 1922. Sanskrit.. shriigautamamuniprand-iitanyaayasuutraand-i. 1943. shrii sitarmayanam. 448 pgs. 234 pgs. Linguistics. 0. Sanskrit. shriibhaashhyamuu.... 1974. Religion.. Language. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… shrii ramayanasaar kaatha tilakamu. Sanskrit. Sanskrit. 1926. Religion. shriibhuvaneshvariimahaastotramu. 222 pgs.. Sanskrit. 746 pgs. shrii vimaanaa charna kalp. Theology.. Linguistics. sii ema paadmanaabhaachaarya.. 735 pgs. Sanskrit.. Linguistics. Literature. Linguistics. Linguistics. Linguistics. 186 pgs. Sanskrit. Language. Sanskrit. 416 pgs. Theology. Sanskrit. Theology.. Literature.org/…/SanskritIIIT. Linguistics. 255 pgs.. Sanskrit. shrii rxgyaju shaavri vaishhnd-avaanaan' brahmakarma.. Language.... Sanskrit. shrii keshri kant sharma.. shriicharakasan'hitaa taatparyetyaparaparyaaya aayurvedadipikaakhya vyaakhyaaya samalang-krxtaa prathamavrxtti. aar ran'garaamaanuja ayyan'gaaru bi ye yal t'i. esa anantaachaaryand-a. Language.. 0. Language. shriilaqs-miidhara. Not available.... 1944. Language.. Literature. shriibhagavadraamaanuja. 1926. 1989. Literature. Language. Sanskrit. Not available. shrii venkatachalamahatyam. bellamkonda ramaraya kavi.. 1984.. shriigautamamuniprand-iitan' nyaayadar^shanan. Language. Language. yas seitumaadavaachaarya. 1989. 0. shriibhagavadbhakttirasaayanamu t'ikayaa premaprapayaa. Sanskrit. Linguistics. shrii shaang-akhaayana grxhyasuutra. Sanskrit. 478 pgs.. Psychology.. 222 pgs. Sanskrit... shrii shankara shankara bhasya vimarsha. Theology.. Literature. shriigitaa bhaavachandrikaa.. Theology. shriigiitaagovindakaavyamu. 159 pgs. shrii vishhnd-uchitiiyamuu.. Literature. Linguistics.… shriigurucharitamu dvisaahastrii sat'iikamu sachuurnd ikan'cha shriivaasudevaanandasarasvatii 146/167 .. Philosophy. tyagaraja. shriibhaashhyamuu shrutaprakaashikaaravya. shriimachchrakachaturaanana shriichakrapaand-idatta. 1954. 74 pgs.. Sanskrit. Literature. Language. Religion. 1947. 1942. sanskritdocuments. Literature. Literature.... Literature.. 111 pgs. shrii kun't'imahi sheshhasharma. Sanskrit. Language. shriiprxthviidharaachaarya. Religion. General.. Language. Linguistics. 690 pgs. Literature. 856 pgs. Sanskrit. vinaayaka gand-esha aapat'e. Language. Sanskrit. Sanskrit.. shriimadhusuudanasarasvatii. Lakshmana Suri. Literature. Linguistics.. Linguistics. shriigiitaasvaamivijaya. Linguistics. Literature. 1948. 1954. Sanskrit. 1972. Linguistics... Literature. 1362 pgs. Sanskrit. 1922. -. 286 pgs. shriidattapuraand-amu sat'iikamu.. 210 pgs. 0. shriibhagavatpaadaabhyudayamu. 1960. shrii tyaagaraaja shatavaarshhika smrxti gran'thaaval'i 1947. Sanskrit.

Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… shriigurucharitamu dvisaahastrii sat iikamu sachuurnd-ikan cha.. Language.. Sanskrit.. Not available. Sanskrit. Theology. 1985. Language. shriimadavaalmiikiraamaayand-amu saralagadyatmakam. shriikand-t'hacharitamu t'iikayaa. Linguistics.. shriimadbhagavadgiitaa. Language. 1953. Literature. 26 pgs. 274 pgs.. maagad'i shriiveng-kaachaarya. 1923. maharshhi vedavyaasa. Theology. Literature.. Sanskrit. moot'e aqs-aravaalii.. Linguistics. Theology. Language.. shriimatpuujya shang-kara bhagavatpaadaachaarya. Linguistics. si . Sri Rajagopal Shastri. Sanskrit. 768 pgs.. Sanskrit. Literature. Sanskrit. Literature. shriimadbhagavadagiigaa. Linguistics. 492 pgs. Literature. Not available. Sanskrit... Linguistics. kedaaranatha. 0. Linguistics. 0. 397 pgs.. shriimadbhagavadgiitaa. Sanskrit. 590 pgs. kaaluuri hanumantaraavu. 1942. Philosophy.. 1983. Literature. 0. LITERATURE. Language... 1923. Not available. shriimabrahmasuutrand-i saadhanaadhyaaya. Religion... Psychology. Literature. Sanskrit. 480 pgs. shriimadbhagavadgiitaa bha t't'aatmajasham'karashaastrind-aa sam'shodhitam. sukumaara kavi. 62 pgs. Language. Literature.. shriimadbhagavadgiita san'put'a 2 ( 10 rin'da 19 adhyaayagal'u ). 0.. 1997. 467 pgs. Literature. 0. Theology. shriimadbhaashhyat'iikaabhaavadiipedditiiyaadhyaaya.. Sanskrit.. shriimadbhagavadgiitaa.. shriimadanuvyaaravyaanan. 610 pgs.. Sanskrit. 114 pgs. shriilokaprakaashan' dhvitiya bhaagan. shriikushhnd-avilaasakaavyamu. Language.. Language. 1958. 0. 1997. 1935. Literature. Literature. Language. Linguistics. Sanskrit. shriimadamarasin'havirachitei. Literature. .. Literature. Literature. Theology. shriimadbhaagaravamu pan'chama khand-d'a. 1921. LANGUAGE. Linguistics. Linguistics. Sri Madramanujacharya. Language. Linguistics. Linguistics... Not available.. Literature.. pand-d'itaratna rayapaalya raaghavendraachaarya. hayavadanaravuu. Sanskrit.. Sanskrit. Language. Linguistics. Linguistics. Sanskrit. 1110 pgs... 599 pgs. Language. Sanskrit. Sanskrit. shriimadadvaita siddhaanta krama prasthaanatraya bhaashhyaanusarend-a.. shriilokaprakaashan. Language. 1946... shriikoshha. 317 pgs. Sanskrit. GENERALITIES. 1954. kapaali shaatri. 0. Religion. 279 pgs. Sanskrit. shriimadvallabhaachaarya. Literature. Language. LINGUISTICS. shriilalitaasahasranaamastootramu.org/…/SanskritIIIT. Sanskrit.. Language. 601 pgs.… h ii dbh d iit bh hh kh b dhi ii d'h th t tt l k 147/167 . 1902. 330 pgs. Language. 156 pgs. shriiharivan'shachampu... 284 pgs. Linguistics. maharshhipravara shriikrxshhnd-aadvaipaayana.. 748 pgs. sanskritdocuments. . Not available. Linguistics.. Sanskrit... 166 pgs. 1928. shriimadbhagavadgiitaa. 614 pgs. Language. shriimadbhaagavatamahaapuraand-amu muulamaatramu. Sanskrit. shriikarabhaashhyamuu. Sanskrit. shriivaasudevaanandasarasvatii. 67 pgs.. shriimadaand-ubhaashhyamu. Religion. shriimaatrxtattvaprakaasha.. 1987. Linguistics. Linguistics... 2004. 120 pgs. shriikand-t'hacharitamu t'iikayaa.. Religion.. shriimadraamaanujaachaarya. Linguistics. Language. Literature. Not Available. Literature. 1997. shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru. 570 pgs. Religion. 233 pgs..... Sanskrit. 1936. Sanskrit.

Sanskrit. Linguistics... 1827. 1887. Language.. shriimadbrahmasuutratadaabhaashhya trxtiiyaadhyaaya. Sanskrit.. Sanskrit. Not Available.. Linguistics. 346 pgs. shriimachchhaang-kara. Sanskrit... Sanskrit. Sanskrit. Language. Language. Philosophy. 1941. Theology.. shriimadbhrahmasuutraand-i saadhanaadyaya.. Sanskrit. Sanskrit. Sri Valmiki. Literature.. Language. 1911. Linguistics. Vadiraja. Linguistics. Theology.. 449 pgs. 130 pgs.. Religion.. Linguistics. Language. Sri Brahma Yogin. 0.. shriimadvalmiikiraamaayand-amu prathamoo bhaaga. Literature. vidvaanu a san'patkumaaraachaarya. shriimadbhagavadgiitaa shriimachchhang-karabhaashhyayutaa.. 144 pgs. Linguistics. shriimaddeidaantadeishika granthamaalaayaan. Language. Linguistics. shriijakannatha. Theology. 1940... Language. 949 pgs. 1834. Literature.. 202 pgs. Religion.. Not available. Language. Literature. Literature. Language. 353 pgs. Theology. Religion. shriimadbhagavata pan'chama skan'dha. shriimadvalmiikiraamaayand-amuu yuddakaand-d'amu 6. Sanskrit.. Sanskrit. sanskritdocuments. shriimaddeidaantadeishikagranthamaalaayaan. Not available.. shriimadgand-eshagiitaa. Linguistics. Not available. Language.. Not available. 0.. Sanskrit. Theology..… shriimadveidaantadeishikagranthamaalaa shrii kan'chi pi bi annangaraachaaryaara Language 148/167 .. 1955. Religion. Sanskrit. Literature. Religion.. Linguistics. 392 pgs. 270 pgs.. shriimadbhahmasuutraand-i saadhanaadhyaaya. shriimadragavadraitaa. 958 pgs. shriijagannadthaya. Linguistics. 1903.. 338 pgs. 0. 309 pgs. shriimadvalmiikiraamaayand-ama arand-yakaand-d'a. 420 pgs. 0. Theology. Literature.. Sanskrit. 591 pgs. shriimadbhagavadgiitaa gn-aanakarmasamuchchayaakhyayaa vyaakhyayaa samaln'krxtaa.. Sanskrit. 1917. aanandavardhana.. Language. 155 pgs. Theology. Linguistics.. Literature. viddaanu a san'patkumaaraachaarya. Sanskrit. Sanskrit.. t'ii aara krxshhnd-achaaryand-a.. Religion. 1834. Literature. Sri Valmiki. 807 pgs... Language. 1912. Sanskrit. bala gangadhara tilak. Language. yadupatii. shriimadbhahavadgiitaas-r^thaprakaashikaa.. shriimadbhraahmasuutraand-i samanvayaadhyaaya. Sanskrit. shriimadvalmiikiraamaayand-ama~ ayodhyaakaand-d'a Part I. 782 pgs. 1926. Sanskrit. Sanskrit... 1941. 1964. Literature. Psychology. shriimadvalmiikiraamaayand-ama~ uttarakaand-d'a~.. shriimadbhagavatamu ashht'ama skn'dha. shriimadbhagavatgiitaa. t'ii aar krxshhnd-aachaarya. shriimadvadiraajiiyagrandamaalikaayaan' ashht'aman. Literature.. Sanskrit. shriimadvalmiikiraamaayand-amu yuddakaand-amuu 6. 783 pgs.. Sanskrit. 273 pgs. 170 pgs. Language.. Literature. 476 pgs. 0.. Literature. 386 pgs. 1941.org/…/SanskritIIIT. vidvaan a san'patkrxmaaraachaarya. shriimadbhagavadgiitaa dvitiiyyashhat'kamu. Literature.. 1917. Linguistics. Linguistics.. Literature. Language. shriimadveidaantadeishikagran'thamaalaa. t'ii aar krxshhnd-aachaarya.. shriijagannathayatii. harinaaraayand-a aapat'e.. 324 pgs. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… shriimadbhagavadgiitaa bhaashhya vyaakhyaaya subodhinii guud'haarthatattvalokan. Sanskrit. Sanskrit. Philosophy. aanandagiri. Religion. 492 pgs. 1965. 0. Linguistics. 0.

. Not available. Theology. Theology. 86 pgs. 1911. shriimadvishhnd-utattvavinirnd-aya. Sanskrit.. Sanskrit. Sanskrit.. Religion. shriimanmahaabhaaratamu... shriimahaabhaaratamutoojeirina 1901. 368 pgs. 1951. Sanskrit. 215 pgs. Language. 1901. Religion. Theology. Literature. 0. Language. Language. 238 pgs. 1941. Not Available. Literature. Literature. 727 pgs. Theology. Sanskrit. Not available.. Sanskrit.. 200 pgs. 1932.. Sanskrit. P. sanskritdocuments.. shriimanmantraarthamanj-jarii. Sanskrit. Linguistics.. 225 pgs. shriimadviddyapayonidhitiirtha shriipaa. 251 pgs.. Theology. Sanskrit. Not available. Maharshi Vedavyasa. 1846. 1811. shriiman mahaabhaaratamu vishhayaanukramand-i. shriimahaalaqs-myupaaravyaana. Literature. 1909.. Literature. Not available. Sanskrit. Theology. shriimana nyaayasudhaa... Linguistics. P. 538 pgs. Linguistics. Sanskrit. shrii kan chi pi bi annangaraachaaryaara. Literature. shriimahaabaarataantargata shriimadbhagavadgiitaa dvitiiyyashhat'kamu. Literature. shriiman mahaabhaaratamu anushaasanaparva 13. shriimajjeiminiiprand-iite mimaan'sadarshind-i. 0. shriimahaabhaaratamuu drond-aparvamu. 1907.… 149/167 . shriimanmahaabhaarahamu. Literature.. Not available.. Sanskrit. 0. Language. pan' jvaalaaprasaadajii sharma. 508 pgs.. Religion. 0. Linguistics. Language. Sanskrit. Not available.. t r krishnaacharya. Linguistics. Language. shriimata jayatiirtha.. Language. 860 pgs. Religion. Language. vinaayaka gand-esh. 1940. Not available. shriimahaabhaaratamu shaan'tiparvamu. Literature.. Language. Subramanya Sastri. 431 pgs... Religion... 0. Sanskrit.. shriimallalitaraamacharitramu baalakaand-d'an' sat'iikamu. shriiman mahaabhaaratamu upoodghaatamu.. Theology.. Sanskrit. Religion. Literature. shriijaanakiivallabha. 540 pgs.. 1832. Sanskrit. 1914. t'ii. shriimanmaharaaja san'skrxta mahaapaat'hashaalaa patrikaa.. Sanskrit... shriimahaabhaaratamu shaan'tiparvamu.. 0.. Linguistics. Language. 842 pgs. Sanskrit.org/…/SanskritIIIT. shriimanmahaabhaaratama~ anushaasanar^vand-i. Religion.. Language. Linguistics. 1912. shriimanmahaabhaaratama~ bhiishhmapar^va. shriimaggavth kapila githa. Literature.2/14/2011 A list of scanned Sanskrit books at III… shriimadveidaantadeishikagranthamaalaa.. 716 pgs.. shriikaanj-chi prativaadibhayang-kara and-ndan'garaachaarya. Language.. Sanskrit... 822 pgs.. 0.. shriimaath kapilananda swamy. Not available. Language. Religion. Sanskrit. Linguistics. 1934. 310 pgs. Linguistics. Theology. Not available.. Literature. Religion. 276 pgs. shriimadveidaantadeshikagranthamaalaa.. Sanskrit. Theology. Language. Not Available. 207 pgs. 0. Sanskrit. shrii a vi narasin'haachaarya.. aara krxshhnd-aachaaryan. Religion. Linguistics. Literature. 0. shriimanmantrarthamanj-jarthaa. Sanskrit. 722 pgs. shriimanmahaabhaaratamu udyoogaparvamu. 262 pgs.. Linguistics. Linguistics. 419 pgs.. Theology. Religion. Theology. yer'r'aapreggad'a rachiyin'chinadi. Sanskrit.. 1905. 292 pgs. t r krishnaachaarya.. Linguistics.. 341 pgs. Sanskrit. Linguistics.. Literature. 0. 789 pgs.

. shriimanu nyaayasudhaa prathamoobhaaga.. 244 pgs. 1942. Linguistics.. 1986. 0... Sanskrit. Linguistics. RELIGION. Language.. 408 pgs.org/…/SanskritIIIT. Literature... dvibhaashhi somanaatha... shriimatuu saathand-aachray. Sanskrit. LINGUISTICS. Language.. Linguistics. Linguistics. sanskritdocuments. Language. Language.. 1956. shriipaadukaasahasramu muulamaatramu. 1100 pgs.. Religion. Linguistics... 1968. Not Availble. Literature.. shriimatsanatsujaatiyamuu kramaang-ka 8. 411 pgs. 617 pgs. not availabe.. 0.. 267 pgs. 1929. shriimannyaayasudhaaparimal'e dvitiiyadhyaaya prathamapaada. Sanskrit. Dwaita Philosophy. Psychology. n ramaswamy iyer. 1930. LITERATURE. Linguistics. Literature. 1829. . Linguistics. Sanskrit. khemaraaja shriikrxshhnd-adaasa. Sri Raghvendra Swami. Linguistics. Not available. 0. Religion. Language. Not available... shriipanj-charaatraraqs-aa paanj-charaatragamasya.. 1960. Language. Not available. Literature. shriimanyaamutan. 248 pgs.… 150/167 . shriimannyaayasuudhaa sheshhavaakyaarthachan'drikaat'ippand-i.. 101 pgs. shriiraamaayanama. Literature. shriiraamaayand-a mahaakaavya bhaaga 5. Literature. Sanskrit. Language. . 308 pgs. Sanskrit. Sanskrit. Sanskrit. Literature. Not available. 48 pgs.. 485 pgs. Sanskrit. Sanskrit.. Linguistics. 0. Language. shri direndra tirth... Sanskrit.. Not available. Sanskrit. Philosophy. 1940. Language. 240 pgs. 0. 1974. Literature. Sanskrit. Sanskrit. 120 pgs. raamachan'dra. shriimannigamaantamahaadeshikaa. 0. Sanskrit. shriimannyaayamrxtataran'gind-i.. 424 pgs... Sanskrit.. shriiraajaratnamaalaachampuu. Language. madhuravaand-ii. Pandit R. shriimatryaayasudhaaparimat't'an. shriiraamaayand-asaara kaavya tilakamu. Sanskrit... Language. THEOLOGY. Literature. daamodara saatavalekara. 1987. Sanskrit.. 760 pgs.. Literature. shriinaaraayand-iiyamuu. shriiraamadaasasvaamiin'che samagra gran'tha shriisamarthagran'thabhaan'd'aara. 1110 pgs. Religion. Sanskrit. Literature. Language. 0. Linguistics. 38 pgs. m. 402 pgs.2/14/2011 A list of scanned Sanskrit books at III… shriimannaaraayand-iiyamu. 228 pgs. shriimadraaghavendragurusaarvabhauma. Linguistics. 584 pgs. 1958. mootiilaala jaalaan. Linguistics. 0. Language.. Sanskrit. 240 pgs. Linguistics. siddheswar jena. shriinaaraayaneupanishad.. shriimadvedaantadeshika. 0. shriirahasyatrayasaarasan'graha. Sanskrit. Literature. Literature. shriinarasimhapuraanamu. 391 pgs. shriinyaayamutttaavalin.. shriiraamalin'gheishvarasthavaraaja. Language.. Literature... Seshasayi Iyengar. Language. Literature. Linguistics. Language. 0. Sanskrit.. 153 pgs. Language. Literature. shrii vaadiraajabhagavatpaada. 0. 128 pgs.. 260 pgs. shriiraamaliilaa raamaayand-a sat'iika.. 0. Literature. 1972. Linguistics.. . Sanskrit.. 226 pgs. Language. shrii mudigond-d'a subrahmand-yasharmand-aa.. Sanskrit. 1952. Linguistics. Literature. Theology.. Linguistics. Theology. Sanskrit. Linguistics. shriimatsarvamulan'san'puurnd-a.. shriimattan'trasaara chhallaarii vyaakhyaana. Theology. LANGUAGE.. shriimatyaagaraajavijayamu prathama sn'skarand-amu... saqs-mand-a raamachan'dra paan'gaarakara. Sanskrit.

0.… 151/167 . Sanskrit. shriiveng-kat'aachalamaahaatmya prathamabhaaga hindii anuvaada sahita. Linguistics. 244 pgs.. Sanskrit. Language. LITERATURE. LINGUISTICS. shriishivasvaroodaya. 1898. 120 pgs. 568 pgs. shriirang-garaamaanujamuniiprand-iitaa. Sanskrit.. Linguistics. LITERATURE. LINGUISTICS.... 1972. Literature. jagannaatha parashuraama dvivedi. 108 pgs. prabhudatta brahmachaarii. LITERATURE. 0. Sanskrit.. 242 pgs. Sanskrit. Linguistics... Literature. 338 pgs.. 1918. 1955. shriishriichaitanya charitaavalii bhaaga 1. Sanskrit. 789 pgs. 0..2/14/2011 pg A list of scanned Sanskrit books at III… shriiramayansaar kavya tilakam madhurvani. LITERATURE. shriiveidaantaachaaryavijaya... Linguistics. shrii krxshhnd-adaasa. Sanskrit. Language. shriiven'kat'aachaletihaasamaalaa. Hari Raghunath Bhagavat... 384 pgs. LANGUAGE. Language. Sanskrit. Language. 1938. Language. prabhudatta brahmachaarii... khemaraaja shriikrxshhnd-adaasa. Sanskrit. Sanskrit. shriivallabhaachaarya. 299 pgs. Theology. Sanskrit. Sanskrit. 230 pgs.. Sanskrit. 300 pgs. 376 pgs. 0. maadhavaachaarya. Linguistics. Language. Linguistics.. shriimahaamaheshvarachaarya. Linguistics.. Literature. 814 pgs. 1947. shriivishhnd-uyaagapaddhati navagrahamakhasahitaa. Sanskrit. 0. prabhudatta brahmachaarii.. shaaravot't'ai kushhnd-aasvaamyayya. Not available. Linguistics. Linguistics. Linguistics.. Linguistics. Language. Not available. Language. 1929. shriimadabhinavagupta. Language.. LANGUAGE. Sanskrit. Literature. 749 pgs. LINGUISTICS. shriikrxshhnd-adaasaatmaja. shriivishhnd-enaamasahasramu. shriiupaasanaatrayasidddhaan'ta. Literature. Sanskrit. 2000. pand-d'itavara shriikeshariikaantajiisharma.. Language. 190 pgs... 0... Literature. 1921.. shriiveng-kat'aachalamaahaatmya dvitiiyobhaaga hindiibhaashhaamayt'ikopeta. prabhudatta brahmachaarii. shriishaantikalpadruma vaastushaantisahita.. Literature. shriisvachchhandatantramu. 1852. Literature. sanskritdocuments.. 1950. shriishan'karaachaayaivirachitagran'thasan'grahan'prakarand-agran'thaan.. ramaraju b ed.. shriiyaajnj-avalkyasmrxti. Literature. 368 pgs. shriishang-karadigvijaya hindii anuvaada vistrxta t'ippand-e tathaa vivechanaatmaka bhuumikaa. Literature. shriishriichaitanya charitaavalii bhaaga 4.. shriishriichaitanya charitaavalii bhaaga 3. Not available. LANGUAGE.. bhaalachandra jagannaatha dvivedii. Sanskrit.. Not Available. 0. Religion. 170 pgs. Linguistics. 279 pgs.. Literature. shriisubodhinii t'ippand-isahita sampradaayavidushhaa. Literature. 0. Linguistics. 1986. Language. LINGUISTICS.. 318 pgs. 274 pgs. 1925.. Linguistics. Sanskrit. Sanskrit. Sanskrit...org/…/SanskritIIIT. Language. Literature. shriitantralooka vivekaakhyat'iikopeta dvaadashobhaaga. Religion... Sanskrit. Literature. prabhudatta brahmachaarii. LANGUAGE.. Literature. 1937. Language. Theology... LITERATURE. ti viiraraaghavaachaaryaind-a. Sanskrit. 340 pgs. 224 pgs. LANGUAGE. shriishriichaitanya charitaavalii bhaaga 2. shriishriichaitanya charitaavalii bhaaga 5. 0. Language. Language. Sanskrit.. LINGUISTICS. Linguistics. shriivign-aanabhairava. Literature. 288 pgs.

Literature. shuudrakamalaakaramu. Sanskrit. Sanskrit.. Literature... 352 pgs.. 171 pgs.. shripatipaddhati adhyaaya 1 8 bhaaga 7. Sanskrit.. 1894. shuddhadhar^ma mand-d'alam' shriimadbhagavadgiitaa. sahadayaaliila.org/…/SanskritIIIT. ilaivilli jagguu veng-kat'aachaarya.. 1896. 1923. Linguistics.. RELIGION. shrundgaratilakamu. 1965. Sanskrit. 946 pgs. Linguistics. 240 pgs. Linguistics. 107 pgs. shrxng-gaarasundarabhaand-a. Language. shrishang-karabhagavatpaadiiyaprakarand-aprabandhavali trxtiiyasan'put'amu. shriimadgang-geshopaadhyaaya. Religion. Religion... Bhrga Samhita. Literature.. Theology. Literature. 108 pgs.. shrii harshha. bhat't'aachaaryend-a shrii paadasharmand-a. Linguistics. LITERATURE. Sanskrit. Sanskrit. 1862. Language. 65 pgs. Language. Sanskrit.. shriiraamabhadra. swamy maheshvarananda giri.. Theology. 46 pgs.2/14/2011 y j j y A list of Sanskrit books at III… gscanned g g pg shriiyatiindrapravand-aprabhaava.. Sanskrit. 1919. 1968. 294 pgs. Language.. Sanskrit..rangaswami. shriibaladevavidhyaabhuushhand-a. 1950. Linguistics. Psychology. K. e. Linguistics. shuklayajurvediiya kaand-va san'hitaa. 232 pgs. Linguistics. Not Available.… 152/167 .. mahaadeivashaastri. shrii madanan'da jagapati. 1932. jiivaanandavidhaasaagara.. 0. shrimadbhrahmasuutraand-i. 68 pgs. 200 pgs. shuddhiprakaasha. 1959. subrahmanya shastri. shrungarasarvasvasvabhaand-an. Literature. 283 pgs. Literature.. shrudikaand-d'amu dashamo bhaagan. Linguistics.. 1950. THEOLOGY. Theology. Language.. Religion.v. 232 pgs.. shrishivamahaapuraand-mu. Theology.. Literature. 1964. Sanskrit. Literature. Language. shrudhikaand-d'amu dashamo bhaagan. Linguistics. maagad'i shriirang-ganaathaachaarya. 1899... 164 pgs. pn' . Sanskrit. Language... 1936. Literature. K. 1902. Language. Literature. 1945. hiiraalaala. 0. 1937.. siddaantaratnamusat'iikamu. Linguistics. 240 pgs. Language.. Sanskrit. 23 pgs. Language. shukraniitisaara.. Sanskrit. 0. Literature. 632 pgs. 1956. Linguistics. v. sidantabindu. 282 pgs. Literature.. shukraniiti.. shriivaamanabhat't'a. iishvarasharma. Sanskrit.. Literature. shrungarabhushhand-amu. Linguistics. Religion. Sanskrit. shripati. Not available. Sanskrit. Sanskrit. 640 pgs.. Sanskrit... Rangasawami Aiyangar. Linguistics. shriinallaa.. shukasaptati agn-aatakartrxkaa kathaakrxti. Sanskrit.. 1912.. Language. 1968. Literature. Linguistics. shrxn'gaara haaraavalii. LITERATURE. 486 pgs. Language. 154 pgs. LANGUAGE.v. Sanskrit. LINGUISTICS. Language. vi . Sanskrit. Linguistics.. krishnajanth panth. Philosophy. Language. siddaantalaqs-and-amu.. sanskritdocuments. gad'gan'prasaadajii. e . 0. Linguistics. LANGUAGE.. Not available. Language. shung-garatilaka... Sanskrit. Literature. Literature. Language. Sanskrit. 1890. shuklayajurveda sahitpani shachhtakamu.... 744 pgs. 846 pgs.. Sanskrit. shrikaara bhaashya vol 1. 480 pgs. LINGUISTICS. Sanskrit..

madhusudana sarasvati. Linguistics. 1921.. smritichandrika 3 vyavahaara khanka bhaaga 2. LANGUAGE. 1918. Literature..... Sanskrit. Religion. Psychology. Language. Literature. 1929. Psychology. Sanskrit.. Literature.. Sanskrit. Linguistics. Sri Krishnananda Sarasvati. 1917.. siddhaantaleshasan'graha sat'ippand-abhaashhaanuvaada. Sanskrit. parashuraama shaatri... Linguistics.org/…/SanskritIIIT. siddhantasiddhaajann'part 2. sidditrayii. 0. Psychology. 1917. 0..2/14/2011 A list of scanned Sanskrit books at III… siddanta kaumudi.. 170 pgs. Language. 1911. sisupalavadha of magha. 1916. Linguistics. Sanskrit.. shriikrxshhnd-aanandasarasvatii. 1925.. Sanskrit. devana bhatta. Linguistics. Language.. 469 pgs. siddhaanta shiromand-e grahargand-itaadhyaayo vaasanaabhaashhyasahita. Philosophy. sitaaraavand-asamvadaajharya uttarabhaaga. 102 pgs. 152 pgs. shrii yaagn-ikadevand-abhat't'opaadhyaaya. siddhaantabindu of madhusuudanasarasvati. 1928. 810 pgs.. Linguistics. siddhantabindu nyayaratnavali laghuyakhya. 566 pgs.. Sanskrit. Sanskrit. Linguistics. 358 pgs. Linguistics. Sanskrit. shrii yaagn-ikadevand-abhat't'opaadhyaaya. Language. Sanskrit. pandit durgaprasada ed. siddanta rahasyam.. Language. siddhasiddhaantasan'graha. Literature. Sanskrit. Not available. siddhaantachandrikaa san'qs-iptabaalabodhinii t'iikaa. 810 pgs.. Not Available. Language. Literature.. Sanskrit.. 242 pgs. vasudev lakshman shastri pansikar ed. siitaaraavand-asan'vaadajharyu ttarabhaaga. Sanskrit.. Language. 153/167 . sri ramnatha shastri tr. 90 pgs. Sanskrit. Philosophy. 596 pgs.. Language. Philosophy. Sri Krishnananda Sarasvati. 1932. Not available. Linguistics.. 156 pgs. 0. Sanskrit. Language... Language. Sanskrit. sidditrayamu vedaantaprakarand-amu vishishht'aadvaita brahmaniruupand-aparamu.. 1940. 132 pgs. 1993. 1919. Literature.. siddhanta kaumudi. shriimadappayyadiiqs-ita. 54 pgs. 1914. sanskritdocuments. shrii yaagn-ikadevand-abhat't'opaadhyaaya. Philosophy.. Literature. Sanskrit. Psychology. Literature. Literature. Not available.. Language. Linguistics. Literature.. Not available. Sanskrit. RELIGION. 146 pgs.. wasudev laxman sastri pansikar ed. Literature. siddhaantasiddhaanj-janan' trxtiiyo bhaaga. Linguistics.… smrxtichandrikaa shraaghdakaand-ad'a. Language. Philosophy.. Language. 156 pgs. Sanskrit. smrxtichandrikaa san'skaarakaand-d'a 1.. Sanskrit... 562 pgs.. Literature. smrxtichandrikaa aahnikakaand-d'amuu 2. sindhukaustubha. LITERATURE. balabhadra. Literature... Language. pan' svaamishriiraamamishrashaastrind-aa. Sanskrit. 0. Linguistics. Sanskrit. riitaaraamashaastrii. 380 pgs.. Linguistics.. 236 pgs. Literature. Tryambakam Sastri. siddhantasiddhaajann'part 4.. 490 pgs. 1928. THEOLOGY... Linguistics.. 0. 410 pgs.. sivalilarnava. Psychology. 0. Sanskrit... Sanskrit. siddhaantasiddhaanj-janamu. siddhaantashiromand-e gorlaadhyaayo vaasanaabhaashhyasahita. prataap sin'ha. 404 pgs. Linguistics. Literature. 1914. 1917. Linguistics.. 170 pgs. LINGUISTICS. 112 pgs. 1919. Theology. Literature. Language.. Language. Language. nilakanta dikshita.

236 pgs. 1244 pgs. Linguistics.. Sanskrit. 0. 222 pgs. 1921. 222 pgs. Linguistics. Language... Language.. Linguistics.. Literature.. shrii yaagn ikadevand abhatat t opaadhyaaya. srimad bhagavatam tasya dritya bagh. 184 pgs.. 1914.... 158 pgs. spandakaarikaa. 1902. 776 pgs. shriimadvidhanaada. smrxtyarthasaagara. srimad bhagavadgita purushaarth bodhani bhaasha tika. Linguistics. kallat'a. damodar s. sphoot'asiddhi. Linguistics. Language. Linguistics.. Sanskrit. sri svayamvaraa paarvatii man'tramaalaa stootram. Linguistics.... Sanskrit. smrxtichandrikaa yaamaashauchakaand-d'e... Language. Religion. Sanskrit. 1961. Linguistics. tukaaraam. Sanskrit.. Not available... 230 pgs. Sanskrit. veda vyas. Literature.. Literature. Literature. Literature. Language. Linguistics. Sanskrit. Sanskrit. Not available. Language... devanabhatta.. 1852. Sanskrit. Language. 1944. vemana. Sanskrit. 29 pgs. 148 pgs.. Sanskrit. Sanskrit. 439 pgs. Sanskrit. Linguistics. Language. srautasuutra 1-5. Linguistics. 1930. smrxtikaustubha. 1918. 824 pgs. 42 pgs. Linguistics. Linguistics. Linguistics..... prashnapatrasahita. 1970.. Linguistics. 490 pgs. Literature. 0. khemaraaja shriikrxshhnd-adaasane shreshht'inaa. Literature. spandakaarikaa. Literature. Sanskrit. Language. smurichandrikaa asaucha kaanda. srimad bhagavatam. Literature. 478 pgs. Literature. Theology... 0. -... Not available..... Language. Linguistics.. sragii. Sanskrit. Language. 1942. 0. 0. Language. Sanskrit. sri tuurvaasamunivar. smuti kaustubhan. sri bhaashhya paart' I. 852 pgs. Language. Theology.. Sanskrit. Language. 1974. Theology. Literature. Sanskrit.. 232 pgs. Sanskrit.. 339 pgs..… 154/167 . Linguistics.2/14/2011 A list of scanned Sanskrit books III… smrxtichandrikaa shraaghdakaand ad a.org/…/SanskritIIIT. Linguistics.. smrxtichandrikaa vyavahaarakaand-d'a 3 bhaaga 1. Language. Religion. Sanskrit. 1969.. 0. srimad bhagavatam tasya chatutho bhag. vinaayaka jand-esha aapat'e. Sanskrit.. Literature. 610 pgs. Language. Srinivasagarya.. sri vemageeta prathama sahasram. aapstaan'baa. veda vyas. 1931. 1835.. Linguistics. raamaanujaachaarya. Literature. Literature. Theology. Religion. spandakaarikaa. 514 pgs. sowgandhikaaharand-amu. Sanskrit. 326 pgs. Sanskrit. shriimada aapadevatmaja anantadeva. smrxtinaan' samuchchaya. sri suresvaracarya.. Language. 1969. 1885.. sri raamaanuja champu. Literature.. Language. 386 pgs. sanskritdocuments.. ramanujacharya. 1914. Literature. Language. veda vyas. shrii yaagn-ikadevand-abhat't'opaadhyaaya.. Literature. 1986. Linguistics. Linguistics. Sanskrit. Not available. 1970. 40 pgs. 1909. Literature. Language. sribhasyaprakasika.. 208 pgs. Linguistics. 1902.. Sanskrit. Linguistics. Religion. Sanskrit. 809 pgs. Literature. aachaarya mand-d'anaamishra. Language. Language. Sanskrit. sottaraaprashnaavalii dvitiiya khand-d'a 23 varshhaand-aan' prashnapatrasahita. Literature. sri raama giita. g krishna shaastri. Language. Literature. 497 pgs. 314 pgs. Literature. Literature.

Philosophy. Unknown. 1971.. Language.. Psychology. 1912. subhaasita ratna bhaand'aagaaramu. Pandith Laxmikanth Kanyaal. Literature.. sumadhvavijaya.. Sanskrit. Sanskrit. Sanskrit. 142 pgs.v. Sanskrit. 1961. suttanipaato.. 498 pgs. Literature. chandrashekarana. Sanskrit. Not available. 138 pgs. Linguistics.org/…/SanskritIIIT. 198 pgs... -. 812 pgs. Sanskrit. Language. Literature.2/14/2011 A list of scanned Sanskrit books at III… srimad ramayan dritya bagh. shriimaadhavabhat't'a. 84 pgs. 1931. 0. Literature. Language. sutravt'ati. 1961. Sanskrit. Religion.. 412 pgs. Linguistics. Sanskrit. 350 pgs... Theology.. subhaashita trishaati vyaakhyaayasahita. 1916. Language. 86 pgs.. 1971. Language. Literature.. Linguistics.. sushrutasan'hitaayaa. Language. Linguistics.. Literature. Literature. Sanskrit. subhaashhitaniivyaan' durvrxttapaddatishchaturthii 4.12. 1933. 422 pgs. Sanskrit.. 0. Literature... subhadraaharand-amu.. Not Available. valmiki. 1924.. statvaprakash. Sanskrit. Sanskrit. Sanskrit. 258 pgs. Sanskrit. 556 pgs. Sanskrit. 25 pgs.bapat. Linguistics. Language. Language. Sanskrit. Linguistics. Linguistics. Linguistics.. Literature. Language. Linguistics. Literature.. naaraayan ram acharya. abhinava kalidasa. suurasaagara. Linguistics. Language. 156 pgs. subhashita niva. subhaashhitaavalin.. r. Language. veidaantadeishikulu. Literature. Sanskrit. sanskritdocuments. Linguistics.. shriirang-kanaatha. srngarasekhara bhana.. subhadraadhananj-jayamu. abhinava kaalidaasa. Literature. Language.. Literature. 1940. 238 pgs. Linguistics. Linguistics. sri vedanta desika.. Sanskrit. 1968. Language. Not available.. Language.. 218 pgs. Linguistics. Literature. t.. P. Linguistics... Literature. Literature. 1955. 0. 260 pgs. 0. 1899. Sanskrit. subod sanskrit vyakhan pradhama bhag. 999 pgs. Language.. Language.. 111 pgs. 569 pgs. Literature. Language.. si sundara shaastriyaara. Sanskrit. subhaashhita sudhaanidhi.… 155/167 . subhaashhitaniivii... Literature.. subhaashita ratna bhaand'aagaara. Philosophy. Psychology.. valmiki.. suuryyasidddhaanta. kaasiinaatha paan'd'uran'ga paraab. ti. srngara sekhra bhana. 170 pgs. Sanskrit. saayand-a. kaashinaatha panduranga paraba. 1917. Sanskrit. Language.. Linguistics.. Sanskrit.. subhashita ratna bhaandaagaaram.. Technology. 1952. krishnaachaarya. srimad valmiki ramayanam.. Language. sushrata sanhita sharira staanamu. 416 pgs. 1891. Not Available. 1134 pgs. 0. Sanskrit. Sanskrit. shriisachchidaanadendrasarasvatii. kulashekara varmaa. pandita nilakanta devarao deshpande. 916 pgs. 0. Language. Linguistics.. Language. Literature. subhaashhitaniivii. Linguistics. 322 pgs. 584 pgs. Linguistics. srimadbhaagavatam skandhas 8 . Sanskrit. Literature. 890 pgs. Psychology. Sanskrit. suutraarthaamrxtalaharii. 1941.. Language. 192 pgs. 1951. Literature. Literature. Linguistics.. 1886. shriimadullabhadeva.. Not available. Philosophy.. bhartrihari... sugamaa.. Linguistics. 1925. 1935. 74 pgs.. Language... Linguistics. 1988. 1911. Sanskrit. shriinigamaantamahaadeshikaa. sundararaamaayand-amu aura satiivilasitamu. Linguistics. Sanskrit.. Literature..

v. kaashiinaatha vaasudeivashaastrii. Language. Language.iii. 306 pgs.. Sanskrit.. 362 pgs. Sanskrit.. Literature. 1917. shriisachchidaanadendrasarasvatii. Linguistics. Language. 540 pgs. Language.. Linguistics. Bhatta Kumarila. 454 pgs. Mahadeva Sastri. Sanskrit. Literature. Sanskrit. shriimadgrund-i shan'bhubhat't'a. Linguistics. Sanskrit. Linguistics. taitiriiya brahmand-a baashha part Ii.. Linguistics. 0. 101 pgs. Philosophy. Sanskrit. svayambhupuraand-amu. Linguistics. Literature. 346 pgs. 454 pgs. Sanskrit. Not Available. Linguistics. Sanskrit.. Literature... 224 pgs. 1926. Religion. 126 pgs. t'ood'araanandamuu volume 1. Sanskrit. e. 0. Psychology. 550 pgs. Language. Literature. Sanskrit. taitiriiya san'hitaa krishhnd-a yajurveida Vol.iv. Literature. svaanandavanavihaarakaavyamu. taatparyachandrikaa. 136 pgs. 1896. 0.. Language.. qs-emaraajaa.org/…/SanskritIIIT.. Theology. taddhitaantaa kechanashabdaa. Literature. Linguistics. shriisambhavai jyothorupaaya. 170 pgs. Sanskrit.. 1898. 374 pgs. 1956... 288 pgs. svaraajyasiddhi qs-igagd'adharendra sarasvati virachitaa. 1895. Language. ramanujacharya. 478 pgs. taajiiraatahinda. Sanskrit. e. Language.. shivaraamakushhnd-ashaastri. 1927. 34 pgs. taittiriiya rand-yakan' bhat't'abhaaskara bhaashhyasahitan' Vol 3. Psychology. Language. Literature... mahaadeiva saastri. Sanskrit. 1983.. Sanskrit. Literature. Not Available. Literature. Language. 0. Sanskrit. Linguistics. 89 pgs. Linguistics. svaanubhavaadarsha. svaravyaajjanamu. Language. 0. 1964. Sanskrit.. Literature..2/14/2011 A list of scanned Sanskrit books at III… suutrabhaashhyaarthatatvavivechani. Literature. 0. Literature. 1948.iii.. Sri Ganapathi Sastri. taatparyachandrikaa dvitiiyasamput'amuu. taitiriiya san'hitaa. Linguistics. Language.ix. 0.… 156/167 . Linguistics. 362 pgs.. Language. Sanskrit. 1904. 0. taitiriiya san'hitaa krishna yajurveida Vol. 570 pgs. Language.. Not available... taitiriiya san'hitaa krishhnd-a yajurveida Vol. 0. Religion. 1902. Literature. pan'd'ita harishan'kara. svarasiddaanta chandrikaa. Sanskrit. Theology. Sanskrit. 471 pgs.... Language. ke maadhava krxshhnd-a sharma. Linguistics. Language. Sanskrit. Literature.. Linguistics. Linguistics.... aachaariyaraghuviirend-a. Language. taajika niilakand-t'hii t'ikayaa savisheshhopapatti sodaaharand-a bhaashhaabhaavaarthana.... Literature. Sanskrit.. 480 pgs.. e. Sanskrit. Linguistics. Literature. Linguistics.. Linguistics. mahaadeiva saastri. 221 pgs.. taaraanaayatarkavaachaspati jiivanacharitamu. 1896. 1961. A.. Language. 1898. shriiniilakand-t'haachaarya.. Sanskrit. svaraprakriyaa. 470 pgs. vyaasatiirtha. Literature.. svachchanda tantramu Vol. t'upuut'iikaa. Language... Language. 360 pgs. mahadeiva saastri. mahaadeiva saastri. Philosophy.. siitaaraama shaastri. sanskritdocuments. Not available. Language.. Literature. Sanskrit.. d'aa maagiirathapraasaadatripaat'hii vaagiisha shaastrii. taitiriiya san'hitaa krishna yajurveida Vol. Literature. Literature. svasthavrxttasamuchchaya bhaashhat'iikaasahita. Linguistics. Linguistics.. 470 pgs. Sanskrit. 1896. Linguistics...

1930. Religion. Religion. taittiriiyabraahmand-amu trxtiiyaashht'ake prathamabhaaga 1 7 prashnaa. Literature. tark shastra terminology of logic part 1. bhat't'abhaaskaramishra.. Literature. Linguistics. Sanskrit. Psychology.. 140 pgs. Theology. Sanskrit. 216 pgs. 186 pgs. Sanskrit..annanagarachari. 244 pgs. Philosophy. tarka sangrah. Philosophy.. abhinava gupta. Religion. Linguistics.. Literature. tantralooka bhaaga 8. Sanskrit. Literature. 1898. taittiriiyasan'hitaa bhaaga 12. Sanskrit. taittiriiyabraahmand-amu prathamaashht'akamu. 1924. Sanskrit. tantrayeprasuunamaalikaa.. -. abhinavagupta. Sanskrit. THEOLOGY.. Not available. Psychology. Sanskrit... tantralooka bhaaga 1. Sanskrit. 1921... Language. taittiriya upanishad anandavalli bhriguvalli. tantralooka Volume Iii. Psychology. Sanskrit.. Language. parvatiiya shriivishveshvarapaand-d'eya. Sanskrit. 1952. 0.. mallaadi vasun'dhara. takra sangra. Religion. Sri Lowgakshi Bhaskara. 512 pgs. 0. 333 pgs. 1917. Theology. abhinavagupta.. Linguistics. Sanskrit.. 1934. 0. 1918. Language. taittiriiyasan'hitaa bhaaga 2. Language. tantrashuddvaya prakarand-an' bhat't'aarakaqs-ivedottama prand-itan. 1962. 1953.. Linguistics. Language.b. 102 pgs. Linguistics.. Psychology.. Sanskrit. Ganapathi Sastri. bhat't'abhaaskaramishraa.org/…/SanskritIIIT.. Linguistics. Sanskrit. Philosophy. 1922. RELIGION. tantraadhikaaranirnd-aya. Psychology.. Sanskrit. Sanskrit... Religion. 0. Language. 48 pgs.. 1918. mahaamahopaadhyaaya parashuraamashaastrind-aa. abhinavagupta. Religion. tarkai shaastra nirupand-amu. Narayana Sastri... tantralooka bhaaga 2. 1971 512 pgs sanskritdocuments.. Philosophy... Literature.. Sanskrit. Theology. 280 pgs. tantrasaara.... Sanskrit.. Theology. Theology. Linguistics. Sanskrit. Literature.. 1897. Theology. 98 pgs. Religion.. taittiriyasan'hitaayaa padaanukramand-ii prathama khand-d'a. Not Available. Sanskrit. Religion. bhat't'abhaaskaramishra. Theology. 443 pgs. Language. 370 pgs. 374 pgs. Sanskrit. tantraprakaashikaasamete mimaaman'sa ar^thasan'graha... Linguistics. 1894. Religion. Religion. 558 pgs. 239 pgs... tarkakutuuhalamu... P. Theology. 1918. 271 pgs. raghu vir. 1923. Sanskrit. shriikeshavamishra. Linguistics. Psychology. Religion. Religion. tan'jaavuurupatanamu... 66 pgs. Sanskrit..… 157/167 . 361 pgs. 1921. 102 pgs. Sanskrit... Sanskrit. taittiriya upanishad. Philosophy.. 38 pgs. 1894. 1989. taittiriyopanishhata. Theology. Philosophy. Philosophy. Language. tantrarahasyamn. Literature. swami satchidaanandendra saraswathi. taittiriiyasan'hitaa bhaaga 10. 227 pgs.. Language. mahadeva shaastri. Sanskrit. Literature.. 206 pgs...2/14/2011 A list of scanned Sanskrit books at III… taittiriiya san'hitaa Vol II. 104 pgs. Sanskrit. Literature. tarkabhaashhaa... Sanskrit. 238 pgs. Religion. Theology. 230 pgs. tantralooka bhaaga 4.. tantrasaara. 1882. Sanskrit. abhinavagupta. 425 pgs.. Not available. Theology. 480 pgs. shrii sachchidaanadendrasarasvatii. 454 pgs. bhat't'abhaaskaramishraa. 1930... 72 pgs.. bhat't'abhaaskaramishraa. 1949. taittiriiyabraah-hmrxnd-amam. Psychology. 1915. Theology. T. abhinavagupta. Ramanujacharya. Madhusudhan Kaul Sastri. -... Sanskrit. 1911. 1952.

sanskritdocuments.2/14/2011 A list of scanned Sanskrit books at III… 1971. Linguistics. LITERATURE. janaardanashaastrii paand-d'eya. 214 pgs. Linguistics. LINGUISTICS. tarkasan'graha diipikaa nyaayabodhiniisamalan'krxta. tarkasang-grahasarvasvamu tarkasan'grahavyaakhyaa t'ippand-yaacha samalan'krxtamu. Literature. jayadayaala.. 216 pgs... Language. 60 pgs... shriimadannan'bhat't'a. tatvabiidhinyaa uttaraardha subiidhinyaakhyan' svaravaidikaprakarand-an.. tarkasangraha. tarkasangraha. LITERATURE. Linguistics. Sanskrit. shriimadvaradaachaarya. 1924. Literature. Language. shriivyaasatiirtha. shriimadannabhat't'a. Linguistics. 386 pgs.. 1932. Gangesopadhayaya. Literature. Language. tarkakutuuhalamuu.. s chandrasekhara sastrigal. tarkasan'graha nyaayabodhini vaakyavrxtti niruktti t'iippand-yaa. Literature. Language. 1916. Language.. tattvachintaamand-e saamaanyalaqs-and-aprakarand-amu. Language... 456 pgs.. Sanskrit. LANGUAGE. llokaacharya. Sanskrit. Jayarasi Bhatta. Sanskrit. tattva chintaamand-i bhaaga 7. Literature. 0. 200 pgs. Language.. shrii vyaasatiirtha. jayadayaala. Language. Psychology. Language. 1888.. sri vachaspati mishra. Sanskrit. 612 pgs. 1932. tattvabindu. tattvachintamand-i Part I. mahaamahopaadhyaaya shrii ganggeshopaadhyaaya. Sanskrit. Sanskrit. Literature.. Sanskrit. Sanskrit. 278 pgs.… 158/167 . LANGUAGE.. Literature. 518 pgs. Linguistics. yativarashriignaanendrasarasvatii. 315 pgs. Linguistics.. Linguistics. Linguistics. 32 pgs. 360 pgs. 0.. tattvatrayamuu. Language. tattvasan'graha volume 1.. Language. Literature. 349 pgs. 1969. tatva vichaar. 1938. Literature. Language. 1940. 1944. Sanskrit. Language. Literature. Literature. Literature. tattvasaara samanugrxhita.. Language. Literature. Literature. 1917. 364 pgs. Linguistics. 1974... pan' shriiaanandabhtaa nyaayachaarya. Linguistics.. tarkakutuuhalamuu. 1915. Sanskrit... 1938. Sanskrit.. tarkataand-d'avamu trxtiiyan' san'put'amu. Linguistics. Sanskrit. 401 pgs. jvaalaa prasaada kaanod'iya. 1926. tattvopaplavasin'ha. LINGUISTICS. tatvabodhanyaa uttaraardhda.. 192 pgs... 1992. 2003. Sanskrit.. Linguistics.. 0.. 1917. Sanskrit. Sanskrit... Not avilable. Language... Language. shriimadannambhat't'a. tarkataand-d'avamu prathamasamput'amu nyaayadiipaaravyaakhyaaya.org/…/SanskritIIIT. 398 pgs.. LINGUISTICS. Literature. Literature.. shriimadavedaantadeshika. Not available. 448 pgs. 1003 pgs. Language... tattvabodhinii puurvaarddha viyaakarand-asiddhaantakaumudiivyaakhyaaruupan. 520 pgs. LITERATURE. kamalashiila.. Literature.. 512 pgs. tarkasan'graha nyaayabodhinii siitaa padmaabhyaan' san'skrxta hindii vyaakhyaaya. shriimachchitsuravaachaaryamunivara. Language. Sanskrit.. 116 pgs. 0. Linguistics. Philosophy.. 0. Linguistics. Sanskrit. Philosophy.. 552 pgs.. Sanskrit. Sanskrit. tattvat'iikaa shataduushhand-ii. tattva chintaamand-i bhaaga 6. Sanskrit. Language. LANGUAGE. Literature. 0. Sanskrit. Linguistics. Literature.. Linguistics. Psychology. janaardanashaastrii paand-d'eya. tattvapradiipikaa chitsuravi nayanaprasaadiniisamaakhyayaa vyaakhyaaya sahitaa. 830 pgs.. 523 pgs. Linguistics. Linguistics. 0. Language... 1953. Sanskrit. Literature. Sanskrit. aanandajnana. Linguistics. Linguistics. 52 pgs. Sanskrit.

moreshwar ramachandra kale tr. Sanskrit.. the jnanadipika tika mahabharata tatparya tika. Sanskrit. Linguistics. Sanskrit..s. Language. Philosophy. vaman shivaram apte. Sanskrit.. Sanskrit. Linguistics. pg tatvakostubha Part 1. Literature. Linguistics.. kshemaraja. Language. Language. 1956. 356 pgs. tatvashuddhi. Literature. Sanskrit. 0. Theology. Psychology.s. Literature. Srinivasachar.. the anargharaaghava of murari. Literature. Sanskrit. Language. Psychology.… 159/167 .. narayana balakrishna godbole. 306 pgs. tatvasan'khyaanaraaghaven'dratiirthiiyat'ippand-ii. Sanskrit. Philosophy.. Linguistics. sambasiva sastry k. 0. 1997. the students guide to sanskrit composition. 29 pgs. Philosophy. Sanskrit. Sanskrit. the panchatantrika of vishnu raman...... the saundarananda. Literature. krishhnd-amaachaarya. 1928. 670 pgs.. the raghuvamsa of kalidasa. 0. 106 pgs. Religion. Language. 830 pgs. Philosophy.. the pratyabhijna hridaya. t'i. 1917.. 1936. veidaan'taachaarya. not avaliable. Linguistics. Not available. 466 pgs... ramaswami shastri. Sanskrit. tatvasan'graha. kasinath pandurang parab. Sanskrit. tatvamuktakalaapa Vol. tatvashuddhijaanadhanapuujyapaadavirachitaa. 1941. 1955. Language... 1937. 750 pgs. Sanskrit. Literature. Literature. Sanskrit. 1926... 1933. Linguistics. the essential gaudapada.. 362 pgs. Sanskrit. 1953 262 pgs sanskritdocuments. Philosophy.ii. Literature.. S. Iv. Language. the ranadipika of kumaraganaka. 1989.. 1954. the meghaduta. tatvamukta kalaapa Vol.. Literature. Sanskrit. Language. tatvamukta kalaapa Vol.org/…/SanskritIIIT.. tatvamuktaakalaapa Vol 1. Psychology. 1938. the ashtadhyayi of panini vol . 0. S. Linguistics. 1925.iii. Literature. srisa chandra vasu... 1900. 746 pgs. Language. Psychology. Sanskrit. Sanskrit.... Sanskrit. shriinivaasagopaalaachaarya. pandit durgaprasad. D. Literature. Sanskrit. Linguistics. Language. Linguistics.. Language.. 1941... Philosophy. 1945. Sanskrit. tatvatrayamuu. Psychology. Linguistics. 542 pgs. Philosophy. Literature. 152 pgs... Linguistics. the supreme epic of devotion. Language. 1944. 670 pgs.. Unknown. Sanskrit. 1975. of scanned books at III… g g Sanskrit g . devabodhacarya. k. Sri Bhattoji Dikshita.. 1933. Psychology... Language.. Sanskrit. 406 pgs. 430 pgs. Psychology. Linguistics. Linguistics. Language. shriinivaasaachaar. Suryanarayana Sastri. 330 pgs. 946 pgs. swami satchidanandendra saraswati. Linguistics. Sanskrit... 428 pgs. the students sanskrit-english dictionary. Linguistics. tatvat'iikaa. Literature.. thakavarg Mahanibandh. 448 pgs. Literature. asvaghosa.suryanarayana Sastri. Language. 60 pgs.. Dr Suresh Chandra Mishra. Linguistics. di. 50 pgs..2/14/2011 y A list. 298 pgs. t'i.. 212 pgs.. Sri Mallikacharya. Literature.. Linguistics. Language. 0. Sanskrit. Literature. Sri Nigamantha Mahadesikar. Language. kalidasa...i. 254 pgs. Literature. the dasakumaracharita of dandin.s. Sanskrit. 100 pgs.

.. the vikramorvasiyam of kalidasa. tithichintaamand-i. upanishhad'asa Vol. Not available. kalidasa. Language... 1914. 1947. the uttararamacharita of bhavabutta. 52 pgs. Sanskrit. Sanskrit. trikaakhaad'amakhad'ana. 112 pgs. Theology. Philosophy. Sanskrit. Literature. suranada kunjan pillai.. Language.. ung-ad'aamareshvaratantramu. Sanskrit.. Language. 1977. Linguistics. Literature. Linguistics.. shriibhaaskara. Sanskrit. Literature. Sanskrit. Linguistics. 1942. 1936. LINGUISTICS. Literature. 19 pgs. 262 pgs.... 1962.. Linguistics.. Sanskrit..… upanishhadaan' samuchchaya hari naaraayand a aapat'e RELIGION THEOLOGY Sanskrit 1895 160/167 . naaraayand-abatta. 135 pgs. 20 pgs. 394 pgs. udhaanapatrikaa. Sri Rama Pisharoti And Subrahmanya Sastri. Pandit A. 0. Psychology. Sanskrit. kalidasa.. Literature. 1930. Rangaswami Aiyangar.. upadeshasahasri Part I and Ii (prose and Poetry). Sanskrit.. Linguistics. 140 pgs. trin'shachchhlokii sat'iikaa.m. upadeshasahastrii gadyaruupa sat'iikaa. Sanskrit. Literature. trishaati seituhu. Sanskrit. 0. Sanskrit. 389 pgs. Bhrga Samhita. Narayana Bhatt. Linguistics. Language. tristhaliisetu tiirthendushekhara kaashiimoqs-avichaara. 0. Literature.. 160 pgs. Psychology. Sanskrit.2/14/2011 1953. Language.. Language. Literature.. Sanskrit.. Psychology. Linguistics. 0. tithisaamaanyanirnd-aya. Language. Not Available. K. the vikramorvasiy. 0. Language. 0. Philosophy. Linguistics. Philosophy. 1918. pand-d'ita shriishashinaatha bhkaa.. 1954. kalidasa. Sanskrit. unmattaraaghavamu.. Sanskrit.v. 194 pgs. Language. 380 pgs. Not available. Language. 1903. Psychology. 124 pgs. hari raghunaath. Badi Mudgara Kuthara Kumara Swami. Linguistics... 298 pgs. 262 pgs. LANGUAGE. Sanskrit. Linguistics.. 443 pgs. 1915... tristhaliisetu. A list of scanned Sanskrit books at III… the taittiriya upanishad. bhat't'ojidiiqs-ita.. Sanskrit. 144 pgs.. Literature. Literature. bhava butta. Language. srimad ramatirtha..org/…/SanskritIIIT.. upakramaparaakrama. Not available.. 446 pgs. swami satchidanandendra saraswati. 1922. 473 pgs. shriibhagavadramand-amaharshhi. Sanskrit. Linguistics... 1915. Sanskrit. 154 pgs. Linguistics. Literature.. 90 pgs... Sanskrit. 1934. Sanskrit. Philosophy.. Language. LITERATURE. Linguistics. tritalaavachchhedakataavaada. 178 pgs.. I. Language... 1949. Philosophy.. upadesasahasri. Literature. Sanskrit. Literature. 63 pgs. Literature. Language. 1937. tithaivivechanakaand-d'avishhayasuchikaa.. Linguistics. Philosophy. 107 pgs. trin'shachchhulokii. Linguistics. Srimad Bhagawatpadacharya.. vinaayaka gand-esha aapat'e. Psychology. Language. Sanskrit. tisarii kitaaba. upaakhyaanamaalaa.. Sanskrit. shriiharisin'hajii.. Linguistics. 1942. Language. 413 pgs. 1922... Sanskrit. 1899.. Literature. Language. trim'shaachchhalokii pat't'aabhiraamat'ikaasahitaa. 346 pgs.. Language. Srinivasachariar.. 382 pgs. Literature. 360 pgs.. sanskritdocuments.. 1957. Religion. the vikramorvasiya of kalidasa. Literature. Not available. Linguistics. Linguistics. 1997. Social Sciences. upadeshasaara bhaashhyasahita. 1924. tripuradahanamu. Not Available. Literature. 73 pgs. Sanskrit.. veidaantaachaaryaa.. Sanskrit. Psychology.

Language. uttaragiitaa. Linguistics. shriimadvedavyaasa. Linguistics. Linguistics. Literature. Language. Language. Linguistics. Psychology. vaadaavalii praaran'bhaha. Sanskrit. vaadaavalii. 0. Linguistics. Literature... Literature. Linguistics. 212 pgs. RELIGION. 475 pgs. 1912. Sanskrit. pand-d'ita brahmashang-karamishra. shuuranaad'a krxjjanuu pilla. ushhaaparind-ayaprabandha. vaadanaakshatramaalaa puurvoottaramiimaamsa. Literature. bhartrxhari. jaakooba. -. Sanskrit. Language. Sanskrit. Language. uttarapaqs-aavali. vaajaneyipraatishaakhyan' kaatyaayanaprand-iitan. Linguistics. Linguistics. Not available. shriibhavabhuti. Language.. uttararamacharitam. Linguistics. Appaya Dikshita. Linguistics.. Literature. Literature. vaadanaqs-atramaalaa. Linguistics. Language. Language. Linguistics.. Literature. Sanskrit. bhartrxhari.e... uttaramiimaan'saa vidaantadarshanamu shaariirakanaamnaabhaashhyan' t'ippand-ii. vaakyapadiiyamuu brahmakaand-d'amuu. 1915. Language. Linguistics. Sanskrit. mahaakavi shrobhavabhuuti. utsargapatrtramu. Sanskrit.. Sanskrit... LITERATURE. Religion.... Sanskrit... 572 pgs.. Linguistics.. 0. 1956.. Sanskrit... Literature. aachaarya karapuut'ugala shrii dharmmashrii. Literature. Linguistics. vaamadeshvaratantraantargatanityaashhod'ashikaarnd-ava vyaakhyaaya. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… upanishhadaan samuchchaya.. 1934. 536 pgs. vaakyavrxtti... 62 pgs. 1823. Sanskrit.. Sanskrit. 164 pgs. Literature. 392 pgs. Language. Language.. 1957. 126 pgs. 384 pgs. 1937. Literature.. Linguistics. not availabe. Language. sanskritdocuments. Language. 0. Sanskrit. uttaragitha. 1977. Literature. 1956. jagadguru vijendra trtha. 1944. 216 pgs.. 374 pgs. uttararaamacharitamu. 0. shriibhaaskararaayonnitasetubandhaara.. 82 pgs. 1908. Linguistics. Linguistics. 366 pgs. shriimadgod'apaadachaarya. uttararaamacharitamu naat'akamu. Sanskrit.. hari naaraayand-a aapat e. Philosophy. 1895. Sanskrit. Linguistics. Sanskrit.. vaakyapadiiyamu dvitiiyobhaaga vaakyakaand-d'amu t'ikayaa ambaakartriivyaakhyayaa. Sanskrit.. 500 pgs. 1103 pgs. Linguistics. 1912. LINGUISTICS.. Literature.. 128 pgs. 1988. 1926. 618 pgs. Literature. shriimachchhan'karaachaarya.. 467 pgs. THEOLOGY.. Language. Literature. Sanskrit. 1903.. vaakyaatharatnam.. appaya diiqs-itaa. 214 pgs. 1835. Literature. mahakavi bhavabhuti. Psychology. Literature. Sanskrit. Language. Sanskrit. Literature. 187 pgs. 84 pgs. Literature. Language. Sanskrit. Sanskrit. Language. 0. 1891. 1943. veimuuriraamagovindashaastrii. 182 pgs. 56 pgs.. vaakyapadiiyamu trxtiiyakand-d'amu vrxttisamuddesaatmakamu ambaakartriivyaakhyaaya samalangkrxtamu.. Sri Madahobala Suri... shuuranaad'a krxjjanuu pilla.. uttararaamacharitamu. gi. upasamhara vijaya.. Sanskrit.. Language. Linguistics. Language.. Literature.… 161/167 .. Language. Literature. 1980.. Sanskrit. 38 pgs. mahaakavishriibhavabhuuti. LANGUAGE.org/…/SanskritIIIT. Sanskrit. 491 pgs. Theology. Language.. ushhaaparind-ayaprabandha. Sri Venkatarama Sharma.. uttararaamacharitamu t'iikayaa sametamu. Philosophy.. upanishhadddakya koosha.. 154 pgs. suuyranaaraayand-aa. 1966.

1934. vakrottkijiivitamu khopagn-avrxtti.. 1828. Sanskrit. 1828. sanskritdocuments. vaiyaakarand-a bhuushhand-asaara. 375 pgs.. Literature. subramanya shastri p p. Sanskrit. Literature. Social Sciences. vaishampaayananitipraashikaa.. V. 270 pgs. vaishhnd-ava upanishhada. Dr. vajjaalaggan. 134 pgs. 1943. Literature. Religion.. gan'gaavishhnd-u shriikrxshhnd-adaasane. 0. 374 pgs. Sanskrit.. Sastri. vaasavadattaa. vaiyaakarand-asiddhaantakaumudii. Language. anantashaktipada. Sanskrit. Sanskrit. vasu charitam. shriimatkaund-d'abhat't'a. Religion. Linguistics. Language. shriimadvaadhulamahaachaarya. Theology. Sanskrit. 1953. Literature.. Sanskrit. Linguistics. 240 pgs. 1952. Language. 1961. var^shhakrxdiipaka.. 442 pgs.. Language. Linguistics. Kunhan Raja. 1872. 1901... Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… vaaraahagrxhyasuutramu.. Theology. Literature. Literature. shriikaund-d'abhat't'a. 1933. varivasya rahasya.. C. S. Language. Sanskrit. L.. 1892. Linguistics.. Linguistics. Sanskrit. 1961. vaatulanatha sutras vritti. vaikhaanasadharmaprasna.. Theology. vaidikakoshha prathamo bhaaga. bhaskararaya makhin.. Sanskrit. Linguistics. 198 pgs. 65 pgs. Language. Literature. Linguistics. 1927. vaidik sahitya charitram. Sanskrit. Language.. Sanskrit.. 1938. 406 pgs. Literature. 704 pgs. 1288 pgs. 1957.. 105 pgs. Linguistics. 55 pgs. vaiyaakarand-asiddhaantakaumuti paand-iniiyavyaakarand-asuutravrxtti. 380 pgs.. 1822. Language.. Language. Language. Linguistics. 1937. 1958. Linguistics.. bhat't'ojidiiqs-itulu.. jayatirtha... Linguistics. vararainugrxhiteshhu panj-chasuvijayeshhu. Language.. 144 pgs. Linguistics. khemaraaja shriikrxshhnd-adaasa. Theology. Literature. 75 pgs.. Linguistics. Religion.. 1458 pgs. 122 pgs. 0.. 1923. vikhaanas. Literature. Language. bhat't'ojiidiiqs-ita. Sanskrit. Linguistics. vaididasaahityacharitrama'm. vaiseshika darsana. Chandrasekharan. hamsaraaja.. 166 pgs. Sanskrit. 65 pgs. Linguistics. vaishhnd-avadharmaratnaakara... vallabhapushht'iprakaasha chaaroon' bhaaga.. Sanskrit. Sanskrit.. vadavali.. Language. 1965. Literature. 68 pgs. Language. Literature. kalahasti kavi... Sanskrit. Sanskrit. Linguistics..org/…/SanskritIIIT. 1923. maadhava vaasudeiva. T. Sanskrit. Linguistics. Language... vaiyaakarand-abhuushhand-asaara abhinavasaralaa vyaakhyaaya t'ippand-ayaa samalang-krxtya. Language. Sanskrit. pi bii annangarachaarya. khemaraaja shriikrxshhnd-adaasa. Literature. vararuchaniruktasamuchchaya. vaiyaakarand-asiddhaantakaarikaa vaiyaakarabhuushhand-asaaravyavyaakhyaaya. Religion. vallabhapushht'ipradkaasha chaaroon' bhaaga.. P. Literature. Religion. Language.. General. 1932. Linguistics. Not available. taranatha tarkavachaspati.. Literature. sri t viraraghavacharya. Sastri and K. 407 pgs. Sanskrit. Mahamahopadhyaya. Sanskrit. bhat't'ojidiiqs-ita.. 270 pgs.. Religion. Sanskrit. 476 pgs.. 568 pgs. 1927. shriimadraajaanakakuntaka. Language.. Theology. vaidikamanoharaa. Theology. 222 pgs.. Sanskrit. 804 pgs.. Literature. Literature. 1913. vachaspatya part 1.. 1873. 619 pgs. Literature. Sanskrit. mahaakavi subandhu. 1926. Linguistics. Sanskrit.. Literature.… 162/167 . a mahaadevashaastriind-a. Literature. Language.... P.. Sanskrit..

. shriimaddharmaraajaadhvariindra. Sanskrit. Language. Linguistics. Psychology. Linguistics. veidaantavijayamang-galadiipikaa. Sanskrit.. shrii baalaghanvi jaggu veng-kagaachaarya. Linguistics. Sanskrit. 166 pgs. Linguistics. 580 pgs.. Language. Literature. Sanskrit. vedaantaparibhaashhaa. Sanskrit... 1985. Sanskrit.. Sanskrit... 145 pgs. 0. Literature. Philosophy. shriimatsvaamidayaanandasarasvatii. kalahasti kavi. Literature. Sanskrit.. vedaantapan'chadashi. 617 pgs. 62 pgs.. veidaantaraqs-aamand-ivimarsha trxtiiyabhaaga. Literature. veidaantabaalaboocdhini kramaan'ka 99. vedaartha bhuumikaa. Philosophy. Linguistics. 219 pgs. Sanskrit. Language. 1833. Sri Satyajnananda Tirtha. 0.... qs-emaraajashriikrxshhnd-adaasa. Linguistics. 1928.. sanskritdocuments. 416 pgs. Sanskrit. vedaanta dharshana brahmasuutra sarala hin'dii vyaakhyamu.. shriibhagavatpaadaachaarya. Sanskrit.. Language... vedaang-gaprakaasha navamobhaaga vyaakhyaaya. 1943. pan' bhat't'ashriigauragoopaalashamaa. 106 pgs. shriividyarand-aya. 370 pgs. 142 pgs..org/…/SanskritIIIT. Linguistics. Language. Language. Sanskrit. shrii bhagavad raamaanuja. 51 pgs. Sanskrit.. Language. Language. Literature. vedhaantaraqs-aamand-ivimashe. Language. Swami Govindasingh Sadhu.2/14/2011 A list of scanned Sanskrit books at III… vasu charitram. Philosophy. 1959. Psychology. Linguistics. Literature. Linguistics.. vedaantaparibhaashhaa. 0. Sanskrit. Psychology.. 620 pgs. vedaantaparibhaashhaa dhameraajaadhvarendrakruti.. Linguistics. Literature.. Literature.. Raja Sri Sri Rama Varma. vedaantaparibhaashhaasan'graha. Linguistics. 314 pgs. vedantapanchadashi. Literature. 1934. Psychology.. Literature. Philosophy.. 230 pgs. 0. Language. Literature.. veimabhuupaalacharitamuu. Linguistics. Religion.. 1992. Literature. 190 pgs... 1965. Not Available. Linguistics. kalahasti kavi. goopaalaachaarya. Linguistics.. Philosophy. Philosophy.. 176 pgs. 1965. Sanskrit. 1937.gopalacharya. vedadhammevyaakhyaanamn. Literature. Sanskrit. shriimanmaharshhi vedavyaasa. 0. Sri Madhusudan Prabhuji. vedaantadeepa bhaagha 2. Language. Literature. Literature.. Psychology. 1902. Sanskrit. Language. Not available. 1942. Sanskrit.. Sanskrit. vedaanta darshana. rayaprolu l somyaji. Literature.. Sanskrit. Not available. Language. Literature.. 463 pgs. veidaanta darshana brahmasuutra. 1942.. Sanskrit. Linguistics.. Language.v.. Language. 242 pgs. Language. Lingannasomayaji. A. Language. 0. 233 pgs. -. 524 pgs. vasu charitram.. 480 pgs. vedaantaraqs-aamand-ivimarsha chaturthabhaaga. Linguistics. 0. vedaantaparibhaashhaa. vedaantavichaaramaalaa. 154 pgs. Dharmaradhwarindra. 1942.. 300 pgs. Theology. harikrxshhnd-adaasa goyandakaa.... Sanskrit.. Literature. Language. Psychology.. Sanskrit. Literature. svaamii vidhyaananda sarasvatii.… 163/167 . 1927. Linguistics... 0. 614 pgs. Sanskrit. Sanskrit. vedaprakasa... vedaantapan'chadashi. vedanta desika. 490 pgs. Linguistics. 236 pgs. Language. 1969. 1887. 1949. Sanskrit. Linguistics..

Sanskrit. vin'shashataabdikan' san'skrxta naat'akamu.s. viiramitroodayei bhakti prakaasha Vol. 1935. Religion. viiramitrodaya paribhaashhaaprakaasha. Sanskrit. Literature. Sanskrit. Literature. 1959... Sanskrit. 147 pgs.. 208 pgs. Language. Linguistics. 166 pgs... Linguistics. Xxi. 1936... Sanskrit. Sanskrit. Language. Religion. 1913. Language. Sanskrit. Linguistics. Literature. srirama desikan siromani. Language. vidyamaacdhaviiyamuu. Linguistics. Sanskrit. Linguistics. 383 pgs. Vishva Bandhu. 194 pgs. Literature. dr sir c p raamaswamy aiyar. Linguistics. viiramitrodaya Part Vii. Language. vend-iisan'haaramu. Sanskrit.org/…/SanskritIIIT. Literature. 1897... mahaamahopaadhyaayashriimitramishra. Sanskrit. viiramitroodaya Vol. viiramitrodaya Part Ii.. 610 pgs. Literature. 577 pgs. 266 pgs. Literature... Linguistics. Language. Linguistics. Language. mahaamahopaadhyaayashriimitramishra. Religion. 1972. Sanskrit. nyaayaacharya. 0.. Linguistics. viiramitrodaya tiir^thaprakaasha.. 1917. 225 pgs. 85 pgs. Theology. Linguistics.. viiramitrodaya laqs-and-aprakaasha. vishatantram. jagadgurukrutayaa t'ippapyaa. Linguistics.. 382 pgs. Language. 228 pgs. viiramitrodaya puujaaprakaasha. 292 pgs.… vishhnd ubhaktikalpalataa mahidharakrutayaa t'ikayaa Language Linguistics Literature Sanskrit 164/167 . Linguistics. Sanskrit. Language. 501 pgs... 578 pgs. 614 pgs.. Literature.. 158 pgs. Literature.. viiramitrodaya shraaddhaprakaasha.. 1906. bhatta narayana.. mitra mishra. Sanskrit. Social Sciences.2/14/2011 A list of scanned Sanskrit books at III… vekramorvasiyamu.... Literature.. Social Sciences. Sanskrit. Language. Sanskrit.. Social Sciences. Language. viiramitrodaya raajaniitiprakaasha bhaaga 6.. Linguistics. shriikaalidaasa. Sanskrit. kaalidaasa. Language.. Social Sciences. vish vekharaanandasan'sthaaniiya hastalekhasan'grahaparitaalikaa saacha khand-d'advayavatiisati. Mahamahopadhaya Pandita Mitra Misra. 494 pgs. 0. 1991. Literature. Sanskrit. 234 pgs. Sanskrit. vishhnd-usharmaa. Sanskrit. parameishvara. 1916. vikramorvasiya. venisamhara.k. Social Sciences... Linguistics.. mahaamahopaadhyaayashriimitramishra. 381 pgs.. 1903. Literature. Language. kalidasa. 1913.. sanskritdocuments.. Sanskrit. 1962. viiramitrotayasya shraaddhaprakaasha. shrii veera raja charan gupta. Literature.. viduraniiti. Theology. Sanskrit.. 158 pgs. 1913.. Language. Linguistics.. Theology.. Literature. viind-aalaqs-and-amuu. vijaya vikrama vyayoga. Language. 1925.. 256 pgs. Sanskrit. 50 pgs.. Mahamahopadhaya Pandita Mitra Misra.. Literature. Linguistics. Language.. 394 pgs. vikramorvasiyam. 1959. vidhyaamaadhaviiyamu prathamasan'put'amu 1 5 adhyaaya. 674 pgs. 161 pgs. Language.x. 1923. 1916. 1914. vemana padyamulu. Mahamahopadhyaya Pandita Mitra Misra. Sanskrit. Sanskrit. Sanskrit. viiramitroodaya Vol.. 1070 pgs.ii. Literature. vidhyaamaadhava... 1955. Linguistics. Literature. Literature. vikramoovrashiiyamuu... raamajii upaadhyaaya. Sanskrit. Linguistics. Literature.. Language. Mahamahopadhyaya Pandita Mitra Misra. mitra mishra. kalidasa. Mahamahopadhaya Pandita Mitra Misra... shriimahaamahopaadhyaayashriimitramishra. 1917. ramamurti. 1932. 0. 1939. Sanskrit.. 1925.

Not available. vushhabhaanujaa.... Language. Swetharnia Narayana.. 120 pgs. Sanskrit.. viveika chuud'aamand-i. 1964. Sanskrit. Sanskrit. Literature. Language. Sanskrit. Language. 1925. Language. Psychology. Linguistics. Kuberanath Shukla. Linguistics. Literature. Sanskrit. lakqs-mii narasin'ha bhat't'aa.. 147 pgs. 1814. Linguistics.. Literature. shriishn'karabhagavatpaada. Rangaswamy Aiyangar. Sanskrit. bhaaratiitiirtha. M. Linguistics. Sanskrit. Literature. Sanskrit. visvasanskrit shatabdi granth yojnaaya. 516 pgs.. 725 pgs.. vrxttaratnaakara.. Literature.. nijagund-ashiva yoogi.. Sanskrit. Sanskrit. vrxttivaartikamu. shriikrxshhnd-aabhat't'a. vishhnd-usan'hitaa. Sanskrit. Linguistics. Sanskrit. Religion.. 237 pgs. Language. 1879.. 118 pgs. Sanskrit. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… vishhnd-ubhaktikalpalataa. 62 pgs. not available. 1893... 286 pgs. vishhnd-udharmoottara puraand-e trxtiiya khand-d'a. sanskritdocuments. Literature. M Rangacharya. 0. Sanskrit. Sanskrit. vivarand-aprameyasan'graha.. 1965. Literature. Linguistics. Not available.... Ramasastri Tailanga. 1926. Linguistics. 1964.. Theology. 1961.. 264 pgs. Sanskrit.. Rangacharya. Language. Linguistics. Sanskrit. Religion. 327 pgs. Religion. Literature. Sanskrit. Literature...org/…/SanskritIIIT.. Literature. vishhvaksenasan'hitaa..v.. Linguistics. 1940... 1892. vivarand-apajnikaa dvitiyo khand-d'an. Theology. vrajavilaasa. 244 pgs. Rangacharya. vivarand-apajnikaa ekaadasho bhaagan. vistaarikaavyaakhyaaya san'valita kaavyaprakaasha dvitiiyobhaaga. Sanskrit. vivarand-apajnikaa ashht'amo bhaagan. Language. Linguistics. 0. b j sandesara. 376 pgs. 169 pgs.. 2001. Sanskrit. Religion. 1942. Linguistics. vuttamautkika. Literature. 1965. paramaanandachakravarti. shriimadappayadiiqs-ita. Literature.. Language.... 1909.. Religion. Linguistics. 1972. vishhnd-udharmottaramahaapuuraand-a. 0.. 1956.. 0. Philosophy... 146 pgs. Language. 354 pgs. Not available. Bhrga Samhita. 482 pgs. T P Upadhyaya. Literature. Sanskrit. 272 pgs. Language..... 676 pgs. Literature. M. Language. 407 pgs. Literature. Not available. Sanskrit. Sanskrit. vivarand-apajnikaa dvadasho bhaagan. 1895. T. vrxddhasuuryaaruund-akarmavipaaka. Theology.. Language. 988 pgs. Language. Religion. 1972... vivarand-aprameyasan'graha vidhaarand-ayamuniprand-ita Vol 5 Sanskrit Text.… 165/167 .. Religion. shriimaduraadaasa.. 511 pgs. 268 pgs. Ganapathi Sastri. 44 pgs. Sanskrit. 1957. 1958. Psychology.. vrxttamuktaavalii. vivaakachuud'aamand-i kramaan'ka 93. Sri Kedara Bhatta.. Religion. Rangacharya. Religion.. 186 pgs. 413 pgs. 1963.. Sanskrit. Sanskrit. M. Linguistics. 1982. Sanskrit. 1962. Language.... Language. 382 pgs. vivarand-apajnikaa saptamo bhaagan... gan'gaavishhnd-u shriikrxshhnd-adaasa. shriisachchidaanan'dein'drasarasvati. vrxttaalang-kaararatnaadlii. 518 pgs. -. 440 pgs. 1953. Linguistics.. Literature. K. Sanskrit. Language. vyaakarand-a granthaa. Religion. viveikachin'taamand-i paart' I. Rangacharya. Sanskrit. vivarand-apajnikaa dashamo bhaagan. M. Theology. Linguistics. Language.. mahidharakrutayaa t ikayaa. Literature. viveikachuud'aamand-i. Sanskrit. vratakaand'amu chado bhaagan. 298 pgs. 440 pgs. Philosophy. 1931. vivarand-apajnikaa trutiyo bhaagan. Linguistics.

Language... vyutpattivaada guud'haarthatattvaaloka. Sri Maha Mahopadya Kapisthalamdesikacharya. Not available. Sanskrit. shriimadagadaadharabhaat't'aachaarya. vyaasashiqs-aa.. Linguistics.. sanskritdocuments. 886 pgs. vyavahaaramayuukha miimaan'sa.. 1230 pgs. Sri Varadaraja. 680 pgs. LITERATURE. 116 pgs... Sanskrit. Literature. Linguistics. Sanskrit. Literature. Religion. vyavahaaranir^nd-aya. 76 pgs. Literature. 1892. 1986. Language.. Philosophy.. Language... 1927. Linguistics. Linguistics. Sanskrit. LITERATURE. Not available. vyaaktiviveka vyaakhyaaya madhusuudaniivivrxtyaa. Literature. vyaktiviveka of rajanaka sri mahimabhatta..org/…/SanskritIIIT.. yaajnd-aavaalkyasmrithi. vyaaptipanj-chakamu.. vyaakarand-abaalabodha prathamobhaaga. vyaatpipanj-chakarahasyamu sin'havyaadhralaqs-and-arahasyan. Linguistics. Language. Linguistics. Not available. Sanskrit. Linguistics. 1929. 0.. 1150 pgs. 484 pgs. 98 pgs. Sanskrit. Linguistics... Literature. Sanskrit. 283 pgs. Sanskrit. 310 pgs. 1977. Linguistics. hari naaraayand-a aapat'e. Linguistics. 430 pgs. gopaalashaastrind-aa. 480 pgs. Language. Language.2/14/2011 A list of scanned Sanskrit books at III… vyaakarand-a puurvapashnaavalii. rewaprasada dwivedi. 0.… 166/167 . Sanskrit. 124 pgs.. vyaasasan'grahamu nov 1933. Language. vyutpattivaada. Theology.. 122 pgs.. Psychology. Language.. vyakaran siddanta kaumadi. yajnj-avalkyasmuti Vol I. vedavidhaalaya. Pandit Durgaprasad.. Linguistics. shriimathuraanaathatarkavaagiisha.. 630 pgs. Literature. pand-d'ita veing-kat'araamashammrond-aa. 1908. -. yaadavaabhyudaya. Literature.. Sanskrit. Sanskrit. Literature.. sircar mk. Sanskrit.. 492 pgs.... Literature. J. yogiishvarend-a maharshhind-aa yaagn-avalkyena.. 0. 114 pgs. Literature. 166 pgs. bapu shastri moghe. Sanskrit. Literature. shriivedaantachaarya. Language. Theology. Literature. Literature. vyutpattivaada guud'haarthatattvaalokena samudbhaasita. mahaamahopaadyaya kapistalama desikaachaariyara. vyaasataatpayenind-eya. Sanskrit. Sanskrit. 0. 0. Linguistics. yaagn-avalkyasmrxti viiramitrodaya mitaaqs-araa t'iikayaa. Language. 1931. Literature.. 1942. LANGUAGE. Sanskrit. Language. LANGUAGE. 1892. Language. Language.. vyakaran pradip. yaajushha jyautishhan' bhaashhya aarcha jyautishhan. 190 pgs.. Language. Language.. Sanskrit. Language. Language. 0. Linguistics.. Philosophy. Sanskrit. Language.... Sanskrit. Sanskrit. Religion. Literature. Sanskrit.. 1964. shriimadagadaadharabhat't'aachaarya. Sanskrit. Literature. Linguistics. 1933.... 270 pgs. LINGUISTICS. vyadhikarand-aprakarand-amuu. vyaasashiddhaantamaataand-d'a. shriimitramishra.. 0. 0.. Sanskrit. Sanskrit. Linguistics. 1937.. Literature.. 1929. 556 pgs. Literature. shriiraajaanakamahimabhat't'a. 0. Linguistics. 1950. Balasubramanyam. vyaasaadhikaarand-amaalaa. shriiniilakand-t'habhat't'a. somaakarasudhaakara... Linguistics. Language. Linguistics. 1942... 306 pgs. Social Sciences. Literature. vidvadbhi ke vi subrahmand-yashaastrii. Linguistics. yaagn-avalkyasmrxti trxtiiyaavrxtti. 1993. Sanskrit. vyaasasiddaantamaartaand-d'a. LINGUISTICS.k... Psychology. 722 pgs. 90 pgs. 568 pgs.

. yuktimallikaayaan'gund-asaurabhan. Psychology. Language. Sanskrit. vaajasaneyi madhyaandina shukla. 226 pgs. Linguistics. Language. yuktimallikaa. 484 pgs. 1903. Linguistics. 1903. 322 pgs. 1983. Sanskrit. 0. Not available.. Theology. navare ityupaabhidhakrxshhnd-asharmand-a.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit. 1897. Sanskrit. 1909. Not available. Not available. yathiraja vijaya natakam.. Language.. yoogasandhyaa. yoogavaasishht'he. Religion.. Language. Linguistics.. hari naaraayand-a.. Language.. Literature... 1919.. Not available. 0.. 218 pgs.. 802 pgs.. Sanskrit. 246 pgs. yudhishht'hiravijayamu vyaakhyaaya. Sanskrit. 126 pgs.. ghatikasatam vatsya varadacharya. Linguistics. Literature. 1857. Literature. Sanskrit. 616 pgs. Literature. yudhishthiravijayamu. Sanskrit. 252 pgs. Sri Vijnana Bhikshu. Sanskrit. Language. Sanskrit... 597 pgs. yogaratnaakara vaidyakagran'tha dvitiiyaasrxti. shriivaasudeva. 202 pgs.… 167/167 . 493 pgs. Sanskrit.. Literature. Sanskrit. yogaratnasamuchchaya dvitiyo bhaaga... Literature. Literature. 1849. Literature.. 969 pgs. Language. 1 0-9 A-D E-H I-L M-P Q-T U-Z sanskritdocuments. mahaakavi shriivaasudeva.. khemaraaja shriikrxshhnd-adaasane. 1834. Linguistics. Linguistics. Linguistics. Language. Philosophy. Religion. Literature. Linguistics. Linguistics... Theology. 1946. yajurveda san'hitaa. Sanskrit. Linguistics. 1884. khemaraaja shriikrxshhnd-adaasane.. Sanskrit.. Literature. Sanskrit. 0. yojavaar^tikama~. yatiindramata diipika. yogavaasishht'a bhaashhaa bhaaga 2 6 t'haa nirvaand-aprakarand-a puurvaarddhottaraarddha. Linguistics. 212 pgs. Literature.org/…/SanskritIIIT. Language. Search matched 4853 books with 1743368 pgs. shriishrutasaagarasurikutayaa. 1949. Language. Language. yashasitalakamu.. 802 pgs..

Sign up to vote on this title
UsefulNot useful