2/14/2011

A list of scanned Sanskrit books at III…

12780 laghupaaraasharii... gagaavishhnd-a shriikruushhnd-adaasa, General. Sanskrit, 2005. 44 pgs. 127801 vrxddhayavanajaatakama... davis pingree, General. Sanskrit, 2005. 452 pgs. 12782 kaavyaadashar... acharya ramachandra mishra, General. Sanskrit, 2005. 332 pgs. 12783 muhhuurtachintaamand-i... narayana acharya, General. Sanskrit, 2005. 492 pgs. 12787 taajikaniilakand-t'hii... pandit srimadhukantagana jyotishacharya, General. Sanskrit, 2005. 478 pgs. 12789 liilaavatii... pt.shri lakhanlal jha, General. Sanskrit, 2005. 386 pgs. 12790 rupachandrikaa... ramachandrajhaa vyaakarand-aachaayra, Religion. Theology. Sanskrit, 0. 318 pgs. 12790 rupachandrikaa... ramachandrajhaa vyaakarand-aachaayra, Religion. Theology. Sanskrit, 0. 672 pgs. 12793 sachitra jyotishha - shiqs-aa... b.c thakur, General. Sanskrit, 2005. 270 pgs. 12794 jyotishha vdaaraa roga upacchara... prem kumer sarma, General. Sanskrit, 2005. 214 pgs. 12795 shatayoogaman'jari... madhurakrishnamurthy sastry, General. Sanskrit, 2005. 92 pgs. 12796 muhuurtadarpand-amu... vavilla rama swamy sastrylu and sons, General. Sanskrit, 2005. 180 pgs. 12798 vitti evan' vuutti prabandha... aacharya mukund devagna, General. Sanskrit, 2005. 254 pgs. 12802 Jyotishha ratnaakara... devakiinandana sih, General. Sanskrit, 2005. 1118 pgs. 12803 dasharsurpakamuu... keshavaraava musalagaavakara:, General. Sanskrit, 2005. 574 pgs. 12804 saahityadaprand-ama... aachaariya sheshharaajashamaa regmii, General. Sanskrit, 2005. 1146 pgs. 12805 chamatkaara chintaamand-i... malaviyadaivajna dharmesvara, General. Sanskrit, 2005. 556 pgs. 12807 bharatiiya jyotishha... nemichandra sastri, General. Sanskrit, 2005. 450 pgs. 12808 sachitra jyotishha shiqs-a... b.c thakur, General. Sanskrit, 2005. 904 pgs. 12809 shhad'avagar phalamuu... krishan kumer, General. Sanskrit, 2005. 450 pgs. 12810 ladhupaaraasharii madhyaparaasharii... kedaaradatta joshii, Religion. Theology. Sanskrit, 0. 128 pgs. 12811 vrxddhayavanajaaakamuu... davis pingree, General. Sanskrit, 2005. 414 pgs. 12812 vasan'taraajashaakuna... -, General. Sanskrit, 2005. 610 pgs. 12815 saaraavaali... -, General. Sanskrit, 2005. 400 pgs. 12816 sarvaarda chin'taamand-i... sri kambampati ramgopalamurthy, General. Sanskrit, 2005. 328 pgs. 12817 maanasagarii... Dr . ramachandra pandey, General. Sanskrit, 2005. 540 pgs. 12818 brxhatparaasharaherashaastramu... madhurakrishnamurthy sastry, General. Sanskrit, 2005. 408 pgs. 12819 sachitra jyotishha shiqs-a... bii . ela . t'hakura, General. Sanskrit, 2005. 286 pgs. 12821 jyothisyashhabdakoshha:... Pandit Sreemathru Prasadha Pandeya, General. Sanskrit, 2005. 440 pgs. 12822 sachitra jyotishha shiqs-a... b.c thakoor, General. Sanskrit, 2005. 252 pgs. 12823 jyautishha- san'hhitaa... aacharya baskaranand lohini, General. Sanskrit, 2005. 272 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 1/167

2/14/2011

A list of scanned Sanskrit books at III… 12824 bhuvanadiipaka... pandit kashiram, General. Sanskrit, 2005. 88 pgs. 12826 svapnavaasavadantamuu... gang-ga'saagararaaya:, General. Sanskrit, 2005. 278 pgs.

12828 jyotirveidan... gobboru venkatananda raghavarao, General. Sanskrit, 2005. 230 pgs. 12831 prashnachand-d'oshvara... pandit vishnu dutt, General. Sanskrit, 2005. 88 pgs. A Catalogue Of Sanskrit And Prakrit Manuscripts In The Rajasthan Oriental Research Institute Part Iii A... Muni Jinavijaya, Unknown. Sanskrit, 1967. 626 pgs. A Cattalouge Of The Sanskrit Manuscripts... Dr.aryendra Sharma, Unknown. Sanskrit, 1964. 338 pgs. A Critique Of The Brahmasutra Part 1... P M Modi, Unknown. Sanskrit, 0. 530 pgs. A Critique Of The Brahmasutra Part 2... P M Modi, Unknown. Sanskrit, 1956. 422 pgs. A Descriptive Catalogue Of Sanskrit Manuscripts Volume I Part Ii... T P Upadhyaya, Religion. Sanskrit, 1953. 266 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts... P P S Sastri, Unknown. Sanskrit, 1929. 530 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts... Vidya Sagara, Unknown. Sanskrit, 1934. 452 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts Vo Iii... P P S Sastri, Unknown. Sanskrit, 1929. 632 pgs. A Descriptive Catalogue Of The Sanskrit Manuscripts Vol 14... Tanjore Maharaja Serfoji S, Unknown. Sanskrit, 1932. 523 pgs. A Dictionary English And Sanskrit... sir monier monier williams, Unknown. Sanskrit, 1957. 666 pgs. A Dictionary Of Sanskrith Grammar... Kashinath Vasudev Abhyankar, Unknown. Sanskrit, 1961. 436 pgs. A Grammatical Dictonary Of Sanskrit Vedic... Surya Kanta Sastri, Unknown. Sanskrit, 1953. 308 pgs. A Grammatical Word Index To Atharvaveda... vishva bhandu, Unknown. Sanskrit, 1963. 734 pgs. A Grammatical Word Index To Rigveda... Vishva Bhandhu, Unknown. Sanskrit, 1963. 648 pgs. A Grammatical Word Index To Taittiriya Samhita... vishva bhandu, Unknown. Sanskrit, 1963. 376 pgs. A Grammatical Word Index To The Four Vedas... Vishva Bandhu, Unknown. Sanskrit, 1963. 506 pgs. A Grammatical Word Index To The Principle Upanisads... vishva bandhu, Unknown. Sanskrit, 1966. 579 pgs. A Handful of Popular Maxims... Dr.m.d.balasuramanyam, Unknown. Sanskrit, 1983. 336 pgs. A Short History Of Sanskrit Literarure... T K Ramachandra Iyer, Literature. Sanskrit, 2002. 220 pgs. A Study Of Bharatas Natyasasatra And Avaloka On Dhananjayas Dasarupaka... Dr Manjula Gupta, Unknown. Sanskrit, 1987. 342 pgs. A Vedic Word Concordance Vol 5 Part 2... Visva Bhandu, Religion. Sanskrit, 1965. 174 pgs. A Vedic Word Concordance Vol Ii Part Ii... Visva Bandhu Sastry, Religion. Sanskrit, 1936. 746 pgs. Aachaara Bhuushhand-ama~ Grantha 57... Paahatryambaka Oko, Religion. Theology. Sanskrit, 1908. 449 pgs. Aachaara~yaa Abhyudayaa... D'indi'ma Raajanaatha~, Language. Linguistics. Literature. Sanskrit, 1945. 130 pgs. Aachaarendu Grantha 58... Aapat'e Hari Naaraayand-a, Religion. Theology. Sanskrit, 1909. 415 pgs. Aadhaanapadhdati... Aapat'e Mahaadeva Chimand-aajii, Religion. Theology. Sanskrit, 1947. 145 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 2/167

2/14/2011

A list of scanned Sanskrit books at III… Aagaashe Ispupaahai Gran'tha 5... Aapat'e Hari Naaraayand-a, Philosophy. Psychology. Sanskrit, 1912. 103 pgs.

Aanandakandachampuu... Mishraa Mitra, Social Sciences. Sanskrit, 1931. 260 pgs. Aapastambashulbasutrama~... Aapastan'ba, Philosophy. Psychology. Sanskrit, 1931. 352 pgs. Aapastambiiyan' Shraotasuutrama~... Chaara~ya Narasin'haa, Religion. Theology. Sanskrit, 1944. 816 pgs. Aapracharya Yasak Ki Vedvyakhya Paddhati... Dr Gyan Prakash Shastry, Unknown. Sanskrit, 1985. 164 pgs. Aapradarshprastavmala Vol I... Pandit Sri Vishwanath Shastry, Unknown. Sanskrit, 1951. 147 pgs. Aaprayyorday Kavyam Poorvadharm... Pandit Ganga Prasad Upadhyay, Unknown. Sanskrit, 0. 250 pgs. Aapstamba Shulba Suutrama~... Chaara Shriinivaasa, Religion. Theology. Sanskrit, 1931. 352 pgs. Aara~tha Shaastra Padasuuchii Trxtiiyo Bhaaga... Shaastri Shamaa, Social Sciences. Sanskrit, 1925. 358 pgs. Aara~thavara~nd-a Jyotishhama~... Dattaa Bhagavata, Religion. Theology. Sanskrit, 1924. 45 pgs. Aara~yaasaptashatii Faskikyulasa~1,2 Cha... Shriivishveshvaraapand-d'ita, Religion. Theology. Sanskrit, 1925. 376 pgs. Aashvalaayana Shraota Suutrama~ Prathamo Bhaaga... Shaastri Man'gala Deva, Religion. Theology. Sanskrit, 1938. 187 pgs. Aath Shri Madrunu Bhasyam... Shri Vallabha Charya, Unknown. Sanskrit, 0. 792 pgs. Aath Shrimadbhagwatha Darshini Ekhadarshaskarandra Prarbhaythe... -, Unknown. Sanskrit, 0. 478 pgs. Aath Smrithisaarodhwarprarambh... -, Unknown. Sanskrit, 0. 102 pgs. Aath Vamanpuranam Prarabhyathe... -, Unknown. Sanskrit, 0. 420 pgs. Aatmadarshanam... Vedhanth Anjaneyakumara Swamy, Unknown. Sanskrit, 1987. 178 pgs. Aatyoug pradipika... Shemraj Shri Krishnadass, Unknown. Sanskrit, 1874. 236 pgs. Aayura~vedasutrama~... Yogaanandanaatha, Philosophy. Psychology. Sanskrit, 1922. 356 pgs. Abhidavimarsh... Yogeshwar Dutt Sharma, Unknown. Sanskrit, 1980. 150 pgs. Abhidhaana Ratnamaalaa... Aupharet'a, Language. Linguistics. Literature. Sanskrit, 1928. 419 pgs. Abhidhana Manjari Of Bhishagarya... Shankar Sharmana, Unknown. Sanskrit, 0. 530 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrit Vol I... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 1056 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrit Vol I I I... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 1378 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrith Vol I V... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 1297 pgs. Abhidhanarajendrah Prakrit Magadhi Sanskrithvol I I... Vijayarajendra Suri, Unknown. Sanskrit, 1910. 728 pgs. Abhidhanarajendrah Prakriti Magadhi Sanskrit Vol 6... Vijayarajendra Suri, Unknown. Sanskrit, 1985. 1482 pgs. Abhidhanarajendrah Prakriti Magadhi Sanskrit Vol 7... Vijayarajendra Suri, Unknown. Sanskrit, 1985.
sanskritdocuments.org/…/SanskritIIIT.…

1217

3/167

Addaitasiddhi Dditiiyan' San'skarand-an. Abhidhanarajendrah Vol. Theology. Acharya Jinabhadras Visesavasyakabhasya Part Iii. Theology. Abhijnana Sakuntalam Naam Natakam. Adharsha Prasthav Rathnamala. sanskritdocuments. Advaitasiddhi Prathamasamput'ama~. Theology.. Language. 210 pgs.. Sri Guru Prasad Shastry. 1950.. Abhidhara~maasamuchchayasya. Sanskrit.org/…/SanskritIIIT. 120 pgs. Dalshuk Malvania. Sarasvatii Madhusudhanaa. Sarasvatii Madhusudhana. Agnipuraand-ama~ Grantha 41. Literature... 1968.... Sanskrit... Satavadhana Srinivascharya... Vasubandhu.... Unknown. 1933. Srimath Paramhans Parivrajakachary. 1950.5.. A N Krishna Aiyangar. 326 pgs.. 0. Sanskrit. Unknown. Narakand-t'hirava Shaastri Vat't'ipalli.. Vijayarajendra Suri. Shaastri Vaamana. Technology. Srimannarayana. Social Sciences. 1861. Abhidharmakocarikah. Ganesh Kashinath Kale. Linguistics. 1992.. Sarasvatii Madhusudhana.. Abhisamayalankara Prajnaparamita Upadesa Sastra. Rasiklal C. Ghoshhaka. Paand-d'uran'ga Oke Mahadevo.. Unknown. Sanskrit. 161 pgs. Unknown.. 0. Unknown. Unknown. Pandith Damodar Sharma Gaud. 364 pgs. Sanskrit. Psychology. Philosophy. Acharya Ddhruva Smaraka Grantha Vol 3. Abhijnana Sakuntalam.... Sanskrit.. Abhijnana Sakuntala.. Sanskrit. 260 pgs. Unknown. 1922.. Pandit Ramachandra Sharman. 522 pgs. 1992.. Unknown.. Psychology. 1946.. 1950. Unknown. Abhidhara~maamrxtama~.. Unknown. Aasn'ga.. Sanskrit. Unknown...obermiller. Sanskrit. 518 pgs. 0. 532 pgs. Sanskrit. Abhidhanaratnamala.... Sanskrit. Abhijnana Sakuntalam Of Kalidasa. 1618 pgs. 1991. 0.. Unknown. Sanskrit. 1937. Advaitasiddhi Trxtiiyasamput'ama~. 0. Mahakavi Kalidasa.. Vijayarajenda Suri.. 170 pgs. Unknown. Sri Chelamcheral Rangacharya. 1910.… 4/167 . 1953. Th Aufrecht. Agnihotra Chandrikaa Grantha 87..... Sanskrit. 1964. 1953. 1982. Sanskrit. Unknown. Psychology.. 40 pgs. Abhinavaratnamaala Davitiiya Bhaaga. Unknown.. Abhijnana Sakuntalam. Sanskrit. Unknown. Abhilekha Sangraha Sixth Khandah. Parikh. 1900. 464 pgs. Religion. Sanskrit. 1301 pgs.. Abhidharmamrta Of Ghosaka. 1921. Abhinava Vaasavadatta. 100 pgs. Abhidhanarajendrah Vol. Sanskrit. Religion.. 405 pgs. 152 pgs... 134 pgs. Bahadur Chand Chhabra. 172 pgs. Sanskrit.. Sanskrit.. Aapat'e Hari Naaraayand-a. Sanskrit. 1910. 732 pgs. 648 pgs. 879 pgs. Sanskrit. Religion.. Sanskrit. Sanskrit.. Asan'gaa. Theology. 130 pgs. 690 pgs. Shanti Bhikshu Sastri. 208 pgs. 284 pgs. 194 pgs.. Religion. Sanskrit. Unknown. 0.. Abhidhara~masamuchchaya. Acyutarayabhyudaya Of Rajanatha Dindima.kale. Sri Viswanatha Shastri Prabhakar. 620 pgs. 993 pgs. Sanskrit. Unknown. Sanskrit.. 1945. Abhijnana Sakuntalam Of Kalidasa. Philosophy. 1912. Abhinavam Prasutitantram First Edition. Unknown. 304 pgs. E. Sanskrit. Philosophy. 1950. Adharva Vedha Samhitha. Sanskrit.. 882 pgs. Adhyathyamramayana Vol Iii. Unknown. 1990. Unknown. Sanskrit. Sanskrit.4. Advaithdeepika...2/14/2011 A list of scanned Sanskrit books at III… 1217 pgs. Mr. 1940. Sanskrit..

Alang-kaaramand-haara Trxtiiyo Bhaaga. Gaurinath Sharmana. Religion.. 69 pgs. Literature.... Unknown. Paand-d'eya Shriivishveshvara. Akasmika Dana Laba Ke Yoga. Parakaalasvaamii Shriikrxshhnd-abrahmatantra. Sanskrit. Ajnanadhavanta Candabhaskarah.. History.. Amara Bharathi Astami Kaksha. Alang-kaaramand-ihaara Prathamo Bhaaga. Alang-kaaramand-ihaara Trxtiiyo Bhaaga. Subrahmanya Sharma. 134 pgs. 262 pgs.. 876 pgs. Language. Parakaalasvamii Shriikrxshnd-abrahmatantra.sivadatta. Sanskrit.. Sanskrit. 252 pgs.. 1929. 1923. Sanskrit..org/…/SanskritIIIT. 98 pgs. 1987. 1921. Sanskrit. Alphabetical index Of The Sanskrit Manuscripts Vol I. brahmananda tripathi. Dr Raj Kumari Trikha. Unknown. Amarakosa Namalinganusasanam Of Amarasimha.. Sanskrit. 1983..... History. Language. Alankara Sangraha Of Amrtananda Yogin. Language. Sanskrit. Religion. 1943. Sanskrit. Unknown. 338 pgs.. k bhaskara rao. Alang-kaaramand-ihaara~ Chatura~tho Bhaaga. Mm.. Unknown.. 1942.. Language. All India Oriental Conference Thirteenth Session Nagapur University October 1946. Akaradhanukrmanika. Literature. Linguistics.. Sanskrit. Literature. 0. Sanskrit. Sanskrit. sanskritdocuments.2/14/2011 A list of scanned Sanskrit books at III… Aitareya Brahmana Of Sadgurusisya Vol I 1 To 15 Adhyayas.. Linguistics. 46 pgs. Aanandagiri. R. 1917. 1923. H L Jain. 520 pgs. Language. 1982. 1981. Biography. Alang-kaara Kaumudii. Parakaalasvaamina~ Shriikrxshhnd-abrahmatantra. Parakaalasvaamii Shrii Krxshhnd-abrahmatantra. Suranad Kunjan Pillai.. Religion.. 139 pgs. Alankarakaustubha Of Kavi Karnapura.. Unknown.. 1951. Linguistics. Geography.. 0. Jaggu Venkatachari. v krishnamacharya. Theology. Theology.. Literature. 1986.. Alankarathatvascha.. 1964.s.. Linguistics... Literature.. 662 pgs. Sanskrit.. Alamkaras In The Works Of Banabhatta. 1923. Sanskrit. Sanskrit.. Amara Shatakamu. Sanskrit. Art.. 138 pgs.. Amara Bharathi. Unknown. 1982. Sanskrit. 282 pgs. Parakaalasvaamii Shriikrxshhnd-abrahmatantra. Alang-kaaramuktaavalii. Alang-kaaramand-ihaara Chatura~tho Bhaaga. Alang-kaaramand-ihaara Da~tiiyo Bhaaga. Aldankar Sarvasvam. 441 pgs.. 559 pgs. Sanskrit. 1997. Sanskrit. Literature. 339 pgs. Sanskrit. Shastrii Esa~ena~. Geography. Enter Subject Of The Book.. C. Parakaalasvamii Shriikrxshhnd-abrahmatantra. Unknown.. 1927. Sri Bharateeya Yogi.. Misropahvedacharyapandithsrivamshidharshastriyna. Surya Narayana Murty. Language. Alankaraustubha Of Visvesvara Pandita. 100 pgs. Anantakrisna Sastri. Sanskrit. Parakaalasvamii Shriikrxshnd-abrahmatantra. 1950. 1996. Alankaramand-ihaara Trxtiiyo Bhaaga. Sri Amaru Kavi. Sanskrit. Lokanatha Chakravarthin.. Literature.. Linguistics. 242 pgs.. 182 pgs. 1929.. Sanskrit.v. 369 pgs. 449 pgs. Unknown.. Biography... 1984. Unknown. Sanskrit. 1949.. Unknown. 368 pgs. 319 pgs. Alamkarasamgraha Of Amrtanamdayogin.. Theology. Theology. Sanskrit. 1957. Religion. Sanskrit. 334 pgs. Unknown. 366 pgs. 1931. Kondapudi Apparao.… 310 pgs 5/167 . Unknown. 94 pgs.. Linguistics.. Sanskrit. Sanskrit... Aitareyopanishhata~ Panj-jamii Khand-d'a Grantha 11.

. Unknown. H H Wilson. 709 pgs. Andhra Bhagvthanuvad. 1986.. An Anthology Of The Epics And Puranas. Literature. Literature...aruna Gupta. 1940. Prof. 358 pgs. Unknown. An Anthology Of Subhashitas Part Two. 1952... sri amar singh. Shriimuraarimishra Mahaakavii. 358 pgs.. Narayan Bhatt. Anara~gharaaghavama~ Trxtiiyo San'skarand-ama~. 1995.. Mahiipa. M. Sanskrit. Anandasundari.. 524 pgs.. 1947. Amarakosa of Amarasimha. Viswanath Bhatt. Unknown. Haragovinda Sastri. Sanskrit. 168 pgs...… 6/167 . V Raghavan. Anandasramsanskritgradhavali. Anekaara~thatilaka. Sanskrit. 138 pgs.... Dr Ram Naresh Tripathi. Literature. 66 pgs. 268 pgs. 0. Sanskrit.. Unknown. Sanskrit. 571 pgs. Language. Sanskrit.. Unknown. History. Unknown. Religion. Sanskrit. Sanskrit. Unknown.. Unknown. Sanskrit. 1936. Unknown. Amarakosah Dwithiya Khandah.... Anandashram Sanskrith Granthavali Trishtlisethu. Shriman Mahadev Chmanji Aftee. Amelioration Genetique Des Arbres Forestiers Forets 20...kale. 1866. Mr..org/…/SanskritIIIT. Amarkosha Of Amarsingh. Ttd. Anandh Samastha Granthavali. Unknown. Anandanandini.r. Unknown... 1979.. A N Upadhye. Unknown. 375 pgs. Sanskrit.. Linguistics...snankarsastri marulkar. 305 pgs. Sanskrit. 2000. 1955. Annamacharya And Surdas... 1970. 1932. Geography. Ogale Gurunaathaprabhakara. 745 pgs. Mamchala. Anekaathara~tilaka.s. Sanskrit. Dr. Sanskrit. 1947. Kuttakarshiromani. Sambu Prasad. 1999. An Indian In Western Europe. 1961. Sanskrit. Linguistics. Sanskrit. Annanda Sramasamskrutha Grandavali. Sanskrit.. 136 pgs. 233 pgs. Sanskrit.. Anthya Karmadeepika. Ancient Indian Economic Thoughts.. 168 pgs. 336 pgs. Ananda Ramayana. Nithyananda Parvathiya. Unknown.. 1985. Amerika Bhaaga Pahilaa. Sanskrit. 0. Sanskrit. Pandith Haragovinda Sastri. Jean Paul Lanly. Sanskrit. 736 pgs. Sanskrit... Arjunavarmadeva. Amarkosh Pratham Kandam. Unknown. Sanskrit. Sanskrit. Amarzakosha Vigraha Comm. . 130 pgs.. 1969. Literature.. 377 pgs. 1998. Anandashramasanskruthagranthavalihi. Sanskrit. S K De... Unknown. 242 pgs. Amarakoshah.s. 468 pgs. 1993. Chandra Sekhara Sharma.. Anu Bhashya Vallabhacharya Art Sanskrit 1921 495 pgs sanskritdocuments.. Literature. An Anthology Of Poetry And Drama Part I. Unknown. Jaganadha Rao. 388 pgs. Sanskrit.. Ramaswarupa Bholanath Pandit. Literature.. 1864.... 1971. 0. Amarkosh Namalingaanusasana. 1981. 70 pgs.. Sanskrit. Amhar Vani (sathvi Kaksha). Unknown. 1990.. V. Madhukar Mangesh Patkar. Shiromani Sannidhanam Suryanarayanshastry. Language. pgs.2/14/2011 A list of scanned Sanskrit books at III… 310 pgs. 258 pgs.... 400 pgs. Anekartha Tilaka Of Mahipa. 239 pgs. 1947.tirupati. 236 pgs.. 1983. Dr V Raghavan.. General.. 1939. Biography. An Introdution To The Grammar Of The Sanskrith Language. Amrau Shatakam.. Sanskrit. Sanskrit... 1984. Theology. Language. Unknown. Unknown. Sri G A V Ms Uppalacharyulu. Unknown. 300 pgs. 314 pgs. Sanskrit. Sanskrit. Unknown. 194 pgs. Mahiipa. 328 pgs. Sanskrit.. Unknown. Sanskrit. 1952. -.... 1984. Linguistics.

122 pgs. 1955. 0. Unknown... 1951. -. Anustana Prakasaha Mahanibandhaha.. Sanskrit.. 0.. Ara~thashaastrapadasuuchii Prathamo Bhaaga.. Sanskrit. . Unknown. 2000. Aryavidya Sudhakara. Linguistics. Aparajitaprccha Of Bhuvanadeva. -. 1955. Apastambasrautasutra Dhurtasvamibhasya. 0. 720 pgs.. pgs.. Sanskrit... 277 pgs. Sanskrit. 896 pgs. Astadhyayisutrapatha. Sanskrit... Sanskrit.. Psychology. Shaastrii Shriichaarudevashaastii. Apastambagrihya Sutra. 1928. Arthavedatdhasamhitha.. Maharshi Panini.... Theology. Swamy Pramodgiri Vedanthkishore. Social Sciences. Ara~tha Shaastra Padasuuchii Prathamo Bhaaga. Popatbhai Ambashankar Mankad. Unknown. Ardh srimadbagavathardha dharsan vol 1. Arthvaved Sanhita. Sanskrit. Arthasatra Of Kautilya Vol Ii. 1940. 492 pgs.. Social Sciences. . Religion. 469 pgs. Sanskrit. 0. Sanskrit.. 72 pgs. 1998. Ashtanga Samgraha. Sanskrit. 0... Religion. Srinivasa Murti.. Anuvrath Vidhya Trishati. Sanskrit. Artha Sastra Of Koutilya... Religion. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Anumana Pramana. Kunj-chanaraaja Chi Dakt'ara~.org/…/SanskritIIIT. R Shama Sastry. Dhamodar.. Unknown.. Unknown. Theology..t. 459 pgs.. Anuvaada Kalaa Athavaa Vaga~vyavaharadara~sha. 1925. 1955.... 1927. Aprakaashitaa Upanishhadah. 247 pgs.. 346 pgs. Sanskrit... Arya Salistambe Sotra. 1924. 1986.. J Jolly. 1924.. 1950. 1924.. 473 pgs. Shaastri Shamaa. Astadasasmrtayah.. 588 pgs. Anusuchi. Apaharvarma Charita. History. Shaastri Shamaa. 1950.. Somraj Krishna Das. Ashtadyayi Sutrapaat. sanskritdocuments. Sripad Damodar Satvalekar. 444 pgs... 1064 pgs. Sanskrit. Sanskrit... 1924... 1989. Asalayina Gruhasutram. Unknown.. Unknown... 289 pgs. Ved Prakash Shastri. Sanskrit. 1948. prasanna kumar acharya. Unknown. 280 pgs. A Chinna Swami Shastrulu.. Sanskrit. Ramachandra Sharma. Sanskrit.. Unknown. 0. 1924. Literature. 865 pgs. Unknown. Sanskrit. Unknown. Sanskrit.. 458 pgs. 1931. Apabhran'shakaavyatrayii. 469 pgs. 762 pgs. Ashvinao Devtaki Bhoomika. Unknown. Philosophy. Sanskrit.. Ardh Srimadbagavathardha Dharsan. 0. Pandith A Chinnaswami Sastri.. 346 pgs. 986 pgs. Unknown.. Sanskrit. Sanskrit. 367 pgs.… 7/167 .. 472 pgs. 158 pgs. Unknown. Sanskrit. History. Architecture Of Manasara. 540 pgs. 248 pgs... Social Sciences. Language.. 330 pgs. Sanskrit. Vidwan Shivasri. Shaastrii Shaamaa. Unknown. 157 pgs. Unknown. Arya Salistamba Sutra. Ramchandra Sharmane.. Dr Bali Ram Shukla. 1950. Jindaattasuurii. Sanskrit. Sanskrit... N Aiyaswami Sastri. 1923. Sanskrit. Sanskrit. Sanskrit. Unknown.. Unknown. Theology. Unknown. . Apasthamba Sulba Sutra. Yajneswara Cimana Bhatta. D Srinivasacharya. Sanskrit. Sanskrit.. Unknown. 552 pgs. 0.. Unknown. Ganapati Sastri. 1976. Arthasastra Of Kautilya. 262 pgs. Ara~tha Shaastra Padasuuchii Dditiiyo Bhaaga. Vethanamanom.

Religion. 266 pgs. Sanskrit. 650 pgs.Vivaram-vranam. 106 pgs.... Nakula. 0... 1955. -. Sanskrit.. 234 pgs. Theology. Theology. Theology. Athagreya Mahapuranam. Sanskrit.. 696 pgs. 404 pgs. Sanskrit. Athara~va Pratishaakhyama~ Prathamogyan' Bhaaga. 1922... 666 pgs. Literature. 594 pgs. Unknown.. Atharva Vedha Samhita Mulya Mantra Sayaye Bhashya Kshiks Kandah. 986 pgs... -. 340 pgs.. . . Sanskrit.. Sanskrit.. pgs. 288 pgs.. Atha Tatpurusha Prakaranam.… 8/167 . Literature. Ath Sriskanandmahapuranam. Sanskrit. Unknown.. Asvalayanagrhyasutra Bhasyam Of Devasvamin.. 362 pgs. Atha Tatpurusha Prakaranam.vishnuteertha.org/…/SanskritIIIT. 1956. Sanskrit.. Sanskrit. 180 pgs.. 0. Gulab Chand. Sanskrit.. Religion. 0.2/14/2011 A list of scanned Sanskrit books at III… Astam. 363 pgs... Shiva Sharma.v.Puspam. 1644. Pandith K P Aithal. Shaastrii Raamagopaala. 1928. 1824 pgs.. 1952.. Sanskrit. Sanskrit. Sanskrit. Ath Sriskand Mahapurane Brahmkhande Sethumahatmay Vol I I I. 73 pgs. 0. Linguistics Literature. Atharavaanaa Upanishhada Second Edition. 555 pgs. 0. Atha Tatpurusha Prakaranam. Rama Chandra Sharma. Asthadhyayisutrapaath. Shri Anand Van Aagadi. 1944... Sanskrit.c. Religion. 562 pgs. Dr. Literature. 0.. Religion.. -. Jacob G A. 867 pgs. Sanskrit. -. Asya Vamasya Hymn. 257 pgs. Unknown.. Ath Sriskande Mahapuranm Vaisnavkhande Venkatachalammahatmay Vol I I.. 214 pgs. 0. 1955. Atmadarsanam. 130 pgs.a. Somraj Krishna Das. Sanskrit.. Ath Vishnudharmottar Mahapuranam. Ath Srimaddwaramahapuranam. Unknown... 520 pgs. Unknown. Sanskrit. Unknown.. Sanskrit. . . Religion... Unknown. Unknown.. Ath Koormmahapuranam Prarabhyate.. Unknown. 0. Unknown. 1951.. saayand-aachara~ya. Sanskrit. Shri Anand Van Aagadi. Sri Venkatesho Vijaytetram. Bhagavadatta.. Sanskrit. 668 pgs.. Sanskrit. Sanskrit. 1996.. Atma Purana. 547 pgs. Theology. Sanskrit. 1996. 0. . Unknown. Theology. Religion. Dr... -. Ath Shuklayajurvedakavya Samhitha. Sanskrit... 0... 100 pgs. Acharya Sri Sitaram Shastri. Theology. Atma Purana With Hindi Commentary. 1923. Sanskrit. Athavarvediiya Panj-chapat'aalikaa. Atha Gaayatrii Tantra. 1916. 1895... Athara~vavediiyaa brxhatsara~vaanukramand-ika. 436 pgs. Ityupaadhidhaarind-aa Ema O Ela. Unknown. Sanskrit.. Religion. . Sanskrit.. Athara~vedasan'hitaa Bhaaga 2. Religion. 1987. P. 1898. Athara~vavedasan'hitaa Trxtiiyobhaagaa.. Religion. -.. Sanskrit. Ath Sriskande Mahapurane Shanst Nagar Khand I I I. Asvasastram... Theology. Atma Praboda. Theology. 1920. Damodar Sathwalekar. 0. 1955.kunhan Raja. Asvalayaand-a Graha Suutraa Vol I. Atharva Vedha Samhitha. Religion. Sanskrit. 0. Ath Srimnmatsyamahapuranam Prarbhyate. Unknown.. Unknown. Tira~tha Svaami Ravi. Astanu Hrudayam. Sanskrit. Saayand-aachara~yaa... Theology. . 0. 1037 pgs.. 0. Baladevaprasaada. 0. 310 pgs.kumaraswamy.. 483 pgs.... Unknown. Unknown. Sanskrit. 263 pgs. 474 pgs. sanskritdocuments. . Sanskrit. Sanskrit..

Language. 382 pgs.. Sanskrit.k.. 1933.. Dr... Sanskrit. Unknown.org/…/SanskritIIIT.2/14/2011 A list of scanned Sanskrit books at III… Atmarpanastutih. Shriimadatkhand-d'adeva.. 1899. C.. Geography.. Philosophy. Unknown. 1939.k. kaas'inaatha paanduranga paraba. 1982. kalluri ahobila rao. Unknown.. 1962. Unknown. Sanskrit.. 1924.kunhan Raja.. 602 pgs. Religion. Kapaaliishaastrii Ti Vi. Unknown. 132 pgs. Sanskrit. Sanskrit. 772 pgs. Bhagavadajjukam. Religion. Language. 206 pgs. S. Bhaashhyaara~tha Ratnamaalaa Grantha 75.. 1965. Sanskrit.a. 290 pgs.. Veturi Prabhakara Shastry. Sanskrit. Sanskrit. Balaramayana... Sanskrit. Sri Sankaranarayana. Unknown. Sanskrit. Mahaakavii.... Religion. Literature... 1948. 52 pgs. Sanskrit. 1945.. Theology. Sanskrit.. Beejganitham Vol I I I. Theology. Bhaat't'adiipikaa Niviitaanto Bhaaga 1. Philosophy. Sanskrit... 1984. Aunadikapadarnava. 674 pgs. 0.. Dr. Language... Literature. Bhaaminiivilaasa. Sanskrit. Unknown. 190 pgs. Sanskrit. 1935.. 1933. Padhye. Avadanacataka A Century Of Edifying Tales Vol I. History. Baapuu Gokhale Yaan'chen' Charitra. Psychology. 1956.. 480 pgs.. 1902.... Geography. Unknown.. 191 pgs.. 1941. 442 pgs. Theology. 126 pgs. Aund-aadikapadaara~nd-avah. 1986. 401 pgs. 324 pgs. Theology. Unknown. Linguistics. The Greatness Of Badari Kshetram Or Holy Place. Sanskrit.. 346 pgs. Aya Srimadhnrumatrayam. Sanskrit. 1054 pgs.. p sri ramachandrudu. Avachedakatvanirukti Of Sri Jagadisha Tarkalankara With Lakshmi Commentary. 324 pgs. Ratna Ketamkavi. Bhaamatii Prathamo Bhaaga.. Paarasaniisa Dattatrayabalavan'ta. Ayurvedabdhisara Part 1. Vaachaspathimishraa.. 1927. Sri Durga Prasad Divyvedaen. Literature.bhatt. Aund-aadikapadaand-ara~va Grantha 7.. Ayodhyeche Nabaaba.... Shaaligraama Shan'karatukaaraama. History. 1939. Sanskrit. 136 pgs.… Bhagavadgaiitaa Bhaaratiiyadashara~naani Cha Shaastrii Ananta Krxshhnd-a Religion Theology 9/167 . Jaikrishndas. Speyer. Sanskrit. Bakthamala Ramramsikavali. Chintaamand-ih Ti Raa. Unknown. Biography. Unknown. Bala Bharatam.. Sanskrit. Sanskrit.. 1915.. 51 pgs. J.. 125 pgs. Sanskrit. Linguistics. Bhaaratiistava Prathaman' Mudrand-ama~. 1989. 327 pgs. 1983. Ayurvedhakandah. Balabharatham Of Agastya Pandita.s. Religion. 280 pgs. Sanskrit.. Pand-ashiikarasan'shodhitaa. Sanskrit.. 412 pgs..ganga Sagar Rai. 1922. Unknown. Psychology.. 1958. Avantisundariikathaa. Sanskrit. 1991. Literature.h. sri laxmiramaswami mahabhagavanamu. Baktha Mandram. Beauties From Kalidas. 432 pgs. 1964. Biography. -. Sanskrit. Literature. G. Swami Sri Dharmananda. Ayurved Vigyanasar. 294 pgs. Bhaaminiivilaasa.. 1889... 1983.. Linguistics.. 182 pgs. sanskritdocuments. Unknown. Chantaamand-i Ti Raa. Subrahmand-ya. Raramurthi. K S Ramamurty. Baismi Parinaya Champu. 146 pgs. Sanskrit. Sanskrit. Literature. Unknown.. Sanskrit. 193 pgs. Baoudhagamarth Sangraha.. Vaidhopahsriparushuramsharma. 1939.

1973.. 1921. Panditraja A Subramanya Sastri. Bharata Kaumudi Part I. Bhatti Kavyam Canto 10.. Swetaranyam Narayana Sastriar. Literature. Sanskrit. 512 pgs.. Matha. 0. 1945. 316 pgs.. Sanskrit.ramachandra Dikshitar. Unknown.. S R Sehgal. Bharathiy Darshan Me Parivarthan Ka Swarup Vishestha Boudd Darshan Ke Sandarb Me. 860 pgs.. 1985... 1944. 1956. Sanskrit. Unknown. Manju. Unknown.. 306 pgs.. Kumudranjan Ray. Bhartiya Darshan Ka Itihas. 1991... Bhakti Chan'drikaa. Bhagavata Tippani Chalari. Unknown. 552 pgs.jd... Bhasa Ki Sambhandi Thatha Natakiya Visheshathaye.. Har Dutt Sharma. 1952.. Sanskrit.. Bhagavadgitha Anandatirtha. Dr Radha Kumud Mookherji. . Sanskrit. 1959.. Bhasa's Pratima Part Ii Natakam. Sanskrit. 519 pgs. Unknown. 0. .. Religion. S Subramnya Sastri.. .. Sanskrit.. Bhasa's Pratima Part Ii Natakam.r. 240 pgs.. Theology. Bharatarnava Of Nandikeswara. 174 pgs. M. 1942. Literature. 589 pgs. Unknown. 1335 pgs. Unknown. Bharatarnava Of Nandikeshwar. 1942. Bhamti Ekk Adhyayan... Shaastrii Ananta Krxshhnd-a. 1968.. 954 pgs. Sanskrit. Dikshit Jd. Sanskrit. 0 pgs. 165 pgs.. Bharathi Nirukth Vedh Swarup Darshan. Unknown.. Naaraayand-atiira~tha. Vacant. pgs. Unknown.. Sanskrit. Bhagavatham With Curmikatika Vijayadwaja Tirtha Padaratnavali 1892. Bhas Kee Bhasa Sambandhee Tat(natakeeya Visheshtaem...2/14/2011 A list of scanned Sanskrit books at III… Bhagavadgaiitaa Bhaaratiiyadashara~naani Cha. Unknown. Sanskrit. Sanskrit. Sanskrit. 1933.. Unknown. 1978. Bhaismiparinayacampu. Saradaranjan Ray. Sanskrit. Bhatta Dipika Uttarasatka Part I I. 1887. 0. Religion.. Bhagavantabhaskara Of Sri Nilakantha Bhatta Vol I I. Sanskrit. Unknown. 1981. Dikshit. 252 pgs. Dr. 1985. Bharata Natya Darsanam. Unknown..… Bhatti Kavyam Canto 11 12 Saradaranjan Ray Vidya Vinoda Unknown Sanskrit 0 280 pgs 10/167 . 1959. S.n. 297 pgs... Sanskrit. Sanskrit. V. Unknown... sanskritdocuments. Sanskrit. Sanskrit. 1921.. 383 pgs.r.. 1935.. 1985. Unknown. V S Venkata Ragavacharya. Sri Laxmana Sastry.. Sanskrit. 172 pgs. 510 pgs.. Unknown. S. 120 pgs.org/…/SanskritIIIT. Theology.. 340 pgs.surya Narayana. 1951.. Literature. Sanskrit. Sanskrit. Unknown. . Sanskrit. . 712 pgs.... Bhatruhari S Neetisataka. Sanskrit. Bharadvajasiksa. Bhatta Chintamani Tarkapada.. 316 pgs. 798 pgs. Sanskrit.. 1938. Janaswamy Subramanya Shasthri. Vachaspti Gairola. K Vasudeva Sastri. Bhagavantabhaskara Of Sri Nilakantha Bhatta Vol I.. Venimadhav Sahastri Musalgonkar. Sanskrit. 291 pgs. 1983.. Sanskrit. Sanskrit. 1936. Unknown. Literature.. 304 pgs. 1938. General. Kumudranjan Ray.. 518 pgs. Ananta Deva. Sanskrit.dasgupta. Venimadhav Sahastri Musalgonkar. 1952. Bhasas Balcharitam. Sanskrit. Art. 442 pgs. Bhatta Dipika(uttrasatka Part I) With The Prabhavali Of Sambhu Bhatta. Bhattaldankartikaythu. Unknown. Bhattalankara Tikayuta.. n gopalapanicker... Bhaminivilasa.. 0. 111 pgs. Bharatiyam Vrttam. Eeshwar Singh... 112 pgs. 223 pgs.. Sanskrit.. Unknown.

rajendralal. Unknown. Unknown. Geography. 1856. Sri Vyasaraja Tirtha. Bhelsanhita. Unknown. Kavikarnapura. Unknown. Bhava Prakasika. Sri Girijadayalu Shukla.. Sri Govind Das. Bibliotheca Indica Volume 71 5... Sanskrit. Linguistics. 722 pgs. Bhuhgoghatharangani. Literature. Sanskrit.. 1992.. Literature.. 1962.. Sanskrit. Sanskrit. Bibliotheca Indica A Collection Of Oriental Works... Bibliotheca Indica Volume 45 1. 434 pgs.. 1959.. Bhedojjeevanam. E. Unknown. 1949... Sanskrit. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Bhatti Kavyam Canto 11 12. Geography. 220 pgs. Sanskrit. Sanskrit. M. Venkataramana Reddy. Unknown. Philosophy. V. 60 pgs. M. Narayana. Geography. Sanskrit. 636 pgs. 830 pgs. Bibliotheca Buddhica V... Bhoja s Samaarangana Suutradhaara Vol I. Unknown. Sanskrit. Sanskrit. Sanskrit. Unknown. 120 pgs. Sanskrit. 0. Bibliotheca Indica Volume 4. 1933. Sanskrit. Geography. Unknown. Vasudeva Sharman. -. 504 pgs. Bhavprakashnidhantu. 0. Language. Sanskrit.. 0. 1987. Bhupala Mandanam Of Devasri Narada. Geography. Sanskrit.. Balvanth Singh. Unknown. Geography. Sanskrit... Vijnana Bhikshu.. 1987. Dwaita Philosophy. E. C Lakshmi Kantaiah. 1987.. Sanskrit. 1995.. Prahladacharya. Geography.. Sanskrit.. Unknown... Bibliotheca Buddhica Vol Vii Nyayabindu. 1959. 0. Bodhaikyasiddhi Prathamo Bhaaga. 122 pgs.. -.rose.. 1854. 185 pgs. Bhramara Sandesa. Sanskrit. 1980. 220 pgs. Bhavya Bharatham..rajendralala. 280 pgs. 1918. -.. Sanskrit. Sanskrit.. 0.. Bibliotheca Indica Volume 3. Literature. Vijnanabhikshu. 0. Bheda Vidya Vilasa. 301 pgs. Sanskrit. 108 pgs. Sanskrit. M.. 1903... Bhesajya Rathna Vathni. Sanskrit..rajendralal.. 1991. Psychology. Bhattikavya Of Bhatti... 580 pgs.. 2003. 294 pgs.. 422 pgs.. 1983... Geography. Vacant. Sanskrit. Sanskrit. 388 pgs. Unknown. Unknown. 984 pgs.rajendralala.... 134 pgs.. Bhedojjivana Of Sri Vyasaraja. 540 pgs. Literature. Bhoja. Tirumala Charya. Sanskrit.org/…/SanskritIIIT.… 11/167 ... 90 pgs.rose. sanskritdocuments. 1980. 362 pgs.. Geography. 320 pgs. Bibliotheca Buddhica Vol Vvxx. Philosophy. Sanskrit. 1980. 968 pgs. Late Vinayak Narayan Shastri Vasudev Laxman Shastri.. 1987. Bhoja Prabanda Of Ballala.. 1945.. 50 pgs. Sanskrit. Bibliotheca Buddhica Vol Vi.. 1991. Maheshchandra. 580 pgs. 212 pgs. Bibliotheca Indica Volume 71 2.. 1951.. M. Unknown. Bheddo Jevana Of Sri Vyasaraja. Saradaranjan Ray Vidya Vinoda. Vacant. 1954. sri ranga ramanujamuni. Biblotheca Indica. 640 pgs. 576 pgs. 557 pgs. 1981.. Unknown.... Sanskrit. Bibliotheca Indica Volume 27. Achyutaraaya. Y Mahalinga Sastri.rajendralal. 66 pgs. Gopinath Kaviraja. 1998. Bhushanasara Samiksha Part Ii. 135 pgs.. Literature.. M. 134 pgs.. Bheda Ratnam. -. Sanskrit. Bibliotheca Indica Volume 71 1. R Nagaraja Sarma... 646 pgs. Sanskrit. Sanskrit. Bibliotheca Indica Volume 31 1. 0. Ramakrishnamacharya K.... Sanskrit. Bibliotheca Indica Volume 71 4. V. pandit sri bhramha shankara misra.. 1934. Bhavaprakasa Of Bhavamisra. Sanskrit.

.. Bodhayana Grihya Sutram. P. Brahma Sutra Dwithiya Bagamu. 1937.. shri bramha gupta. Brahma Sphuta Siddhanta Vol. Religion. 762 pgs. Unknown. Sanskrit. Sanskrit. Somraj Krishna Das. 1992.. Unknown. Bodhicharya Vatara Of Santideva. Brahmasutrashaariirabhashhyaara~tha Bhaaga tiisara.. Theology.. Unknown. 1982... Sanskrit. Brahma Sutra Nyaya Sangraha. 1937. 486 pgs. 336 pgs.. Brahatkatha Manjari. G. 1960.. 586 pgs... Sanskrit. Brahma Sphuta Siddantha Vol I. Unknown. Sri Vijayeendra Tirtha. 286 pgs.. Brahatstotraratnavali Vol I.... Brahmanjali Nam Parameswararpitha Slokamalika. Unknown. Unknown. Brahma Sphuta Siddhanta Vol 4. L.. Sanskrit. Geography. 505 pgs. 1979. Sanskrit. 1966. 1906.srinivasacharya. Acharya Mandanmisra. Brahmasutras And Dasasloki..… 12/167 . Unknown.. 600 pgs. Brahdaranyakopanishath Vol-liv. Theology. .. Natural Sciences. Unknown.panchamukhi. 890 pgs.ananthacharya. 1915. 644 pgs.. 1973.. sathyanarayan tripati. Not Available. Sanskrit.... 0. Sanskrit.. 402 pgs. Religion. 95 pgs. Religion. 18 pgs. Dr.. 740 pgs.. 1944. Brahmachary Vishnu.2/14/2011 A list of scanned Sanskrit books at III… Bodhasara a treaties on Vedanta. Sanskrit.nene. Book Of Exercises Part I.. Sanskrit.. General. Brahmasutra Bhasyamsahithayatham Thathvaprakasika. Sanskrit. 584 pgs. Sri Madra Dwapayamuni. 1966. 758 pgs. R. R Antoine. Sanskrit. Physical Fitness.. 462 pgs. 168 pgs.sampurnananad. Ram Swapup Sharma. Sanskrit. Bodhicaryavatara. Sri Narahari with a Commentary by the Author's Pupil Pandit Divakar. 584 pgs. Sanskrit. Unknown.. Brahma Vaivartha Puranamu Vol 1. 222 pgs. 1950.s. Sanskrit. Brahmasutras. Brahmanda Puranam.. Unknown... Unknown. Bhaapat'ashastrii Vishhnd-uvaamana. 1927.. Unknown. Brahaspatismrti.s.s. J L Shastri. Sanskrit. Arka Somayaji.. Brahama Sphuta Siddhanta Vol Iii.panchamukhi... Khemraj Sri Krishnadass. Brahma Sphuta Siddhanta Vol 3. K V Rangaswami Aiyangar. 1980.. Sanskrit. sanskritdocuments. Unknown.. Language. 200 pgs. Pandurangatmaj Kashinath Sharma. Unknown. 334 pgs. 1904. Unknown.. Ram Swarup Sharma. Sanskrit. Sanskrit.2. 0.. Archaryavara Rama Swarup Sharma.. I. 448 pgs. Unknown..tekct. Sanskrit. Sanskrit. 1941. Brahmasutrabhasya Vol 1. Brahmasutra Bhasyamsahithayatham Thathvaprakasika. 0. 329 pgs. Brahma Sphuta Siddhanta Vol Ii. Brahma Suutraand-i Grantha 67. Brahmasutrabhashya.. Sanskrit.. 0.. Brahmasutravrtti Mitaksara Of Annambhatta. 0... Literature. 1965. 586 pgs. Sanskrit. Sanskrit. 452 pgs. Pandit V. 708 pgs...tatvaprakashka1. Sanskrit.. Sanskrit. R.. 326 pgs. Sanskrit. Sanskrit. Unknown.s. Unknown. Linguistics.. Sanskrit. 88 pgs. Brahmanda Purana Of Sage Krsna Dvaipayana Vyasa... 661 pgs. 779 pgs.. Unknown. Acharyavara Ram Swarup Sharma. Philosophy..org/…/SanskritIIIT. 1953. Unknown. 1966. 536 pgs. P L Vaidya. 1980. 750 pgs. Brahmasiddhi. .. Brahmasutra Bhashya. 1966. Brahmasutra Bhashya Of Sri Madhvachrya.. Shankar Shastry Venegavakar.. Unknown. Brahma Vaivarth Eak Pradyayan. 1911. 0. Sanskrit. 0. 1832. Laxman Shastri Pansikar.. Sanskrit.. . 372 pgs.. Sanskrit.. Sanskrit. 1925.rama Sastri. Unknown.2. 0.

880 pgs. Sanskrit.. 1992. . Sri muralidhar. 1935.sharmistha Sharma.. Unknown. 282 pgs. Sanskrit. Unknown. Sri Krishnadas Aatmajain Ganga Vishnuna. . Sanskrit.. 437 pgs. .. Theology. Sanskrit. . Sri Krishnalal Thanaya Datt. Unknown. 614 pgs. Unknown. Sanskrit.. Bruhat Samudrika Sastramu... Buddhapalita Mulamadhyamakavrtti. Unknown.. 753 pgs... Sanskrit. Philosophy. Pandit Ramgopal Shastri. 926 pgs. Bruhadh Hodachakra vivaranamulu. 1935. 396 pgs. Max Walleser.. 503 pgs. Religion. Brihat Sarvanukramnika Of The Atharva Veda. Sanskrit. Vira Raghavachaya. 1922. Sanskrit. 0. 0... Buddhist Avadanas. Sanskrit.. Sanskrit.. Sanskrit.. General.. 1992. Buddhist Logic Vol 1. 600 pgs. 463 pgs. . 580 pgs. 0. 457 pgs. Franklin Edgerton. 1935.. Sanskrit. Brahmavaivarta Maha Puranam.. Prabhaakaramishra.Bhashya. Sanskrit. Srilnarayana Bhatta Goswami. Sanskrit.org/…/SanskritIIIT.. Upanishads... 206 pgs. Language. T Veeraraghavacharya.. 914 pgs.. 0. 1954. jyotirvdaya datta. Unknown. 385 pgs. Buddhist'a T'eksat'a Ashokaa.. 1936. 1885. Bruhajjyothi Sarnava (mirra Skandha) Hari Krishna. 1986. Psychology. Theology.. 216 pgs. Religion. Religion. Theology. . Brhadavanyaka Bhava Botha... Brahmavaivatara~purand-ama~ Ddvitiiyo Bhaaga Grantha 102.. Literature. Linguistics. Sanskrit. Sanskrit. Chaara~ya Matsureshvaraa.. Theology. sanskritdocuments. Theology.. Sanskrit. Buddhist Technical Terms.. Religion. 0. Brxhatii Prabhaakaramishraprand-iitaa Prathamo Bhaaga. Sanskrit. Sanskrit. Stcherbatsky. Religion.t.. 214 pgs. Sanskrit.... Dr. Unknown. Sanskrit. Brxhadaarand-ya Kopanishhadabhaashhya Vaara~tikama~ Prathamo Bhaaga Grantha 16. 1953. 1980.. 1994. 503 pgs. Maraat'he Vaasudeva Shaastrii. Brhajjatakam Bahotpala Tika.. Buddhist Hybrid Sanskrit Reader. Religion. Prabhaakaramishra. Sanskrit. 1867.. Sanskrit. Sanskrit. Sanskrit. Unknown. .. pg Brahmavaivara~tapuraand-ama~ Prathamo Bhaaga Grantha 102. Theology. Sanskrit. 1954. 260 pgs. 1886.. Brihadaranyakopanishad . Unknown. Aapat'e Vinaayaka Gand-esha. Brhadaranyakopanishad Bhasyam. 225 pgs..2/14/2011 . 334 pgs.. Bruhaddevagnanaranganam. Philosophy. Sanskrit. Sanskrit. 1934. Bhat't'achaara~yaa Vidhu Shekharaa. Unknown. 0. Brahmavaivara~tapurand-ama~ Dditiiyo Bhaaga Grantha 102. Theology. Braj Bakthi Vilas. Somraj Krishna Das. 616 pgs...books at III… Brahnni Ghantu Ratnakar Vol V I. Gand-esha Vinaayaka. 110 pgs. Religion. . Bruhanigantu Rathnakara Panchama Bagh. Religion.… 13/167 . Shaastrii Kashiinaatha. 0.. Theology. Kenjiu Kasawara. . 1937. Sanskrit. 0. 0. Theology. -... Brahnnighantu Ratnakar Vol I. 86 pgs. Brxhatii Prabhaakaramishraprand-iitama Da~tiiyo Bhaaga. Religion. Brxhadaarand-yakopanishata~. 56 pgs.... A list of scanned Sanskrit. Sri Krishna Das Satmaj Gangavishnu. Brahmavaivatar Puraand-ama~. Religion... Aapat'e Vinayaka Gand-esha... 457 pgs. 268 pgs. 1935. Theology. 190 pgs.... Sanskrit. 1953. Unknown. Brihadaranyakopanishad Bhasya Part 1.. Brahmavaivarta Puranam.. 351 pgs.

2/14/2011

A list of scanned Sanskrit books ,at III… y g

gy

,

1948. 73 pgs. Budhabhushhand-ama~... Shambhu Shriimada~, Philosophy. Psychology. Sanskrit, 1926. 132 pgs. Budhabhushhnd-ama~... Shriimachchhan'bhunrxpa, Philosophy. Psychology. Sanskrit, 1926. 132 pgs. Bugusamhita Mahashastra Palitha Kanda... , . Sanskrit, 0. 613 pgs. Bugusamhitargata Yogavali... Somraj Krishna Das, . Sanskrit, 0. 343 pgs. Calcutta Sanskrit Series... Pandit Amareswar Thakur, Unknown. Sanskrit, 1934. 830 pgs. Camatkarachandrika Of Visvesvarakavichandra... Dr P Sri Rama Murhy, Unknown. Sanskrit, 1969. 270 pgs. Canakya-caritam... Dr.thakur Prasad Mishra, Unknown. Sanskrit, 1981. 180 pgs. Candravyakarana Of Candragomi... K C Chatterji, Language. Linguistics. Literature. Sanskrit, 1953. 360 pgs. Carudattam Edition I I... C R Devadhar, Unknown. Sanskrit, 1943. 136 pgs. Catalogue Of Sanskrit Pali And Prakrit Books Vol-i... -, Unknown. Sanskrit, 1951. 354 pgs. Catalouge Of Sanskrit Parakrit Manuscripts Vol 3... Muniraja Sri Punyavijayajit, Unknown. Sanskrit, 1968. 368 pgs. Chaitanyachandroday Naam Natakam... Sri Rajendra Lal Mitrena, Unknown. Sanskrit, 0. 294 pgs. Chamatkaar... Dr Krishna Lal, Unknown. Sanskrit, 1985. 112 pgs. Chamatkara Chintamani... bhatta narayana, Unknown. Sanskrit, 1964. 550 pgs. Chanakyasuthram Part 1... Pandit Vijendermisra, Unknown. Sanskrit, 0. 48 pgs. Chandas Sastram... Sri Pingalacahrya, Unknown. Sanskrit, 2002. 321 pgs. Chandha Shastramu... Sri Pingali Nagh, Unknown. Sanskrit, 0. 326 pgs. Chandogya Panisad Bashyam Pradhama Bagamu... Sri Ranga Ramanuja Muni, Unknown. Sanskrit, 1952. 546 pgs. Chandogyopanishad... Sri Ranga Ramanuja Muni, Unknown. Sanskrit, 1952. 596 pgs. Chandologyopanishad... Venkata Subramanyam Sastri.m, Ayurveda. Sanskrit, 1924. 939 pgs. Chandrapeeda Katha... Pandit V Ananthacharya, Unknown. Sanskrit, 1946. 90 pgs. Chandraprabha Charithramu... P.amruthlal Jain, Unknown. Sanskrit, 1954. 34 pgs. Chandrika Sahitha Kuvalayananda... , Religion. Theology. Sanskrit, 0. 328 pgs. Charak Saheta Vol 3... Sri Narendrasen Gupt, Unknown. Sanskrit, 0. 664 pgs. Charaka 1... -, Unknown. Sanskrit, 0. 502 pgs. Charaka 5... -, Unknown. Sanskrit, 0. 626 pgs. Charaka Samhita 3... -, Unknown. Sanskrit, 0. 326 pgs. Charaka Samhita 6... -, Unknown. Sanskrit, 0. 534 pgs. Chaturdashalakshani With Didhiti,didhitiprakashka,vivarana... N.veejhinatha, Indian Logic. Sanskrit, 1997. 867 pgs. Chhaandogyopanishhata~... Upanishhata~, Religion. Theology. Sanskrit, 1952. 549 pgs. Chhaandogyopanishhata~ Grantha 14... Aapat'e Vinaayaka Gand-esha, Religion. Theology. Sanskrit, 1934. 539 pgs. Chhaandogyopanishhata~ Grantha 79... Nityaananda, Religion. Theology. Sanskrit, 1915. 223 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Chhanda Shaastrama~

Chaara~ya Pin'galaa Language Linguistics Literature Sanskrit 1950 272

14/167

2/14/2011

A list of scanned Sanskrit books at III… Chhanda Shaastrama ... Chaara ya Pin galaa, Language. Linguistics. Literature. Sanskrit, 1950. 272 pgs.

Chhatrapatisan'bhaajii Mahaaraaja... Rangand-ekara Keshavaman'gesha, Geography. Biography. History. Sanskrit, 1950. 86 pgs. Chidgagana Chandrika... Kalidas, Unknown. Sanskrit, 0. 208 pgs. Chitra Champu... sriram charan, Unknown. Sanskrit, 0. 146 pgs. Chitra Prabha... Bhagavata Hari Sastri, Unknown. Sanskrit, 1932. 480 pgs. Chitrasenapadmavati Charita... Mulraj Jain, Unknown. Sanskrit, 1942. 98 pgs. Chittavishuddiprakarand-a... Aara~yadeva~, Religion. Theology. Sanskrit, 1949. 147 pgs. Chrak Samhitha Part 2... -, Unknown. Sanskrit, 1950. 568 pgs. Chytanya Nandanam... Nistala Subramanyam, Unknown. Sanskrit, 1987. 170 pgs. Cikitsa Of Srinivasa... sri s venkatasubramanya sastri, Unknown. Sanskrit, 1953. 414 pgs. Cikshasamuccaya... Canti Deva, Unknown. Sanskrit, 1992. 494 pgs. Cola Campu Of Virupaksa... T Chandra Shekaran, Unknown. Sanskrit, 0. 90 pgs. Collected Papers Of Manavalli Ramakrishna Kavi... P S R Appa Rao, Unknown. Sanskrit, 1986. 340 pgs. Critical Study Of Vedarthasangraha... t v raghavacharyulu, Unknown. Sanskrit, 1989. 250 pgs. D'a Had'agevaara Charitra... Paalakara Naaraayand-ahari, Geography. Biography. History. Sanskrit, 1882. 538 pgs. Da Aara~ya Shatakama~... Shriimadappayyadiiqs-ita, Philosophy. Psychology. Sanskrit, 1944. 72 pgs. Da Ethimalojiisa~ Apha~ Yaska... Vara~maa Siddheshvara~vara~maa, Language. Linguistics. Literature. Sanskrit, 1953. 272 pgs. Da Jaataka Maalaa Prathama~ Bhaaga... Aara~ya Kuuraa, Philosophy. Psychology. Sanskrit, 1943. 279 pgs. Da Katuhsataka Dvitiya Bhaaga... Ara~yadeva~, Religion. Theology. Sanskrit, 1931. 344 pgs. Da Mahaabhaarata Sabhaapara~va... Vishhnd-u Esa~ Suktaankara~, Language. Linguistics. Literature. Sanskrit, 1943. 217 pgs. Da Saundarananda... Ashvaghosha, Philosophy. Psychology. Sanskrit, 1928. 200 pgs. Daa. Ketakara Vyaktti Aand-i Vichaara... Ketakara Shriidharavyan'kat'esh, Geography. Biography. History. Sanskrit, 1955. 216 pgs. Daivat Sanhita Vol-3... Sripad Damodar Saatvalekar, Unknown. Sanskrit, 1948. 284 pgs. Daivata San'hita Prathama Bhaaga... Shriipaada Daamodara Saatavad'ekara bhat't'aachara~ya, Religion. Theology. Sanskrit, 1941. 987 pgs. Daivata San'hitaa Bhaaga 2... Saatavalekara Sriipaada Vasan'ta, Religion. Theology. Sanskrit, 1943. 923 pgs. Dandanitiprakaranam... V S Bendrey, Unknown. Sanskrit, 1943. 144 pgs. Daqs-ind-achyaa Mdhyayugiina Itihaasachi sadhane Khan'd'a 2... khera~ Gand-eshaharii, Geography. Biography. History. Sanskrit, 1934. 119 pgs. Dara~sha Puura~nd-a Maasa Prakaasha Prathamo Bhaaga Grantha 93... Daad'ekaro Sarasvatii Bhushhand-a, Religion. Theology. Sanskrit, 1924. 652 pgs. Darsan Ka Prayojan... Bhagvan Das, The History Of Philosophy. Sanskrit, 1987. 312 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Das Gopatha Brahmana

Dieke Gaastra Unknown Sanskrit 1919 360 pgs

15/167

2/14/2011

A list of scanned Sanskrit books at III… Das Gopatha Brahmana... Dieke Gaastra, Unknown. Sanskrit, 1919. 360 pgs.

Das Purana Pancalaksana... Wllibald Kirfel, Unknown. Sanskrit, 1927. 664 pgs. Dasa Charitam... Sri Sailusuri, Unknown. Sanskrit, 1989. 232 pgs. Dasapadyunadivrtti No 81... Dr Mangal Deva Shastri, Unknown. Sanskrit, 1943. 578 pgs. Dashaa Kumaaraa Kathaa Saaraa... Appaayaamatya, General. Sanskrit, 1949. 39 pgs. Dashopanishhada Grantha 106... Maarulakara Shan'kara Shaastrii, Religion. Theology. Sanskrit, 1937. 227 pgs. Dasopanishadas Vol 1... C.kunhan Raja, Unknown. Sanskrit, 1935. 520 pgs. Dasopanishads Vol Ii... The Pandits Of The Adyar Library, Unknown. Sanskrit, 1936. 644 pgs. Dasopanishads Vol-1... C.kunhan Raja, Upanishads. Sanskrit, 1935. 519 pgs. Dasopanishads With The Commentary Of Sri Upanishad-brahma-yogin... C.kunham Raja, Upanishads. Sanskrit, 1936. 518 pgs. Dasopanishads With The Commentary Of Sri Upanishad-brahma-yogin... G. Achari, Art. Sanskrit, 1936. 518 pgs. Dathu Rathnakara... Sri Madwi Jayalavanya Soori, Unknown. Sanskrit, 0. 348 pgs. Dattakamiimaan'saa Grantha 116... Nanda Pand-d'ita, Religion. Theology. Sanskrit, 1954. 379 pgs. Dattapuranam... Swami Vasudevananda Saraswathi, Unknown. Sanskrit, 2004. 736 pgs. Descriptive Catalogue... K.s.ramamurthi, Upanishads. Sanskrit, 1993. 111 pgs. Descriptive Catalogue Of The Government Collections Of Manuscripts Jaina Literature And Philosophy Vol Xvii... Harilal Rasikdas Kapadia, Unknown. Sanskrit, 1954. 330 pgs. Descriptive Catalogue Vol I... Dr.k.s.ramamurthi, Religion. Sanskrit, 1993. 222 pgs. Deshabhakta Krxshhnd-aajii Prabhaakara Uura~pha Kaakaasaheba Khaad'ilakara Charitra... Khaad'ilakara Kaashinaathahari, Geography. Biography. History. Sanskrit, 1949. 428 pgs. Deshabhaktta Saahityasamraat'a Narasin'ha Chin'taamand-a Kelakara Yaan'chyaa Aat'havand-ii... Baapat'a Sa Vi, Geography. Biography. History. Sanskrit, 1945. 680 pgs. Deshii Naama Maalaa Dditiiya Khand-d'a... Hema Chandraa, Religion. Theology. Sanskrit, 1938. 523 pgs. Deshiinaamamaalaa... Hemaachandraa, Language. Linguistics. Literature. Sanskrit, 1938. 525 pgs. Devalaya Grama Mahatmyam... Balachandra Kavishvar, . Sanskrit, 1827. 277 pgs. Devanandamahakavya of Sri Meghavijayopadhyaya... Pandit Bechardas.j. Doshi, Unknown. Sanskrit, 1937. 102 pgs. Devatadhyaya Samhitipanisad Vamsa Brahmanas With Commentaries... Ballikoth Ramachandra Sharma, Unknown. Sanskrit, 1965. 270 pgs. Devatadhyaya Samhitopanisad Vamsa Brahmanas... B Ramachandra Sharma, Unknown. Sanskrit, 1965. 264 pgs. Devendra Mahakavyam... P.bhochardas Jeevraj Desi, Unknown. Sanskrit, 0. 114 pgs. Dhaara~mikavimara~shasamuchchaya... Bhaaratii Svaami Vidyashan'kara, Religion. Theology. Sanskrit, 1944. 237 pgs. Dhaatukoshaa... Shaastrii Baahuballabha, Language. Linguistics. Literature. Sanskrit, 1912. 288 pgs. Dhanyaalokaa... Chaara~ya Aanan'davaradhana, Language. Linguistics. Literature. Sanskrit, 1937. 149 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 16/167

1950.. 388 pgs.. 1872. Sanskrit. Sanskrit. Dravya Gun Vignan Purvardhamu.2/14/2011 A list of scanned Sanskrit books at III… Dhara~ma Bin'duu. Dharmakosa Vyavaharakhanda. laxman shastri joshi.l. 76 pgs. Dharmakosa Upanisatkanda Volume 2 Part 4.. Dharmakosa Upanisatkanda Vol 2 Part 2. Laxmansastri Joshi. 415 pgs. History. 156 pgs. 860 pgs. Sanskrit. 182 pgs. 552 pgs.. Unknown.. Dhavnalokha. Theology. 1942.. Sanskrit. 0. 109 pgs. 1949.. Dura~daivii Mohare. Unknown. Khem Raj Krishna Das.org/…/SanskritIIIT.. Late Munichaturvijayaji. 214 pgs... Theology.... Unknown. 674 pgs. History. Sri Purshoutam Sharma Chaturvedi. Geography. 145 pgs. Unknown. 0. Geography.. Sanskrit. Dhara~matattvanind-ara~ya Prathamaa Bhaaga 1.. Sanskrit. Unknown.. Sanskrit. Dhaturupa Manjari.. 86 pgs. 1953... Biography. Theology. Docrichikitsarnava. Drahyana Grihya Sutra. Dharmikvimarsamuchya Vol I I. Sanskrit. Unknown.. Unknown... Aapat'e Gand-osha Vinaayaka. 146 pgs. 1940. Unknown.. Aapat'e Gand-osha Vinaayaka..… 17/167 . Dhavnyaloksar. 1929. Sanskrit. Laxmana Shastri Joshi. 232 pgs. Dharmasindhu.. 1935.. 1977. Dharma Kosah Vyavaharakanda Vyavaharamatrka Vol 1 Part 1.. Unknown. Dina Visheshha. Dhathuratnakarah Shasthi Vibhagah.. N G Kalelkar.v... Sanskrit. 0. 1937. Biography. Educationas A School Social Factor. K. Shriivasudevaanan'da~. 1954. Unknown. Dr Nagendhra. sanskritdocuments.. 1950. 1914. Draahmaayand-a Grxhma Suutravrxtti Grantha 74. Sanskrit.. 216 pgs.. Charandas Shastry. Sanskrit. Dvadasaranaya Chakra Of Sri Mallavadisuri Vol 1.. Theology. 544 pgs. 1950. Theology. Theology. Sanskrit. Dhaturoop Sangraha. Unknown. Lelegan'gadhara~ Vinaayaka~. Ddivedii Dura~ga Prasaada. Sanskrit. Unknown.. 1937. 294 pgs.... Unknown..sastri. Unknown. Sanskrit. Unknown. Sanskrit. 120 pgs. laxmanshastri joshi. Joshii Prahlaadanarahara. Dhara~matattvanind-ra~ya Parishishht'ama~ Bhaaga 2. 166 pgs. 1941. Sanskrit... 1955. Gokhale. Sanskrit. Pandith Marulkaropahvanar Hari Shastry. Dhatvarthavijnanam. Unknown.. Dutadangand. Religion. Sanskrit. Religion. 212 pgs.. 117 pgs. Pandith Sri Shobhit Mishra.bhagiratha Prasada Triputhi Vagisa Sastri. Dr C Kunhan Raja Presentation Volume. Dura~gaa Pushhpaanj-jali Grantha 22.. 56 pgs. Unknown. Dhwanyalok Rahasyam Prashnouttari. Sanskrit. M L Jacks. 1954. Sanskrit. Religion. Sanskrit. 320 pgs.. Unknown. Khemraj Shri Krishnadas. Sanskrit.. Dr. 764 pgs. Religion. 0. 352 pgs.. 1952.. 1980. 1952.. Sanskrit. Sanskrit.. -. vadilal bapulal shah. 0. Sanskrit. 0. Thakur Udaya Narayana Singh. pandit feroz phamaji.. Sanskrit. Sr Madananthram Shastry Vetalen. Unknown.. Hari Bhadraa. 1946.. 1935. 167 pgs. Dvadashan' Pushhpama~. 528 pgs.. Unknown. Religion. Unknown. Sanskrit.. 463 pgs. Vaidy Jadwaji Trikamaji Acharya.... Religion. Unknown. Sanskrit. 211 pgs. Dhvani Vicara.. 2001.. 424 pgs. Sanskrit. Dilkush Untasdi Gayaki Prathama Bhag.

Sanskrit. Unknown. Religion. Language.. Sanskrit. Sree Krishna Sarma E. Sternbach Ludwik. Sanskrit.. 1920. Psychology. Religion.V I I I.j. P L Vaidya... 1981. Dr. Dr. Geography. ... 1953.. Unknown. Language. Unknown. Ganesa Purana. Theology. 116 pgs. Ganesh. Unknown. 0. First Lesson In Sanskrit. Srimath Paramhans Parivrajakar Chary Brahmanisht Loksangrahi. Gautamiyamahatantram.ramaji Malaviya..... 226 pgs.. Sanskrit. Ganitatilaka.. -. 670 pgs. mahadeva deshiah. Sanskrit. Gatagoshha~t'i Arathata~ maajhii Jiivana Yaatraa. Sanskrit. Unknown... 702 pgs. Bhattacharya. Unknown. Unknown. 0. S. Exercises in sanskrit translation. Gaekwad's Oriental Series... Raamataarand-a.k ramachandra aiyar. 206 pgs..r. Sanskrit. 152 pgs.... Unknown. Dr P Sriram Chandrudu. Sanskrit.. 470 pgs. 96 pgs. 490 pgs. Sanskrit. 1960. 1992. 96 pgs. Unknown. Sanskrit. Sanskrit.. 1954. Sanskrit.. Bhasara~vajnaa Aacharaya~.... 383 pgs. Philosophy.. 94 pgs. 106 pgs.. Somraj Krishna Das. Dr. Gajagrahana Prakasa.padmanabhachrya Chitaguppa. Gaja saastram of paalakapya muni. 1968. Unknown. Krishana Gi Parisharam Bide.... 707 pgs.. Gajasiksha. 1867. Pandit Kedaranatha Sastri.. Sanskrit. subrahmanya sastri k s. 0. naradamuni.. History. Gaud'ayaada. Linguistics. 0. Ekavali Of Vidhydahra. Sanskrit. Veeraragava Achariya. 90 pgs. Unknown. Garuda Puranam. 177 pgs. Sanskrit.. Unknown. 253 pgs.. Unknown. 1950. 82 pgs. Narayana Dikshita. 1084 pgs.. sanskritdocuments..r. Gandhi Gita. Literature. Unknown.r.. Unknown. Sanskrit.org/…/SanskritIIIT. Esevyopanishad Bhashyam... Unknown. 130 pgs.. Sanskrit. Theology. 1975.. Gananeshwari. Sanskrit. 1920. Sanskrit. Biography.tadpatrikar. Sanskrit. 1975. Sanskrit. Gaud'apaadoyama~ Aagamashaastrama~. Gandavyuhasutra. Eethi Sriskande Mahapuranam Prabhaskhand. 542 pgs. 214 pgs. 1939. Sanskrit. Literature. Gangavaratana. Gand-akaarikaa. 1958.. . Sanskrit. -. 2000. 1975.. Sripati. Sanskrit.. Unknown. Unknown.. Social Sciences. 1916...brej Mohan. 360 pgs. Unknown. Unknown. 1968. 1987. P.sreekrishna sarma.. Sampurnanand.. Linguistics... 534 pgs. Garuda Maha Puranam Of Sri Vedavyasa Mahamuni..2/14/2011 A list of scanned Sanskrit books at III… Eeshavasya Upanishad I. Sanskrit. 2001. Gajasiksa. Tantras. Sanskrit. Gand-adara~pand-a Shhashht'ha San'skarand-ama~.. Linguistics. Ganatiya Kosh. 1801. Kelakara Chin' Na.n. 78 pgs. Eeshopanishanthu. T. Sanskrit.. 348 pgs.ballantyne. Gaadadhari Vol Ii. Sanskrit. 1933.. -. 561 pgs. Gajasiksa. Literature. 0. 1949.. 1937. Language. 418 pgs. 0.… 18/167 . Unknown. Gadhy Padhy Mala Chaturth Kusumam Vol I. E. Sanskrit. 100 pgs. Sanskrit. 140 pgs. Sanskrit. 2004... Gand-ikaa Vrxtta San'grah Khand-d'a 1 Grantha Maalaa 4.. 490 pgs.

Sanskrit. 1924. Gochar Aur Asthakavarga. Gruha Vidhan. 1934. Unknown.... Gilgit Manuscripts Vol I. 1952.. Unknown. 116 pgs. Religion.. Sanskrit. 1983. 66 pgs. Sanskrit.. Glimpses Of Buddhist Culture In India.s. Gudharthatattvaloka A Commemtary On Samanyanirukti Gadadiiari.. Unknown. Gomileeygruhakarmaprakashika. 1948. Rajendra lal Mithra. Sanskrit. Gilgit Manuscripts Vol Ii. 174 pgs. 253 pgs. Sanskrit. Unknown. 186 pgs.. Golaadhyaaya Uttarara~dharupo Da~tiiyo Bhaaga. Unknown. A. 1935. Dr. Sanskrit. Gilgit Manuscripts Vol Iii Part 3... Gilgit Manuscripts Vol Iii.. 890 pgs. 178 pgs. Gramegeya Ganamatk... Dr.. Sanskrit. Gitagovinda Kavyam. 186 pgs. Geetha Dharm Chandogyaupanishad Vol Ii. Unknown. Sanskrit. Sanskrit. Geetharthsangraharsha Geetabhashytathparyachandrikach. Krishna Yajurved.r... Sanskrit.. veerendrarai chandra shankar mehatha. 1985. Gommatasara Karma Kandah. 1943. Religion. 320 pgs. Nalinaksha Dutt... 1939. Unknown.. Geetageervanam.org/…/SanskritIIIT. Mohan Lal. Sanskrit. Pandit S'ri Lakshminatha Tha. Sanskrit.. 1934. Dhanapati Suri. Sanskrit. 1908. Sanskrit. Unknown.. 1942.. Unknown. V Subramaniam. Religion. 452 pgs. Guruparampara Charita With Comm sanskritdocuments. 532 pgs. 1971. Sanskrit... Theology. 1969. 1939. Aacharya baskaranand lohini. Unknown. Dattatrey Venkateshwar Kettar. 200 pgs. 338 pgs. 0. Aara~muni Pand-d'ita~.. Goladyay Dwithiya Bagam. 0.... Religion.. 1946. 1942... 507 pgs. 1941. 1972..… Religion Theology Sanskrit 0 1049 pgs 19/167 . 360 pgs... Religion. Nalinaksha Dutt. Sanskrit... Gilgit Manuscripts Vol I I I Part I I I. 1932. Gita Samiksa. 322 pgs. Unknown.. Unknown. . Sanskrit.. 256 pgs. Unknown..m.nalinaksha Dutt.l.. Sanskrit. Graganithadyaya. Gitagovinda Of Jayadeva. Unknown.. 1941. Sri Math Paramhans Parivrajakarchary Brahmanisht Lok Sangrahi. Sanskrit. Unknown..s. 184 pgs. Gopala Sahasranama Stotram. Grihya Sutras Of Varah. K.. Gitagovinda Of Jayadeva With Commentary Of Laksmidara.aryendra Sharma. Anil Varan Roy.. Unknown. Religion. 126 pgs. k s ramamurty. 100 pgs. 1990. Gangadar Bapurao Kale. 316 pgs. Religion. Unknown.. Unknown. Sanskrit. Gitagovinda Mahakavyam. Dr Nalinaksha Dutt.. 284 pgs. Goldavyaprashnavimarsh. Sanskrit. 1943... 338 pgs. Sanskrit. Gopath Brahmana Of Atharva Veda. 1952.. Sanskrit. Sanskrit. Gudhartha Dipika. S B Valankar. 0. Sanskrit. Dr Nalinaksha Dutt.. 1972.2/14/2011 A list of scanned Sanskrit books at III… Geeta Vignana .. Theology. 512 pgs. Unknown. Geethopadesa. Religion..... Nalinaksha Dutt. Unknown. -. 244 pgs. 100 pgs. Sanskrit.sampath Kumara Charya.... Narayan. Ramamurthi. 247 pgs. 0. Bhaaskaraachara~yaa Shrii.. Sanskrit. Gilgit Manuscripts Vol Iii Part Ii. 383 pgs. 219 pgs. 1927. Sharma. E R Sreekrishna Sarma.n.. Sanskrit.. 132 pgs. Theology. 1941. Unknown. Sanskrit. 322 pgs.. Giitaayogapradipaara~yyabhaashhya. Subhramanyamvidhusha. Unknown.tatacharya. Sanskrit. Dr. 246 pgs. Sanskrit..Bhashya. 1990. Narayana Ram Acharya. Sanskrit. Unknown.

Haridiiqs-ita. Haricharita... Theology. 1939. Hariliilaa Nan' 3. 1948. Bi h Hi t S k it 1939 500 sanskritdocuments. Sanskrit. Unknown. Unknown.p.. 1917. Sanskrit. Mahadevaiah K. 764 pgs. C Sankara Rama Sastri. 1879. Literature. 0. 1982. 98 pgs. Halayudhkosh Abhidhanratnamala. History. History. . Gurvarthadipika..m. Sanskrit. Biography.. Religion.. 113 pgs. Theology. Hashacharitha Sangraha.. Psychology..org/…/SanskritIIIT. 763 pgs. Religion. Sanskrit.. 1945. Shri Dhanya Kumari.. Sanskrit. 1958.. 0. Durgaprasada amp Kasinath Pandurang Parab. 254 pgs. Hasya And Prahasana A Critical Study.. Tryambaka Makhin. Sanskrit. Paanase Venubaaii.. Religion. Bal Govind Jha. Gulab Chand. Unknown. Theology. Unknown.y. 308 pgs... Sanskrit. Religion. Haribhadra Suri Grantha Sangrahah... Harshacharitha Sangraha. 93 pgs. Hatopadesha. Parameswara Bhatta. Religion. 1999. 261 pgs.… 20/167 . Hara Naaraayand-a Aapat'e Yaan'chen' San'qsipta Charitra.... Sanskrit. 1989. 743 pgs.. Religion. Sanskrit. Bodhendrasarasvati. 139 pgs. Sanskrit. 1917. 1948.. Religion. Sanskrit. 144 pgs. Harshacharita The Fifth Ucchhvasa. Theology. Harshacharita Sara.. Sri vadiraja Tirtha. Religion. Unknown.. Sanskrit. 1960. Unknown. Religion. Sanskrit. Literature. 0. 305 pgs. 199 pgs.. 419 pgs. Harmakutam Sundarakanda. Unknown.. Sanskrit. The Arts..... 1931. Sanskrit. Harshacharitha Sangraha. 96 pgs. Sanskrit. Sanskrit.. Biography... Hemaadra Uura~pha Hemaad'apan'ta Yaachen' Charitra. Geography.. Krishnamacharya. 115 pgs. 1909. Vopadeva. Haricharita. Philosophy. Guruvamsha Mahakavyam.. 1049 pgs. Durgaprasada amp Kasinath Pandurang Parab. Hari Charitra. Jaya Bharati... Piit'ara~sana~ Piit'ara~. . 1952. 0 pgs. Jai Shankar Joshi. 0. 67 pgs. Harshacharita Ek Samskrutika Adhyayana. Unknown. Sanskrit. Unknown. Geography.. 1964.... 556 pgs.... 1948.. Sanskrit. Sanskrit. 238 pgs. Hanumannnatak.. Geography. Sanskrit. Ram Swaroop Sharma. Haricharita... Sanskrit. 1951.v Krishnamachariar. 120 pgs. 1922.. Subrahmanya Shastri.. Sanskrit. Harsha Charitam.. 0.. 249 pgs. Jaya Shankar Joshi.. Gyaariibaald'ii.sri. Sanskrit. Sanskrit. 1948. R. Sanskrit. Pandit V Ananthachary. 146 pgs. O.dhorasamaiah. Unknown. Philosophy. Psychology.. pgs. 0 pgs.. Dr Suram Srinivasulu. Haravijayam Of Rajanaka Ratnakara. Aappaapaadydhye Keshava~. Vaamanashaastriikhare Vasudeva. 383 pgs. 1954. Unknown. Aan'bekara baapujiimaara~tan'd'a.. Sanskrit. Haasyaara~nd-avaprahasanama~.k. Sanskrit. Kelakara Narasin'hachin'taamand-a. Shriijagadiishhvarabhat't'aachaara~ya.. 1850. Paramesvara Bhatta. Theology. Theology. The Arts.. Vasudevasaran Agarwal... 104 pgs. Sanskrit. 167 pgs. 1948.. Religion.. Unknown. Hariharaaddaitabhuushhand-ama~. Literature. 1896. 153 pgs. Sanskrit. 166 pgs. Theology. Halayudh Kosha. Haricarita By Paramesvara Batta. Harivan'shaachii Bakhara. Haridiiqs-itakrxtaa Brahmasutravrxtti. 1994... 590 pgs..2/14/2011 A list of scanned Sanskrit books at III… Guruparampara Charita With Comm. 1920. Sanskrit. Haimsa phrama~ Da Rxgvedaa.. Hari Naaraayand-a Aapat'e Charitra Va Vaang-a~mayavivechana. 1957. Sanskrit.

Hitopdesh.. 100 pgs. 1921. Sanskrit.. 457 pgs. Unknown. 1986. Sanskrit. Ishvara Pratyabhijna Vimarshini Of Utpaladeva. 132 pgs. Theology. i srinivasa rao. Dr Jatindra Bimal Chaudhuri. Peterson Peter.. 1949. Unknown. 1953.. Unknown. 1949. Unknown... Sanskrit. Pandit Sukhlaji Sanghavi.. Iishrvarapratyabhijnaavivrxtivimara~shini. Iishvara Pratyabhinj-aa Prathamo Bhaaga Grantha 22. Hymns From The Rgveda. 105 pgs. Introduction To The Study Of Mudra Raksasa. Unknown... Suniti Kumar Chatterji. 1921. R Shama Shastri.. 1969. 168 pgs. Deva Utpala. Unknown. 1925. Govinda Das. Hetubhindut'hiikaa. C Dwarakanatha. 90 pgs. 1973... 274 pgs. Sanskrit.. 197 pgs. Sanskrit. H M Lambert. Sanskrit.. Shan'karaananda. Unknown. Sanskrit. 258 pgs. Sri Madhusudan Sharma. 1942. 302 pgs. Unknown. Index Verborum Part Ii. 0. Hetubindutika Of Butta Arcata. Religion.. Intermediate Sanskrit First Year. Intermediat Patchabagh. Sanskrit.. Sanskrit. 354 pgs. Indo Aryan And Hindi.. Unknown.... Index Verborum Part 1. 1986... Sanskrit.. 454 pgs. Gupta Abhinava. Indravijay. Religion. Sanskrit. 192 pgs.… 21/167 ... Hitopdesh Mitrlabh. History Of Sanskrit Poetics. 1924. Psychology. 520 pgs. Sanskrit. Mukunda Rama Shastri. Bhin'd'a Sadaashivashaastrii. History Of The Duta Kavyas Of Bengal. Sanskrit. Iishvarapratyabhinj-aa Dditiiyo Bhaaga Grantha 33. Kiranvalli. Introduction To The Study Of Mrcchakatika.. Gupta Mada Abhinava. Index Verborum Part Iii. 1938.. 515 pgs.. G V Devasthali. Theology. Sanskrit. 354 pgs. 1948. Iishaavaasyopanishhada~.. Sanskrit. Unknown. Unknown. 436 pgs. 323 pgs. Unknown. 1949. Sanskrit. 1939. Unknown. Religion. Iishrvarapratyabhijnaavivrxtivimara~shinii Trxtiya Bhaaga. Philosophy. 2002. Sanskrit. Unknown. Raghu Vira. Bhat't'a Aara~ya.. Religion. Sanskrit.. Religion. -.. Sanskrit. Unknown. Introduction To The Devanagari Script. Gupta Abhinava. Sanskrit. 500 pgs.. Religion. Arthasasthra Visarada.... Theology. Hitopdesh Suharbudedh. 1925.. Theology. 1951... 0.... Unknown. 1943. Sanskrit.org/…/SanskritIIIT. Religion. Sanskrit. 466 pgs. Sanskrit. G V Devasthali. sanskritdocuments. Unknown.. Unknown. Pt... Sanskrit.. 134 pgs. Theology. 530 pgs. Sanskrit. Religion. Deva Utpala. Dr R Shama Shastry. Hinduism. Theology. Introduction To Kayachikitsa. 161 pgs. Theology. Intermediate Sanskrith Selections.. Indian Scientific Nomenclature Of Birds Of India Burma And Ceylon Vol X X. Sanskrit.. 1918.. Sanskrit.. 1934.. Unknown. Theology. Religion. 1953.. 1941. Unknown...hargovind Shastry. Sanskrit. Sanskrit. 1953.... 470 pgs.2/14/2011 A list of scanned Sanskrit books at III… Biography. Sri Krishnavallabha Charya.. Iishaavaasyopanishhata~ Grantha 5.. Theology. 360 pgs. Unknown. 423 pgs. P V Kale. 78 pgs. G V Devasthali. 1990. 176 pgs. 120 pgs. Influence Of Kalidasa On Harshavardhana. Iishvara Pratyabhi Nj-aavivrxti Vimara~shinii Prathamo Bhaaga Grantha 60. Sanskrit. 632 pgs. 0. Sanskrit.. Sanskrit.. History. 1930. 1930.. 1938. 290 pgs. 457 pgs. N Padmavathy.

568 pgs. Unknown. Language. Sharma. Kalaan'da Vi. Sanskrit. 940 pgs. Jaatakapaarijaata.... History. Mahopadesaka S Rajavallabha Sastrigal. Unknown. Sanskrit. Itihasah Shaastra Va Tattvajnj-aana. Javaahara~lala~ Neharu Aatmacharitra. Jaipur Ki Saskrith Sahitya Ko Daen.... Jaimani Sutra Vritti Subhodini Namika. Janasrayi. Dr Prabhakar Shastry. Sanskrit. Jalabheda.. Sanskrit. Achyatananda. Sanskrit. 1950. Sanskrit. 446 pgs... Unknown.. Religion.. 1954. 524 pgs. Geography.org/…/SanskritIIIT.. 1984. 1950. Jaiminiya Brahmana of the Samaveda. Religion... Sanskrit. Dr B Ramaraju..r. Language.. Sanskrit. 175 pgs. 344 pgs. Theology.. Jaiminiya Brahmana Of The Samaveda. Sanskrit.. Sanskrit.. Lokeshachandrend-a.. 0. Theology. Jatakattha Katha.. Unknown. Jathaka Baranamu. 406 pgs. Jainadara~shanasaara. Mallinathana Si Esa.. . 350 pgs. 0. 1982. 171 pgs. 0. Language. Sanskrit. sanskritdocuments... Sanskrit. Unknown. Sanskrit.. Jagadruru Sri Sacchidananda Sivabhinava Nrisimhabarathi Vijayakavya... Religion. Jataka Parijata Adhyayas 11-15. Jaiminiiya Braahmand-an' Dditiiye Kaand-d'e. 1969.… 22/167 . Sanskrit. Sanskrit. Unknown.. Jathakat'a~t'hakathaa Prathama Bhaaga. 538 pgs. Sanskrit. Devanandimunii. 178 pgs. shambhunath tripathi. Sanskrit. Raghu Veera. Sanskrit. 408 pgs. Bhiqs-u Dhara~maraqs-ita. Linguistics.. Biography. 1947. Linguistics. 1937. 333 pgs. Unknown. Jaminiya Arseya jaiminiya Upanishad Brahmanas. 1956.. Unknown.. 0. 342 pgs. Theology.. 0... Literature. Unknown.. Sanskrit. 1951. Geography. Sanskrit. Gupte Ke Esa~. Daivajana Vaidyanatha. 105 pgs. 146 pgs. 1934.... 1904. Jambu Chariyam Number Xxxxiv. Subramanya Sastri. Acahrya Jinvijay Muni.. 305 pgs. Linguistics Literature. Jaiminigrxhmasuutrama~. Unknown. Religion. Jaiminiya Arseya Jaiminiya Upanishad Brahmanas. Sanskrit. Sanskrit.. Ramakrisha Kavi.. Tripitakacharya Bhikshu Dharma Rakshit. 248 pgs. Jainendravyaakarand-ama~..r. B. Pullagummi Venkatacharyulu... V. 1922. 247 pgs. Sanskrit... 1950. 145 pgs. Jainashiilaa Lekha San'grah Dditiiyo Bhaaga.. Unknown. 76 pgs. brahmachari sarveswaranand. Jathaka Bharanam. 0. Theology.. 1951. Unknown.. 0.m. Sanskrit. 455 pgs. 1952. Sanskrit. Jambhavati Parinayam. Sanskrit. Gandesha~gore Naaraayand-a. .. Panditharinarayansharmami. Unknown. Jaisinhakalpadrumah Dharmashstragranth 1. Unknown.. Sri Vallabhacharya.. Unknown. V. Jathaka Baranamu. 1951. 1944. Jatakatthakatha Vol I. Literature.2/14/2011 A list of scanned Sanskrit books at III… Isvasyopanished Asyam.. Religion. Religion. gopesh kumar ahoja. 1980. 414 pgs.. Sanskrit. Jainendra Mahavritti Of Shri Abhayanandi. Linguistics.. Sanskrit.. Astrology. 714 pgs. Muura~tii Vijaya. Literature. Unknown. 1920. Vacant. Sanskrit... Jagadish Anumitha Grandhah.. 81 pgs. 296 pgs. Theology.. Bellikoth Ramchandra Sharma. Bhikshu Dharm Rakshit. 0. Theology. 1933. 442 pgs. Acharya. 170 pgs. 582 pgs.. Jaathakadesha Margaha Chandrika. 1984. Linguistics Literature. Biography. Sanskrit. 536 pgs. Raghuvira..

Jivanandanam.… 23/167 . Sanskrit. Jayasri Grandhavali. Linguistics. Theology. 1944. 216 pgs. Literature.. Sanskrit. Kaasyapagnaanakandaha. Linguistics. Sanskrit. Literature. Language. Literature. Psychology. 545 pgs. Sanskrit.. 304 pgs. 1913. Sanskrit... Sanskrit.. Ramchandra Kesava Bhagwat.. Shriibaand-abhaat't'aa Mahaakavii. 0.. Philosophy. 1951.. -. Rajanadh Sarma. Sanskrit. 1959. Theology.duraiswami Aiyangar. 88 pgs. 1909. 1921. Kaalidaasa... Literature. Sanskrit. 0. Religion. Aashaadhara Pand-d'ita. Unknown. Language. Jigyansadhikarnpoorvapaksh. 563 pgs... Vilomakaaland-d'a Shriidakt'ara~. Jnaanaara~nd-avatantrama~. 643 pgs. 0.. 1944. Sanskrit. 1948. 1975. Language. Unknown. 1976. Sanskrit. 1929. Religion. 349 pgs.. Jnaneshwari. Shriidhashaastrii Pan'd'ita.. Unknown... 1076 pgs. 56 pgs. 1954. Ram Chandra Narayan Velingkar. Literature. Sanskrit. 1867. Sanskrit. Unknown. Religion. Sanskrit.... Kaalidaasa. -. 1925. Language. 1952. Jinasahasranaama. M.. R.. 714 pgs. Language. Sanskrit.. Sanskrit. 142 pgs. G Laxmi Kantaiah.. Kaarikaavalii Mukttaavaliida~vitiiyan' San'skarand-ama~. K t'h k i hh t Ch t thi k tti V d Phil h P h l sanskritdocuments.. Literature... Jyothishshamasangraha Jaathakbhag.b... Sanskrit. 1131 pgs. Theology.. Buddhi Jinendra. 1919. Iishvara~ Proktama~. Jyaneswarinche Shabda Bhandar. Unknown. 264 pgs. Hari Damodar Velankar. Kaat'hakopanishhata~.. Theology. Kaalidaasiiyama~ Rxtusan'haarand-ama~ Da~vitiiyo Granthaa. Jotisha prasna phala ganana.. Language. 0. Unknown. Sanskrit. 247 pgs. Kaalamaadhava. Balasharma. 0. Linguistics. Jeevandhara Champuh.. Sanskrit.. 623 pgs.. Unknown. Sanskrit. Religion.. Unknown... Jayapoorva Bhavamu. 576 pgs. Religion. Unknown.. Sanskrit.. Biography. Parthasarathy Battacharya... 772 pgs. Jitante Stotram. 1925. Literature. 1954. Chakravara~tii Chan'draa. Linguistics. 1947. 1934.. Sanskrit. Geography. Buddhi Jinendra. Language. Journal Of Sri Venkateswara Orintal Institute Tiruoathi Vol 2. Kaashi Kaa Vivarand-a Panj-jikaa Vol Ii Part I.. 134 pgs... Linguistics.. Sanskrit.. 141 pgs. 217 pgs.. Literature. Religion. Pandit Narayan Datta Vaidy. Kaadambarii Shhashht'a Vrxtti. Linguistics. Sanskrit. Pandit Pannalal Jain Sahitya Charya. Sanskrit. Theology. Sanskrit. 64 pgs... Jinaratnakosa Vol I. Sanskrit. 488 pgs. Jayadevacharitram... 1936. Sanskrit. Sanskrit. Philosophy. Chaara~ya Maadhava. Kaat'hakagrxhyasutrama~ Bhaashhyatrayasarasutama~. Unknown. 0. 408 pgs. Kaadambariikalyaand-an' Naat'akama~. 694 pgs. Bhat't'aachaara~ya. Linguistics. 188 pgs.2/14/2011 A list of scanned Sanskrit books at III… History.org/…/SanskritIIIT. 736 pgs. Kaashikaavivarand-apanj-jikaa Prathama Bhaaga. Sanskrit.. 1995. 264 pgs. Sarasvatihrdayalankara. shyam lal. Kavii Narasin'ha. 1947. Kaashi Kaa Vivarand-a Panj-jikaa Khand-d'a 3. Jeevanandanamu. Miraashii Vaasudevavishhnd-u. Unknown. Pandit dayashanleareupadhyaya.. 314 pgs. 416 pgs. History..

.. Kaavyamaalaa Da~tiiyao Guchchhaka. Unknown. Literature. -. Sanskrit. Theology. Linguistics. 1959. Aapat'e Mahaadeva Chimand-a. Sri Vishnu Sharma.. Dr M Srimannarayana Murti.. Sanskrit. 280 pgs. Kalpa Kalkika. Kalapoornoday. 389 pgs... Literature. Ara~hadhaasii. Linguistics. 1992. 114 pgs. Kalatattvakosa. 363 pgs.. Sanskrit. Unknown. 1952. Religion.. Unknown. 1993. Kadambari . 1972. Sreemannarayanamurthy. Geography... 1953. Kalidasa Sahitya Evam Vadana Kala. Language. Language. Language. 377 pgs. Durgaprasada~ Pandita~. 1934.. Unknown. Kainkaryaratnavali Of Paravastu Krsnamacaharya. Psychology. Sanskrit. Linguistics. Biography. 1954. Technology. Sanskrit.. 376 pgs. Sanskrit. 126 pgs. Kaavyamiimaan'saa Prathama San'skarand-ama~. 172 pgs. 1926. 1394 pgs.. 140 pgs. -. S Suryanarayan Shastry.. Kaavyaratnan. History. Shaastrii Shriivasudeva. Kaayaparishuddhi. Sanskrit. Literature. Kaavyamiimaan'saa. Raajashekhara Kaviraajaa. 175 pgs. 1939. Kalidasa's Kumarasambhavam (cantos I-vii). Dand-d'i Aachaara~yaa.. Raajashekhara Kaviraaja. Sanskrit.. 300 pgs. Sanskrit.. Sanskrit. Geography. Sanskrit. 1936.org/…/SanskritIIIT. Kainkaryaratnavali..r.. Sanskrit. Shriimaanatung-gaachaaraya. 108 pgs. Sanskrit. Kaavyaprakaashakhand-d'ana. Sanskrit. 290 pgs.. Kaavyamiimaan'saa Aalochanaa Nibandha. 1937. Durgaprasada~ Pandita~. Philosophy. Dura~gaaprasada~ Pand-d'ita. Kaavyamaalaa Dvadasho Guchchhaka. kapila vatsyayan. Siddhichandragand-i.... Sanskrit. Kakolutikeeyamu.. Philosophy.. Sanskrit. 1954. 1938. 1935. Unknown. Kalpadrukosa Of Kesava Vol I Ramavatara Sarma Unknown Sanskrit 1928 564 pgs sanskritdocuments. Sanskrit.. 1932..Purva Bagha. 1955. Sri Paramanandaji. Harihara Kripala Dwivedi. Raajashekhara Kaviraajaa. Parushuraamachin'chaalakara Dattatraya. 0. Kala Madhav. Kasinatha Panduranga Parab. Unknown.… 24/167 . Language. Sanskrit. Sanskrit.. Biography.. Sanskrit. Kaavyamaalaa Shashht'ho Guchchhaka. Linguistics. Sanskrit. Kalidasa Vol Ii.. 147 pgs. 212 pgs. Unknown. Kabeer Manshur.. Kaavyaadara~sha. Kadhambari Purvabaga Part 2. Unknown..sehgal... 240 pgs. History. 715 pgs. 0. 0. 1931. Geography. Literature.. Kai Govin'dasuta Ura~fa Parushuraama Govin'da Chin'chaalakara.. 412 pgs. K S Rama Swami Sastri. Sanskrit. 1914. Madhava Charya.. Language. Linguistics. Linguistics Literature. Sanskrit. Sanskrit.. Sin'h Satyavrata. Kaavyamaalaa Saptamo Guchchhaka.. Sanskrit. Unknown. 160 pgs. 510 pgs. 143 pgs.. Language. Kaat'hakopanishhata~ Grantha 7. Dr Sushma Kulshreshtha. Sanskrit. Biography. Technology. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… Kaat'hakopanishhata~ Chatura~thiyamang-kanaavrxtti. 1955. Vyasadevena. 254 pgs. 1958. 176 pgs... 0. Literature.... S. 1930. 156 pgs. 606 pgs... 1986. Sanskrit.. 352 pgs. 1935. Kalaamruthamu. 207 pgs. Literature. Linguistics.. Kaavya Prakaasha 15. Social Sciences. 1993. Unknown. Linguistics Literature.... Literature. 282 pgs... Psychology.. Sanskrit.. Literature. History..

Kanya Sanhitha Of The Shukla Yajurveda. Karanaprakasa. 176 pgs.. 395 pgs...... Karak Darshanamu.. 1958. Unknown.. Sanskrit.. 1926. Hanuman Prasad. Sanskrit. Sanskrit. Indian Astrology... Somasnambhu.. Unknown. 140 pgs. 528 pgs. Sanskrit. 906 pgs. 231 pgs. Hanuman Prasad Pothar. 0. 234 pgs.org/…/SanskritIIIT.. Dr.. Kamakunjalata. Geography..patrusarthi Bhatta Charya.. 90 pgs. Kapphinabhyudaya.. Sanskrit. Sanskrit. Sanskrit.. Sanskrit. Sanskrit... Kalpadrukosa Of Kesava Vol I I. .. 1927. Motilal Joshi. Unknown. Sanskrit... 2001. Indian Astrology. R. 30 pgs. Kashyapgyaankanda. Kashika Part 3. Kashyagnanakandah. Kashyapa Mahaara~shhi. -..2/14/2011 A list of scanned Sanskrit books at III… Kalpadrukosa Of Kesava Vol I. Unknown. 1991. 306 pgs... Sanskrit. Karana Kutuhalam Of Sri Bhaskaracharya.b.. 412 pgs. 0. Unknown. sanskritdocuments. Madhava Shastri... Kara~maviira Bhaauuraava Paat'iila Charitra Va Kara~ya. 1175 pgs. 462 pgs. Sanskrit.. Unknown.. 1860.. Kesava.. Sanskrit.. 0.. Pardha Saradhi Battacharya... 112 pgs. Sanskrit. 302 pgs..... Unknown. 234 pgs. Kashyapajnana Khandah. Karakan'd'achariu. Religion. 760 pgs. Linguistics. 0. 1969. Kanakaamara Munii. 782 pgs. Kasaya Pahudam Iii Thidi Vihatti. History. Unknown. 674 pgs.. 0.satyendra Mishra.. Unknown... Sanskrit. Kaniviya Anthyashti Padhathi. Sanskrit. 1899.… 25/167 . 558 pgs. Sanskrit. Biography.. Kalyan Sankhya-i. Kashyapashilpama~. 212 pgs. Panditraj Dhunddhiraja Sastri. Manomohan Ghosh. 1932.. 1947. Literature. 0. 370 pgs. Kalpalataviveka By An Anonymous Author.. Kalyan Sanshikpt Skand Puranam. 1948.. Sri Kalanath Jha. Unknown. 1960. Unknown. Sri Somashambhu. 1932. Kalyaanamaalla Mahaakavi. Sanskrit. 1947. Murari Lal Nagar. Sanskrit. Sanskrit. Sanskrit. Karmakanda Kramavali No Lxxiii. Unknown.. Sanskrit. 207 pgs.. Sanskrit. 294 pgs.. Parthasaradhi Bhattarcharya. Kalpasutra(subhodhika Vyakya). 268 pgs. 1971. Karupuramanjari Edition Ii.... Kalyan. Unknown. Unknown.. 100 pgs. Linguistics Literature. 216 pgs. Kanva Sanhita.. Kalyan Markandeya Puranam. 1934. Kalyan Ank. 900 pgs. 1937. Ghorapad'e Ekanatha Keshavarava. 307 pgs. Unknown. Vamana. Karaka Mimamsa. 240 pgs. Linguistics.. Unknown. 1915. Literature. Narayana Kavi. Krishna Das Gupta. Unknown. Language. Technology.. 1976. 0. Unknown. 0. Ramavatara Sarma. Unknown. 1967. 1942. 0. 0. Sanskrit. 1928. Unknown. -. Linguistics Literature. Sanskrit. Kamalavilasabhana. Srikanth Sharma.. Sanskrit.. 0. 564 pgs. 313 pgs.. Unknown. -. Bapuharshet Devalekar.. Sanskrit. Sanskrit. Kanva Sanhitha... Language. Karmakanda Karmavali. Sanskrit. Kalyana Sancheka. Bhattacharyen Sripad Sharmana Damodar Bhattsununa. Unknown. 1960. Hanumanprasad Pohar.. Sanskrit. Unknown. 148 pgs. 192 pgs. 240 pgs. Gauri Shankar. Theology. Unknown. Badlikar Sriyeag Raghavrisurisununa. Sanskrit. The Arts. Kalpadrukosha Da~vitiiya Bhaaga.. Sanskrit. Sanskrit. Sanskrit.. Brahmadeva. Gunabhadracharya. Kartika Masa Mahatmyam.. 1915. Kalyaanamaalla Anan'garan'gama~. Unknown.. Sanskrit.

Sanskrit. Sanskrit. Sanskrit. Unknown.. Kasyapa Jnanakanda.. Language. Sanskrit. 1921. 222 pgs. Sanskrit. Unknown. Social Sciences.b. 1979. 624 pgs. Sanskrit. Rambalak Shastri. Kavya Parisha. Kathopanisad Bhasya. Sanskrit. Sanskrit. Kavyakotukadarsh. Rarthasarathi Bhattachar R. Kasyapa Maharshi. 1951. 84 pgs... Kasyapa . Kathaka Vyasatirtheeya Teeka.girdhar Sharma.. Vamana And Jayaditya. Literature.. 342 pgs. Sanskrit.. William Caland. Unknown. 62 pgs. Sanskrit.. Sanskrit. Kaut'iliiyama~ Ara~tha Shaastrama~ Dditiiyo Bhaaga.. 1904. 1948. 1944. Katha Kagruha Suthra...2/14/2011 y pgy p A list of scanned y Sanskrit books at III… pg Kasika Part 1.. Sanskrit.. 330 pgs. Unknown. Literature. sanskritdocuments. 142 pgs.Jnan kanda. Har Dutt Sharma. Linguistics Literature. 240 pgs. Unknown. Sanskrit.. 0. Unknown. Unknown. 1963. 502 pgs. Unknown. 1923. Sanskrit. Sanskrit.r. 172 pgs. 1952.. Shriivopadevagosvaamii. 1987. Kathasaritsagara Part 2... Rajachudamani Dikshita. 1969. Unknown. Sanskrit.... 1919. Unknown... 1924. Somadeva. Unknown. Sanskrit. Jollii Je. 266 pgs. 211 pgs. 1934.. Kat'hopaanishhada~ Aavrxtti Pahilii. Sanskrit. 466 pgs.. 1984. M. Katyayana And Patanjali Edition Ii. Theology. 210 pgs. 423 pgs. 348 pgs. R Ananta Krishna Sastry. 92 pgs. 1939. Bhin'de Sadaashivashaastrii.. Sanskrit.. Language. -. Parthasarathy Battacharya. 1904... Unknown. 1960. Sri Parushuram Sharmana. 338 pgs. Social Sciences.. Linguistics.. Unknown.. 122 pgs. Sanskrit. Sanskrit. Kavya Prakash. Kavyadeepika. 230 pgs... 339 pgs.… 26/167 . 338 pgs. Theology.manduka Vyasatirtheeya. Gajanan Balkrishna Pa sule. 260 pgs. Literature. Dr Gaya Charan Tripathi. Religion. Social Sciences.. Kavindracharya List. Kavindracandrodaya. R.. 202 pgs. Sanskrit. Linguistics. Jolli Je. Sanskrit. Pt.. Katha Sarithsagara. 1948. 1923.. Sanskrit. 0. Kathakagrhyasutram. Kasyapa Gnanakandaha. T. Kaushhiitakagrxhyasutraand-i. Kathamruthamu..nitya Nanda Parvatiya.org/…/SanskritIIIT. 236 pgs... Dr.. Sanskrit. Kavyadarpana Volume 1.. 1924.vedeshiya Teeka. 378 pgs.. Kavyadarsh.. Kaumudi Mahotsava. 1930. 1938.m.. 142 pgs.. Unknown. Unknown. Pandith Rangacharya Raddi Shastry. Katakarajavamsavali Vol I.... 344 pgs. 220 pgs. Kasyapa Samhita... 1925.. 1925. Kaut'iliiyama~ Ara~tha Shaastrama~ Dditiiya Khand-d'a. Unknown.. Sanskrit. Chintaamand-i Ti Ra. Sanskrit. 1998. Sanskrit. Rarthasarathi Bhattachar. Sanskrit. Kavikalpadruma Prathama San'skarand-ama~.willem Caland..krishnacharya.p. 1965. Sanskrit. Kautilya Vol I. Unknown. K C Varadachari.. Sanskrit. Kaut'iliiyama~ Ara~tha Shaastrama~ Khand-d'a 1. Social Sciences... Dr Ram Gopal Mishra. Sanskrit. Religion. 58 pgs..r. 1954. 114 pgs. S V Shastri. Unknown.. 1959. Kavikalapadruma Of Vopadeva. 164 pgs. Unknown. Sanskrit.. Religion. 0. F Keilhorn.srinivasa Tirtheeya Etc.. Unknown. 1924. Kaut'iliiyan' Ara~tha Shaastrama~.. Pandith Sri Ram Govind Shukla. 486 pgs. Unknown.. Shaastrii Ra Shamaa. Jolli Je.. Sakuntal Rao Sastri.. Unknown. Katiyeshti Dipaka..

Unknown. Kavyamrtam. Krishna Charitramu Peri Venkateswara Shastri Unknown Sanskrit 0 74 pgs sanskritdocuments. 140 pgs. Unknown. 538 pgs. Kavyalamkarasutravritti Of Vamana.. Krishna Charitam. Narayan Ram Acharya. Sanskrit. Sanskrit. Sanskrit.. 1929. Bhat't'a Keshava. Unknown. Sanskrit. Keinchuifantsan.. 114 pgs.b. 1951. 1944. -. -.. Pandit Durga Prasad.. 0. Religion. Khiladikara. Linguistics.. Khilandhikara. K. Sanskrit... The Arts. 1934. Sanskrit.. 57 pgs.. Kenopanishhata~. Pandit R. 1992. 1916. Sanskrit.. Kavyalankara.... Sanskrit. 1938. 576 pgs. 1962.. Arka Somayaji. 587 pgs. Sanskrit. 203 pgs. 1956. Narayana Daso Banahatti. Sanskrit. 1957. Kavyamala Part 1. 1917. Rajvaidya Jivaram Kalidas Shastri. Kiratharjuniyam. Kavyaprakash.. Unknown.. Kiichakavadhama~. 1916. Sanskrit. 123 pgs.... Sanskrit. Kiranavalirahasyam Of Mathuranatha Tarkavagisha. Philosophy.. Ganeshopadhyay. Sanskrit... Kavyalankarasutrani Vol I V. 1938.. of scanned Sanskrit books at III… . Unknown. 1934. Unknown. N. 1889. 191 pgs. Sri Harishankara Sarama. pg Kavyalaksana Of Dandin.. Kavyamala Part 5.. Dr.org/…/SanskritIIIT. Pandit. Kiratarjuniya 1889. Kavyamala Part 13. 1959. Sridhar Shastri. Psychology. 356 pgs.. Kavyalankara.. 449 pgs. Kavyasamudaya. 327 pgs.. Unknown. Unknown.. Kasinath Panduranga Parab. Koushetika Brahmanam Achara Vichara. 232 pgs. Kemopanished. Unknown. Unknown... 275 pgs. Sanskrit.. Unknown.. 582 pgs.. Sanskrit. 1938. Sreeramamurthy. 1992. Sanskrit. Religion. Sanskrit. Sanskrit.. Sanskrit. Kavyaprakasa of Acharya Mammata... Kavyasangraha 3. Sanskrit.pathrusarthi Bhatta Charya.. Theology. Sanskrit. Poems. Theology. 176 pgs. 1981. 1997. 117 pgs.. 646 pgs. Unknown. 70 pgs.. ananthalal thakur. 359 pgs. . Unknown.. Sudhakar malaviya.. Unknown.. Kavyamala. 1961.. 2003. Mahamahopadhyaya Pandith Shivadatta. Laqs-mikaantasyaa jii. 510 pgs. 190 pgs. 0. 1937. 124 pgs. Sri Venkataramanarya. Kishkindhakandah Of Srimad Ramayanam. Sanskrit. Kiirasandeshah.. Kavyalankara. Narayan Nathaji Kaulkarni.. Machchhakad'araachaara~ya. Durgaprasad. Kavyanusasana. Srigowrinatha Shastri. Sanskrit.. 1166 pgs. Keralodaya (a Historical Poem). Literature. 174 pgs. Acharya Hemachandra. Language... Sanskrit.d.. Sanskrit.2/14/2011 y p A list. 112 pgs. 43 pgs. 1919. 180 pgs. 332 pgs.. 1919. Unknown. Banhatti. Kavyanusasana Vol I. 0. Sanskrit.. Jivananda vidyasagar Bhattacharya.ezhuthachan.. 1927. Naaraayand-a. 1925... Indian Logic. Theology. Kavyalankara Sara Sangraha. Unknown. Kenopanishhata~ Shhashht'hiiya Khand-d'a Grantha 6. Sanskrit. Kevalanavyiprakarnaam.. Unknown. 166 pgs. Unknown. 2002..... Pandit Sivadatta. Dr. Sanskrit. 1952.. Sanskrit. Khanda Kadya Sahastrika.madladevi Shastri. Hari Narayan Aapte. Unknown. Pandit Durgaprasad.. 1951. Unknown. Unknown. Sanskrit. Kramadiipikaa. Religion.… 27/167 .. 108 pgs. Kavyamala Part I X. Sanskrit. 224 pgs.. Sanskrit. 334 pgs. Pardha Saradhi Battacharya. Nitiivara~ma Mahaakavi...n. Sanskrit. Sanskrit. Poems.. 1929. 626 pgs.

Sanskrit. Sanskrit. 178 pgs. Krishnajuvirdeeya Taitireeysanhitha.. Shivaa Chara~yaa Niilakan't'ha. sanskritdocuments.org/…/SanskritIIIT.. 1941. Sanskrit...xiv. Theology. 1890... Kundamaalaa. Unknown. Thakkura. Shriimatsaayand-achaara~yaa. Kumarasambhavam Mahakavyam.moksakanda.. 372 pgs. 580 pgs. 1950. Krxshhnd-a Yajura~vedii. K V Rangaswami Aiyangar. Sanskrit. 401 pgs. Sanskrit... Religion. Krxshhnd-ayajura~vediiya Taittiriiyasan'hitaa Prathamo Bhaaga. 1976.. Shriimatsaayand-aachaara~yaa. Language. 1997. Dr... Kurmapuranam. 258 pgs. Shriimatsaayand-aachaarayaa. 1967. 1983. 1848. Sanskrit.ramamurti. 322 pgs. 1940. 446 pgs. Unknown. 1954. Krxshhnd-ayajura~vediiya Taittiriiyopanishhata~ Pnj-chamiiyamang-kanaavrxtti... Theology. Krtyaratnakara.. 1950... Kriya Svara Laksanam Or Yohi Bhasyam. 1929.. Sanskrit.. 1976. Suru Bhatta. k.. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… Krishna Charitramu. Rangaswami Aiyangar. Ksemendra Ladrukhayasangra. 1950. Theology. K.ayendra Sharma.. Unknown. Krsnavilasa Of Punyakoti. 180 pgs. Krtyakalpataru Of Bhatta Lakshmidhara Vol Iv.. Krishna Vilasa Of Punyakoti With Commentary.. Sanskrit. 462 pgs. Sanskrit. Rama Murti.. Sanskrit.. Sanskrit.. 1946. Rangaswami Aiyangar.. Religion.. 349 pgs.v. 1940. 592 pgs...s. Theology. 414 pgs. Literature. 1950. Sanskrit.. Shriiding-a~naaga Mahaakavii.. Ksemendra Studies. 446 pgs. k... 373 pgs. Sanskrit. Krxshhnd-ayajura~vediiyataittiriiyasan'hitaa Da~viitiiyo Bhaaga. Dr. Unknown.v. 413 pgs. Krtya Kalpataru Of Bhatta Laksmidhara Danakanda Vol 5.v.s. 1929. Sanskrit. 1948. Sanskrit... Unknown. 478 pgs.. K V Ranga Swami Aiyangar. Religion. 681 pgs.. Sanskrit.. Theology. Sanskrit. 1945. Peri Venkateswara Shastri. 644 pgs. 777 pgs. Sanskrit. 234 pgs.. Kumparnapuranam.. Dr. Religion.. Krtyakalapataru Of Bhatta Laksmidhara Vol 1. Kriyaasaara Vol I. Unknown. 1925. Religion. 490 pgs.. Sanskrit. Sanskrit. Theology. Shriimatsaayand-aachaara~yaa. 436 pgs. Krtyakalpataru Of Bhatta Laksmidhara Vol 3 Niyatakala Kanda. Unknown.k. Sanskrit.… 28/167 . Krxshhnd-ayajura~vediiya Taittiriiyaarand-yakama~ Prathamo Bhaaga. Unknown. Unknown. Unknown. Dr. 1954. 74 pgs. Religion.v.ramshankara Bhattacharya. Sanskrit. Krtyakalapataru Of Bhatta Laksmidhara. 1961. Religion. Sanskrit.. 1983. Religion... Krxshhnd-a Yajura~vediiya Taittiriiya San'hitaa. Religion. Sri Neelamanimukhopadhya. Unknown.. Unknown. 290 pgs.. Sanskrit.. Krtyakalapataru Of Bhatta Laksmidhara Vol.. 230 pgs. Dr Surya Kanta. Sanskrit. Religion. 1942. C. 658 pgs. Vaamanashastrii Pand-d'ita. Rangaswami Aiyangar. k... Krtyakalpataru Of Bhatta Lakshmidhara Vol X. 0. Rangaswami Aiyangar. Theology. Unknown. Krithya Kalpataru. Unknown. Unknown.sudhakar Malaviya. Krxshhnd-a Yajura~vediiya Taittiriiya San'hitaa Panj-chamo Bhaaga. Unknown. Pandith Sripad Damodar Sathvalekar. 1945. Sanskrit.. 424 pgs.. Sanskrit. k v rangaswami aiyangar. K. Rangaswami Aiyangar.

. Latkamelakamu. Raghunathaharya N c. 0. Lectures On Patanjali S Mahabhasya Vol 2 Ahnikas 4 6. Sudarshanacharya Tripathi.. Prakash. 70 pgs. 466 pgs. Dasharadhi.… 29/167 . 514 pgs. Natural Sciences. Shriinaageshabhat't'a Mahamahopaadhyaaya. Unknown.. N C S Venkatacharya. 1938.. Sanskrit. Religion. Pandit Sri Achyutananda Jha...... 1917.. Sanskrit.. Unknown.. Lagusidhantkomudhi.. Tata Subbaraya Sastri. Laghurkatantrasamgraha And Samasaptalaksana. History. 1988. Suryakanta.. Sanskrit.. 314 pgs.. 34 pgs. Sanskrit.. Unknown. 1954. Sanskrit.. Linguistics Literature.. Unknown. 277 pgs. 1993.... 1944. Sanskrit. Sanskrit.. Sanskrit. 1944. Lalleshwari Vyakyani.. shri achyuthananda jha. Saktisrm. Sanskrit.. 0. Laghu Kashika 1. Sanskrit. Religion. Pandith Nandkishore Shastri Ayurvedacharya. Laghu Siddanta Kaumudi.. Laghushabdendushekhara Napadaantasuutraanto Bhaaga. Laghubhaaskariiyama~. 328 pgs. Laghu Sabdendu Sekhara Vol I. Unknown. 65 pgs.. Laghu Siddhanta Kaumudii Pura~vaara~dharuupa Prathamo Bhaaga. Sanskrit.. 1950. Sanskrit. 152 pgs. 134 pgs. Laghusidhantakoumudhi. Language. Lakshmi Sahasram Part 1. Unknown. Sanskrit. Unknown. Sri Varadharajacharya.2/14/2011 A list of scanned Sanskrit books at III… Kut't'aakaarishiromand-i. Madhusudan Kaul. 1974. Ladhu Ramayanam. Laghusiddhantkaumudi. 1999. Sanskrit. Shara~mand-aa Vaasudeva.. Kuvalayaananda. Diiqs-ita Vaasudeva. 0. 296 pgs. Sanskrit. Acharya Krishan Mohan Shastry. 2000. Theology. 342 pgs. Sanskrit... Lalitha Madhavam Gareth And Lynette. Sanskrit.. 1941.. 310 pgs. Laghu Parasari And Madhya Parasari.. Pandith V. Sanskrit. 394 pgs.. Varadaraajaachaara~yaa. 1952. Biography. 133 pgs. 220 pgs. Sanskrit.. Prakash. Sanskrit.. Kulakara~nii. 1993. Krishnamacharya. Literature. 298 pgs. Peri Venkateswara Sastri. Unknown.. 456 pgs. 1941. Lakshmisahasra Vol Iv... Unknown... Lavangee. 1977. Unknown.. Sri Girishkumar Tagore. 1931. Sanskrit. Sanskrit. Lakshmi Tantra A Pancaratra Agama. 1978. Laghumaanasama~. alfred lord tennyson. 257 pgs.. 162 pgs... 496 pgs. 1867.. Unknown. Sanskrit. Theology. Unknown. Sri Govindnath Guha. 1983. 1962. Language. Laghu Shabdendu Shekar. Unknown. Pandith Sri Narayana Dutt Shastrina. Religion. 0. Laghuparashari Madhyaparashari. 1940. Le Role Des Forets Dans Le Developpement Des Collectivites Locales Forets7. 174 pgs. Sanskrit. 1998. P S Subramanya Sastri. Sanskrit. 1651. 1951 314 sanskritdocuments. Kuttanirmatam Kavyam.. Theology. Sanskrit. Laghu Sabdendu Sekhara.. 1946. Varadharajacharyapranith. 130 pgs. Sanskrit.. Geography. 46 pgs. Laalaa Lajapatharaaya Yan'chen' Aatmacharitra Va Charitra.. Literature. Venkatadhvari. Religion. Sanskrit. Theology... Unknown. 372 pgs. Unknown. Shriidevaraaja. Shriibhaaskaraachaara~ya. Unknown.. 290 pgs. Natural Sciences.. Munj-jalaachaara~ya. J P George. 124 pgs. Lagusidhanthkoumudhi. 1959. Unknown. 684 pgs. 608 pgs. Kutuuhalavrxtti Prathamodhyaaya.. -. Natural Sciences. 858 pgs. Sanskrit. 1280 pgs. Linguistics. 34 pgs. Unknown. Unknown. 1904. Sanskrit. Ladhunibandha. Linguistics. 1936. Sanskrit... Sanskrit.. Lakshmisahara. Sanskrit. Unknown.. Unknown......org/…/SanskritIIIT..

1931. 1944. Literature. Unknown. History. Sanskrit.. 1924. Kara~ve Chintaamand-agand-esha. 194 pgs. Geography. 1955. Gaan'dhii dara~shana~. Geography. Maan'nd-d'ukyopanishhada~ Taittiriiyapanishhada~ Aavrxtti Pahilii.. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… 1951. 1937.. Language. Theology. Sanskrit. Shriinivaasaachara~yaa Laqs-miipurama~.. 1948. Liilaavatii Uttarara~dharupo Da~vitiiyo Bhaaga.. History.. 374 pgs. 314 pgs. Biography. Geography. Literature. Sanskrit. 1946... 491 pgs. 491 pgs. 0. 1930. Ma. 268 pgs. Devadhara. Maalati Maadhava Sekand'a~ Ed'iishana~. Literature.. Pandith Ravi Dutt. 1925.. Sanskrit. Linganusasana Of Durgasimha. 1935. Maajhaa Sn'giita Vyaasan'ga. Maajhii vilaayatachii Saphara~. Linganusasana. Maanavaa Grxhayasuutraa. 1812.. Biography. Sanskrit.. 1937. vinayak ganesh apte. Sanskrit. Linguistics. bhogilal. 115 pgs. Unknown. Sanskrit. Religion. 685 pgs. Korat'akara Vit't'alakeshavaraava. Sanskrit. 1952. Unknown. Natural Sciences. Sanskrit. Maanameyarahasyashlokavara~tikama~. Psychology. 1953.... Sanskrit. Psychology. Philosophy. Unknown. Natural Sciences.. Maadhaviyaadhatuvarittii. Sanskrit. 474 pgs. Language.. 314 pgs. Maara~ka T'a~vena. Unknown. Maalatiimaadhavan' Naamaprakarand-ama~. Language.. Linguistics. 120 pgs.. Biography. Biography.. Bhavabhuuti. Shriimadbhaskaraachaaryaa. Lokaprakasha Of Kshemendra. Sanskrit. 277 pgs. 104 pgs. Dattatrey Gangadhar Koparkar. T'en'be Govin'da. 146 pgs. Shriimadbhaskaraachaara~yaa.. History. Sanskrit. Linguistics. Sanskrit.. sanskritdocuments. P S Subrahmanya Sastri. Vinayak Ganesh Aapte. Shaastrii Raamaakrxshhnd-a Hara~shaajii. Bid'e Sadhaashivashaastrii.. Religion.. 182 pgs. Life of Pingali Suuranaarya.. 266 pgs.. 448 pgs. Kulakara~nd--ii Ran'ganaatha. 150 pgs. Maalatiimaadhavama~. Unknown..... 1926. 1931. Leelavathi Uttarshorupo Dwithiyo Bhagah. Lectures On Patanjalis Mahabhasya Vol I I I. Literature. Harsavardhana.. 0. Unknown. Sanskrit. History. Sanskrit. Madanpalnidhantu. Shriinivasaachaara~ya Laqs-miipurama~. 1953...org/…/SanskritIIIT. Leelavathi.. 1947. Shriibhavabhuutii Mahaakavii. Language.. Philosophy.. Sanskrit. Aapat'e. Linguistics. 86 pgs. 1934. Pandit Jagaddhar Zadoo Shastri.. Madanamaharnava. 270 pgs...... Literary Circle Of Mahamatya Vastupala And Its Contribution To Sanskrit Literatute. Sanskrit. 178 pgs. Sanskrit.. Geography. Chaara~yaa Vyaakarand-a. Geography. 1913. Sanskrit. sri visvesvara bhatta.… Madhavanidan Vijayarakshita And Shri kanthadatta Unknown Sanskrit 1932 792 pgs 30/167 . Sanskrit. 0.. 1951. Linguistics. Unknown.. 327 pgs. 501 pgs. Biography.. Sanskrit. Sanskrit. Literature. 1928. 326 pgs. History. 187 pgs. Liilaavatii Pura~vara~dharupam Prathamo Bhaaga. Unknown. Tekumalla Achyuta Rao. Maanameyaarahasyashlokavara~tikama~ Sakalashaastrasaarasan'graharupama~. Theology. Sanskrit. 677 pgs.. Maanavii San'skrxtiicha Itiihaasa... Language..

Mahaanaarayand-a.. Literature. madhakara... 162 pgs. Saradaranjan Ray Vidyavinodha. Linguistics. 1953. Sanskrit. 176 pgs.. Saatalekara Daamodara. Raghuviiraa. Unknown.. 454 pgs. sri madhuvakar. 1984. 1931. Language. -. 84 pgs. Maha Bandho Vol Iii Book Iv. Sanskrit. 0. Language. Unknown.. Manmukundamuni.. Bhuda~bali Bhagavan'ta~.. Madhvatantramukhamara~danama~. 1969. Sri Vrajwallabh Sharmana. Unknown.. Linguistics.. 792 pgs. Literature.. Sanskrit. 180 pgs. Religion. Unknown. Theology. Sanskrit. Unknown.chaudika prasad sharma.. Pand'e Siitaaraama Vasudeva.. Unknown. Sanskrit. Sanskrit.. Sanskrit. Mahaaraaja Shivaajii. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… Madhavanidan. 601 pgs.. Dr Hari Narayan Dixit. Shriimanniilakand-t'ha... Mahaapurand-ama~ Da~tiiya Khand-d'a. History. 590 pgs. Biography. 832 pgs. 1992. khemraj Shri krishnadas. Maha Bhashyam. Linguistics... The Arts. 406 pgs. Mahaabhaaratama~ Prathama Bhaaga Viraat'apara~vama~.. Sanskrit. Literature.. 710 pgs.. Unknown. History. 0. Unknown. Sanskrit.... 1941. 385 pgs.. Theology. Maghas Sisupalavadham Canto I I Edition V I. Philosophy.. Mahaaban'dho Pustaka~ 3. Sanskrit. 1931. Shriimadappayyadiiqs-ita.… 31/167 . Unknown.. Pushhpadantaa Mahaakavii. 1932.. Sanskrit. Social Sciences. 104 pgs. Geography. 1954. Religion.. Madhyakalin Hindi Sant Vichar Aur Sadhana. Madhyakaumudini Rahasyam Prashnottari. Sanskrit. Bhagavan'ta Bhad'aaraya Bhuudabali. 741 pgs. Madhavanidana.... Biography.. Kaand-e Pii Vii. Pandith Sri Ramchandra Bhatt. Unknown. 1953. Philosophy. Gaddangadevi. 92 pgs. Sanskrit. Madhyama Kavatara Par Candrakirti. Mahaapuraand-ama~ Uttarapurand-aada~vitiiyaara~dhabhuutah Trxtiiya Khand-d'a. Mahaabhaarata 13 Anushaakanapara~va. Sanskrit. Linguistics. 1912. 0. 1986. Psychology. 1930.. Vipushhpadantaa Mahaakavi.. Sanskrit. 456 pgs. 520 pgs. Vijayarakshita And Shri kanthadatta. Sanskrit. 408 pgs. Ganga Devi.. Linguistics. Unknown. sanskritdocuments.. P. 1965.. Mahaanaarayand-a Upanishhada. Literature. 170 pgs. Language.. Sanskrit. 1992.. Geography. 198 pgs. Unknown. 1835. Unknown.. 1940. Literature. Maenkavishwamithram. 444 pgs. Sanskrit.... 589 pgs.. Valle poussin. Sanskrit. Madvanidhanamu.org/…/SanskritIIIT. Psychology. Vasubhandu And Sthiramati. Sanskrit. 1919. Sanskrit. 172 pgs. Literature. Mahaabhaaratapraveshikaa. Sanskrit.. Mahaabhaaratama~ Sat'iikama~ Chatura~to Bhaaga Drond-apara~va... 1983. Madhavnindanam. 70 pgs.. 1951. Madhavanidhan.. Mahaaban'dho Bhaaga 2. Madhyanta Vibhanga. Sanskrit. Madhura Vijaya Or Virakamparaya Charita.. Unknown. Mahaabhaashhyama~ Prathama Grantha. Madhura Vijayam. Sanskrit. 1936. Keshani Prasad Chaurashiya. Sanskrit. 448 pgs... 0.. Sanskrit. Language.. 503 pgs. 1924. Madvanidhan. 1888. Language. 596 pgs. 1086 pgs. Phool Chand Siddhanth Shastry. Sanskrit. 1956.

1989.r.. 315 pgs. 1911.. Sanskrit. Sri Sheshraja Sharma Shastri. Mahabharathmarmagya Varnasi Subhramya Shastry. -. Bhuutabalibattaraka Bhagavan'ta~. 1969. -. . 1926. Sri Anjani Nandan Sharan... 284 pgs. 0. Unknown.. Malatimadhava. Unknown.. Mahakavi Bhasas Swapna Vasavdatta Natak. Maharajas Sanskrit College Magzine. Mahabharatha Kosha. Sanskrit. 1955.. 232 pgs. Sanskrit. M. Sanskrit. Mahabhasyam. 422 pgs. Sanskrit. Mahaarashhatra Itihaasaman'jarii.. Sanskrit. 280 pgs. Unknown. Sanskrit. Sanskrit. 370 pgs. Mahaviirachacharitaa.. Sanskrit. -. 790 pgs. Unknown. 1941. Swami Dwarikadas Shastri. . Mahabhasya Praskash. Biography. 1951. 765 pgs. 597 pgs. Anundoram Borooah. 0. Geography. Unknown. 1929. Vayu Purana. Maharaja Bhojarajas Sringar Prakasha. Sanskrit.. 1990. Biography. Unknown... Malavikagnimitram. Sanskrit.. -. Unknown.. 77 pgs. Sanskrit. Unknown. 1986.. 153 pgs.. Unknown. 537 pgs. Sanskrit.. -. P. Bhaavabhuuti... Shastri. 0. 709 pgs.. Sanskrit. 744 pgs.. Sanskrit. Sanskrit... Mahanirvana Tantra Vol Xiii with The Commentary Of Hariharananda Bharati.. History. Mahabharata Tatparya Nirnaya With Comm Anandha Thirtha. sanskritdocuments... Aapat'e Dattaatrayavishhnd-u. 360 pgs.. Geography. Sanskrit. Sanskrit...... Gaan'dhiijii Mohana~daasa~karama~chanda~. 334 pgs.. Mahabharathvachanamruthm. 0.. Mahaatmaajiin'che Satyaache Prayoga Athavaa Aatmakathaa. H Mhpohobs.. 1951. Mahaban'dho Prathama Bhaaga. Sanskrit. 378 pgs. 0.. Sanskrit. 1968. Mahaveera Charithramu.. Mahavira Charita Of Mahakavi Sri Bhavabhuti. Mahartha Majari. 1951. Shri Yogendra. Unknown. 1949. Geography. Sri Charudevshastryna.. Mahaviracharita Of Bhavabhuti. Manasa Piyush Sundara Khanda. 1918. Mahabharathtatvadeep. Unknown. 1931. Unknown.. Unknown. Sanskrit. Mahapurana Vol Ii Uttar Purana. Sanskrit. Sanskrit. Sanskrit. 1998.. Sanskrit. 0. 486 pgs. History. Mahabharathamu.. Majjhi Manikaya Vol 2. Unknown. 290 pgs. Acharya Sri Ramachandra Mishra. 0.. Unknown. 1993. 166 pgs. Unknown. Majjhi Manikaya Vol 1.. 0. 1954. 420 pgs...2/14/2011 A list of scanned Sanskrit books at III… Mahaaraashht'a San'ta Kavayitri. Maitrayani Samhita.. Religion.. . Unknown. Unknown. 1947.… M h t Of Th M it i S kh R ki h H h ji S ti U k S k it 32/167 . Madhukanth. ramkumar rai. Spiritual Experience And Mysticism. 1982.... Sanskrit. 503 pgs.org/…/SanskritIIIT. G R Josyer. Theology. 556 pgs. 354 pgs... Swami Dwarikadas Shastri. Aajagaan'vakara Jagannatha Raghunaatha. 285 pgs. 670 pgs. Pandit Guru Prasad Shastri.. 1918. 269 pgs. Unknown. Unknown. Malavikagnimitram. Pannalal Jain.... 274 pgs. 164 pgs. Sanskrit. 502 pgs. Religion. 750 pgs. Sanskrit. The Arts. Malavikagnimitram A Play In Five Acts. Theology. Sanskrit. 1845.. Mahabhashyam. Unknown. Sanskrit. Pandith Sri Ramchandra Mishra. Satavalekar. Biography. History. Mahavyutpatti... Sri Ramachandra Mishra. Unknown.... Sanskrit.

. 49 pgs. 0.. 632 pgs. Linguistics. Literature. 702 pgs... Sri Harish Shankar Sharmana. Mudrarakshasa Or The Signet Ring A Sanskrit Drama In Seven Acts.. Literature. 174 pgs. 333 pgs. Marcandeya Purana.. Philosophy. Language. Unknown. -. Unknown. Jaya Shankar Lal Tripathi.. Sri vidyanth Jha. Sanskrit.. Sanskrit. Maunt'ast'uara~t'a Elfinst'ana Saaheba Yaan'chen' chariitra Pura~vaara~dha. Mayadprajaichariu. 184 pgs. 203 pgs. Manormaratnavivek Vol Iv. Sanskrit..r. Shalaram Dwivedi. Mrcchakatika of Sudraka. 0. Psychology. 1929. Vishaakhadatta. Unknown.. Sanskrit.... Religion.. Language. Meghadutam. Sanskrit. 1879... Raajaa Kun'haana.. Unknown.nandargikar... 330 pgs. 1969. Language. Manthrardha Deepika. 1937. 318 pgs.. Sanskrit.. Meghaduta of Kalidasa Text With English Translation amp Notes. Unknown.. Sanskrit. Visakhadatta. Mayuura Sandesha. 2001. 1962. Sanskrit. Sri Mukunda Shastri. Minorworks Of Ksemendra. Sanskrit. Mimamsabalaprakasha Of Sri Bhatta Shankara. Linguistics. Unknown. Upanishads.... 195 pgs. Unknown... Linguistics... 335 pgs. Unknown. 0. 0. 1944. Sanskrit. Deva~ Shriivishvanaatha.org/…/SanskritIIIT. 1926. Markandeya Samhita. Sri Shathragna Mishra. Psychology... Mudra Rakshasam. 308 pgs. Manusmruthi. Sanskrit. 583 pgs. Mrxgaang-kalekhaa Naatikaa. Mudraraksasa First Edition.. 690 pgs.. 760 pgs. 1982.. Hira Lal Jain. Sanskrit. 1948.… 33/167 . 0. -. Unknown. Sanskrit. Unknown. Literature. 302 pgs. Sanskrit. Geography. Unknown.. 220 pgs.. Muhatri Chintamani... 374 pgs. Unknown. Mudraraaqs-asa Prathama San'skarand-ama~. Sanskrit. 372 pgs. Sanskrit. Ganesh Bihari Mishra. 200 pgs. Sanskrit. 1902. Literature. Kavi Shriikrxshhnd-aa. Language. 306 pgs. 185 pgs.. Apte. 1961. 1923. 1924. V. Muhoorta Depika. Unknown.. Kashmorey Dwij Sri Prannath Pandith. 128 pgs. Unknown.. 1911. Sanskrit. 1918. 94 pgs.. Philosophy. Mandaaramarandachampuh. sanskritdocuments. Dr C Kunhan Raja. 2002. Linguistics.. Sanskrit. 274 pgs. 1915. 0.g. Sanskrit. Mruschakatika...raghavacharya. Unknown.. Sanskrit. History. 1970. gagaavishhnd-a shriikruushhnd-adaasa. -. -. Jaimini. G.. Sanskrit. 1984... Shyam bihari Mishra. 1921. 178 pgs..2/14/2011 A list of scanned Sanskrit books at III… Manavagrhyasutra Of The Maitrayaniya Sakha. Sanskrit. Miimaan'saadara~shanama~. 1944.. Mimamsa Shastram. Sanskrit. 114 pgs. Literature. Dr Ramashankar Tripathi. Biography. Meghavijayopadhyayas Digvijaya Mahakavya. Sanskrit. Sanskrit. 230 pgs. Megh Dootam.. Mudrarakshasam. Sanskrit. 540 pgs.. Theology. E. God'abole Krxshhndaajiiballaala. Medhdutam.. Literature. Unknown. 0. Saradaranjanray Vidyavinode.. Sanskrit. Mayurasandesa. 235 pgs. -. Sanskrit. Shukadev Bihari Mishra.. khemraj Shri krishnadas. Sri Haridas Siddhanta Vagosha Bhatta Charya. Unknown. Unknown. Ramakrishna Harshaji Sastri..v.... 0. Sanskrit. Mandukya Upanished.. Unknown. 62 pgs.. 2002. Sanskrit. Mishra bandhu vinod.v.

. Linguistics. Sanskrit. 1987. Dr Devarshi Sanadhya Shastri. Literature. Nagananda Natakam. Sanskrit. Language. Sanskrit. Naathamaadhava Trot'aka Charitra va Aat'havand-ii.. Technology.. Naisadhiyacharitham Canto12 22 Uttarardha. 210 pgs. Pada~mashrii. Unknown.. Naanaara~tha San'grah Grantha 10. 4-8. Geography. 1906... Unknown. Natural Sciences.org/…/SanskritIIIT. Nagari Pracharini Granthamala Series No. Nagari Pracharini Granthamala Series No. Linguistics.. 4-6... Sanskrit. 290 pgs. Unknown. 168 pgs. 358 pgs. Unknown.. Chand baradai. Naamamaalaa. Sanskrit. Dhanj-jaya Mahaakavi. Sanskrit... History.. 1906... Sanskrit. Naanaathara~ San'grah. 135 pgs. Psychology. 132 pgs. Literature. 0. 1962. Kaviatan Pandit Shiv Dutta... 384 pgs. Naat'a~yadara~pand-ama~ Prathamo Bhaaga. Nagari Pracharini Granthamala Series No. Unknown.... Unknown. Philosophy. Naaraayand-aguro. 567 pgs. Linguistics. Sanskrit.. Mund-d'akopanishhata~ Grantha 9.. Sanskrit.. 276 pgs. 78 pgs. 1933. Sanskrit.. 1934. 452 pgs. 1937... -. Sanskrit.. Sanskrit.. Naagapura praan'taacha Itihaasa. Chintaamand-i.. Sanskrit.. 4-9. 1929. Sanskrit. Language. Chand baradai.. 0.. Language. Linguistics. Chintaamand-i Ti Raa. 1937.devarshi Sandhya Shastry. Myths And Races Of The World. 194 pgs. Literature. Literature...… 34/167 . 1927. Language. Chand baradai. Sanskrit. Literature. Pandith Sri Guru Prasad Shastry. Geography. 1926. 0... Sanskrit..b.. 1933.3. 111 pgs. jyeshtarama mukandaji. Sanskrit. Literature.. Language. 236 pgs. 674 pgs. 4-10. Unknown. Jagdamba Prasad Sinha. Biography. Sanskrit.dhawan. 1469 pgs. 0. Mulamadhya Makakarikas. Baalakrxshhnd-akulakara~nd-ii Purushhottama~.. 1985. Sanskrit.. Literature.. Unknown. Nalopakyanam Dwithiya Khandah. Biography. Sanskrit. Naisadhiyacaritam Of Mahakkavi Sriharsa. Naamalid'agaanushaasanama~. History. Literature. 1906. Chand baradai.. Unknown. 680 pgs.. 1907.. 1331 pgs. Sanskrit.d. 1941. Gunasaan'dra and Raamachandra. Naagarasara~vasva Kaamashaastrakaa Apuura~va Gran'thaa. Dr. Sanskrit. Literature. 1953.. Unknown. C. Sanskrit. Literature... Maadhavakaale Yaadava. Mysticism And Symbolism In Aitareya And Taittiriya Aranyakas. Dr Jagdamba Prasad Sinha.chakraberti. Theology. Nagananda Edition I I. P V Ramanuja Swami. 1992. Sanskrit.. 162 pgs. 0. Aapat'e Hari Naarayand-a. Unknown. Naaraayand-aguro San'skrxtakrxtayaa.. 790 pgs. 4-8. 1988.. Linguistics. Dr.. 92 pgs. Valle Poussin. Nalopakhyanam. Bhat't'a Qs-irasvaami. Sanskrit. m m pandit sivadatta dadhimatha. Naagakumaaracharita. 1927. 178 pgs. 131 pgs... Sanskrit. 170 pgs. 1934. Unknown. My Prayers Vol. 67 pgs. 492 pgs. S k it 1984 554 sanskritdocuments. 0. Nagari Pracharini Granthamala Series No. Nagari Pracharini Granthamala Series No.. Chand baradai. 173 pgs.. Pushhpadanta Mahaakavii.2/14/2011 p g g A list of scanned Sanskrit books at III…gy g pg Muhurtha Chintamaani.. Sanskrit. Namalinganusasana Alias Amarakosa Of Amarasimha. Naishaddhiya Charita. Religion. 206 pgs. Unknown. 1950.. Sanskrit.

Sanskrit.. Nanjarajayasobhusana Of Abhinava Kalidasa. 764 pgs. Narayankruthvruthisametamashrav Layan Shauthsutram. Bhattacharya.. Sanskrit. 1984. 422 pgs. Unknown.. Sanskrit. 344 pgs.r.org/…/SanskritIIIT. Unknown. 0. Kulakara~nd-ii Ekanaatha Dattaatreya. Sanskrit. 0. Unknown.. 300 pgs. -. Natya Sastra Of Bharatamuni 3. Unknown. 222 pgs.. 129 pgs. 562 pgs. 446 pgs. 1994. Sanskrit. Linguistics.. Literature. Unknown. Literature. Nanarthasangraha Of Ajayapala.. Natyashasrta Of Bharathamuni Vol Iii. Unknown.. 64 pgs. Nighantusesa. Theology. Sanskrit. Language. Namamalikaa Bhojaa... Sanskrit.. Linguistics.s. Dr. Sanskrit.saini. Language. 0. Sanskrit. Nispannayogavali. 1986. sanskritdocuments. 560 pgs. 1930. 0. Rama~lala~ Kanjilala~ Yama~ Hecha~. Religion. Natyasastra With The Commentary Of Abhinavagupta Vol 3. 219 pgs. Nareshvarapariksha.. 420 pgs.sankara Ramashastri. Nishkarma Siddhi. 1955.. Sanskrit. Sanskrit. 146 pgs. 471 pgs.. Sanskrit. 1949. Unknown. Ramakantha. Dr. T R Chintamani... Sanskrit.s. Unknown. Natya Sastra Sangraha Vol Ii. 506 pgs..... 554 pgs. Natyasastra Of Bharatamuni Vol Iv. Abhinava Gupta Charya. Sanskrit. 420 pgs. Unknown. C.ravishankar Nagar. Unknown.. 204 pgs. 1954..r. 748 pgs. Sanskrit. Literature. Language.. 1969. 1942..… Nitiprakashika Vaisampayana Unknown Sanskrit 1953 135 pgs 35/167 . 1941.. Sri Prem Vallbh Tripatisha Thran. Nirakttama Da~vitiiyo Bhaaga. 366 pgs. Sanskrit. 1928.. Sanskrit. Niilamatapurand-ama~... 1926.. Sanskrit.... Nira~nd-aya Sindhu. 1926.. Unknown. 340 pgs. 0.. Naradh Puraye. embar krishnamacharya. 972 pgs. Sanskrit. Unknown... Nirnaysindhu Vol Ii.. Sundara Pandya. acharya hemachandrasuri s. 1953. 367 pgs.. Unknown. Sanskrit. Unknown.. Sri Kamalakar Bhatt. Sanskrit. Sri Madanthram Shastry. Narasinha Puranam. Social Sciences. 1934. Sanskrit. 1924. 230 pgs. m ramakrishna kavi. Unknown. Sanskrit. Literature. Sanskrit... 772 pgs. Makara Bhad'aka.. 1984. Unknown. Unknown. Unknown. Dr.nagar.abhinavabharati 1. 1949. Shriimadhyaaskaachaaraya. 1983. Sanskrit. 1986.. Unknown. 392 pgs. Unknown. Niteshatakam.. Nitidvishashtika. 1984. 474 pgs.. 1917. 162 pgs. Sanskrit. Natyasastra Of Baratamuni. Sri K Vasudeva Sastri. Hari Narayan Aapte. Literature. 1994..2/14/2011 A list of scanned Sanskrit books at III… Sanskrit... 144 pgs.. Natya Sastra Sangraha Vol I. Abhinava Gupta Charya.... Pandith Shivduttsharma. 1961. Sanskrit. Linguistics.. Bhat't'a Kamalaakara. 218 pgs. Sanskrit.. Natyashasrta Of Bharathamuni Vol I I. Abhinavaguptacarya. Navaratnavidhapadhathi.. 556 pgs. Nanartha Samgraha. Sanskrit.. Sanskrit. Unknown. Niruktan' Dditiiyo Bhaaga. Unknown. 1968. Anundoram Borooah. Language. Linguistics. Narayaniya Of Narayana Bhatta.. Niruktam.. Unknown. 1937. Sri Daivagyadunichandratmajapandit. K Sambhasiva Sastri.. K Vasudeva Sastri.. Nilakanthavijaya.

E. Unknown. 666 pgs. 1909. Mahendra Kumar Nyaya Shastry. Gopinath Kaviraj. Sanskrit. Nyayabhindu Of Dharmakirti. 872 pgs.. 118 pgs. 1932. Remella Suryaprakasa Sastri.. Nrisinha Prasada Tritha Sara. Nrxsin'hapuuvauttarataa Paniiyopanishhata~. Nyay Lalavati. Theology. Sanskrit. 1927. Philosophy. 184 pgs. Nyaya Lilavati Ii 2. 1953.. Sanskrit. Nyayamritakulya. Nyaayasudhaa Faskikyulasa~9. Nyayabhindu. Sanskrit. Nyasakalpalata. Language. Nitiprakasika. 1929. -. 58 pgs. Psychology. Sanskrit... 216 pgs. Aapat'e Gand-osha Vinaayaka. Nyaaya Kumuda Chandra Dditiiyo Bhaaga. 1904. 1955.. Sanskrit. Psychology. Sanskrit. Linguistics.. 1932. Sri Ananda Bodha Battaraka Charya. 36/167 . Vishwanathvritti.. Bhat't'asomeshvara. Nyaya Lilavati Vi 6. 1992. Unknown.. Sanskrit. Goswamy Damodar Shastry.. Sanskrit..8.. Unknown. Literature. E. 0. 110 pgs. Unknown. Sanskrit.. 106 pgs. Nyaya Lilavati V 5. Philosophy.. Sanskrit.. 41 pgs. Sanskrit... Nyaayabindu. Nyayadarshanamu... 1902.. Mahadeva Sastri. 1909.2/14/2011 A list of scanned Sanskrit books at III… Nitiprakashika. Literature. Nyaya Makarandaha. Unknown. 1938. 153 pgs. Literature. Kumaara Nyaayaachaara~ya Mahendra.. . Unknown.. -. Unknown. 1990.. Unknown. Psychology. Psychology. Dwaita Philosophy.. 102 pgs. 328 pgs. Sanskrit. Sanskrit.. sanskritdocuments. Nyaya Lilavati I 1. 110 pgs. Unknown.. 112 pgs... Literature. 102 pgs. 119 pgs. Vaisampayana.. Philosophy... 216 pgs... 1940. Gustav Oppert.. Unknown. 1916.. Shriidhara~mottaraa Chaara~ya. Philosophy. Sanskrit. Sanskrit. 1907.org/…/SanskritIIIT. Remella Suryaprakasa Shastri. Unknown. 1941.. Unknown. Unknown. 0. Nyayamrithaha Sudha chandrika. vallabhacharya. 249 pgs. Nitya Kamya Karma Mimamsa. Sanskrit.. Nyayadarsana... Sanskrit.. Unknown. Sanskrit. . 236 pgs. 1990.. 388 pgs. Shriimadudayaanaachaara~yaa. Philosophy..obermiller.. Sanskrit. Unknown. Nyayabhindu Of Dharmakirti And The Nyayabindutika Of Dharmottara. 1933. . Tukaram Javaji.. 1985. Nityotsava Vol Iii. Religion. Sanskrit. vallabhacharya. 332 pgs. 1992.. 1919. vallabhacharya. Sanskrit. Unknown.… Nyayamrtatarangini 686 16383.. 135 pgs. Theology... Nitya Kamya Karma Mimamsaa. 849 pgs. 1932. Sanskrit. Nyaya Kumud Chandra Vol-i. 1948. 186 pgs. Shukla Sri Raja Narayan Sastry.. Indian Logic. Sanskrit.. Someshvara Bhat't'a. Nyaya Lilavati Viii . Nyaya Lilavati Vii 7. Sanskrit.obermiller. 108 pgs. Sanskrit. 1938. 243 pgs. Sanskrit. 2000. Shastrii Raamasubramand-yama~.. 1929. vallabhacharya. Nyaayabhaaskarakhand-d'anama~.. 355 pgs. Unknown. vallabhacharya. Sanskrit. Unknown.. Vyallabhacharyya... 115 pgs.. 1927. 1954. Unknown. 1936.. Psychology. vallabhacharya. 155 pgs. Religion. Nrsimhtyasya Prayoga Parijatasya Sodasa Samskara Kandam Pakasamstha kanda Samksepasla. Sanskrit.. Linguistics. Sanskrit. Nyaayakusumaan'nj-jali. Nyaayasudhaa. Sanskrit... 1992.. Nyayabhindutikatippani.... 971 pgs. Sanskrit. 134 pgs. Sanskrit.. 608 pgs. Padamunnur Sri Narayanacharya. 96 pgs. Language..

Sanskrit. Sanskrit. 534 pgs.. Theology.. Padhamanjari Dwithiya Bagamu..ramaswami Sastri Siromani. Sanskrit. 1990. Nyayasiddhanta Muktavali. Sanskrit. Panditaraaja Jagannatha. Literature. Unknown. Gajanana Shastri Musalagaonkar. Sanskrit.. Padhamanjari Pradhama Bhagamu. 258 pgs.. 1904. Literature. 702 pgs.. Nyayaratnamala Of Parthasarathimisra. 1940.… 37/167 . Dr Smt Mudigonda Uma Devi. Sanskrit. Unknown. Palkuriki Somanatha.. Nyayamrtatarangini 686 16383. Philosophy.. Religion. Sanskrit.org/…/SanskritIIIT.. P i ht k Utt dh P dith S i Y t d tt t ibhi U k S k it 0 380 sanskritdocuments. ... 1953.. 210 pgs. Unknown.. Pandit Ramgopala Shastri. 380 pgs.... 230 pgs. 311 pgs.. Sarasvatii Vaasudevaananda. Unknown. Sri Jaya Tirtha. 777 pgs. Sanskrit. 1973. Unknown. Sanskrit. Unknown. 1984. 392 pgs...r.. 1958. Padit Raj Jagannath Mahakavi. 1941.. 254 pgs.. 249 pgs. Panchampushpam V. Sanskrit. 422 pgs. Padukapattabhisekam Of Narayanakavi. Om Brihat Sarvanukramnika Of The Atharva Veda.. Anantha Charyar. Sri Haridatta Misra. K Surya Narayanashastri..s.. Sanskrit.. Sanskrit. 1951. Padya Mala. . Psychology.. Dr K S Rama Murthy. 757 pgs. Linguistics Literature.gajanana Shastri Musalagaonkar. History. . Theology. 1954. Pancaratram. Unknown. 1971. 283 pgs. 1934. at III… 0. 0. 1983.. Unknown... Language. Language. Panditaraaja Kaavyasangraha Complete Works of Panditaraja Jagannatha.. Unknown. m ramakrishna kavi. Shriimadamitagatyaachaara~ya. Sanskrit. Sri P P Vasudevanand Saraswathi Tembeswami. Sanskrit. Dr. 134 pgs. Nyayasiddantamuktavali Of Viswanathapancanana Bhattacarya. 1957. Linguistics. Sri Haridatta Misra. Geography. Pandit Bhanu Dattshastri. 157 pgs. 660 pgs. Nyaysutravaidikvruthi. 1981.. 667 pgs. Sanskrit.. Theology. Paashhara~dasuutrama~. Unknown. Nyayaratna. Haribhaskara. 1981.. Maniantha Misra.. 252 pgs.b. K. Unknown... C R Devadhar. Nyayasudha Sesavakyartha Chandrika Chapter 1 Subunit 4.. 68 pgs. Pandit S. 152 pgs. Unknown.. 132 pgs. 1939. 274 pgs. Unknown. 1984. P... Linguistics. Sanskrit. 554 pgs. 1922. Viiraraaghavaachaara~ya Mund-aluura~. Pan'chamapushhpama~ Kaavyadvayama~. Aara~yend-a Subrahmand-ya.krishna Murthy. 434 pgs. Dr. Biography. gandanatha jha. 392 pgs. Unknown. 1937. 1927. Unknown. Sanskrit.. Sanskrit.. Paand-inisutravyaakhyaa. 83 pgs. Unknown.. Nyayasutra Of Goutama.... Sanskrit. Padakavya Ratnakara. Pan'chasan'graha. Literature. 0. Sanskrit. 1953. Sanskrit. Sanskrit.. Sanskrit. Religion.. Padhyapushhpaanj-jali. Panchatantram Vol Ii. Shaunakamahaamuninaa Bhagavataa. Unknown. Padyamrta Tarangini. Religion.. Sanskrit.. 1953. Sanskrit. Unknown.. 386 pgs. Pahile Mahaayudhda Bhaaga Tisaraa..2/14/2011 A list ofLinguistics.. Sanskrit. Language.. Sanskrit.. Unknown. scanned Sanskrit booksSanskrit. Sanskrit. Pandith Devdutt Sharmana. Khaad'ilakara Shrii Krxshhnd-aajii Prabhaakara. Nyayarakshsmani Of Srimad Appayya Deekshithendra.. Nyayasastra With The Commentary Of Abhinavagupta. 89 pgs. 1941. 1952.. 1953.

.. 506 pgs. Plane Trigonometry. Datta Nalinaaqs-a. Harinarayna Apte. Philosophy. Religion. Unknown. 374 pgs.. Unknown.. Sanskrit. Literature. Paniniya Shiqs-aa.. 252 pgs. Sanskrit. pandit bapudeva sastri.... Paramaananda~. Literature.. srinatha pandita. Sanskrit. C Kunhan Raja. Linguistics.. Theology..org/…/SanskritIIIT. T. 1980. Unknown. Language. 252 pgs.… 38/167 . Unknown. Sri Nagesh Bhatt. 70 pgs. Sanskrit. Sanskrit. 200 pgs. 380 pgs..2/14/2011 A list of scanned Sanskrit books at III… Panineeyashtakam Uttaradharm. Paqs-chimottarashaakhiiyan' Vaalmikiiya Raamaayand-ama~ Yuddha Kaand-d'ama~. Nrxsin'hashaastrii. 0. Pilibhit ka Sahitiyik Itihaas. Narendra Nath Choudari.. Unknown. Pandith Sri Kapileswar Shastrina. Ganesh Shankar Shukla. 1940. Valmiiki. Sanskrit. Sanskrit. 112 pgs.. Persian Sanskrit Grammer. Paribhashendushekar. Sanskrit.. 1938. Language. 175 pgs. Sanskrit. Paraamara~sha Khan'd'a 1. Bhat't'a Naagojii.. Literature. Unknown. 1954. 624 pgs. Ghosha Manamohana. 247 pgs.. Sanskrit.. Pandith Sri Yutagnadutt Sastry. 173 pgs... S Krishnaswami Aiyangar. 436 pgs. Philosophy Of Poetry. Pingala Acharya. 1938. 97 pgs.. Parama Samhitha. Paqs-chimottarashaakhiiyama~ Vaalmiikiiya Raamaayand-ama~ Uttara kaand-d'ama~. Linguistics.. Sanskrit. Sanskrit.. Sanskrit.. 334 pgs. Unknown. Paribhashedendushekar. Natural Sciences. 172 pgs. Sanskrit. Sanskrit. Valmiiki.. Vaalmiikii. Language. 582 pgs. Linguistics. 1874. 1936. Sanskrit. 1913. Aan'bekara Vishhnd-ubaapujii. Pashvaalambhamiimaan'saa. Panini As A Variationist. 188 pgs. 0. 1931.. Literature.. k r joshi s m ayachit. Natural Sciences. Jinavijaya Muni. Sanskrit. Pindagalachand Suthram. Language. 322 pgs. 0.. Language. Parameshwarpitha Slokamalika. Unknown... Paramaanandakaavyama~. 172 pgs. Praayashrvittendushekharah. Praakrxtashabdapradiipikaa. Parama Laghu Manjuaha Of Nagesh Bhatt. Tadnujen Sri Manmadhusudansharma. Sanskrit. 1959. Pandita Viswanatha Shastri.. Unknown. Shaastri Vaamana. Paribashendu Sekhara. 531 pgs. Sanskrit. 1916. Theology... Pandith Sri Yutagnaduttasastribhi. 1933.. Literature. 132 pgs.. Sanskrit.. Sanskrit. Paqs-chimottarashaakhiiyan' Vaalmikiiya Raamaayand-ama~ Kishhkindha Kaand-d'ama~.. Unknown. 1990. Sanskrit. Unknown. Sanskrit. Sanskrit...... Unknown.. Sanskrit.. 1947. 134 pgs. D. Unknown. 1952. 0. Theology. Viraraghavacharya siromani... 1972. 1923. -.. Sanskrit. 1947... Sanskrit. Viraraghavacharya.. 0... 164 sanskritdocuments. Unknown... Unknown. Sanskrit. 1935. 1940. Linguistics.. 497 pgs. Unknown. 245 pgs. Pandith Nityananda Panta Parvatiya. Parijaat. 454 pgs. Paninisutra Vyakhya Vol 1 Purvardhamu.. 1934. Linguistics. Sanskrit. 694 pgs. Unknown.. Poona Akhbars Vol Ii... Literature. Unknown.. Grammer.. 1954. Parahita Samhita. S D Joshi. Unknown. Sanskrit.arkasomayaji. Panj-chavin'shatisaahastrikaa Pranj-aapaaramitaa. Sanskrit. 0. Religion. 334 pgs. 1946. Prabandaha Cintamani Of Merutungacharya Part I. 323 pgs. Sanskrit. Panineeyasthakam Poorvadharm. 442 pgs. Religion... Post Independence Sanskrit Literature. 1957. 0. Sri Pindagala Charya.. 1944. Paramartha Prakasika. 181 pgs.

186 pgs. 1935.. 0.. 160 pgs. Sanskrit.... Theology. Shriimadabhinavachaarukiira~tipand-itaachaara~ya.. Unknown. Sanskrit.... 441 pgs. Prabhu Lingaleela. 1951. Psychology. Unknown. Linguistics. Ramaji Upadyaiah.. Literature. Sanskrit. 1954. Appayya Diiqs-ita. Mishra Krxshhnd-a. Unknown. Prashanamka choodamani. Prasnamarga. 676 pgs. Religion. Prachina Sanskrit Natak. 164 pgs. Prabodhachandrodayama~. Unknown. Religion.. Punnasseri Nambi Neelakndha Sarma. Technology. 1947.. Sanskrit. 1932.... 0.. Narayana Bhatta. Sanskrit. 924 pgs.. 1926. Panditaratnam A. K.. Prabhanda Chinthamani Of Merutungacharya Part 1. Psychology. 239 pgs. 1932.. Sanskrit. Sanskrit. Sanskrit. Unknown. 922 pgs. Prakriyaasavara~svama~.. Prameyakamal Martand.. Unknown. 1948.. Prameykamlamartand Vol Ii. Jinavijaya Muni. 70 pgs. Sanskrit. 722 pgs.. Shriigovindaamrxbhagavaana~. Unknown. Theology. Pradhama Padyamala. Sanskrit. Dr P L Vaidhya. Shriinaaraayand-a Bhat't'aprand-iitan. Tantras. Sanskrit. 134 pgs. Prakriyasarvasva Taddhita. Unknown. 186 pgs. 272 pgs. 1940.. Unknown. 77 pgs. Sri Ramachandra Mishra.. Prataha Smranmala.. Pandit. Prasadamandanam. 1943... 346 pgs. 1953.. Sanskrit. Vijaya Jina. Prameyaratnaalang-kaara. Prakrta Prakasa.. Sanskrit. Unknown. Theology. 1931. 1978. -. Religion. 1975. 1947. 1933... Prameyaratnalankara.. Sanskrit. E..2/14/2011 A list of scanned Sanskrit books at III… pgs. Prasaada Mand-d'anama~.. Literature. 1936. 1992. Pratima Natakam.. Sanskrit.Edition. Mahendrakumar Shastriyna. 142 pgs. Sanskrit. Sri Harishanker Mishra. Unknown. Sanskrit. Atalananda Sarasvati. gomi kara~nd-aka.shantiraja Sastri. Shriiprabhaachandraachara~yaa. 152 pgs. Prakrutananda.. Sutradhaaramand-d'ana. Literature. 262 pgs.varadhachari. Sanskrit... 484 pgs. Philosophy. Shri Prabha Chandra. Haribhadraa.c.. 394 pgs. Literature. 1941. Prajnaparamitasa~ Prathama Bhaaga Abhisamayaalad'a~kaaralokah.. Sanskrit. Pramaand-avaara~ttikama~ Svaara~thaanumaanaparichchheda. 1955. 265 pgs. Sutra Dharamandana. Unknown. 652 pgs. The Arts... Unknown. Prabhaavakacharita Prathama Bhaaga Muula grantha.... sanskritdocuments. 176 pgs.... Philosophy. 252 pgs. Language. Linguistics. Language. Sanskrit.… 39/167 . Prajna Paramitha Ratnaguna Samcaya Gatha. Sanskrit. 261 pgs. Religion. Prakrxtamand-idiipa Prathamao Bhaaga.. Linguistics. Prasnopanishad Bhasya. Raghunatha Kavi.. Sanskrit.. Mallikarjuna Shastri. 252 pgs. Unknown. Sanskrit. Theology. 20 pgs. P. 1941. Prashnopanishhata~ Grantha 8. 1981. Prabhodhanaachandrodayama~. 1941. Prabandhakosha Prathama Bhaaga. Sanskrit. Tallapally Muralidhara Gowd.. Sanskrit. Sanskrit. Sanskrit.... 0. 94 pgs. Language.. Sanskrit.. 128 pgs. Theology. Unknown.org/…/SanskritIIIT. Prapancha Sara Tantra Of Sankaracharya. Linguistics. Sanskrit. 1935.obermiller. Sanskrit. Prasnopanisad Bhasya I I. 1948.. Aanandagiri. Unknown. Religion. 107 pgs.. Language. 1994. Pandit sri seetaramanga Jotishaclarya. 0.

1929. Unknown.. Da~vivedii Kapiladeva. 0.. 1952. Sanskrit. Sri Sadanand Vidvadwirichith. Unknown. Religion. Prayodhya Kavyam. 536 pgs. 1926. 1935. 492 pgs. Sanskrit. Sanskrit. 112 pgs. Lakshminarasimha. 1952. 1945.. Pt. 451 pgs..a. Unknown.. Sanskrit. Linguistics.. 82 pgs. Sri P. Prem Pathanam... Haradaasa Baalashaastrii Saahityaachaara~ya. 828 pgs. 369 pgs. Ragatarangini.. Proceedings And Transactions Of The All India Oriental Conference. Unknown. 1927.. Theology. 163 pgs. History.. 480 pgs. 0. at III… pg Pratimaa Mana Laqs-and-ama~.org/…/SanskritIIIT. 1985.. Sri Krishnaiah Panth Sastriye. Miimaan'saka Yudhishht'hira. Sanskrit. Sanskrit. Premarasayana. Raamaayana Of Vaalmiki Bala Kanda. -. Sanskrit. 626 pgs... Purushparthchintamani. 118 pgs. 490 pgs. 154 pgs. Kara~mara~kara~ Epi.. Theology. Unknown. Sanskrit. Raamaayand-ama~ prathama khand-d'a. Proceedings And Transactions Of The First Oriental Conference Poona Vol 1.... 730 pgs. Suryakanth Shastri. 82 pgs.. S. Sanskrit. Sanskrit.. 1950.gangaprasad.... 246 pgs. Sanskrit.. 302 pgs. 242 pgs. 1931. Sanskrit. G D Thukral.. Sanskrit. Sanskrit.. Bhagavad Datta.subrahmanya Sastri. Qs-iira Ratagd'ind-ii. a s altekar.. Visvanatha Pandita. Religion. Purana Vishya Samnukramayaka. 0. 286 pgs. 1989. Unknown.shastry. 1908. Raghuvamsam (canto vi). Unknown. 0. Raghava Naishadhiya.. Pratyakruttatvachintamani Vol I.. Unknown. 936 pgs. Unknown.shrikrishnamani Tripathi... Unknown. 176 pgs. 1985. 0. Purva Kalaamrutamu. Vaalmiiki. Puranika~ En'thalojy Puraand-a Kaavya Stotra Sudha. Mahadeva Sastry.. Language. A.. Language.. Sanskrit. 1947... 348 pgs. Unknown. 1875. Yagna Ramulu. Sanskrit.. 1928. Late. Bosa Phanin'draa Naatha. 226 pgs.. Sanskrit. Geography. Unknown. scanned Sanskrit books . Unknown. Raghuvamsam Canto V. Biography. 330 pgs.. Theology. Unknown..... Unknown. Sanskrit. Saradaranjanray Vidyavinode. Sanskrit. 1945. 1920. Social Sciences. 308 pgs. Unknown. History. Sanskrit Religion.. 0.. Purusharth Chintamani. 1999.. 1323 pgs. 1922... Purana Panchalaksana. Unknown. 1993.. Literature. Unknown... Sanskrit. G. Sanskrit. Ragavibodha. Dr. Sanskrit. 0. 370 pgs.2/14/2011 A list of . Sanskrit. A. Religion...… Raghuvamsham. sanskritdocuments. Purva Mimansa Darsana. Dr. Unknown. 310 pgs. Purva Mimamsa.. Sanskrit.. Purascaryarnava. Unknown. Ranjit Sitaram Pandit. Pandit Sivadatta.. Raashht'a~ra Giitaanj-jali. 1979. Linguistics. Saradaranjay Ray. Unknown. Sanskrit.. Vasudev Sharma. Proceedings And Transactions Of The First Oriental Confirence Poona. 98 pgs. Muralidhar jha. 40/167 . Bharatwaj. 826 pgs. Sri Madramkrishnabhattsunuvishnubhatt. Sanskrit. 1930. 611 pgs. Purvakhandatmika Bhaktiyogaparisha. 1935. Literature. Proceeding And Transactions Of The Fifth Indian Oriental Conforence Vol I. Sanskrit. Sanskrit. Unknown.. Raasabihaarii Basuun'che Kraan'tijiivana... Sanskrit.. Sanskrit. Sanskrit.. Yashpal Tandon's. -. Raghuvamsam.

Satkari Mukhopadhyaya. 1983.. Sanskrit.. at 730 pgs. Satkari Mukhopadhyaya. Sanskrit.shrikrishnamani Tripathi. Rangayan Vol 34. Ramayana With Three Commentry Tika. Unknown. 164 pgs. Sanskrit... . 1935. Sanskrit. 523 pgs.. Sanskrit. 1934.. Sanskrit. 0. Sanskrit... Philosophy. 1950. 706 pgs. 605 pgs. Ramalashiktha Jyothish. -... Psychology. 2002.. Ramayana Of Valmiki Vol Vii Uttarakanda. 1915... 1983.. Pandit Sri Bhadarinath Jha. Sanskrit. Sanskrit. Ramayana Of Valmiki Vol Viii Index Of Verses.. Unknown.. Bhagavad Datta. Sanskrit. Sanskrit. Bhudeb Mookerjee. 426 pgs... 192 pgs. 1938. Raghuviracharata. Sanskrit. 0. . Sanskrit. Unknown. 317 pgs.. 427 pgs. Sanskrit. 2001. 700 pgs. 1985. 1992. 460 pgs.. Unknown.… Rasagadagdar Rahasyam Sri madanmohan Jha Unknown Sanskrit 0 60 pgs 41/167 . Unknown.. Bagaiah . 164 pgs. Durgesh Singhal.. Rajagopalachari. Satkari Mukhopadhyaya. 481 pgs. 681 pgs. pgs. Ramayana Of Valmiki Vol I Balakanda. Religion.. Jagannath Prasad Kayath. Ramayana Of Valmiki India S National Epic. 193 pgs.. Sanskrit. Literature.. Unknown. Sanskrit. Sanskrit. 1983. Ram Swayamvaram. T. 0.. 1983. Sanskrit. Ramayana Of Valmiki Vol Iii Aranyakanda.. Unknown.. Di Valmici.. 354 pgs. Ramayana Of Valmiki Vol V Sundarakanda. Ramayan Valmikiye Aadikand.m. Sanskrit. 1983... Temples. .Vaarasree. Unknown... Kalhana. Rangaayana... 369 pgs. -.... Sanskrit. Unknown. 168 pgs. 795 pgs. Raghu Vira. Sri P Ramachandraghna Vyakaranacharyah. 845 pgs. Unknown.c.. 0. Unknown. Sanskrit..2/14/2011 A list of scanned Sanskrit books III… Raghuvamsham.. 2002.. Satkari Mukhopadhyaya. Ramayana Of Valmiki Vol Ii Ayodyakanda. . Unknown. sanskritdocuments. Ramayana Of Valmiki Vol Iv Kishkindhakanda. 454 pgs..ganapati Sastri. Raghuvamshamahakavyam. 1895.. Sanskrit. Satkari Mukhopadhyaya. Mishra Brahmashan'kara. Satkari Mukhopadhyaya. Temples.. Unknown.. 330 pgs. Unknown. Shripad Krishna Belvalkar. Ram Rasayan Ayodhyakand. Ramayana Of Valmiki Vol Vii Yuddhakanda. 1983. 0. 588 pgs.. Rangayan Vol 34 Jan-june 2001. 1955. Sanskrit. Ramayana. Unknown. Ramayana Ramabirama... 350 pgs. 1917. Kavignar . Satkari Mukhopadhyaya... Vishva Bhndhu Shastri.. 1965. 1902. Ramayana Of Valmiki Yudda Kanda. 638 pgs. Ramayana Vol 3. Rasa-jala-nidhi. Sanskrit.. Satkari Mukhopadhyaya. Sanskrit. Sanskrit. Sanskrit. 2001. 612 pgs. 164 pgs.. Religion. Raja Tarangini. Ramas Later History Vol X X I.. 234 pgs. Ramayana Of Valmiki The Aranya Kanda.. Unknown. Sanskrit. Peeyush Darya. Raghuvan'shamahaakaavyama~. Unknown. 112 pgs. Unknown. 0. Ras Gangadhara. 1983.org/…/SanskritIIIT. 1260 pgs. Rangayan Vol 34 Jan-june 2001. 1983.. Unknown. Unknown.. Sanskrit. Unknown.. Unknown. 1944. ... . Sanskrit. Dr.. Sanskrit.

1949. 0. 1956. Sanskrit. 82 pgs. Narayana Sharma.. 1152 pgs.. Sri Rama Sharma.. Rigveda Samhita Vol Iii 6 8 Mandalas. Late Dr... -.p. Vedas.. Sanskrit. Sanskrit.. Unknown... 1108 pgs.. Sanskrit. 148 pgs. Reader I... Sanskrit. 133 pgs. Dev Raj Chanana. Sanskrit. Sayanacharya. Sri Mathsainacharyavirchitbhasyasameta. Art. 500 pgs.. 1955. 1314 pgs. 1074 pgs... Reader Iii. 1951.. Unknown. K. Rgvedi Purva Proyoga. Rgarthasara Vol I. J Gonda.sastri. Ratnadiipikaa Ratnashaastrama~cha.. Religion. 134 pgs. 964 pgs.s. Rgvedasamhita. Linguistics. Sanskrit... Sayanacharya.. Linguistics.l. Sanskrit. 594 pgs. 1997... Ratna Dipika And Ratna Satram. Language. 60 pgs. Sanskrit. 1204 pgs. 1941. Ravi-vichaar. Language. History. 2001. Language. 1961. 0. Sanskrit. 0. Sanskrit. 1951.. Unknown. Biography. 1974.. Allaraaja.. K. 1986. Linguistics.sastri. 0. Rediscovering India Manav Dharma Shastra Vol 30 I. Unknown.. Rasendra sarsangra. Sanskrit. Unknown.. Shriigovindabhagavatpaada. Unknown. Rgarthasara Of Dinakara Bhatta Vol 1. Rgveda Samhita Vol-i. Gonda. Rastrapala Pariprccha Sutra Du Mahayana.v.. Theology. Sayanas Comentary. 1988. 1959.v.. L Finot.. Srit. Sanskrit.. 152 pgs... Sanskrit. Sanskrit. Sanskrit. Unknown. Rasahrxdayatantrama.lakshman Sarup.v. 354 pgs.. V S Venkata Raghavacharya. 75 pgs.. 403 pgs. Unknown. Unknown. Sanskrit.. Rigved..l. 1965. Sanskrit.org/…/SanskritIIIT.l.sastri. Ravanarjuniyamu. Bhaanubhat't'aa Shrii... Rasaratnapradiipikaa Gran'thang-ka 8. Rasamanj-jari faskikyuulasa~ 3. Rashtriya Panchang. Unknown. 220 pgs.. Religion. Rasaviveka of Kavya Darsa..k. Technology. 82 pgs. Sanskrit. K. 332 pgs. Sanskrit.kapali Sastry. 231 pgs. Rgveda Samhita Vol 4. Srinarayan Misra. Sanskrit..… 42/167 . Vidhydhar Johrapoorkar. 1961. 100 pgs. 84 pgs. Sanskrit. Unknown... Dinakara Bhatta. -. Rigveda Samhita. Ram Suresh Tripathi. Literature. Literature. T.. 0. Unknown. Sanskrit.. Theology. Sanskrit. Sanskrit. 241 pgs. Sanskrit. Remarks Of Similes In Sanskrit Literature... Unknown. Aryendra Sharma. Sanskrit. 128 pgs..v. 94 pgs. Unknown. N R Bhatt. 1996. Rigveda Samhita. 1981. 2001. 266 pgs... 146 pgs. Sudarsanacharya.. 1959. Literature. Dr. 1951. Literature. Rigveda Samhita Vol Iv Ix X Mandalas. 1945. 129 pgs. Unknown.. Sri madanmohan Jha. Unknown. Budhdabhat't'a Chand-deshvara~ cha. Unknown.. Unknown.. Rauravagama Volume I.2/14/2011 A list of scanned Sanskrit books at III… Rasagadagdar Rahasyam. 100 pgs.. 552 pgs. 1946. Ramasastri. Reader Ii. Rasamanjari Of Bhanudatta. 1987.. Regved Sanhita Vol. 116 pgs. Remarks On The Sanskrit Passive. Unknown.n. 0.I. Unknown... 1868. Sanskrit.... Philosarhy. Haughton G. Unknown... Geography. 1904. sanskritdocuments. Sanskrit. P. Ramgovind Trivedi Vedanthshastry.. Unknown. Sanskrit. 1992.c. Sanskrit. 206 pgs.v. Rg Bhasya Sangraha. Sanskrit.. Sanskrit. 188 pgs. 1951. Rasagangadhara. 1927. Unknown.. sri bhattabeem. Sanskrit..

. 770 pgs. Sanskrit. Krishnacharya.... Rksamhita. 1219 pgs. Sanskrit. Unknown. 1955. Theology. Pramodhini Panda. Rubaiyat Of Omar Khaiyam. Religion. Rudrasthadhyayi. Rigveda Samhita Vol-v Indices. Sanskrit. Dharmasthala. Bijapurakara Vishnd-u Govinda. 1966. 102 pgs. Rxgvedaanukramand-ii Prathamo Bhaaga Grantha 2.... Literature.. 1062 pgs. 1928.. Rxgveda San'hiita Shashht'o Bhaagaa. Rxgvedaa Vyakhyaa Maadhavakara~ta. Rxgveda San'hitaa Prathamo Bhaaga. Religion.. Religion... Sanskrit.. 298 pgs.... Sanskrit. Rksamhita. Sanskrit. Sanskrit. Krishnacharya. Theology.. Unknown. 429 pgs. Theology. 454 pgs.. Religion. Sayanacharya. Religion. Sanskrit. Religion. Rigvedasya Prathamamanadalasya Sayana Venkatamadhava Bhasyayos.. 1945. 352 pgs. 200 pgs. Vilsana~ Hecha~ Hecha~. Sanskrit.. Theology. Sanskrit. Rukminishavijayahaha. 1939. Theology. 502 pgs. 158 pgs. . Sri Rama Sharma.. Rxgveda San'hitaa Trxtiiyo Bhaaga. Sanskrit. Theology. 0. Rkbhasyam Tika.. Unknown. Ramanand Divvedina. Dr A N Upadhye.… 43/167 . Sanskrit. Theology. 736 pgs.. 450 pgs.. Shriimaadhavena Shriiven'kat'aara~yaatanudbhavena. Ritriratna Prakash. A Narayanadas. Sanskrit.. Theology.r. Rxgara~thadiipikaa chatura~tho bhaaga. 170 pgs. 362 pgs. Sayanacharya. Unknown.. Sanskrit..t. . Sri Balayajnavedesvara. 1058 pgs. 249 pgs. 1935. Theology... Religion. Theology. 1823. 0... 374 pgs. Sanskrit. . Linguistics.. Sanskrit. 1929. Literature. Literature.. Unknown.. 1936. Language. Rudraadhyaaya Grantha 2. Raajaa Kunahaana. Santavalekara~ Shriipaada Daamodara~. 1955. Language.. Sanskrit. Rigveda. 176 pgs. 2000. 1932. Sanskrit. 1940. 1140 pgs. Shriimadhavaa. P.. 914 pgs. 1951.. Roopdeepika. Rxgara~thadiipika Chatura~tho Bhaaga.. 1242 pgs. 1929. Riksan'graah Trxtiiya Khand-d'a... Rxgveda San'hitaa Bhaaga 2. 641 pgs.. 1951.r. Language. Shriipaadashara!~mand-aa Bhat't'aachayaind-a. .org/…/SanskritIIIT. Shaastri T'i Vi Kapaali. Literature. Theology. sanskritdocuments... 1950. Shriimatsaayand-aachara~ya. Shriimaadhavena Shriiven'kat'aara~yaatanudbhavena. Bhat't'ena Maadhava.. 32 pgs. 1208 pgs. Rukminikalyana Mahakavya Of Rajacudamani Diksita. Kolan'gad'e Raamachan'dragovin'da. Linguistics. Rxgara~thadipika Bhaaga 2. .. Religion. Religion. Rxgveda Sn'hitaa. Sanskrit. . 1940..2/14/2011 A list of scanned Sanskrit books at III… Rigveda Samhita Vol-ii 2-5 Mandalas. Sanskrit. 283 pgs. Rudradasas Chandralekha. Kamakshi.. 1986.. 1950.. Sanskrit. Theology.. Sanskrit. Sanskrit. 0. 1986. Sanskrit. Linguistics. Religion.. 1929.. Unknown. 242 pgs. Religion. Sanskrit. Religion.. Journals. Rxgaratna Bhaand-d'aara.. 0. Aapat'e Hari Naarayand-a. Sanskrit.t. Sri Pandith Jwalaprasad. Sanskrit. 1058 pgs. 1823. 1931.. Rkbhasyam Chalari. Rukminikalyana Mahakavya. Sanskrit..

1934..u. 1957. Pandit Dhundhiraj Sastri. Saamaanya Bhaashhaavijnj-aana. Saadaashivabhaashhyama~. Theology.. 1934.v. Religion. Saamavediiyataand-jyamahaabrahmand-ama~ prathama bhaaga.. Literature.. Sanskrit. Indology. Madhavaka~ra~ta.. 1936. 359 pgs. Natural Sciences. Sanskrit. Linguistics.… Sabdakalpadruma Kanda Ii Radhakanthadev Religion Theology Sanskrit 1976 944 pgs 44/167 . Maadhavakara~ta.. Theology.. 547 pgs.. 353 pgs. 1913. 702 pgs. Sabda Manjari. Theology. Saamavediiya Taand-d'yamahaabraahmand-ama~ Da~vitiiya Bhaaga. 1922. Unknown. Religion. Saarasvata Vyaakarand-ama~ Uttaraaddhara~ma~.. Theology. Shriikapaalishaastrii. 1947. Religion. Sanskrit. Tippayya Parishkrit. Sabda Sakti Prakasika. 1943.. 1935... 1941. Saamavediiya Chandogyopanishhata~... Chaara~ya Saayand-a. 285 pgs. Religion... Literature. Sanskrit. 353 pgs. Svaruupaachaara~ya Anuubhuuti. Bhaagavata Hari Radhunaatha.. Religion. 2002.. Religion. Saksenaa Baaburaama.. Linguistics.. 208 pgs. 197 pgs. Sanskrit. 1990. Sanskrit. Rxgvedasan'hitaa Prathamaashht'akama~.. Sanskrit. Literature... 370 pgs. 500 pgs... Sanskrit. 1947. Sanskrit. Sanskrit. Sont'ake Esa~ena~.v... Raamaanuja Jaiyasaragomat'han. Sanskrit. 1938. Shriikapaalishaastrii. Theology. pg A list of scanned Sanskrit books at III… Rxgvedasan'hitaa Pdaadisuuchyaatmakah Panj-chamo Bhaaga. Sanskrit.. Theology. Sanskrit. Sterling Publishers Private Limited New Delhi. 189 pgs. Virachita Nanj-jund-d'aaraadhya. Saara~tha Upanishhatsan'graha Bhaaga Sahaava. 543 pgs. Unknown... Saayand-aachaara~yaa.. Purushottam. 1940.. Religion.l. 1142 pgs. Sabda Manjari....t.2/14/2011 ... Sanskrit. Shara~maa Raamasvaruupa.. 168 pgs. 1951. 126 pgs.. Theology. Sanskrit. Matsaayand-aachaara~ya. Sanskrit. 602 pgs.2. Religion. Rxgvedasan'hitaa Trxtiiyo Bhaaga... 1917. 387 pgs. Language. Saathar Upanishhatsn'grah 4 Bhaaga. 492 pgs. Theology. 1961. Religion. Religion. Rxgvedavyaakhyaaya Bhaaga 2 Ast'aka 1 Adhyaayaasa~ 5 Se 8. Rxgvedasan'hitaa Trxtiiyobhaaga. Sanskrit. Rxgvedavyaakyaa. Religion. Religion. Saamavediiya Jaiminiiya San'hitaa Bhaaga 3.. Rxgvedasan'hitaapadapaat'hah. S. shriimatsaayand-achaara~yaa. Unknown. Shriikapaalishaastri.. Religion. 1936. Theology. 1922. Rxgvedasan'hitaa Prathamaashht akama~ Prathamo Bhaagaa. Rxgvedasan'hitaa Prathamashht'akama~ Prathamo Bhaaga. Saaraswatham (vyakaranam). 1151 pgs.. Sanskrit. Bhaagavata Hariraghunaatha.. Sanskrit. 160 pgs. 1072 pgs. Language. Religion. Language. Sanskrit. sanskritdocuments. 1950. Theology. 949 pgs. 1984. Sayanaachaara~yaa Shrii. 1939. Sanskrit. Sanskrit. 77 pgs.. Linguistics. Sanskrit.. Theology. 1951.org/…/SanskritIIIT.sastry.. 238 pgs.oriental Journal Vol-4 Part 1 . L Laxminarayan. Theology. Religion. Raghuviira~ Achaara~ya.a. K. Sanskrit. Theology. Theology. Theology. Saamaveda San'hitaa.

Unknown.… Samanya Vedanta Upanishad Mahadevshatrin Religion Theology Sanskrit 1921 556 pgs 45/167 . 944 pgs. Not Available.. 494 pgs. Sahithya Darpan Of Vishvanatha Paricchedas I Ii X. Unknown. Dr P Sri Ramachandrudu. Salihotra Of Bhoja. 388 pgs. Sahiti Jagathi. 485 pgs. Religion.. Bhuskut'e Vi Bha.2/14/2011 A list of scanned Sanskrit books at III… Sabdakalpadruma Kanda Ii. Unknown.narasimha Charya. 634 pgs. Literature. Sanskrit. 408 pgs.. Unknown.. Theology. Unknown. 1939. 498 pgs.a. Sanskrit.. 84 pgs. Geography.. 292 pgs.... 412 pgs... Sabdartna With Bhairavi. 1974. M. Stotras. 151 pgs. Biography.. Sahitya Darpanam. Bhagavata Shan'karaanan'da. Sanskrit. 272 pgs. Unknown. 1962. The Arts. Sabdartha Ratnamu... . Literature. -. Sanskrit. Sanskrit. sanskritdocuments. Language. 1945.r.. Sabdanusasana... Unknown. Sahstra Deepika Of Partha Sarathi Misra. Dr B R Shastry... Pushpa Srivatsan. . Sabhashyatatvarthadhigamsuthrah. Sanskrit. Sahityaratnakara Of Dharmasuri Part I I I. 394 pgs. Sacitra Prasuti Tantra. 348 pgs. 1932. Sabhashya Rathna Manjusha. Hari Damoder Velankar. 1981.. Sanskrit. Shriibhojadeva Mahaaraajaadhiraaja. Sanskrit. Unknown. Sahityasara.. Monier Williams.. 1967.. 623 pgs. Sanskrit.. Samaarang-gand-asuutradhaara Prathama Bhaaga. Srotaranay Tarakavachaspati abhattacharya. W. 1979. Unknown.. 0. Sanskrit. 498 pgs.. . 1982. Unknown. Religion. Sagaud'a Paadiiya Kaarikaathara~va Vediiya Shhashht'hiya Khand-d'a Grantha 10. 110 pgs. Sanskrit.. Sanskrit. 0. Sri Madachutaraya.. Sabhasha Arthavedika Vishaysoochi. Sanskrit.. Kaloori Hanumanthrao.. Sanskrit. 1981. Unknown. Sanskrit. Chaturveda Shastry. Mayuram Sri M. 450 pgs. 1886 pgs. Rama Krishana Misra. 639 pgs. Unknown. Sanskrit. Sanskrit..bhatt. Sanskrit. 0.. Sabdapasabdavivekahaccn0 946. Khubchandraji Siddhanthashasthri.. 1949. Sanskrit. Sadguru sri Tyaga Brahma Pushpanjali.. Sahasra Yogaha. Sadaashivaraavabhaauu. Sanskrit. 1976. 1982.. History. shivnath khanna. 1913. 1911. 814 pgs. Theology... Sachurnika Srimad Bhagavatam.. -. Unknown. Sanskrit. 1957. Sakuntala. 249 pgs. 1987... T. Pandith Bechardas J Doshi. Unknown. Sri Haribhadrasiri.org/…/SanskritIIIT. 1906.. Sanskrit. 1961. Unknown. Sanskrit Grammer.. Unknown. Sabdha Koustubha. 1973. 0. 1994.. 0... Sanskrit. 174 pgs. Sri Durga Prasad Divyedaen. 101 pgs... Sanskrit. Radhakanthadev. Aomesvara Sharma. Linguistics. 558 pgs. 142 pgs. P V Kane..... Unknown. 1953. 1924.. Unknown. 1936. Literature. Sanskrit. 188 pgs. Sahitya Sudhalehari.. Unknown.. 1802..ramanatha Deekshithar.. Sahitya Darpan. 266 pgs. Nalinaksha Dutt... 420 pgs.. 1951... Sanskrit. Pandit Bhatta Yogi Dikshit.. Sahithya Rathna Kosah Thruthiya Khandamu. 1917. Sama Veda Rahasya Ganam. 764 pgs. Unknown. Language. Saddharmapundarika.radloff. Sanskrit. Literature. Sahitya Vimarsa. Sahityaratnakara Of Dharmasuri Part I I. Sanskrit. Sahitya Darpan (vimla). Sanskrit. Sanskrit.. 188 pgs. 94 pgs. Religion. Sanskrit. Saddarsanasamuchchaya. 88 pgs. Unknown. 1956. Theology... Sanskrit. ekanath dattatraya kulkarni.. Sanskrit. Linguistics.

Unknown.. Sanskrit. Samskruta Sahitya Silanam. Unknown.. Samskruta Vyakarana Sastra Ka Ithihas Part . Samkalpasuryodaya Of Sri Venkatanatha. 84 pgs... 0.. -. R. Unknown. Theology..1.. Sanskrit. Literature.. 364 pgs. Satya Srinivasa Ayyangar.. Yudishtar Mimasak.. Sanskrit.. Linguistics Literature. 1948. Linguistics Literature.v.. Pandit M Suryanarayana Shastry. 0. Language. Unknown. Sanskrit. Narayana Swamy... 136 pgs. Samsara Chakram. Literature. Sanskrit.. Linguistics. 266 pgs..... 102 pgs. Literature. 144 pgs.. -. 1935. Sanskrit. Samaskrit Basha Vibushanam. Sambapuranam (upapuranam). Linguistics.. 0.. 0000. Sanskrit. Sanskrit.. Samskritha Prathibha Vol I.. Unknown.. 1982.. Sanskrit. 0. Samskruth Chittah Trutiya Bagh. Sanskrit. 0. Bhavavibhuti Bhattachary. 0. Unknown. Sanskrit. V. 103 pgs. Theology. Unknown..… Samskrutha Sikshamajyarayaha Bhattacharya Sanskrit 1934 143 pgs 46/167 . Sanskrit. Samskrutha Bhakthamala. Religion.. -. Samskruth Natakome Athi Prakruth Thatv.. 226 pgs. 1921. Sanskrit. 2000.. 0. Art.2/14/2011 A list of scanned Sanskrit books at III… Samanya Vedanta Upanishad.. Sanskrit. Krishnamacharya. 1983. Satyavarata Samasarami Bhattacharyyaa. Sanskrit.. Subbrayudu. Samskrit Baladarsa. 1948. 0. 422 pgs. Trutiya Kanda... Theology. Literature. Samarangara Sutradara Vasthu Sastram Mulamatram. 0.. Samskruta Sukthi Sagar. Language.. Pandith S Subrahmanya Sastri. Samkhyayogadarsanam. 166 pgs.. Sanskrit. Gosvami Damodara Sastri. Literature. 568 pgs. Linguistics Literature.... Samskaranrusimhaha. Sanskrit. Sanskrit. 263 pgs. 587 pgs.. pandit s subramanya sastri... Samskrita Swayam Sikshak Praba. 557 pgs.. 440 pgs. Sanskrit. 634 pgs. .. Language.. Samarrngara Sutradara Vasthu Sastram Mulamatram. Sridhar Bhaskar. Literature... Samgitaratnakara Vol I V Ashyaya 7. Sanskrit. 1965. 1992...krishnamacharya. Samskrta Kavi Jivitam Part Ii. 0.org/…/SanskritIIIT. Sanskrit. . 1965. 104 pgs..krishnamacharya. 95 pgs. Samarad'gand-asutradhaara Bhaaga 2.. .. V. 98 pgs.. Linguistics. Samskara Prakasika. Unknown. Linguistics. Sanskrit. 1925. Pandit V. Samkalpasuryadaya. Sanskrit. Language. 0. 454 pgs. 0. 1948.. Sri Gowrishankar Sastri. 424 pgs. Samaveda Samhita Volume Iv.. Sanskrit. 226 pgs. Sanskrit. 323 pgs. 436 pgs. Sanskrit. Unknown. Mulchandr Patak. . 615 pgs. V. Samsara Chakram. Unknown. Ramji Upadhyaya. Samskruta Vanmaye Chandrah. Sriramdeen Cheturrvedi. 452 pgs.. Samgita Rathnakara Vol 1.balasubramanyam. . 1963. 556 pgs. Religion. . Shrikrishanamani. C. Mahadevshatrin. 0. . Unknown. Samskrtu Vadumaya Kosa.. Dr. Sanskrit. Shriibhojadeva. Unknown. sanskritdocuments. Jithendranath Shukla.... Vidyasagar k L V Sastri. Sanskrit.. Sanskrit. Literature. 233 pgs. Unknown. 384 pgs. Samskrita Akshara Siksha. 288 pgs... Sanskrit. 407 pgs. Samskruth Sukthi Sagar. Sanskrit. . 0. Sanskrit. 736 pgs. . Samkalpa Suryodaya Of Venkatanatha Part 1. 1961. Linguistics Literature. Literature. 1983. 1937. Samaveda Samhita. Sanskrit. 0. 1990. 1943. Religion. Samavedasamhita. 490 pgs...

331 pgs. Sanghameswara Krodam.33. Natural Sciences. 173 pgs. Vaidaya Si Vi. Unknown. Gand-eshaa Shaastrii Laqs-mand-a... 267 pgs.. 1677. Atri Maharshi. 405 pgs. Theology. Art.. Atri Samhita. 560 pgs. Geography. Social Sciences.. Chimnaajii Gand-esha. Others .. Suklapandita. 212 pgs. San'skrxtapadyavali. 270 pgs.. Sanskrit. Poonam Niraula. San'qs-epashaariirakama~ Da~vitiiyo Bhaaga. San'qs-epashaariirakama~ prathamaadhyaayarupa Prathamo Bhaga. 1950. 455 pgs. Atri Samhita.. 1950.. Biography. Bhaand-d'aarakara~ Raamakrxshhnd-agopala. 1941. Sanskrit. pandit s subramanya shastri. San'pura~nd-a Aagarakara Bhaaga 2. Natural Sciences. Samveda Vachaspathi. Sangitaratnakara Of Sarngadeva Vol I.. Religion. 72 pgs... Sanskrit. Theology. 1987. Samurtar Chanadhikarana: Atri Samhita. Sangita Chandra (a Trearise On Indian Dance). History. 1899. 1953... Sanathakumara Samhita. Rigveda Samhita. 1933... 298 pgs. 1918. Unknown. Psychology. 603 pgs. Sanskrit.. Gummaluura~yupanaamaka Sang-game Shrvarashaastrind-a. . 1955. Sanskrit.. Sangeetanjali. Sri Kunda Kunda. Sanskrit. 386 pgs. Unknown. Sanskrit. 1913. 1947. San'skrxtamandiraantah Praveshikaa. Vaamana Kaane Paan'd'uran'ga. 1934. 1953... 1899. Unknown.. Unknown. Unknown. Sanskrit.. 0000. Sanskrit. Pandit S. Samvedika Sri Subhodini Paddhati. San'skaararatnamaalaa Uttaraara~dama~ Bhaaga 2. Literature. San'skaararatnamalaa Prathamo Bhaaga. Language. Sanskrit. 1931. Sangitaratnakara Of Sarngadeva Vol 4 Adhyaya 7. Sanskrit.krishnamacharya. Sanskrit. History.. Theology... Sanskrit. Literature. Sanskrit.. 1921.. 244 pgs. Pandit Omkarnath Thakur... Sandhi Samasa Manjusha. Linguistics. Unknown. Sanskrit. V... San'skaara Paddhati Grantha 94.. Sanadaapatraan'tiila Maahitii.. Unknown. Sri Ramachandra Jha Vyakarnacharya.. Shaastri Bhaaskara. 1982.. Sanskrit.… Sangitopanisat Saroddhara vacanacharya sudhakalasa Unknown Sanskrit 1961 198 pgs 47/167 . Philosophy. Samtanantarasiddhi Vol Xix. sanskritdocuments.org/…/SanskritIIIT. 1917. Bhattacharya. 1943. 86 pgs. Bhat'a~t'agopiinaathadiiqs-ita. Sanskrit. Hajari Prasad Divyedi.. Sri Kunda Kunda. San'skrxtavaachanapaat'hamaalaa Dvitiiya Khand-d'a.. Sanatsu Jatiya. Religion.. 822 pgs. Gopinathadiiqs-ita Bhat't'a... 154 pgs. 1982. Geography. Biography. Art. 1918. 143 pgs... 462 pgs. Sanskrit.subrahmanya Sastri... Sanskrit. 1928.. Language.. 638 pgs. Sanskrit. 80 pgs. Sanskrit. Sanskrit. Sang-game Shrvarakrod'ama~. Sangita Chandra. Sanskrit. 0. Samtanantarasiddhitika. Linguistics. San'qs-ipta Vaalmikii Raamaayand-a Trxtiiyo Khand-d'a.. Samyasara Of The Nature Of The Self. Religion. 0. 312 pgs. Samyasara Of The Nature Of The Self.. Sanskrit. Sara~jnj-aatmamuni. 230 pgs. 1992..2/14/2011 A list of scanned Sanskrit books at III… Samskrutha Sikshamajyarayaha. Suklapandita.. Sandesh Rasak.... Sanskrit. Unknown. 237 pgs. Aalatekara Maadhava daamodara. 439 pgs. 406 pgs. 82 pgs. Sanskrit. 180 pgs... Sanskrit. Sara~vajnj-aatmamuni. 1924. Mathura Prasad. 1934. 1960. 176 pgs.. Sandhi Chandrika. Psychology.. Sanskrit. Philosophy. Others . Sanskrit. 406 pgs..33.

. Kurt F. Sanskrit. Pandit Krishnama Charya. Sanskrit. P K Gode. Theology..s. Sanskrit. 1956.. 118 pgs. Sanskrit.sriram Sharma Acharya... Sangrahartha sangraha.. Sri T K Tiruvenkatacharya.. Unknown.. Sanskrit. Language. 131 pgs. Unknown. I Shekhar. Linguistics. 1976. sanskritdocuments. Sankskrutha Gantha Suchi. 0. Unknown.. Vyasacala. 0... Sankara Bhashyalochanam. K. Unknown. Sankhya Darshan Ka Ethihas. Literature. Not available. 164 pgs. Sanskrit.upadhaya. 1976. 588 pgs. Sanskrit. Sanskrit.. Surendra Kumar Gambhir. Sankhyadarsana.. 1947. 1953.. Sankaravijaya. 1994.. 150 pgs.2/14/2011 A list of scanned Sanskrit books at III… Sangitopanisat Saroddhara. Sanskrit Essentials of Grammar and Language.. 1948. 1886.. G.. 146 pgs. Sanskrit Ratnakarmay Shigyandank. 1940. vacanacharya sudhakalasa. -. Brahmachari Surendra Kumar. Sankya Darshan. 260 pgs. 1930. Sanskrit. Sanskrit. Sanskrit. 0. Sanskrit.. 1945. Unknown. 377 pgs. Literature. 70 pgs. Sanskrit. Sanskrit. 0.. 1947. 1959. Religion. Unknown.. 254 pgs. Sree Purushottam Lal Srivastav. Sanskrit Text Book For Detailed Study 1960. Sanskrit. History... Sanskrit Sahithyothihas Vol. 644 pgs.. Unknown. Sanskrit. Unknown..venkataramanan. 758 pgs. 302 pgs. Sanskrit Saiva Kavyas Vol I. Language. Sanskrit... Sanskrit Manuscripts 2. Sanskrit Sopanam Vol Iv. 1994. Shri Brihaspati Shastri. -. 467 pgs. 0.. 0. Sanhit. Pandit Vruddhi Chandra Sharma Shastri. Sanskrit Bhasha Bhodhini Vol I I... Sanskrit Journal on Sahrudaya.... Unknown.. Sanskrit. 1960. Sanskrit English Dictionary Vol 2.. . Sanskrit Text Book For Detailed Study. Unknown. 650 pgs. Unknown. Sastri.. 2002. Unknown.1. 68 pgs.krishnamachariar. Sanskrit. Biography. 1963. Sanskrit Drama Its Origin And Decline. Sanskrit Syntax And The Grammar Of Case... Sanskrit. 107 pgs. S.. Sanskrit. 0. 62 pgs. 684 pgs. Unknown.… 48/167 . Sanskrit. Unknown. Unknown. Acharya Udhayveer Shastri. Unknown.. Sanskrit Text Book For Detailed Study 1962. Sanskrit Manuscripts Vol. Sanskrit Nibandhavali.. 0.. Unknown.. Sankshepa Sarirakasya Adhyaya I. Pt... Linguistics. Sanskrit. 146 pgs. 2002. 1954. 266 pgs. Linguistics Literature. -. Sanskrit Journal Sahrudaya Part 8... Sanskrit.p. 1961. 284 pgs. -.. 1958. 667 pgs.. Unknown. Sanskrit...p. 1980.. 1987. Sanskrit. Gopala Bhatta. 102 pgs.. Sanskrit Gadya Padya Samgraha. 1985.... Sri Vijnana Bhikshu. Narayanacharya. Sanskrit. 435 pgs. Unknown.. Sri Brahaspati Shastry. 50 pgs. 198 pgs. Sanskrit.. 243 pgs. Sanskrit. Literature. Sanskrit.... Ramashankara Bhattacharya.. 456 pgs. Krishnamachari. Thibaut.. Hari Narayan Dikshit. Unknown. Language. Sankhya Darshan Pravachan Bhashya. 1976. . Kanta Gupta. Unknown.. 0. P. Pandith Rajesh Dixit. Unknown. Leidecker. Sanskrit. G. Sanskrit. 207 pgs. Sanskrit Gadhy Padhy Sangraha Vol I.. Linguistics. 523 pgs. Unknown. 110 pgs. Unknown.. 435 pgs.org/…/SanskritIIIT. Sansar Sagar Manthanam Vol Ii. Sankhyayana Grihya Sangraha. Pro. .hansraj Aggarwal.ix. Unknown. Sanskrit. Geography. 352 pgs. Sanskrit Bhashamahe.. Sanskrit. Sankalp Suryoday Vol I.. Unknown.

kapildev Devedi Acharya.. Sanskrit.. Unknown. -. Sanskrit. Unknown..... Sanskrit.. Unknown. 324 pgs. Sri Guru Prasad Shastry. 1928... Sanskrit. 300 pgs.. 72 pgs. Philosophy. Sanskritkavicharcha.. Gopinatha Kaviraja. Sanskrit. 62 pgs. 42 pgs.. Dr. -. Dr. Sanskrith Siksha Vatika Vol Iv.. Mangesh Patkar. Sanskrit Vyakaran Praveshika A Sanskrit Grammar For Students. Sanskrit.. Geography.. 302 pgs.. Sanskrit. .. Janardana Pandeya. 166 pgs. 0. Sanskrita Shiksha 3.. Sri Vadirajathirtha. Unknown. 133 pgs. 58 pgs.. Unknown. Sanskrit. 40 pgs.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit Text Book For Detailed Study 1963. -. Sanskrit.. Pandith Rahul Sanskruthanen.. Babu Ayodhya Prasad. 0. Ramchandra Sharma. 70 pgs. Sanskrit. Sanskrit. Sanskrit. 84 pgs. Sanskrit. 336 pgs. 1949. Sanskrit.. 60 pgs. 57 pgs. Surendra Narayana Tripathi. Literature. 100 pgs. 174 pgs. 1951. Saralaayurved Shiksha. 1985. Sanskrit. Unknown. -.. 133 pgs.. Unknown. Sanskrith Siksha Vol Ii. 1950. 1843.. 1973.. 366 pgs. Sanskrit Vyakaranam. Unknown.… 49/167 .. 116 pgs. Sarasabharathi Vilasa. 1868. 1955.. 418 pgs. Sanskrith Paath Mala Vol X I I. Sapindya Kalpalatika. Unknown. 122 pgs. Sanskrit. Unknown. Sanskrita Shiksha 2. Sanskrit. Linguistics Literature.. 1930.. Sanskrita Shiksha 1. Language. 0. Sanskrit. 1942. Saradiyakhya-namamala of Harsakirti.. Sanskrith Grammar.. Sanskrit. Sanskrith Paath Mala Vol Ix. 315 pgs. Sanskrit Text Book For Detailed Study 1964. Religion. 1981. 475 pgs. Santati Shastra. Sanskrith Paath Mala Vol I V. Unknown. 1927.prabhanjanacharya. 404 pgs... Sanskrit. 0.kapildev Devedi Acharya. 0. sanskritdocuments. 1950. Sanskrith Paath Mala Vol Ii. 1982. -.. 1996.. Unknown. 0... Sanskrit Text Book For Detailed Study 1967. Krishnagopal Goswami Sastri. Religion. 0.org/…/SanskritIIIT. Sanskrit. Sarasvata Vyakaranam. Sanskrit. Sanskrith Sopanam Vol Ii. Sanskrite Panchadevastotrani. Unknown. History.. 2002.. Linguistics.. Jagdish Kumar.. Sanskrita Sahitya Itihasa Khunjka. Sanskrit. Sarasangrahah. Unknown. Sarasabharati Vilasa.. 146 pgs. Sarasvatibhavana Granthamala Volume X. Sanskrith Kathasagar... Garikapati Laxmikanthaiah. Sanskrit. 132 pgs. Dr. 70 pgs. Unknown. 0. Sanskrit. 110 pgs.. 44 pgs.. Unknown. V. 48 pgs. Unknown. Sarasvanth Vyakaranam Poorvadharma. Benfey T H. Surendra Kumar Gambhir. Sanskrit. Sarasvata Home Of Kalidasa. 410 pgs.kapildev Devedi Acharya. 1982. 1990. Unknown. Pandith Sripad Damodar Sathvalekar. Sanskrit. Unknown.. Unknown. 1990. 1976... Unknown.. Acharya Paramanand Shastry... Unknown.... Sanskrit. Lele Laqs-mand-agand-eshaastii... Sanskrit... Sanskrit. Unknown. Santi Prakasa. Pandith Jeevaram Upadhyay. Unknown. 420 pgs. Pandith Sripad Damodar Sathvalekar. 1956. Sanskrita Kavya Kanthah. 0. Sanskrit.... Unknown.. Pandit Ram chandra Jha.. Sanskrit. Biography. Literature. Sri Naraharishastry.. Chaturya Lal. Pandith Sripad Damodar Saatvalekar. Unknown.m. Sanskrit.. 0. Sri Rurthar M Mikanal.. 214 pgs.. 0. Sanskrxtavaachanapaat'hamaalaa Da~tiiya Khand-d'a. Sanskrit. 1927. -.

Linguistics. . Geography. Sanskrit. Sardh Jnaneshwari... 1967. Sanskrit. 357 pgs. Sarvedic Prasnothari. Sastra Siddhantalesasangraha Volume I. 162 pgs. Sanskrit. Sanskrit. Unknown. Sanskrit. 0. Sanskrit. 1935. History. Philosophy.. sanskritdocuments.. Sanskrit. Sanskrit. Dr. Sanskrit. Geography. Unknown. 1927. Sastra Siddhantha Lesa Sangraha. Sri Amalananda. 400 pgs. bhatta vasudeva. Vageesha Sastry. 120 pgs. Satha Dushini. Ramchandr Savath. 402 pgs. 0.. Religion. Sanskrit.shama Sastry. 1935. Sathavarthmala Sampoorna... 0. .. 1935.shama Sastry. 233 pgs. Philosophy. Mangesh Patkar. Anubhavananda Swamy. 1995.. Satapada Brahmanam. 1951.. Sarvasiddanthasara Vivechanam.… Satikathraya Sri Valmiki Ramayanam Utthara Kandam Sanskrit 0 2090 pgs 50/167 . Chinnaswamy Sastri. Sanskrit. Sarvavednta Siddhantasarasangraha.. Unknown. 1973. 1986. Unknown. Biography.. Sathya Shasan Pariksha. Sarth Jnaneswari. 185 pgs. Sanskrit. 539 pgs. Dr. 1952. 1986. Geography. Sanskrit. 182 pgs. Sanskrit... 405 pgs. 382 pgs. Sri Pradhacharya Vidwanandi. 226 pgs. Sarva Siddhanta Sourabham. History. . 1957. 1913. 1983. Pandit Rama Krishna Misra... Vedanta Desika. Theology. 1901. History. 0. Sastra Darpana. 1912.. 1916... 214 pgs. Sanskrit. 1951.. Saraswati Bhavana Texts Part Ii. Biography. 1927. Sanskrit.. Sanskrit. Biography. P. 1927.... Gopi Natha Kaviraja. 1964. Sarva Darsana Sangraha Of Madhavacarya.r. 694 pgs.. Sanskrit.. Saraswati Sushma Vol 37 1 4.. 164 pgs. Sanskrit. Linguistics. Pandit Sri Vishveswara Jha... Unknown. 401 pgs. Sastra Dipika.cowell. Sanskrit. Sanskrit. 166 pgs. Unknown.. . Sanskrit. Sanskrit. Sanskrit.r. Unknown.. Raobahadur Gangadhar Bapuraj Kate. 562 pgs. Unknown.shama Sastry. E...sastri. Sanskrit.. Unknown.. 1937. Sathyaashhaad'ha. Chin'taamand-i Ti raa. Anundoram Barooah... Saraswathi Sushama Vol 37 (1-4). Sarvadarshana Sangraha. Religion. Philosophy. Unknown.. Sanskrit.r. Saraswathi Sushama Vol 37 (1-4). Philosophy.. 1915. Sanskrit. pgs. 80 pgs. Sastri Dipika..2/14/2011 A list of scanned Sanskrit books at III… Sarasvatii Kand-t'haabharand-ama~ Bhojaadevaa. Sarkara Srinivasavirachita Tatvaprakasika. Literature.. Sri Nanamaharaja Sakhare. Sanskrit. 0. 212 pgs. 1969. Unknown. Literature. Theology. Unknown..m.. Language.. 241 pgs.p. Unknown. 456 pgs.org/…/SanskritIIIT.m. 0. Mangesh Patkar. Saraswatha Vyakaranamu Purvardhamu..b.. 431 pgs. Language. Satha Dushini. History.. Dr.. Shri Nanamaharaja Joshi Sakhre. Satha Dushini. Sanskrit...... Sanskrit.. Biography.. 206 pgs.. Sri Sankaracharya. Philosophy. Vedas. S R Krishna Murthy Shastry. pgs. Sanskrit. 241 pgs. Sanskrit. Sathyaashhaad'havirachitamn' Shraotasutrama~ Shhashht'o Bhaaga. Religion. Pandit Rama Krishna Kishra. Vaidya Shivacharan Dhyani. Sanskrit. 544 pgs..s. Saraswati Vilasa (vyavahara).. 431 pgs. Unknown. Unknown. . Sarira Kriya Vijnaniyam... 1940. Saraswathi Suhama Vol 53 Mar Dec 1998-99... 880 pgs... Geography. Saraswathi Suhama Vol 53 Mar Dec 1998-99. Sasthramuktavali. 1950. 1927.. 158 pgs. Srimadvijayeendrateertha. Saraswari Kanthabharana. pgs. Literature. Unknown. 340 pgs..

Literature. N. 73 pgs.. Satyaashhaad'a. Sanskrit. 1921. 1969.... Satyagrahodaya.. 1939. Sanskrit. Religion. Sanskrit. Prof. Linguistics. Sanskrit. Select Sanskrit Inscriptions. 169 pgs. Theology.. Sanskrit. Sanskrit. Sattotravalivibhag.. Religion.. 212 pgs. Satyaashhaad'a Shraotasutrama~ Trxtiiyo Bhaaga. 1975. Diskaalkara~ Di Bii. Linguistics.. 350 pgs. Religion. 71 pgs.. Sanskrit. Satyaashhad'ha Shraotasuutrama Trxtiiyaa Bhaaga. Aapat'e Vinaayaka Gand-esha. Vedas. 1930. 1941. Satyaashhad'ha. Unknown. Religion.. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… Satikathraya Sri Valmiki Ramayanam Utthara Kandam.. 1929. Satyaashhad'ha Shraotasutrama~ Chatuura~to Bhaaga. 1927. Sanskrit... Religion. Satprati Pancha Grandhaha. Dr B R Sastry. 1933... Aapat'e Vinaayaka Gand-esha. Religion. 144 pgs.. Theology. 455 pgs. 0. Dr. Sanskrit. Aapat'e Vinaayaka Gand-esha. Language. 331 pgs. Satyaashhad'havirachitan' Shraotasuutrama~ Navamo Bhaaga.. Religion.. 1940. Sanskrit. Shriiraghunaathasuri. . Literature. 1922.. Satyaashhad'ha. 455 pgs. 2090 pgs. Theology. Satyashhad'ha. Sanskrit.. Religion.. Theology... Philosophy.n. Theology.. Theology.. 359 pgs. Satyaashhad'ha. Sanskrit. Psychology. 400 pgs... 328 pgs. Theology. Karambelkar. Unknown.. Sanskrit. Sanskrit. 1932... Seleqs-ansa~ Phrama~ San'skrxta~ Insa~kripshhansa~ Para~t'a~ 1 Tekst'a~. 368 pgs. Shaan'karapaadabhushand-ama~ Da~vitiiyo Bhaaga. Saundarananda Kavya Of Arya Bhadanta Asvaghosa. Mario E Carelli. Shaad'a~khaayanaarand-yakama~ Grantha 90. 51/167 . Religion. Satyaashhad'ha. sanskritdocuments. 1908. Theology. Raghunaathasuuri. 165 pgs. Kalluri Hanumanth Rao. 0. Sanskrit. 138 pgs.. Seethaharanam. 406 pgs. V.. 166 pgs. Sanskrit. Swamy Ghanapathi. Saurapuraand-an' Vyaasakrxtama~ Grantha 18. Sanskrit... 1908.. Vedas.. Unknown. Sanskrit. 1907. 1987. 1932. 140 pgs. Theology. 310 pgs. 1908. W. 1953. Theology. Gaadi. Theology.org/…/SanskritIIIT. Theology. 1925. .. Religion. Satyaashhad'ha Shraotasutrama~ Da~tiiyo Bhaaga... Satyaashhad'ha. 1975. Sekoddesatika Of Nadapada Naropa. Sanskrit. Saudaryalahari. 221 pgs. Theology.. Religion.. Satyaashhad'havirachitan' Shraotasuutrama~ Saptamo Bhaaga. Unknown. Sanskrit.… Shaan'karapaadabhushhand-ama~ Prathamo Bhaaga. 158 pgs. Religion. 125 pgs. Saundara~yalaharii Third Edition. Satyaashhad'ha. Satyaashhad'ha Shraotasutrama~ Da~tiiya Bhaaga. Satyaashhad'havirachitaman' Shraotasuutrama~ Ashht'amo Bhaaga. Sanskrit. Jwalaprasad Goud. Language. 370 pgs. Philosophy. Satyashhad'ha Virachitaman' Shraotasuutrama~ Navamo Bhaaga. Shan'karaa Chaara~yaa. Religion. Satyaashhaad'havirachitan' Shraotasuutrama~. Satyaashhad'ha. Religion.. 1930.. Satyaashhad'ha. Satyaashhad'havirachitaman' Shraotasuutrama~ Dashamo Bhaaga. Sanskrit...shri Krishnamacharyswamy. Psychology. 1907... Unknown. Theology. Haraprasad Shastri. Sanskrit... 367 pgs. Sanskrit..

289 pgs. 1961. Vyaasaachala. Shabda Kalpadrum Part 5. 569 pgs.. Literature. Sanskrit.. Sanskrit.. Linguistics. Language.. Shareerak Vignanamu Dwithiya Bagamu.. Babu Zalim Shing.. Shaiva Paribhaashha. Unknown. Linguistics. Ramswaroop Sharma. Literature. 1954.. Unknown. Language. Theology. Shabdh Deepika. Shabdakaustubhah Da~vitiiyo Bhaaga. Theology. Shakttivaada. Shriibhara~trxhara Mahaakavii. Sri Madhusudhan.. Unknown. Sanskrit. Language.. . Religion. 278 pgs. Psychology. Shabdhakapadrumaha Panchamakandaha. 1984. 0. 818 pgs. Psychology. Literature.. 0. 1946.. 573 pgs.. -. Sanskrit. Religion.. 430 pgs. Linguistics.. Shankara Bhashya Sametha. 0. Sanskrit.. 485 pgs... 0. Unknown. Sanskrit.. Shabda Kalpadrum Part I I I. 0.. sanskritdocuments.. Prabhakara Prasad. Language.. 557 pgs. Shabda Kalpadrum Part I V. -. Shabdhakapadrumaha Chaturthakanda. Shambhohara Prakasha. 294 pgs. 340 pgs. 592 pgs. 1822. Sir Raja Radha Kanth Dev Bahadur. 0. 438 pgs... 0.. Raja Radha Kanta Deva. Psychology. Sanskrit. Shabdashattkiprakaashika. Shaan karapaadabhushhand ama Prathamo Shriiraghunaathasuri. Shastavakru Geeta. Anandagiri. 116 pgs. 1988.. 345 pgs.. Dr B R Shastry. 0. . Sanskrit. Sanskrit.… 52/167 . 802 pgs. 652 pgs. Linguistics. 1961. 1927. Shabda Nirnaya Dipikahsampadanamu. Shang-karavijaya. Unknown.. Sharushan-sar-patrika.. 324 pgs... 790 pgs. 1961. 247 pgs. Shabd Kalpa Druma Chaturthi Kandam.. Shabd Kalpa Druma Padama Kanda. Sanskrit. Sanskrit... -. Shabda Kalpadrum Dwithiya Bagam. Sanskrit. 945 pgs. 344 pgs. Pandith Madhusudhansharamamaithila. 265 pgs. Sanskrit. Unknown. Raja Radha Kanta Deva. Shabda Kaustubha Prathamo Bhaaga. ... Sanskrit. Literature. 1949. 194 pgs. Kaatare Sadaashiva Laqs-midhaaraa. Unknown. Unknown. mahidhara sharma. 519 pgs. Tara~kalan'kaaraa Shriijagadiisha. Pandit Ramprasad Rajvaidy Patiyal. Sanskrit.. 244 pgs.. Chara~yaa Shiva. Sanskrit.. Shabdakalpadruma Volume V. Unknown... Shabdhakapadrumaha Thruthiyakandaha. Ramakanta Angiras. Linguistics. Diiqs-ita Bhat't'o.. Shang Dhara Samhata. Literature. Sanskrit.. Shadgadhara Samhitha. Shadkar Vijay. Unknown. raja radha kanta deva. Language. Sharirkvigyanam Vol I.. scanned Sanskrit books at III… Philosophy. Unknown. 1933. Sanskrit. 524 pgs. Sanskrit. Vedas. 147 pgs. Sanskrit. 1951. Unknown..... Sanskrit. Sanskrit. Literature. Literature. Unknown. . 1822. Literature. 8798.. 1934. 1929. Sanskrit. Language. Shaastratattvavinira~nd-aya.. 340 pgs. 1997. Sanskrit. 1909.. 2003. Sanskrit... Language.. Theology. 1949.. Sir Raja Radha Kanth Dev Bahadur. Sanskrit. Shabdakalpadruma Volume I.2/14/2011 A list ofBhaaga. Shanker Vedanta Ek Annusheelan. Religion.. Sanskrit.. . 494 pgs. Kantha Dev. Religion. Philosophy. Theology. Unknown. Bhat't'ojiidiiqs-ita.r. Sanskrit. Sanskrit. . 170 pgs. 1932. Sanskrit. Sanskrit. 1979. 0. Linguistics. 1961. 558 pgs.... Unknown. Bhat't'aachaara~ya Gadhaadara. Linguistics. Sanskrit. Philosophy. Sanskrit. Shatakatratama~ Bhaaga 9... 245 pgs.org/…/SanskritIIIT. 1950... Raja Radhakanta Deva... Shamakosh sabhayanuvadh..

Sanskrit.. Sanskrit.. 1972. Shrimat Trayibhashyakar Sayanacharya.. Satyaashhaad'ha. 0.. Shivacharitra Saahitya Khan'da 3 Ra. 317 pgs. Shatpath Brahman. Sri Guruprasad Shasrti. 221 pgs. Theology. Shiqs-aatrayama~. Religion. Theology. 0.. 1997.. 1908. Aapat'e Hari Naaraayand-a.. Sri Narendraprasadji Maharaja Sri Ni.. Sanskrit.. 337 pgs.madannatkrishnshastrikrut. Vedas. 1935. Shivacharitra Pradiipika. Shraotasutrama~ Prathama Bhaagah. Unknown... Unknown. Joshii Shankara~naaraayand-a. Shri Hari Swami. 200 pgs. Theology. 1940.. 127 pgs... Unknown. 1929. Sanskrit. History. Religion. Shatpath Brahmanam. 0. Sanskrit. 936 pgs. Religion.. Shatbhushni Vol-1. 360 pgs. Sanskrit. 1928. Shraotasuutrama~ Saptamabhaaga. Sanskrit. Shri Ramacharanpurikruth.. Satyaashhaad'ha.. Aagesh Ithyupavedattatreyashastry. Shivaraj Vijay.. 225 pgs. 1927. Shatapatha Braahmand-ama~ Dditiiyo Bhaaga.. Satyaashhaad'ha. Theology.. Shatpath Brahmanam Part V. Vishwanath Shastri.. 302 pgs. History. Pandit Sreemathru Prasadha Pandeya. Religion.. Religion. Unknown. Theology. Unknown. Sanskrit. Theology... Religion. Religion. 1982. Vaasudevananda Pa Pa. Biography. 360 pgs. Sanskrit... 1939. 0... Sanskrit. Unknown. 209 pgs. Sri. Shraotasuutrama~ Ashht'ama Bhaaga. Aapaat'e Da Vii. 62 pgs. 135 pgs.. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… 212 pgs. Sanskrit. Satyaashhad'ha. sanskritdocuments.jetendriya Charya. 1908. Shatashlokii Aavrxtti tiisarii. Shraotasuutrama~ Panj-chamo Bhaaga.. 1951. 608 pgs. Satyaashhaad'ha. 1868. Sanskrit.. Sanskrit. Sanskrit.. Shraota Suutrama~ Shhashht'ho Bhaaga Grantha 53. 1927. 438 pgs. Theology. Sanskrit. Sanskrit. Sanskrit. P. Viiraa Raghu. 1909. Bosa~ Phaniin'dranaatha~. Shiksha Patri. Sanskrit. Sanskrit. 1907. 288 pgs.. Shiva Samhita. Satyaashhaad'ha. Shatgidhara Samhitha.. Sanskrit. Unknown. Srimat Travibhashyakar Sayanacharya. 1854.. Satyaashhad'ha. 1847. Sanskrit. Shilpa Shaastrama~. Shraotasutrama~ Chatura~tho Bhaaga.. Krishna Kaura Mishra. 168 pgs. Theology. Religion... Shatpath . 404 pgs. Theology.… Shri Madbhagvadgeeta Vijay Chandra Varmanujya Unknown Sanskrit 0 340 pgs 53/167 . Shraadhdamanj-jarii. Shriimachchhan'kaarachaara~ya.. Religion.Brahmanam Part Ii.. Theology. Narayana Ram Acharya.. Theology. Sanskrit. Religion. 1940.. Sri Vasudeva Brahma Bhagwat. Unknown. Shraotasutrama Bhaaga 2. Religion. 1893. Theology. 1919.. Sanskrit. Unknown. Satyaashhaada. Sanskrit. Unknown. 315 pgs. Sanskrit. Shishupalvandh. Geography. Sanskrit.. 52 pgs. Religion. Religion. 1927. 254 pgs.. Srimathi Urmila Devi Sharma. Theology. 909 pgs.. Satyaashhaada. Shradhamanjari. 160 pgs. Shraotasuutrama~ Panj-chamo Bhaaga.... 816 pgs. Vedas. Unknown. 310 pgs. 893 pgs.. Social Sciences. 105 pgs. Sanskrit... Theology. Shraota Suutran' Dditiiyo Bhaaga Grantha 53.. 1940. Shrautapadarthanirvachanam. Religion. 1930. 1907.. Geography.... Sanskrit.. Unknown. Biography. Shatpath Brahmanamu Part Iii. 1928. Sanskrit... 84 pgs. Sanskrit. 400 pgs. Shri Anka Kavya.. 152 pgs.org/…/SanskritIIIT. 1957.. Shivajataka. 404 pgs.

. Shrii Madabhgavadagiitaa Grantha 44. Jayakrishna Misra. Shrii Alang-kaarakaustubha Da~vitiiyo Bhaaga. Literature. 239 pgs. Shriimanniilakand-t'haa. Shrii Madabhagavadagiitaayaa Prathama Dditiiyaadhyaayau... Language.. Goswami Tulasidas.. Philosophy. Sanskrit. Sanskrit.. Sanskrit. 1918. Bhat't'a Shriinaagesha. 1932. 112 pgs. Theology. 167 pgs. Shri Ram Charit Manas. 326 pgs.. Raghunaathaprasaada~ Pand-d'ita~. Gautamamunii. 517 pgs. 1922. Literature.... Shrii Paraatrin'shikaa Grantha 18. Theology. 1917. 131 pgs.. Social Sciences. Mumbayyaan. Sanskrit. Shrii Paribhaashhendushekhara. 161 pgs. Shriibhaasa Mahaakavi. 458 pgs. Shrii Panj-charaatran.. Language. Religion. Religion. Shrii Ashht'adashasmrxtayaa.. Religion. 219 pgs. Shrii Dara~shanodaya. Sanskrit. Sanskrit. Shrii Sang-gameshvarakrod'ama~. Sanskrit. 0. 808 pgs. Theology. Literature. -.. 1237 pgs... 278 pgs. 1934. Linguistics. Shriimadramaanujaachara~yaa.. 1644. 1978. 1933.. Unknown.. 82 pgs.. Sang-gameshvarashaastrii Gummaluurii... Shrii Mada~ddaipaayanaprand-iita Brahmasuutraand-i Grantha 21. Sanskrit. Shaastri Mukundaraama.. 2001. Shriinivaasaachaara~ya Laqs-miipuran. Linguistics. Maarulakara Shan'kara Shaastri.. Sanskrit... Chaara~yand-a Shrii Krxshhnd-a Priyaa. Sanskrit. Literature. Psychology. 373 pgs. Language. Literature. Unknown.. Psychology.. 1923. Shrii Bhaashyama~ Da~vitiiyo Bhaago Vivrxtyaatmaka. Sanskrit. Sanskrit. Theology. Sanskrit 1933 89 pgs sanskritdocuments. Literature. 340 pgs. Mahaakavii Shriishaktiibhadraa. 1958. Shri Vidrananya Muni.. 1846. Sanskrit. 1951. 1947. 612 pgs. Vijay Chandra Varmanujya. Shrii Dayaananda Mahaavidhaalaya Vol 25. Theology.. Shri Manmahabharathamu Vol 3. Shrii Lat'akamelakama Trxtiiyo Bhaaga. Sanskrit. Shrii Puraand-a San'hitaa Grantha 89. 1903.. Paramadiishvaraa. Sanskrit... 1933. Shrii Gautamamuniiprand-iitanyayasutrani. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Shri Madbhagvadgeeta. Vishvabandhu Shaastrind-a. Sanskrit.. Sanskrit. 473 pgs. Shri Raghavendra Vijayah. Language.. Sanskrit. Unknown. Religion. Psychology. Sanskrit. Shrii Chitraprabhaa. Unknown. 50 pgs. Shrii Giitaamrxtataran'gind-ii. Shriihariishaastrii Pand-d'itavara.. Linguistics. Aapat'e Vinayaka Gand-esha. Religion. 680 pgs. 1933.. Sanskrit. Social Sciences.. Language. Sanskrit. 1927. Philosophy. Shriishang-khadhara. Linguistics. Literature. 1938. Theology. 1851.. 1933. 0. Shrii Manmahaabhaartama~ Shhashht'hobhaaga Anushhsanapara~va..org/…/SanskritIIIT. Shriddisarah. 357 pgs. Religion. 642 pgs. Psychology.. 294 pgs.. 378 pgs. 611 pgs.. Aapat'e Hari Naaraayand-a. Linguistics. Social Sciences. 1916. Sanskrit.. Linguistics.. Language. Sanskrit.. Sri Narayana Charya. Sanskrit. Natural Sciences. Shrii Aashchara~yachud'aamand-i.. Philosophy. 1874.… 54/167 . Shrii Madaara~yabhat'iiyama~.. Sanskrit.. Shri Pacchadashi Pitambhari Bhashya. Kara~nd-apura Kavii. 384 pgs.. Philosophy...

291 pgs. 1924. 330 pgs... 297 pgs. Theology. Philosophy. Theology.. Biography. 1921. Religion. Sanskrit.. Psychology.. Geography. Sanskrit. Shriimanmadhvaachaara~yaa.. 1924. 94 pgs. Theology.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit. Shriimadaachaara~yadand-d'i. Shrii Vedaara~thasan'graha. 1924. Sanskrit. Theology. Shrii Svachchhaandatantrama~ Grantha 52.. Religion. Shriikrxshhnd-ayajuravediiyataittiriiyasan'hitaa Panj-chamakaand-d'arupa Saptamo Bhaaga. Kand-t'ha Raajaanakaraama. Shriimadabhagavadagiitaa Grantha 112. 1933. 344 pgs. 111 pgs. Religion. Religion.. 215 pgs. Shrii Shaakttivaadah. Shrii Svachchhandatantrama~ Grantha 31.. 1906. 1933. 288 pgs. Niilakand-t'ha. Sanskrit. Sanskrit. 1954. Sanskrit. Natural Sciences. 1947. Shrii Madabhinavaguptachaara~ya.. Vallabhaachaara~yaa Shriishrii. Sanskrit. Religion. 619 pgs..… Shriimadand-ubhaashhyama~ Faskiikyuulasa~ 8 Shriishriivallabhaachara~yaa Philosophy 55/167 .. Theology. Religion. Shriigand-eshaathara~vashiira~ra~shha Sabhaashhyama~. 348 pgs... sanskritdocuments.. 110 pgs.. Sanskrit. Theology.org/…/SanskritIIIT. Religion.. Taad'apatriikara Shriinivaasa Naaraayand-a.. Chaara~ya Madraamaanujaa.. Religion.. Bhat't'aachaara~ya Gadaaghara. 1939. Religion. Shaastri Kaashiinaatha. Sanskrit. Sanskrit.. Philosophy. 1906. Raamaanujaachaara~yaa Shrii... Shriivaasudevaanandasarasvatii Pa Pa. Shriimadabhagavadagiitaa Grantha 92.. Theology. Shriishriivallabhaachaara~yaa. 1948. Shriimatsaayand-aachaara~ya. Theology. Shriimadabhagavadagiitaa Grantha 64.. 1927.. 1929. 374 pgs. 89 pgs. Sanskrit. Sanskrit. Sanskrit.. Theology. Theology. Philosophy. Shriikrxshhnd-ayajura~vediiyataittiriyasan'hitaa Trxtiiyo Bhaagah. 1927. 443 pgs... Shriimadagand-eshagiitaa Grantha 52. Shriimadabhagavadagiitaa Dditiiya Khand-d'a Grantha 34. Sanskrit. Psychology.. 1919. Qs-emaraaja. Religion. 299 pgs. 1943... Theology. Shrii Svachchhandatantrama~ Chatura~tha Bhaaga Grantha 47. Sanskrit. Theology.. Religion. 168 pgs. Shriimatsaayand-aachaara~yaa. Shriimadaachaara~yadand-d'ivirachita Kaavyaadara~sha. 1923. 1906. 1952.. Sanskrit.. Qs-emaraaja. Sanskrit.. Abhinavaguptaa. 1930. Theology. Shriikhachchhandatantrama~ Panj-chamo Bhaaga Grantha 53... 1951. Psychology. Shriimadand-ubhaashhyama~ Faskiikyulasa~ 9. Vaamanashaastrii Pand-d'ita. Theology. 1921. Sanskrit.. Sanskrit. Theology.. 219 pgs. Sanskrit. Shriigurucharitama~ Da~visaahastrii. Religion. Religion.. Religion. Philosophy. 112 pgs. Psychology.. 215 pgs. 326 pgs.. 264 pgs. Theology.. Shriikrxshhnd-ayajura~vediiyataittiriyasan'hitaa Ashht'am Bhaagah. Religion.. History. Theology. 393 pgs. Sanskrit. Shriimadand-ubhaashhyama~ Faskiikyulasa~ 13. Shriishriivallabhaachaara~yaa. Religion.. Sanskrit. Shrii Tantraaloka Shhashht'ho Bhaaga. 42 pgs. Sanskrit. Shrii Sara~vadara~shanasan'graha. Shriimadand-ubhaashhyama Faskiikyulasa~ 8. Shrii Tantraaloka Bhaaga 7. 1945. Shriimatsaayand-aachaara~yaa. Kaula Madhusuudana. Qs-emaraaja. Religion. 761 pgs.

Literature. 1906. Religion. 138 pgs. Sanskrit. Psychology. Shriishriivallabhaachaara~yaa. Religion.org/…/SanskritIIIT. Shriimatsaayand-aachaara~yaa. Psychology.2/14/2011 A list of scanned Sanskrit books at III… Shriimadand ubhaashhyama Faskiikyuulasa 8. 1935.. Shriipurshhasukttama~. Shriishang-karaachara~yaa.. Sanskrit. Theology.. Shaastrii Pi Pi Subrahmand-ya... Sanskrit.. Religion. 1963. Philosophy.. 700 pgs. Sanskrit. Sanskrit.. Shriimadand-ubhaashhyama~ faskikyulasa~ 5.. Shriimadand-ubhaashhyama~ Faskikyulasa~ 6. 1939. Sanskrit. Shriishriivallabhaachaara~yaa. 1953. Sanskrit.. History. sanskritdocuments. Religion. Shriimada~vallabhaachaara~yaa. 1936. Psychology. 110 pgs. 110 pgs. Religion. Sanskrit.. Philosophy. Vaad'hdivasa. 110 pgs.. Religion. 102 pgs. Shriimadand-ubhaashhyama~ faskikyulasa~ 4. Shriishan'karabhagavatpaadaachaara~yaa. Paramaananda. Sanskrit. Shriisvachchhandatantrama~ Bhaaga 5. Sanskrit. Shriimadgand-oshagiita. 639 pgs. Sanskrit.. Shriimadand-ubhaashhyama~ Faskikyulasa~ 10. Shriisvachchhandatantrama~. Geography. Linguistics.. Sanskrit. Sanskrit. Religion. 1953. Shriiqs-emaraaja.. Religion. Shriishivabhaarata.. Shriimanmahaabhaaratama~ Prathamo Bhaaga.. Shriishuklayajura~vede Shatapathabraahmand-ama~ Bhaaga 2.. 1926. Biography. Shriisvachchhandatantrama~ Dditiiyo Bhaaga Grantha 38. Sanskrit. Shriimadand-ubhaashhyama~ Faskikyulasa~ 14. Shriishivabhaarayama~.. Qs-emaraaja. 324 pgs. 1905. 29 pgs. Philosophy. Religion. Shriivaalmiikimahaamuni Aadikavi... Sanskrit.. Philosophy. 851 pgs. Religion. 1923. Paramaananda Kaviindra. Sanskrit. 212 pgs. 110 pgs. Theology. 483 pgs. Shriiraamaayand-ama~ Prathama Khand-d'a Baalakaand-d'ama~. Philosophy. Psychology... Sanskrit. Philosophy.. Sanskrit. Sanskrit. Shriimaddevii Bhaagavatama~ Mahaapuraand-ama~.. Religion. Philosophy.... Sanskrit. Baapat'ashaastrii Vishhnd-uvaamana. 1926. 350 pgs. 297 pgs. 1905. 517 pgs.. Philosophy. 1849. Theology.. 1368 pgs. Religion. Language.. 165 pgs. Theology. 1930. Aapat'e Vinaayaka Gand-esha. Shriimadbhagavadadgiitaa.. Theology. Paand-d'eyena Raamateja. Kalanda~ Viillemena~.. Shriimadbhagavadagiitaa Trxtiiye Khand-d'a Grantha 34.. Theology. 395 pgs. Theology. Theology. 112 pgs. 112 pgs. Language. Qs-emaraaja~. 874 pgs. 377 pgs. 626 pgs. 1875. Shriimadand-ubhaashhyama~ Faskikyulasa~ 12. Vallabhaachaara~yaa Shriishrii.. Shriimadbhagavadgiitaabhaashhyaara~tha.. 1921. Psychology. 1906... 1933. Upaadhyaaya Shrii Baladeva. Theology. Sanskrit. Theology. Theology. Psychology.. Shriipaarameshrvarasan'hitaa. Sanskrit. Philosophy. Aapat'e Hari Naaraayand-a. 1952.. Theology.... 1906... Vallabhaachaara~yaa Shriishrii. Sanskrit. 110 pgs. 1931. 1906. 1906. Shriisayaajiigauravagran'tha. 1933. Sanskrit. Psychology.. 1906. Shriishriivallabhaachara yaa. Shriishriivallabhaachaara~yaa.… Sh ii h hh d t t G th 31 A h M h h h R li i Th l 56/167 . Psychology. Govindaachaara~ya. Shriimadand-ubhashhyama~ Da~tiiyo Bhaaga Baalabodhinii.. Linguistics. Social Sciences... Literature. Sanskrit. Psychology. Shriishriivallabhaachaara~ya.

Shrutisaarasamuddharand-ama~.. Sanskrit. 300 pgs.. Biography. Shriitantraloka Dvadasho Bhaaga.. Religion. 1926. Sanskrit.org/…/SanskritIIIT. sanskritdocuments.. 1930.. Aachara~ya Maaheshvara. 185 pgs. 1921. Srimadvaman Pandith Virchita. Theology. 279 pgs. 280 pgs.. 177 pgs. Shriitantraalokah Bhaaga 2. Religion. Sanskrit. 1922. Sanskrit. Sanskrit. Shrxn'gaaraa Prakaasha Prathamo Bhaaga Grantha 1.. History. Shriitantralokah Navamo Bhaaga. Sanskrit. Sanskrit.. Sanskrit. 93 pgs. Shriman Mahabharatam Part 4 7 Dronaparvan. 1924. Geography. Theology. Theology.. Theology. 1938... Shriiraamabhadradiiqs-itaa... Religion. Aachara~ya Mahaamaaheshvara. Linguistics... Unknown. 1910. 287 pgs.. Sanskrit. 1922. Shriisvachchhandatantrama~ Trxtiiyo Bhaaga Grantha 44. Sanskrit. 232 pgs. Sanskrit. Shastri. 287 pgs. Sanskrit. Philosophy. Unknown.. Theology. Ant'ona~fuha~rera~. Sanskrit.. Aloiisa~ Ant'ona~ fuha~rera~. Ram Prasad. Shriivaasishht'adhara~mashaastrama~. Sanskrit. 1935. Gupta Abhinava. Sanskrit. Religion. Gupta Abhinava. Niranjananda Swamy. Shrotriyas Of Mithila. 1938. Aachara~ya Maaheshvaraa. 340 pgs. Gupta Abhinava. Religion. Religion. Unknown. Religion.. 321 pgs. 351 pgs. 548 pgs.. Shriitantraloka Saptamo Bhaaga. Theology. Shriramanageetha. Religion. 1912. Religion.. Shukasaptati. Gupta Abhinava. 304 pgs. 237 pgs. Shriitantraaloka Navamo Bhaaga. Shrii Mumbayyaam. 1930. Sanskrit.. 370 pgs. Sanskrit. 1922. Jeevanrama Lallurama. Chaara~ya Madaabhinava. 1984. Theology. Sanskrit. Religion. Shriisvachchhandatantrama~ Grantha 48... Raaghavana Vi. 93 pgs. 1956.. Shriitantraaloka Ashht'amo Bhaaga Grantha 47..… Shukla Yajura~vediiya Kaand-va San'hitaa Saantabalekara Vasantashriipaada Religion Theology 57/167 . Mulkaraj Sharma.. Shriitantraalokah Chatura~tho Bhaaga. 78 pgs. Shriitantraaloka.. 1936. Unknown. Theology. 844 pgs. Theology. 1926.. 105 pgs. Chara~yaa Tot'akaa. Shriitantraalokah Shhashht'ho Bhaaga. Abhinavaaguptaa. 1940. 1930. K. Philosophy. Qs-emaaraaja Shrii. Gupta Abhinava.. Sanskrit. 301 pgs. 2001. 290 pgs.2/14/2011 A list of scanned Sanskrit books at III… Shriisvachchhandatantrama~ Grantha 31. 1946. 262 pgs. Shriivaasishht'hadhara~mashaastrama~. Gupta Abhinava... 1921.. Philosophy. Pandit Ramachandra Shastri Kinjawadekar. 1936. Sanskrit.. Religion... Sanskrit.. Theology.. 342 pgs.. Theology. Sanskrit. Theology. Unknown. 1926. Shriitantraalokah Ashht'amo Bhaaga... Sanskrit.. Theology.. Sanskrit. Literature. Religion. Shrimad Bhagvad Geeta. Gupta Abhinava. 1931.. Religion.. Religion. Religion. Dr Abhaya Nath Mishra. Shubh Santhathi Yogaprakasha. Sanskrit. 1975. Shriitantralokah Panj-chamo Bhaaga. Religion. 1921. Religion.. 594 pgs.. Sanskrit. Sanskrit. Shriisvachchhandatantrama~ Shhashht'ho Bhaaga..... 161 pgs.. Theology. Theology. 282 pgs. Gupta Abhinava. Theology. Shrutikalpalata. Language... Unknown.. Psychology. Shrimad Bhagawatam. Shrxng-gaaratilakama~ Da~vitiiya Vrxtti. 111 pgs. Shriitantraaloka Chatura~tha Bhaaga. Sanskrit. Religion.. 262 pgs.. Theology. Theology.. 1927. Guptaa Abhinava. 1922. Sanskrit.

Jagannatha Shastri. 1893. Sinjiniyam.. Bhat't'oji Diksita.. 360 pgs.. Sindhi Jaina Granthamala. Sanskrit.. . Shulkayaju Praatishaakhyama~ Dditiiya San'skarand-a. Geography.. Siddhanta Kaumudi Or Bhattoji Dikshit S Vritti On Paninis Vyakarana Sutras. 1960. Diqs-ita Appayya. Dr. Pan'chaananabhat't'aachaara~ya Shriivishvanaatha. Sanskrit. 155 pgs. Linguistics. Shukraniiti. Siddanta Siromani Of Bhaskaracharya. Siddhanta Siddhanjana... 142 pgs. Sri Ramasram..s. Sanskrit.. Siddhanta Tatva Viveka Of Sri Kamalakara Bhatta. 142 pgs.. 1005 pgs. Sanskrit. Literature. 325 pgs. Siddhivinishchayatika. 679 pgs.. Literature. Shukla Ysjuhu Shskeysksrams kanda Pradeepa. Unknown. Sanskrit. Sanskrit.. Unknown. Philosophy. 1962. 565 pgs.. 1949. Siddhaantakaumudii. Sanskrit. Sanskrit. Indian Astrology. 1959.. Literature. 0. M. Siddhanta Kaumudi Vol 3 Part 1. Sanskrit. 1980. Philosophy. Sidhdaantamuktaavalii. Siddhanta Kaumudii Bhaaga 2.bhatt. 2002. Siddhanta Rahasyam.. Sanskrit. Language. 434 pgs.. Siddhanta Kaumudi.. Siddanta Muktavali Dinakari Ramarudra.. 1877. Unknown. Bhat't'aachaara~yaa Jiivaananda Vidhaasaagara. 942 pgs.2/14/2011 A list of scanned Sanskrit books at III… Shukla Yajura vediiya Kaand va San hitaa. Sanskrit. 1937. Sanskrit. Theology.. Siddantakaumadyam.. 690 pgs... G. 317 pgs. Philosophy. 235 pgs. Shukraachaara~yaa Shriimada~. 96 pgs. Sanskrit. Language. Philosophy. 1916. 1499 pgs. Sanskrit. 1929. . Sanskrit.. 215 pgs. 1990. Yudishtara Mimamsak. Sanskrit.. Msk Shasthri... Sidghnithryam. Sanskrit.. Sri Vallabhacharya..venkata Rao. Sanskrit. Diiqs-ita Bhat't'o. Linguistics. Sanskrit. 1937. Siddhaanta Kaumudii Trxtiiyo Bhaaga Grantha Maalaa 136. Religion. M. 130 pgs. Sidhanthkalpavalli. Sibrasutra Nrubhatrayam. Vedanta. Religion.kesavarao Musalgaonkara. 112 pgs. . Unknown... 40 pgs. Literature . Language... 1925. 1998. Siksha Sutrani.... -. Philosophy.. 235 pgs. 1991.shastri. Psychology.. Dr D Arkasomayaji. Chandra Sekhara. Philosophy. Sanskrit Grammer.. Linguistics. Diiqs-ita Shriibhat't'oji. Technology. 1910. 474 pgs. Jagannatha Shastri. 1219 pgs. Sisupalavadham. Linguistics.. Sanskrit.org/…/SanskritIIIT. 404 pgs. Unknown... Linguistics. 1916. 0. Language. Siddantha Sidda Gnanam..5. 1921. 534 pgs. Literature. Sanskrit. 134 pgs. Unknown.. 580 pgs. T. 0. Unknown. Shvetashvataropanishad. Sanskrit. 249 pgs. Unknown. Language.. Sanskrit. Sanskrit. Sanskrit. 1906.… 58/167 .. Biography. Siddanta Chandrika..... A C Subbukrishna Srowthy. History... Sri Anantaviryacharya..g.h. 1929. Siddhanth Kaumudhi. wasudev laxman sastri pansikar. Bahadur Simhaji Sindi.. Literature.. Sanskrit. 1942. Sanskrit...... Siddhaantalesha San'graha Bhaaga 2. Siddhitrayi And Prthyabhijna Karika Vritti. 1938... Saantabalekara Vasantashriipaada. 234 pgs.sri Sudhakara Dvivedi.. Pt. Sri Chandiprasadshuklashastrina. 0. Anantha Charya. 0. 416 pgs. 166 pgs. Sanskrit. Sanskrit. Unknown. sanskritdocuments. kumudranjan ray. Theology. 2002. . Sanskrit. Sanskrit. Unknown. 932 pgs. 1997. 1862.

g. Smritichandrika Iii Vyavahara Kanda Part I. 252 pgs... 1959. 1949.. Language. R. Smrxtiinaan' Samychchaya Grantha 48. Sanskrit. 437 pgs. L. Sreenivasacharya. 1914.. . 0. Sanskrit. 1914. .. Language. 336 pgs. 673 pgs. 144 pgs. Skanda Puranam Brahma Khanda. Unknown.. Sanskrit.. 1899.. 1916.. 412 pgs. Philosophy. Smrxtichandrikaa Samskaarakaand-d'ah Prathamah. Bhat't'a Devand-a. Sanskrit. Philosophy. Unknown. Sanskrit.... Unknown. Sanskrit. 334 pgs.. Smrxtyara~thasaara Grantha 70. 474 pgs. 1982. 179 pgs. Sanskrit.. 0.. Skanda Mahapuranam Vol Iii.. Smrxti Chandrikaa Prathama Bhaaga. Religion. . Smriti Chandrika Sraddhakanda.... . A B L Awasthi. Bhat't'aa Devand-a. krishna Das. 480 pgs.padhya. 170 pgs. Sanskrit. Philosophy.. Sanskrit.srinivasacharya. Smruthi Chandrika. Smritichandrika Part Ii. 661 pgs.. Linguistics. . 478 pgs.. Sanskrit. Theology. 1916. L. Sanskrit. Somraj Krishna Das.. Religion.. Smrxti Chandrikaa. 122 pgs. Bhat't'aa Devaanaa.. 1918.. Sanskrit. 1965.. Theology... Devana Bhatta. Sanskrit.. Skanda Purana Kasi Kanda.. Unknown.. 375 pgs. Skanda Purana Avantya Kanda Vol7.. devana bhatta. 1921. Language.. 1962.. Religion. Sanskrit.. 502 pgs. 423 pgs. A Ramachandra Ratnaparakhi. Art. Skanda Purana.. Sanskrit. Smrutyartha Sagara.. 1965.. Literature. 156 pgs. Skanda Purana Volume 1 Index. Smrxti Sandara~bha Trxtiiyo Bhaaga. krishna Das. Bhat't'aa Devaanaa. Sanskrit. Theology. L. Smritichandrika. Smritichandrika Ahnika Kanda. 1912. Sanskrit.k. 1914. Sanskrit. devana bhatta..org/…/SanskritIIIT. Religion. Dharaachaara~ya. Literature. Bhat't'opaadyayaa Shriiyaajnikadevand-a~.... Smavadamala. 301 pgs. Sanskrit. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Sita Ravana Samvada Jhare. Unknown. Linguistics. Smrxti Chandrikaa Khand-d'a 3 Dditiiyaa Bhaaga.. 1918. 410 pgs. Pandith Sri Ramchandra Jha. Sanskrit. Skanda Mahapuranam Vaishnava Khanda. Language. Skanda Mahapuranam Nagara Kanda. 944 pgs. 1916. 486 pgs. Literature.k.. Smrxti Chandrikaa Shraaddha Kaand-d'a. Sitaramaviharakavyam Of Orient Laksmanadhvari.. Literature. Sanskrit.. . Religion. Narasimhachar. 119 pgs. Sanskrit. Sanskrit. . Theology.. Sreenivasacharya. 232 pgs. Unknown. 379 pgs.. 1914. Nag Sharan Singh. sanskritdocuments. 0. Sanskrit.. 262 pgs. Sanskrit. Philosophy.... Somraj Krishna Das. Linguistics.. Appayya Diksita. . Social Sciences. Linguistics. 328 pgs. Theology. 0. 1912. Religion. Smritichandrika.… 59/167 . Hari Narayana.. 1914. Gand-apatin' Naathaadigurutrayan. Sanskrit. Theology. 1966.. 198 pgs. 1966... Sanskrit.. Sivadvaita Nirnaya. 1978. Srimadananda Theertha. 102 pgs. Sotara Siddhanth Kaumudi Prayogsoochi Vol Iii. 1905. 1929. Smrityartha Sarah.. Skanda Purana Part Ii.. Unknown. Religion. D. 1952. Religion. Sanskrit. Sanskrit. Sanskrit. . 470 pgs. Sanskrit. 1875. Theology. Aapat'e Hari Naaraayand-a.. 787 pgs.

Southara Prasnavali. Swamy Vishnu Thirdha... Sanskrit. Sree Mrgendra Tantram. Sanskrit.. 244 pgs. Sphot'asiddhi Grantha 6. Psychology. Language. Sanskrit. 46 pgs. 1887. 130 pgs. 1946.. Sri Bashya Vimarsana Pariksha.. Soundarya Lahari. 0. Sotthara Prashnavali Vol I. Linguistics Literature. 0. Sphotavada. Sri Bashyam.. A Ramulu. Sanskrit. 1956. Sri Ramachandra Jha. 372 pgs.. Sri Ascharyachudamani. 214 pgs. Unknown.. Sanskrit. Pandith Sri Ramchandra Jha. Sanskrit. Ramdin. Unknown. 0.. Southara Pradhama Prasnavali. V. Sanskrit.. 416 pgs.. Linguistics. Sri Bashya Vartikam. Krishnananda Natha. Sanskrit.. 1931. Sanskrit. Sanskrit. 270 pgs. S Kuppuswami Sastri. Language. 126 pgs. Unknown.. Sanskrit. Unknown. Krishnamacharya. Sraddha Marthandam. 1946. Literature.. Sanskrit.. 1992. 136 pgs. 341 pgs.. . Spota Darsana. 0.. Sri Anubhashyam.. Sakthism. Linguistics Literature... 110 pgs.. 0. Unknown. Sanskrit. 1917. Unknown. Sree Lakshminarayan Samhitha. Sanskrit. -. 439 pgs. 0.. Philosophy.. Ramayanam. Mishra Aachara~ya Mand-d'ana. Govindacharya.. .... 108 pgs. Sri Bashya Vimarsana Pariksha.. 0. 1927.. Linguistics Literature. Vedanta. Naageshabhat't'a.. Sradda Viveka. 0. Unknown. 1065 pgs. 392 pgs. 188 pgs.. 1997. Unknown.. 225 pgs. . Sri Bagavathgeetha. 701 pgs. 0. . pgs.. Linguistics. Sanskrit. 1952. 158 pgs. 142 pgs. Sanskrit. Sanskrit.org/…/SanskritIIIT.2/14/2011 A list of scanned Sanskrit books at III… Sothara Prashnavali Dwithiya Kandamu. Literature. Madhusudan Kaul. Srauta Prayascitta Vidhi.. Literature.. Sphutartha Abhidarmakovyakhya.. Unknown. Unknown. Sr Madradbagavathgeetha. Krishna Datta Shastrin. 1919.. 1956. . Sanskrit.. 0.. Muni Ratna Prabha Vijaya. Sri Ath Madhvanidaanvishayanukramnika. 1930... Unknown.. Sanskrit. Unknown. Sri Krishna Das.. Sanskrit... Mahamahopadhyaya Pandit Mukunda Rama Shastri.. Unknown. 682 pgs. Sree Subhodhini. Unknown. 46 pgs. Sanskrit.. Unknown. Sphotavada Of Nagesa Bhatta. 598 pgs.. Sanskrit. Sanskrit. 1927. Swamy Sri Krishnavallabha Charya. Spanda Sandoha Of Kshemaraja... 40 pgs.. Sri Sundaracharya. Sri Bajothsav Chandrika. 1956. Language. 490 pgs. 1907. Sanskrit. Unknown. 166 pgs. Sanskrit.. Sri Ramachandr Jha. 220 pgs. 163 pgs. Sanskrit. Sri Acaranga Sutram Part3. Sree Madbhagavathgeetha. Linguistics. Unknown.. Unknown. Sri Bashya Vimarsana Pariksha. 580 pgs.. 0. Sanskrit. Unknown. Sree Skande Mahapurane Panchama Avanthyakhandye.. Sanskrit. V Krishnamacharya.. 0. Sanskrit.. Sphot'avaada. Sanskrit... . Madhusudanacharya. S Levi. 234 pgs. Sril Narayan Bhattagoswami.. 110 pgs..… 60/167 . 1946. 1989. 1933. 0. 194 pgs.. Unknown. Sanskrit.. sanskritdocuments. 0. 1927. Unknown. Unknown. Sanskrit. Sanskrit Mimansa.. Sanskrit. Literature. Sanskrit. Vallabhacharya. 258 pgs. -. Sradha Martanda. 1949. Raghunatha Patak. 374 pgs. Sramana Bhagavan Mahavira Vol 1 Part 1.. Unknown... Sanskrit. Soundarnand Mahakavy. 1948. g somayaji....

. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Sri Bashyam... Sri Mahadev. Religion.. 1240 pgs. 1938... 1917.. Sri Brahmasutrani.. Pandit V. Sri Ranga Ramanuja Charya. 0. Sanskrit.. sanskritdocuments. Sri Bhasya Mahapuranam.... 1970. 70 pgs.. Sanskrit. 504 pgs. 0.ityanen... Sri Bhasya Sariraka Mimamsa Bhasya Vol I. Swami Jagadisvarananda. Sri Devipuja Kalpa. Bhavamisra. 1947. . Sanskrit.. 1942. Sri Geethardha Prabodh.. sribhavamisra. Venkat Rao Raysam. 312 pgs. Sri Yashodanandanayen. M. Sri Chaitanayalilamratsar.. 334 pgs.ananthacharya.. Sanskrit. 1962. Sanskrit. Sanskrit. Sri Bhavishya Mahapurana. Acharya V R. Shes Raj Sharma.. 2000. Sri Gurugovind Singh Bhagvat Padh Jeevnetivratham. Sanskrit... 1993. Sanskrit.. 569 pgs.. Linguistics Literature. Sanskrit. 1237 pgs. Sri Jathi Bhaskar. Sanskrit.… 61/167 . Sri Geetha Jnanmarg. Unknown. Sri Bhrthurisubhashitam Vairagya Shatak.. Sanskrit. 588 pgs. Ramanatha Nanda Sarma.. 252 pgs. 694 pgs. Unknown. Sanskrit. Sanskrit. 1939. 1938. Chakravarthy Acharya Swamy U V P M. 536 pgs. 538 pgs.. Unknown. Sanskrit. Pandith Jwala Prasadji Mishra. 616 pgs. Sri Durga Saptasati. Unknown. Sri Bhasya Or Brahmasutrabhasya Vol Ii. V. 506 pgs. Linguistics Literature. Somraj Krishna Das. Sri Devi Poojakalp. 1935. Unknown. Narayana Bhatta Goswamy. Sanskrit. Sri Brahnidhanturatnakar Vol Iv. Unknown. Pandith Duttram. History.. Sri Vasudeva Nandasaraswathi Tembeswami. Unknown. Biography. Sri Brahtstotraratnakar. Sri Ramanuja.. Pandith Sri Sudama Mishra. 580 pgs. 294 pgs. 1943.. Unknown. . Unknown.. 1954. 0... 1954. Sanskrit. Unknown. Sanskrit. Sri Fakkikartanmanjusha Vol I. Sri Harithsanhita... 624 pgs.. 243 pgs... Grammer. Sri Bhasya Or Bhramasutrabhasya Vol 3.. 1910. Sri Bhava Prakasa... 1941. 1953. Sanskrit.. Sri Dommraj Narsinghraj. 268 pgs. Sanskrit....org/…/SanskritIIIT.... Pandith Sri Kankalalasharma Thakur. 228 pgs. Sanskrit. 1867. Sanskrit.. Language. Sri Datta Puranamu. 0. Sanskrit. Philosophy. Unknown. Unknown.. Unknown. Unknown. Sanskrit. Srikanth Sharma. 362 pgs.. 2000. Sri Bhagavata Dashamaskandha part. 0.. 1930. 1960. Sanskrit. Literature. 1935. Sanskrit. Sanskrit. Unknown.. 128 pgs.ananthchary. 473 pgs.. 242 pgs... Theology. 22 pgs... Unknown. Sri Brajotsava Chandrika.ranganadhacharya. Sri Hikmath Prakasha. Unknown. Sri Jayapura Raja Vamsyavali. Sri Daandeepika. Unknown. Sri Bhasya Vol I. 128 pgs. Sri Gurucharitam Vol 2. 154 pgs. 1950. Sri Gurusanhita. Sanskrit. Khem Raj Krishna das. 886 pgs. 1953.. Linguistics. 1966. Sri Bhavaprakasa Of Bhavamisra. 1958. Badhiri Das.. Philosophy.. 1954. Geography. 290 pgs. 202 pgs. Sanskrit... Unknown. Unknown. Sri Vasudevanandsarawathiswamikrutha. Sri Bhattikavyam. Unknown. Swami Sri Raghuvaracharya. 408 pgs.. Khem Raj Krishnadas . Unknown. Sanskrit. Vasudeva Vidyabhushan. Sanskrit.. Sanskrit. Srivasudevanandsaraswathikruthm. -. 1955. Sri Brahma Sutriya Vedanta Vrtti. .. 569 pgs. Sanskrit. Sanskrit. 532 pgs.

. 393 pgs. 0.… 62/167 . Sanskrit. Ganga Vishnu Sri Krishna das. Literature. Abhinava Gupta. Sanskrit.. Sanskrit. Sri Madbagavath Sridaritika. 412 pgs.. 0. Sanskrit. Theology. Sanskrit. Literature. Sri Mad Bagavadgeeta Sri Mahabharath Antargath.. Sri Karbhashyam Vol.. Sri Madbhagavatam Pradama To Dvadasakandaha Full With Sanskrit.. Sri Krishna Janmaskanda. Unknown.I V. 0. Unknown. 1164 pgs.. Chintamani Gangadhar Bhanu. Unknown. Sanskrit. . Unknown. Sri Madhandra Maha Bhagawatakathah. 546 pgs. Sri Chidirematiyeveerchandrasharma.. Sri Madhusudhan Sharma Maithli. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Sri Madbhagavathy Thiruthiya Skandhaha.. Unknown. Sanskrit. Unknown. 0. 262 pgs. Sri Laghu Bhasyam. Sri Kavyardash. 252 pgs. 746 pgs. . .. Sri Mad Bhagavatam. Sanskrit. Unknown. Swami Srikrsnavalla Bhacarya Shastri. Unknown.. 515 pgs. Sanskrit. 1976. Unknown. Literature. 246 pgs. Dr.. Language. Sri Kavyadarsa Of Dandin Edition Iii.. Language. 784 pgs.. . Sanskrit.. Sri Raghunath.. 283 pgs.org/…/SanskritIIIT.. Linguistics.. 0.. Shivnarayan Shastrina. 1971. 192 pgs. 0.. 1957.. 792 pgs. 1921.sankaranarayanan... Sanskrit. Sanskrit. Sanskrit. Sri Maaliniivijaya Varttikam. Sanskrit. Swami Vireshwarananda. Unknown. 466 pgs.. .. G Laxmikanthaiah...s. Sanskrit. 0. Sanskrit. Jona Raja. . Sanskrit. Sri Ramanujbhasyen. .. Sri Lalthasahasranama. .. 1956. ... 0.. 0. 1956. 1567 pgs. Khemraj Krishnadas. Unknown. Pandith Sri Shobhakanth Jha... 1953. 1976.. Sanskrit. Sri Laghu Bhasyamu. Sri Madbhagavathe Prathamaskandhaha.... Sri Ramanuj Bhasyen. 352 pgs. 1976.. 0.. Srimannarayanramanujjeeyswamini. Linguistics. Sri Madbhagavathy Panchama Scanda. Sri Madbhagavadgita Gitarthasangraha Of Abhinava Gupta. Sanskrit. Linguistics.. 855 pgs. . 0. Unknown. 353 pgs. . Sri Madbhagavatham Vol 5. 0.2/14/2011 A list of scanned Sanskrit books at III… Sri Kanta Charitam Of Munkhaka. 1957. ..... Sri Madbhagavad Gita Sri Mahabharathantargath.b.. 0. 1956. Sri Laxminarayana Samhitha Of Sri Svetayana Vyasa Vol 1 Part 2. 1957. 1985. Unknown.. 1963. Sri Laghushabdendulkala. 145 pgs. 122 pgs. Sri Mad Bhagavatam Ashtamaskanda. 1971... Sri Mad Bhagvadgeeta.. 383 pgs. 1972. 384 pgs. Sri Madbhagvadgeeta. .. 415 pgs. Unknown. -. 0. 468 pgs.. Sri Madbhagvathgeethaya Vigyanbhashyam. Sri Mad Bhagavad Gita. Sanskrit.. Sanskrit. Unknown.. Language. Sri Madbhagavatham Vol 7. Dr. S Vshwanathan. Sanskrit.. Language. Sri Madbhagavathe Akadhasaskandhaha. Linguistics.1. Sanskrit. 1985. Swami Srikrisna Vallabhacharya Shastri. Sri Madhevibhagavatam Mahapuranam. Sanskrit.. Unknown. Sanskrit. 1976. 845 pgs. Literature. Unknown. 306 pgs. . Literature. 854 pgs. Mahakavi Sridhara Acharya Virchit. Sanskrit. Unknown.. 362 pgs. Sanskrit.raghunathacharya. Religion. Sri Mad Bhagavatam Trutiya Kandam. 278 pgs. Somraj Krishna Das. 422 pgs... sanskritdocuments. Sri Laghu Siddhanth Kaumudi. Unknown.. 0.. Unknown. 151 pgs. 802 pgs. 578 pgs. Sanskrit. Sanskrit... . Pandit Ramtejpandeyan. . Sri Laksminarayanasamhita Vol....

. Unknown. 0. Sanskrit.. Sanskrit.krishnacharya.. Sanskrit. 0. Sri Madramayanmimamsa.. Sri Manoramashabdaratn Prashnouttarwali Vol I.. . . 665 pgs. Sanskrit.. Sanskrit. Sanskrit. 1992. Hariprasad Bhagirathi Ityesham. 1322 pgs. Sri Nyayamrutha Kaladharaha. Sanskrit. 1940. Sri Madhvas Tattva Vada. Unknown. Unknown.. sanskritdocuments. T. 226 pgs. Sri Madvalmiki Ramayanam Vol. Sri Mahabharatham Shanthi Parvan. Unknown. Sri Madvalmikiramayaname Sundharakandam. Language. Sri Thulasi Das. Sri Malavikagnimitra Of Kalidasa. Sanskrit. 0.… 63/167 .... Unknown. 288 pgs. Dr Malladi Gopal Krishna Sharma.. Sri Madhwa Mantrartha Manjari Of Vaishwanathi Narayanacharya.. Religion. Sanskrit. . Unknown. Sri Madhvacharya Brahmasutra Bhasya Vol Iii. Sri Madvalmiki Ramayanam Vol... 240 pgs. Sanskrit. Sri Rajnarayan Shastry. 1922. 0. 1992. Sanskrit. 572 pgs. Sanskrit. T R Krishnacharaya. Religion. Sri Madvalmiki Ramayan Vol I.. Unknown. Unknown. Unknown. 368 pgs. 0. 1366 pgs. Sanskrit. 43 pgs. Ganagavishnu Sri Krishnadas.I I I.. Linguistics. 534 pgs. Linguistics. 259 pgs.. Literature... Literature. 1995. Unknown. Religion. Sanskrit. 1921.. 780 pgs. Yoganarasimha. 956 pgs. 0. Sanskrit. Sri Malinivijayottara Tantram Vol Xxxvii. 334 pgs. 0. Ganaga Vishnu Sri Krishnadas.. 900 pgs. Unknown. 1955. Sanskrit.. Pandut Madhusudan Kaul Shastri. Literature.. 402 pgs. 1948.. 1948.. 215 pgs.. Ganga Vishnu Sri Krishna Das. 82 pgs. Sanskrit. 1935... Unknown. Pandit V Ananta Charya.. Sri Mannyayasudha Prarambha. Sanskrit. 1985. P P S Sastri.2/14/2011 A list of scanned Sanskrit books at III… Sri Madhragra Sanhitha.. Dattavathari Sri Manik Prabhu Yanche. Pandit Madhusudan Kaul Shastri. T Srinivasacharya. 939 pgs..I. 1987.. Sanskrit. Sanskrit. 1950. 0. 1994. Anandtheertha Bhagavatpadacharya. Pandith Shivdutten. Sri Manoramashshabdartan Prashnouttarvali Part I I. Sri Markandeyapuranam.. Sri Madwasiddantasarasangraha... K Ramachandra Shastri.. Unknown. Unknown. Sri Natakatha Sangraha Abridge Stories Of Sanskrit Dramas. 0. Sri Nilakanta Bagavathpada.. Vedavyasachar. Sri Maha Bhagavatam... Sanskrit. Sanskrit. 1944. Unknown... 1867.. Literature. C Sankara Rama Sastri. 94 pgs.. Sri Man Mahabharatam.. 130 pgs.. Theology. Sri Mahabharatha Tathparyyanirnaya Satikas. Sri Nirnaysindhu. 98 pgs. Language. 0.. Unknown.. Language. . Unknown... Sri Mahabharatham Ashravmedhikparv Vol X V I I I. 498 pgs... 816 pgs. 328 pgs. 148 pgs. Sanskrit. Linguistics. 459 pgs.r.. Language. Sanskrit. Religion. Sri Manmaharaj Sanskrit Mahapatashala Patrika. Sri Manmanas Namavandana. Sanskrit. Sanskrit. Sanskrit. Jai Krishna Das Haridas Gupt. Nalachakravarthy K. 370 pgs.. Sri Nimbarkvrathnirnay..org/…/SanskritIIIT. Sri Malinivijaya Varttikam.. Linguistics. .. . Religion.. Sanskrit. 0. Sri Mani Charithamruth... 1043 pgs. 540 pgs. Sri Nilakanta Bashyam. 1922. 1907. .. Sanskrit.. 1968. Religion Theology. Unknown. Sanskrit.

Unknown. Sri Sukhanandnathen.. Unknown. Sri Shabdharthchintamani Kosh I Vol I I I. Sanskrit. Sanskrit... Sanskrit.. Sanskrit.. Linguistics.. Sri Sandhichandrika. 0. 1952.… 64/167 . 818 pgs... Sanskrit. Sri Ramanujas Theory Of Knowledge. Religion. 378 pgs. Unknown. M. 1920.. 235 pgs. Sri Ramayanamu Pradhama Khandamu Balakhandamu. 656 pgs. 394 pgs. Sanskrit. 0..Upanishadvani. 592 pgs. 635 pgs. 128 pgs. 0. 558 pgs. Sanskrit.. 160 pgs. Sri Sankara Grandhavali Upanishadvani. Sanskrit. Unknown. 52 pgs.. Literature.... Sanskrit... P Sri Rama Chandrudu.. Unknown. Sanskrit.. Narasimha Charya A. 416 pgs. Ram Balak Shastri. Sanskrit. 88 pgs.. 0. Pandit Sri Mayaram Sangrahit... 724 pgs. Sanskrit. Sri Rasayoga Satakam Part Ii. 1998. Sanskrit... Vedanta.. 210 pgs. 230 pgs... Teekadutt Dhikal. Sri Sareeraka Meemansa Bashya. Sri Raghuvamsam Pakyanam. 1933... Sanskrit. Theology. Sanskrit. Unknown. Pandith Sri Ramchandrabhakt. Sanskrit. Sanskrit. 0. Literature.c. Not Available.. P Srirama Chandrudu.... Theology. Subramania Sastri. 1661. Pandith Sri Ramchandra Jha. Sri Rama Sahasra Namastotram Sri Tyagaraja Nama Stotram And Namavali... Dvaita Philosophy. Sri Nyayasudhatipani Srinivasathirthavirachita Prarambyathe. Sanskrit.org/…/SanskritIIIT. Sri Pithrakarm Nirnay.. Unknown. Sri Ramanuja Campu. Unknown. pgs.Vol 2..varadachari. Literature. Sanskrit. Linguistics. 81 pgs. Unknown. Sri Valmiki Mahamuni. Literature. 47 pgs.. 1949. . Literature. Sanskrit. 1958. 1987. 1661. 1054 pgs. Vijayeendrateertha. Sri Raga Ratnakar Tatha. Unknown. 0. Unknown. Philosophy. Unknown. Sanskrit.. Sri Paramahamsah. Sri Paribhasendushekhara. Language. 382 pgs. History. 500 pgs. 533 pgs. 0. Language. Sanskrit... Tirumazisai Alwar. Language.. Dhinanathasharma. Acharya Pandit Sri Sotharam Chaturvedhi. Unknown. Unknown. 1976. Religion. V. -... 0. 0. Sri Sankara Vijaya Makaranda.. K Srikrishna Das. Linguistics.. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Sri Nyayasudhatipani. 1942. .. Literature. Sri Sanskrithalok Vol I I.. Pandith Surya Narayan Shukla. 1956. Sri Paninivyakarne Vadartanam Vol I. 242 pgs.. Madhvacharya Gangur.. Sanskrit. 1965. Sri. 100 pgs. Literature. Sri Satika Threemuthrrasagara Nam. 1954. 1988.. Unknown. Krishnamacharya V. Sri Sahityanushasanam. Sri Sanskruthalok Vol I I I. Prabhakara Rao M. 2001.. -. Sanskrit. Sri Paribhashendu Shekar. 86 pgs.. Geography. Sanskrit. 232 pgs. .. Sri Saaraswatham. . Unknown. 70 pgs. Sri Sanatana Dharma Lokaha Part Iv. 0. 1980. Sanskrit.. 1978. 1954. 600 pgs. Sri Sarvasiddhantasarasara Vivechanam.. Sanskrit. 570 pgs. K. Sri Parasara Bhatta's Sri Ranagarajasta . Sanskrit. Sri Sarvamoola Granthah Of Sri Anandatirtha Bhagavatpadacharya I. Sri Sankara Grandhavali . Sri Sathpurush Charitra Prakash... sanskritdocuments... 1999. Biography. Sri Ramayan Valmikiye Ayodhyakand. Sri Madnubhutiswarupacharyapranitham.. Rambalashastri. Sharma V A. 605 pgs. Sanskrit.. Sanskrit. 2000. Unknown. Sanskrit.

. Sanskrit. Sri Valmiki Ramayanam Sundara Kandam. Sri Valmiki Ramayanam Ramabiramatikayitham. 108 pgs. Sri Sri Chantayan Chandramurthy. Sri Vaikhansagruhasutram. Sanskrit. Sanskrit. Sanskrit... Dvaita Philosophy.. Sri Sri Gandhi Katha. 696 pgs.. Garikpati Laxmikanth. 0.. Chandraji Goswami Mahodayan. 1973. Sanskrit. Linguistics. Sanskrit. Sri Tantraloka Vi. 1998. 148 pgs. Unknown.. Sri Srinivasamkhivedanth Deshike. . 0. Sri Sudarshana Shathakam. Sanskrit.. 402 pgs. 1889. Goswamy Sri Krishnaiah Chautan. G H Bhatt. Unknown. 0. Sri Shaligramoshdhshabdh Sagar. Sanskrit. Unknown.. .. Sanskrit. 184 pgs. Sanskrit... 0. Unknown. 255 pgs.2/14/2011 A list of scanned Sanskrit books at III… Sri Shagdhara Pragadvitha. Sanskrit. 210 pgs. Sri Subodhini. Sanskrit.. Dr Parama Hamsa Mishra. Sanskrit. Philosophy. Sanskrit. Sri Veerkrishnavijay Mahakavyam. Unknown. Lanka Sita Ramanshastrin. Sanskrit.. Sanskrit.. 0.. Sri Siddhhemchandrashabdanushasanam. 262 pgs. Sri Sri Vishnu Purana..org/…/SanskritIIIT. 660 pgs.... Sri Vallabhadigvijaya. 374 pgs. G Sri Yadunathaji Maharaj. Sanskrit. Chilukuri Ramabhadra Shastri. 72 pgs. 192 pgs. 78 pgs. Maheshwar Shastry.. 610 pgs.. 1947. Sreemuralidhar. . Unknown. Dr Palle Poorna Pragnya Charya. Sri Sita Ramayanam. 1939... 728 pgs.. Unknown. Unknown.. Unknown. 673 pgs.. 0.. 1980. Religion. 1966. 1064 pgs. 216 pgs. Nrusimha Bharathi. Acharya D V N. Sanskrit. Unknown. 1959... Sri Srinivas Vilas Samskruth Kavyam. 423 pgs. Sanskrit. Sri Tukaram Charitra. 108 pgs... Sri Skandamahapuranam Saptmaprabasakandam Prarambyathe. Vedas.. Sri Valmiki Ramayanam Mahabyas.. Sri Vayustuti. Language... Sri Shankatrashdarbhashyvimarsh.. Unknown. Sanskrit.. Haridas Shastri. Sanskrit. Sri Vaikhansagruhasutram Vol Ii.. . 1940. Religion.. Sri Srimad Alankara Koasthubha Accn0 589. Literature. K Krishna Das. 82 pgs. Khem Raj Krishna Dasane. 804 pgs. 0. -. Late Prof. Sanskrit. Unknown. 0. Sri Sivagitabhashyam. Literature.. Unknown. Linguistics. Theology. Language.. Pandith Ramchandra Sharma.. Unknown. Laxman Ranchandra Pangarkar. sanskritdocuments.. Tiruvenkatacharyana. 0.. Ganga Vishnu Sri Krishna das. 1830 pgs. Unknown. A S Mahaskar... Sri Svathsvrutham Vol I. Literature.. Unknown. Pandit Taradatta Panth. 1985. Unknown.… 65/167 . Sanskrit. 1116 pgs. Unknown. 406 pgs. Sanskrit.. 0. 1960. 672 pgs. Sri Srishukadooth Mahakavyam. 218 pgs. 355 pgs. 0. .. Tantras. 1952. Kulkarni G V.. 236 pgs. Sanskrit. Sri Siva Samhita. Sri Vaikhanasa Paitrumedhika Prayogaha. Sanskrit. Shri Madhava Charya. 418 pgs... 1963. Sri Srigandgiri Sri Jagadgur Charitra Sangraha.. Literature.. 1953.. Sanskrit.. 1979. Unknown. Sri Shivamahapuranam Vol Ii. Sri Munilal Gupta. Sanskrit..... Sri Vallabhacharya And His Doctrines. 1889. 1996. Sri Srinivas Makhi Vedanth Deshike. 0. 1985. 1867.. 1993. Bellankondopnamkaramaraykavindren. 545 pgs. 112 pgs. Sanskrit. Sanskrit. Sanskrit... Sri Suryacharit Mahakavyam. Unknown. Sanskrit.

. Sanskrit.. Sri Venkatachalam Mahatmay Vol Ii.. Sri Venkatachalamahatyam....… 66/167 ..vargranth Bhattacharya. Sanskrit. 208 pgs. 130 pgs. Srimad Bagavathgeetha. -. Sri Yogtarangini.. Sri Prayoga Dasji. Sanskrit. Sanskrit. Sanskrit. Unknown.. 416 pgs. Sri Venakatachala Mahatyam. 584 pgs.. Sri Venkatachalam Mahatyam Vol I. Sri Venkatachalam Mahatyam Vol. Sri Venkatachala Mahathyam Dwithiya Bagam.. Sri Vishnu Dharmottara Mahapuranam. Sri Vishnu Puranamu. 441 pgs.. Unknown. Someswara Sharma Y..... 1926. 340 pgs. -. 1959. Tatacharya D T. Unknown. -. Srima Brahmasutra Bashyam Part 3 2 Pada. Sanskrit. 1244 pgs. Philosophy. Sri Vrath Raja.. Srimad Bhagavad Gita. Sanskrit. 1972. 1982. Sriharshas Naishadha Darshanaparamsha.. 1960. 582 pgs. Unknown. 276 pgs.. 0. Sanskrit. Sanskrit. 0. 1960. Sanskrit.. Literature. Unknown. Sri Vrindaranya Kshetramahatyam.. Srimadvallabhacharya. Religion.. Srilakshminaryanasamhita Of Sri Svetayana Vyasa Vol Iii. Madhusudhanacharya. 1944. Sanskrit.. sanskritdocuments.. Sanskrit. Sri Vyasa Panini Bhavanirnaya. 1959. 1941.. Somraj Krishna Das. Sri Ram Chandra Jha. Sanskrit. 105 pgs. 294 pgs. Unknown..2/14/2011 A list of scanned Sanskrit books at III… Sri Vemageeta Prathama Sahasram Part Ii.. Dr. 202 pgs. 500 pgs. 0. Unknown..... Unknown. 1959. Srimad Bagavad Geetha... Unknown. Unknown. 1959. Srimad Almiki Ramayanamu Thruthiya Bagamu.. -. Sanskrit. Sanskrit. -. 250 pgs.. .. Unknown.. Sri Yogvashista Bhasha Vol I I. 498 pgs. 1963. Srikhaudar Khanda Granth. Srimath Srinivasay Parasmay. Srimath Srinivasay Parasmay Brahman. 1943... 1000 pgs. Sanskrit. 1915.. 1987. Unknown.. Sri Venkatachala Mahathyam Pradhama Bagam.. 0. 0. Dinker Vishnu Gokhale.. Shri Math Srinivasa Parasmay Brahman. Unknown. 123 pgs.. Sri Venkatachalam Mahatmay Vol I. Sri Vidvadwibhooti. Religion. 1961. 584 pgs. Srikrsnavallabhacarya Sastri. Bhagavadgita. 1954. 559 pgs. 460 pgs. 552 pgs..m. 280 pgs. Unknown. 606 pgs. Sri Venkatachala Mahathyamu. Gandham Sri Rama Murthy.. Religion. Sri Viswanatha Shamran.. 584 pgs... 1974. 578 pgs. 448 pgs. 360 pgs. Belvalkar S K. Sanskrit. Sanskrit. 846 pgs. Unknown. Sanskrit. 510 pgs... Unknown. Unknown..org/…/SanskritIIIT.. 1930. Unknown. Srimath Srinivasay Parasmay Brahmaney. 1867. Sri Venkatachalam Mahatmayam Vol I. 1953. Unknown. 349 pgs. 1959. Sanskrit. Sanskrit. S Sethumadhavacharya. P. Unknown. Sanskrit. Sri Krishna Das Sathmaj Gangavishnu. 714 pgs. Sri Venkatachalammahatmayam Vol-i. Sanskrit.. Sanskrit.jayaseeta Rama Sastry. Sri Vichara Dipika. Sri Vimanacharya Kalpaha. Sanskrit. M Ranganadhacharya.. Sanskrit... 1960. Sanskrit. 1973. Sri Venkatesa Kavya Kalpaha.I I. Sri Parashar Rammaharshi. Unknown. 1993.. Sanskrit.. Unknown. Unknown. 1959.. Srimath Srinivasay Parasmay Brahmane. Swami Bramahananda. Unknown. Sanskrit.. Sanskrit. Tippal Samalad. Sanskrit. Ramlagna Pandey..

Srimadbhagavatam Navamaskanda.. 1961. Unknown. Sanskrit.. Religion.. Srimad Brahmasutrani Part Ii. 428 pgs. Sanskrit. Sanskrit. .. Ramayanam. 1984. Srimad Valmiki Ramayana Part 2. 276 pgs.. 1954..… Srimadbhivishgarvgadadhartanyavadgnasen Vidhusha Virchitaha Khemraj Sri Krishna Das Srehthina 67/167 . 291 pgs. Religion. Srimad Bhagavata Mahapuranam Vol I. 1997. Srimadbhagavatam Pradamaskanda. Religion.. 148 pgs. Religion. Religion. Unknown. Srimad Vijayindratirtha. 1270 pgs.2/14/2011 g A list of Sanskrit books at III… g scanned g pg Srimad Bhagavadgeeta. 1006 pgs. Srimad Brahmasutra Bashyam Part 2 2 Pada. Prof. Jwalaprasad Misra. Unknown. Brahucharya.org/…/SanskritIIIT. Srimad Valmiki Ramayanam: Aranyakandamu Kishkinda Kandamu. 291 pgs. 1961. 1913.. Sanskrit.. Sanskrit. Hanumantha Rao K.. Brahucharya. 1982. K Hanumanth Rao. .. Sanskrit. Sanskrit. 120 pgs. Srimad Brahmasutra Bashyam Part 1 1 Pada... sanskritdocuments. 327 pgs.. 1997. 92 pgs. 1961. 1936. Sanskrit. Srimadvallabhacharya. 308 pgs. . Srimad Brahmasutra Bhashyam Vol I Part Iii. Sanskrit. Anandtheertha Bhagavatpadacharya. Sanskrit. Unknown. Srimad Vallabhacharya. P Radha Krishna Sarma.. D Harishankar Mishra. 1987. Srimadvallabhacharya. Unknown... 341 pgs.... 0. Wasudev Laxman Shastri Pansikar... 605 pgs. Theology... 126 pgs. Srimadbhagvata Aur Tulsi Sahitya Tulnatmaka Anushilana. 1980. Srimad Jayatirthas Tattvasankhyanatika. Religion. 242 pgs. Srimad Bhagavadgita. Maganlal Ganapatiram Shastri. Religion... . Sanskrit.. 370 pgs. Mahadeva Gangadhar Bakre. Dr N C V Narasimhacharya. 720 pgs. Bhagavadgeeta. Sanskrit. . 426 pgs. 1982. Srimad Bhagvad Geetha. Sanskrit. K Hanumantha Rao. Sanskrit. Hanumantha Rao K... 1969. 1985. -.. 1997. Srimad Valmiki Ramayanam Balakandam Ayodhya kandam. Srimadbhagavatam Astamaskanda... 1989. Sanskrit. Srimadbhagavatam Shashtamaskanda. Sanskrit... Srimadvallabhacharya.. Bhagavadgita. Srimad Bhagavath Dashamaskanda Subhodini. Religion. . 1983. Sanskrit. 358 pgs.. Sanskrit. 292 pgs.. Sanskrit. Sanskrit. 956 pgs.. Maganlal Ganpatiram Shastri. Art. Srimadvallabhacharya. Bhagavadgeeta. Religion. Brahucharya.. 650 pgs.. -. Sanskrit. Unknown. .. Theology. Srimad Brahmasutranu Bhasya Of Srimad Vallabhacharya. Bhagavad Gita. Srimad Valmiki Ramayanam Part 2. 744 pgs... Sanskrit. 1998.. Srimad Brahmasutranubhasya Of Srimad Vallabhacharya. Sanskrit. 1980. Unknown. Sanskrit. 0. Srimad Bhagavata Mahapuranam Of Maharsi Vedavyasa Vol 1 Skanda 1. A V N Acharya.. 1997... 355 pgs. 286 pgs. Sanskrit.. Srimad Brahmasutra Bashyam Part 3 1 Pada. 1992. Srimad Valmiki Ramayanam Saralagadyatmakam. Srimadbhagavatam Ekadasaskanda.. 75 pgs. Srimad Brahmasutra Bashyam Part 3 4 Pada. 212 pgs... 1875.. Sanskrit. 1911. Sanskrit.. Srimad Valmiki Ramayanam. 0..

1983.. . 384 pgs. Philosophy. 336 pgs.. 1981.org/…/SanskritIIIT. 1998...8. Sriman Nyayasudha part Ii. Sanskrit. 186 pgs. Sriman Nyadudha Vol . Sanskrit. Srimat Sitaramajaneyam. Philosophy. . Linguistics... . 198 pgs.. 0.. 1941. 1984. Sriman Nyadudha Vol Ii. Sanskrit. 130 pgs. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… Srimadbhivishgarvgadadhartanyavadgnasen Vidhusha Virchitaha. Sriman Nyaya Sudha Vol Viii.. Vayu Purana. P P S Shastri. Sriman Nyaya Sudha Vol Ix. 1983. Philosophy. 171 pgs. 1983. 842 pgs.. Jayatheertha. Sriman Nyayasudha part 1. . Sanskrit.1. Sanskrit. pgs. Srimath Vedantadesika Granthamala. Unknown. Sanskrit.1.. Sanskrit.. Philosophy. Venkata Reddy K. 1061 pgs. Sriman Mahabharathamu Aranyaparvan. 163 pgs. .. Sanskrit. Philosophy. Sriman Nyaya Sudha Vol .. Sriman Nyaya Sudha Vol .. . Sanskrit. Sriman Nyaya Sudha Vol . 1982. Philosophy.2. .. . Srimadhandra Mahabharatha Kathah.. Philosophy... 171 pgs. Sanskrit.. 1983. .. Unknown. G Laxmikanthaiah. Sanskrit... . Language. 164 pgs..… 68/167 . Jayatheertha.10...3. Sanskrit. 1980. Philosophy. Sriman Nyaya Sudha Vol Ii. Philosophy. Sanskrit.. Sriman Nyaya Sudha Vol . Sanskrit. 1983. Venkata Reddy K.. 164 pgs. Literature... Unknown. Sanskrit.10.5. Sanskrit. pgs.. 171 pgs... Sriman Nyaya Sudha Vol .. pgs. 1982. Sanskrit. 1982. Sanskrit.arka Somayaji. . 1982. Sanskrit.guru Venkatacharya. Philosophy.. Sriman Nyadudha Vol I.. Sriman Nyadudha Vol Iii. Philosophy. Sanskrit. 1868.. Sri Kanchi P B Annangaradharyar.. 1982.. Sriman Nyadudha Vol V. 184 pgs. Sriman Nyadudha Vol . 1983. Sriman Nyadudha Vol . 160 pgs. B N K Sharma.2... . sanskritdocuments.. Philosophy. Sriman Nyaya Sudha Vol ..... Srimahedantdesika Grantha Malaya. Sanskrit.2. Philosophy. Sriman Nyaya Sudha Vol .8.. 1982. 1983. Khemraj Sri Krishna Das Srehthina. Philosophy.. .. 1156 pgs.. 1983. Sanskrit.... Philosophy.. Sriman Nyadudha Vol . Ramayanam. 1982. pgs. Sanskrit. . Sanskrit. 1981. 1983. Philosophy. Sriman Nyaya Sudha Vol I. Unknown.. 160 pgs.. Dr. . Srimat Tatparya Chandrika Volume Iii.d. Philosophy. 160 pgs. Jayatheertha. Sriman Nyaya Sudha Vol . Sanskrit. Sriman Nyaya Sudha Vol . . 166 pgs. Linguistics Literature. .. 167 pgs. Venkata Reddy K. 723 pgs. 1110 pgs.9. G. Philosophy. 1983. 186 pgs. Sriman Nyaya Sudha Vol X.9. Philosophy.. Philosophy. Philosophy. 1983.. Sanskrit. Srimadhya Mahapuranam.1. Sanskrit.. Sanskrit.. 1981. 1983. .. Unknown. Philosophy. Linguistics Literature.9. Philosophy. Sanskrit. 1981. Gadi Srikrishnmacharyaswami. 163 pgs.8. pgs. 183 pgs. 1933. 316 pgs.. . 1983. Sanskrit. 1981. Sanskrit. Sanskrit. 1997. 166 pgs. 1982... Sriman Nyaya Sudha Vol . .. Sriman Nyaya Sudha Vol . Philosophy. 1918. Philosophy. pgs. Sanskrit.. Sriman Nyaya Sudha Vol . ... 266 pgs. Sanskrit. 167 pgs.

2/14/2011

A list of scanned Sanskrit books at III…

Sriramakirti Mahakavyam... satya vrat shastri, Unknown. Sanskrit, 1990. 582 pgs. Sriramyansar Kanya Tilakam... B.ramraj, Unknown. Sanskrit, 1972. 243 pgs. Sritattvacintamani... Chintamani Bhattacharya, Tantras. Sanskrit, 1937. 123 pgs. Srngara Sekhra Bhana... Dr B Rama Raju, Unknown. Sanskrit, 1969. 76 pgs. Srngaraprakasa... P P Subrahmanya Sastri, Language. Linguistics. Literature. Sanskrit, 1939. 100 pgs. Srngaraprakasa Part I... Maharajadhiraja Sri Bhoja Deva, Art. Sanskrit, 1939. 101 pgs. Stava Chintamani... Bhatt Narayana, Art. Sanskrit, 1918. 165 pgs. Sthotramala... K Prathivaadi Bhayankar, Art. Sanskrit, 1942. 112 pgs. Stotraadisan'grah... T'embe Shriivaasudevaa Nanda Sarasvatii, Religion. Theology. Sanskrit, 1952. 474 pgs. Stotrasamuccaya... Dr.v.raghavan, Unknown. Sanskrit, 1969. 332 pgs. Studies In Buddhism And Sikhism... Harcharan Singh Sobti, Unknown. Sanskrit, 1986. 116 pgs. Studies In Skanda Purana Part 3 Vol 1... A B L Awasthi, Unknown. Sanskrit, 1983. 182 pgs. Subhaashhitaratnabhand-d'aagaarama~ Parivara~dhitamashhtaman' San'skarand-ama~... Raama Naaraayand-a, Language. Linguistics. Literature. Sanskrit, 1952. 528 pgs. Subhashitasudha Ratna Bhandagaram Or Treasures Of Sanskrit Poetry... pandit shivadatta kavirathna, Unknown. Sanskrit, 0. 876 pgs. Subhasita Ratna Bhandagara... Narayan Ram Acharya, Kavyas. Sanskrit, 1952. 525 pgs. Suddhadvaitamartanda... Ratna Gopala Bhatta, Kavyas. Sanskrit, 1954. 116 pgs. Suddhadwita Pushtimaargiya Samskut Vagnmaya Part I... Prof Kantamani Sastry, Religion. Theology. Sanskrit, 0. 268 pgs. Sudhasharachhandhramu... Chilakamurthy Laxmi Narasimham, . Sanskrit, 1927. 180 pgs. Suklyajurveda Samhitha... Wasudev Laxman Sastri Pansikar, Unknown. Sanskrit, 1929. 658 pgs. Sulabasutram... P Venkataramaiah, Kavyas. Sanskrit, 1984. 74 pgs. Sulabasutram... Niccolao Manucci, Kavyas. Sanskrit, 1984. pgs. Sulabasutram Katyana... P Venkataramaiah, Kavyas. Sanskrit, 1984. 70 pgs. Sulabasutram Katyana... Niccolao Manucci, Kavyas. Sanskrit, 1984. pgs. Sulbhavykaranamu Part I... kambamupathi gopalakrishnamurthy, Unknown. Sanskrit, 1959. 46 pgs. Sundari Meghasamdesa Or Dakshinatya Meghasandesa... Veluri Subbarao, Unknown. Sanskrit, 1999. 122 pgs. Sundarkandam... Dr.chandra Prabha, Unknown. Sanskrit, 1981. 284 pgs. Supplement To Purana Vol Ii No 2... Dr Ganga Sagar Rai, Religion. Theology. Sanskrit, 1963. 40 pgs. Surjan Charita Mahakavyam... Sri Chandrashekhar, Unknown. Sanskrit, 1952. 264 pgs. Surya Dandaka... Mayura Kavi, Unknown. Sanskrit, 1989. 46 pgs. Surya Siddhanth... -, Religion. Theology. Sanskrit, 0. 358 pgs. Sushruta San'hitaa Muulamaatraa... Sushruta, The Arts. Sanskrit, 1945. 1261 pgs. Sushrutasamhita Of Sushruta... Jadavi Trikumji Acharya, Unknown. Sanskrit, 1915. 778 pgs. Sutrarthamrta Lahari... Dr. R. Nagaraja Sarma, Unknown. Sanskrit, 1951. 112 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Sutrutham

Sri Jovanand Vidhyasagar Bhattacharya Unknown Sanskrit 1983 908 pgs

69/167

2/14/2011

A list of scanned Sanskrit books at III… Sutrutham... Sri Jovanand Vidhyasagar Bhattacharya, Unknown. Sanskrit, 1983. 908 pgs.

Suuktimuktaavalii... Harihara~, Technology. Sanskrit, 1949. 186 pgs. Suuta San'hitaa Dditiiya Khand-d'a Grantha 25... Chaara~ya Maadhava, Religion. Theology. Sanskrit, 1950. 441 pgs. Suutasan'hitaa Grantha 25... Aapat'e Vinayaka Gand-esha, Religion. Theology. Sanskrit, 1924. 374 pgs. Suutasan'hitaa Trxtiiya Khand-d'a... Aapat'e Hari Naaraayand-a, Religion. Theology. Sanskrit, 1929. 380 pgs. Suutasn'hitaa Bhaaga 3... Aapat'e Gand-osha Vinaayaka, Religion. Theology. Sanskrit, 1929. 390 pgs. Suvarnaprabhasa... C.e.marobz, Unknown. Sanskrit, 1992. 758 pgs. Suvarnaprabhasa Das Goldglanz Sutra... W Redloff, Unknown. Sanskrit, 1992. 270 pgs. Svabhaava Chitren' Prathamaavrxtti... Divekara Dinakaravaasudeva, Philosophy. Psychology. Sanskrit, 1934. 180 pgs. Svacchanda Tantram... Kshema Raja, Literature. Sanskrit, 1923. 345 pgs. Svachchhan'da Tan'trama~ Vol V... Shaastrii Madhusudhana Kaula, Religion. Theology. Sanskrit, 1930. 297 pgs. Svachchhandatantrama Bhaaga 2... Qs-emaraaja, Religion. Theology. Sanskrit, 1923. 348 pgs. Svapnavasavadattam... C R Devadhar, Language. Linguistics. Literature. Sanskrit, 1946. 169 pgs. Svara~nd-a Kirana~... Shrii Sumitraanan'dana Pan'ta, Philosophy. Psychology. Sanskrit, 1947. 197 pgs. Svetasvaradyupanishad Purushasuktha Bashya Part 1... Veera Raghavacharya T, Upanishad. Sanskrit, 1955. 445 pgs. Svetasvataradyu Panishad Purushasukta Bhasya Part 1... T Veeraraghavacharya, Unknown. Sanskrit, 1955. 448 pgs. Svetasvataradyupanishad Purushasukta Bhasya... T Veera Raghavacharya, Unknown. Sanskrit, 1955. 446 pgs. Swapravasavadatta... Haradayalu Singh, Art. Sanskrit, 2003. 47 pgs. Swetha Swatharaghupanishatpurushasukthabhashyam Prathama Bhagah... Sri ranga rananuja murthy, Unknown. Sanskrit, 1944. 448 pgs. Taan'trika T'eksat'a Khand-d'a 11... Raavaa Bhaaskara, Religion. Theology. Sanskrit, 1922. 117 pgs. Taittiriiya Praatishaakhyama~ Grantha 10... Maahishheya, Religion. Theology. Sanskrit, 1930. 262 pgs. Taittiriiyaarand-yakama~ Bhaaga 2... Krxshhnd-ayajura~vediiyan, Religion. Theology. Sanskrit, 1927. 471 pgs. Taittiriiyaarand-yakama~ Dditiiyo Bhaaga Grantha 36... Aapat'e Vinaayaka Gand-esha, Religion. Theology. Sanskrit, 1927. 479 pgs. Taittiriiyabraahmand-ama~ Dditiiye Khand-d'a Grantha 37... Krxshhnd-ayajara~vediiye, Religion. Theology. Sanskrit, 1937. 570 pgs. Tajika Neelakanti... , Language. Linguistics. Literature. Sanskrit, 0. 280 pgs. Tamara Parinayam... , . Sanskrit, 0. 448 pgs. Tandyamahabrahmana... Pandit A Chinnaswami sstri, Unknown. Sanskrit, 1935. 510 pgs. Tantra Sara Sangraha... M Duraiswamy Aiyangar, Indology. Sanskrit, 1950. 566 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Tantra Trutiya Samputam

Sri bhagavad ramanuj Unknown Sanskrit 1951 380 pgs

70/167

2/14/2011

A list of scanned Sanskrit books at III… Tantra Trutiya Samputam... Sri bhagavad ramanuj, Unknown. Sanskrit, 1951. 380 pgs.

Tantraaloka 57... Abhinavagupta, Religion. Theology. Sanskrit, 1936. 374 pgs. Tantraaloka Dashamo Bhaaga Grantha 52... Gupta Madabhinava, Religion. Theology. Sanskrit, 1933. 400 pgs. Tantraaloka Ekaadasho Bhaaga Grantha 57... Gupta Madabhinava, Religion. Theology. Sanskrit, 1936. 377 pgs. Tantraaloka Grantha 30... Madhusudana, Religion. Theology. Sanskrit, 1921. 314 pgs. Tantrasara... , . Sanskrit, 0. 495 pgs. Tantrik Tests... Swamy Trivikrama Tirtha, The Four Vedas. Sanskrit, 1937. 132 pgs. Tarad'aga... Saagarikaa, Philosophy. Psychology. Sanskrit, 1940. 132 pgs. Taranatha's... Albert Grunwedel, Unknown. Sanskrit, 1914. 222 pgs. Tara~kataand-d'avama~ Chatura~tho San'put'ama~... Vyaasathiira~tha Shrii, Philosophy. Psychology. Sanskrit, 1943. 409 pgs. Tara~kataand-d'avama~ Da~vitiiyan' San'put'ama~... Vyaasatiira~tha Shrii, Philosophy. Psychology. Sanskrit, 1935. 417 pgs. Tara~kataand-d'avama~ Prathamasamput'ama... Shriivyaasatiira~ta, Philosophy. Psychology. Sanskrit, 1932. 564 pgs. Tarka Tandavam Vol I... D.srinivasacharya, Indology. Sanskrit, 1932. 557 pgs. Tarka sangraha... Acharya kedharnadh tripati, Religion. Theology. Sanskrit, 1974. 204 pgs. Tarkabhasa Of Moksakara Gupta... Embar Krishnamacharya, Unknown. Sanskrit, 1942. 140 pgs. Tarkabhasha And Vedasthana Of Mokshakaragupta And Jitaripada... H.r. Rangaswami Iyengar, Religion. Theology. Sanskrit, 1944. 144 pgs. Tarkasamgrahah... Shri Guru prasada shasthri, Unknown. Sanskrit, 1939. 308 pgs. Tarkasan'graha... Annambhat't'a, Philosophy. Psychology. Sanskrit, 1930. 225 pgs. Tarkatandava... , . Sanskrit, 0. 331 pgs. Tarkatandavam Of Sri vyasa Tirtha Ii... V Madahvachar, Dvaita Philosophy. Sanskrit, 1935. 407 pgs. Tarkatandavam Of Sri vyasa Tirtha Iv... V Madahvachar, Dvaita Philosophy. Sanskrit, 1943. 402 pgs. Tarkatandavam Of Sri vyasa Tirtha,3... V Madahvachar, Dvaita Philosophy. Sanskrit, 1938. 373 pgs. Tathava Teeka... Mahadesika, Geography. Biography. History. Sanskrit, 1934. 538 pgs. Tathvaprakasika Chapter1... , Language. Linguistics. Literature. Sanskrit, 0. 451 pgs. Tatparya Chandrika Part 2... Krishnacharya,t.r, . Sanskrit, 1913. 2011 pgs. Tatparya Chandrika Vol Ii Part Ii Iii Iv... Sri Vyasateertha, . Sanskrit, 1982. 213 pgs. Tatparya Chandrika Volume I... Sri Vyasateertha, Unknown. Sanskrit, 1981. 182 pgs. Tatparya Chandrika Volume Ii... Vyasateertha, Geography Biography History. Sanskrit, 1981. 211 pgs. Tatra Pratham Samputam Vedratha Geetabhasya Gadyatrey... Sri Mannarayanramanujayteendranamagya, Unknown. Sanskrit, 1980. 292 pgs. Tattva Pradipika With Citsukha Commentry... , . Sanskrit, 0. 294 pgs. Tattva Samkhyanam... Ramamurthy Sharma R, Philosophy. Sanskrit, 1980. 77 pgs. Tattva-kaustubha-kulisa... Dr.rnaga Raja Sarma, Unknown. Sanskrit, 1956. 324 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

Tattvaara~thasuutrama~

Svamii Umaa Religion Theology Sanskrit 1944 324 pgs

71/167

Language. Biography.. 367 pgs. Thathvaprakasika Kavyankya Sharkara. Tattvarthavartik Of Shri Akalank Deva. 0.. Sanskrit. 1934. 1940. Tattvaara~thavaara~tika Bhaaga 1. 1954. 1933. Tatvodyota. 72 pgs. Philosophy. Religion. 99 pgs. .t. 811 pgs. Tattvatika. Sanskrit. 462 pgs.. .. . Linguistics Literature. Sanskrit.. Raghava Bhatta. 152 pgs. Sanskrit. 0. Krishnacharya. Tatvamukttaakalaapa Prathamasanput'ama~... 1927.. bhattamalla. Unknown. Veng-kat'anaatha.. Unknown. Sanskrit. Sanskrit. Texts On Courtezans In Classical Sanskrit. Wasudev Laxman Sastri Pansikar. Anantarama Sastri Vetal. 1939....… 72/167 . 461 pgs. Sri Madhvacarya.. Tharkasangraha. Religion. Sanskrit... Tatuabodhini Uttaraidha Gnanendra Saraswathi. Svamii Umaa. Sanskrit. Ramanuja.. 0. Sanskrit. Unknown. 1303 pgs. 1953.. Vdaantaachaara~yaa. 157 pgs. Theology.. Philosophy. Sanskrit.. The Abhidhana Sangraha. 1938.. D Sreenivasachar.. Philosophy. . Tatva Marchand Vimarja. 106 pgs. Sanskrit. 347 pgs. Unknown. Tattvasankhyanam..org/…/SanskritIIIT. The Alankaramasekhara... Sanskrit. 1914. . 748 pgs. Sanskrit. 314 pgs.. 692 pgs. 1964.. 1980. Psychology. The Amarakosha... Tattvamukttakalaapa Trxtiiyasamput'ama~.... Sanskrit.. Linguistic. A B Gajendragadkar. The Alanka Asa Vasva Of Rajanaka Ruyyaka. Sanskrit.. 117 pgs. 1938. 22 pgs. Unknown. Literature. 110 pgs.. Unknown. Tatva Prakasika Bhavadipa Volume I to Ii. Tatvapradipika Nyaya Prasakdika Vyakyanamu.... G V Ramamurti. Prof. 0. Philosophy. Linguistics Literature. Tattvasamkhyanam. Sanskrit. Telugu-savara Dictionary. 1948. 0. Sri Jayatirtha. Nigamaantadeshika~. Literature. 528 pgs.. Literature. 1944. Thaithariya Brahmanamu Dwithiya Bagamu.2/14/2011 A list of scanned Sanskrit books at III… Tattvaara thasuutrama . Tatvaprakasika Bhavdiya.. 1936. The Abhijnana Sakuntala of Kalidasa. 538 pgs. Unknown. Pandit Girijaprasad Dvivedi. Sanskrit.. Vidya Manyatirth Swami. The Akhyata Chandrika. 406 pgs. . Sanskrit. Tattvaraya Rahasyam. . 342 pgs. Tattvamukttakalaapa Da~vitiiya San'put'ama~... 1999. Psychology. Unknown. 198 pgs.. 0.. Veeraraghavacharya.. Tattvamuktakalpa. 289 pgs. kshitish chandra chatterji. Sanskrit. Unknown. Sanskrit. Tattvamukttaakalaapa Da~vitiiyasan'put'ama~... 554 pgs. Sanskrit... Tattvatika. Sanskrit. R S Panchamukhi. Mahendra Kumar Jain. 754 pgs. Psychology.. sanskritdocuments. 1940. 329 pgs. 551 pgs. 1940.. 602 pgs. 375 pgs. Unknown... Sanskrit.. 1954. Sanskrit.. 324 pgs. Geography Biography History.. History. Geography Biography History. Sanskrit. . 1943. Unknown. 382 pgs. Sanskrit. 1953. Sanskrit. 554 pgs. ludwik sternbach. 1981. Philosophy. 0. Unknown. The Abhijnana Sakuntala Of Kalidasa.... Geography. Language. Sanskrit... -. . Sanskrit.. Technical Terms And Technique Of Sanskrit Grammer Part 1. 1936.. Sanskrit. kalan'kadeva Bhat't'aa.. Linguistics. Sanskrit. Mahadesika. 1980. Linguistics. Theology. -. Sanskrit. 1953. Vedaantaachaara~ya Shrii.r.

1943. 139 pgs. 1928. Linguistics. 1936.. 1938.. Unknown. 160 pgs. Sanskrit. 96 pgs. The Bhaskarodhyam The Rising Sun. 396 pgs. 290 pgs. The Andhra Pradesh Pension Code 1960. Aryabhatacharya. The Atmatattvaviveka Of Sri Udayanacharya.. 183 pgs.. Theology. 1922. 1961. 538 pgs. The Brahmasutra Bhashya Volume Iv. 1956.. Sri Madhwacharya. 162 pgs. Govinda Shankara Shastri Bapata. Unknown.. Unknown. Unknown. Sambasiva Shastri K. The Antagonist In Sanskrit Drama. 630 pgs. 440 pgs. The Atmatattv Aviveka. 521 pgs. 394 pgs. The Aranyaparvan Part 2. Sanskrit. K Smba Siva Sastry. Unknown. Philosophy. The Brahmasutra Bhashya Volume Iv.. 1931... 1940. 644 pgs. Sanskrit.. Unknown. 76 pgs... Pt.. Unknown. Charudeva Shastri. Jiva Natha Jhi. The Boudhayana Dharmasutra. Linguistics Literature. 1933. The Bhakti Candrika. P. Sanskrit. The Bhagavadgita.... Linguistics Literature. 1937. 534 pgs.... The Brahmavada Sangraha.. Unknown. Wasudev Laxman Sastri Pansikar. 550 pgs. Sanskrit. pgs. The Brahmasutra Bhashya Volume I. 1960. 162 pgs. 1984.. The Bijaganita Elements Of Algebra Of Bhaskrachrya.. Unknown. Sanskrit. Kasinath Pandurang Parab... The Bhattikavyam Of Bhatti.. 433 pgs. Religion.. 442 pgs. Pandit Harisankara Sastru Vedabta Visarada... The Art Of Sanskrit Translation Or A Mirror To Sanskrit Usage. 1967.. Bhagavadgita. Sanskrit.. The Ashtanga Hridaya Kosha With The Hridaya Prakasha. 1922. The Aranyakanda Vol.. The Aryabhatiya. Literature. Literature. 560 pgs. Unknown. Sanskrit.c. R. Sanskrit. Unknown. 243 pgs... Ramakantha R. The Balamartandavijaya.. 216 pgs. K. 1943.I I I. 1943. Bhagavadgita Sanskrit 1928 140 pgs sanskritdocuments. The Bhagavadgita. Indology. 1940. 423 pgs. Unknown. Unknown. Ramakantha. 350 pgs.. Sanskrit.. . Sanskrit. Sanskrit. 1942. Sanskrit.org/…/SanskritIIIT. Sujitkumar Mukhopadhyaya. Unknown. Sanskrit.. Vishnu S Sukthankar.. Sanskrit. k m vaidya. The Bhaminivilasa Of Jagannath Pandit. 1963. Sanskrit. Govinda Swami.. G Raghavendracharya. 1887. pgs. 1920. The Brahmavada Sangraha And Suddhadvaitapariskara. 1937. Literature.. Sambasiva Shastri. The Anargharaghava Of Murari Edition V. Sanskrit... Sanskrit. Literature. Sanskrit. 1963. Pandit Durga Prasad..… 73/167 ... The Arthsastra Of Kautilyavol I. 466 pgs. Rajanaka Ramakantha.. The Brahmasutra Bhashya Vol-3. The Bhrngasandesa Of Vasudeva. Sanskrit.. Abhay Mithra.. Language. Sanskrit. Diavanji. Unknown. 494 pgs. Sanskrit. T Ganapati Sastry.. Sanskrit. G Rghavendracharya. The Balamartandavijaya. 1930. 1984. 1934. Sanskrit. The Bhagavadgita.. Unknown. Unknown... Sanskrit. Ramakantha... 1943. Bhagavadgita. Sanskrit. 1930.. 400 pgs.. 648 pgs. The Arthasastra Of Kautilya. Sanskrit. 0. Unknown.. Raghavendracharya... Dr Jatindra Bimal Chaudhri. Sanskrit. 1949. Brahmasutras.. Unknown. Sanskrit. 1940. 674 pgs.anant Shastri Phandke Vyakaranacharya. Sri Narayancharya Atreya. Dhundiraja Sastry.. T Ganapathi Sastri.. The Bhagavad Geeta Vol Lxiv.2/14/2011 A list of scanned Sanskrit books at III… The Amarakosha.. The Asokavadhana.. Sanskrit. Sanskrit. Sanskrit.. 260 pgs.. Harihara Sastri. Unknown.

1949. 1112 pgs...jayaseeta Rama Shasthry.. 0. The Elements Of Darsanas Of Shriharshas Naishadha.. Unknown. 1969.k. Unknown. Unknown.. 1900.k. The Commentaries On The Prajnaparamitas Vol 1.. Dr. Sanskrit. M M Sri Mukunda Jha Bakshi. Literature. 140 pgs... Sanskrit. Literature. Sanskrit. Sanskrit.. Ganapati Sastri. Pandit Anantaram Dogara Sastri. Yugalakishora Vyasa. 426 pgs. Sanskrit. Sanskrit. Unknown. Sanskrit.. sage agnivesa. pgs. Sanskrit. 1939.. Pandit Sri Sudama Misra. M... 340 pgs... padmakara dvivedi jyautishacharya. The Charaka Samhita Volume 1.. The Dasrupaka of Dhanamjaya. 661 pgs. 1949. Sanskrit. Unknown. 430 pgs.. The Charaka Samhita Volume 5. 436 pgs. 1953.. Sanskrit. Pt. Unknown.. Sanskrit. The Ganita Kaumudi Part 1. Sahib Kaul. Unknown. Unknown... Unknown. 1987. 1969. Sanskrit. The Chhandogya Upanishad Vol Iii.. 296 pgs.... 126 pgs. L. Dr M Jaya Seetha Rama Sastry. Sanskrit. Religion. pgs. Sri Gagabhatta.rocher.. 344 pgs. 30 pgs.. The Dasarupaka Of Dhananjaya.. Sanskrit. Narayana Pandita. Sanskrit. 1936. A Mahadeva Sastri.s. 56 pgs. Sanskrit. 1176 pgs..… The Harasastra Sastri K S Unknown Sanskrit 4008 394 pgs 74/167 . Literature. Ganganath Jha. Unknown. Unknown.. Sanskrit. T..s. Unknown. The Durghatavrtti Of Saranadeva. Sanskrit.. sanskritdocuments.. 1936. sage agnivesa. 1987. 1953. 1932. 283 pgs. Sanskrit. Sanskrit. 394 pgs.. Mangal Deva Shastri. The Dharmasindhu By Kasinath Upadhyaya. The Gospel Of Advaita.org/…/SanskritIIIT. 1890. 140 pgs. Unknown. 1942. Unknown. 4008. The Charanavyuha Sutra Of Saunaka. The Ganitha Koumudi Part Ii. 1519 pgs. The Dhatuvritti Vol I Part I.. Manmatha Nath Dutt. 184 pgs.. Kasinath Panduranga Parab. 668 pgs. The Dharma Sastra Vol I... 4008. Unknown. 1941. The Chandraloka Of Shri Jayadeva. 1986. Sanskrit. 426 pgs.. Unknown. 1942.. 1928. 332 pgs.. Sanskrit. Sanskrit. 1938. Sastri. The Catapatha-brahmana.. 1908.. Unknown. The Charaka Samhita Volume 4. The Danadipika With Tha Bhavabodhini Hindi Commentary.. Unknown. Giuseppe Tucci.. 1942. Unknown.. The Grihaya Sutras Of Gobhil. Duncan Greenless. Pandit..2/14/2011 A list of scanned Sanskrit books at III… Bhagavadgita. sulapani.. Unknown. The Gobhilagrhyasutra. Sanskrit. 1889. Pandit Sri Sudama Misra.. 400 pgs. Social Sciences.. Duncan Greenless. 1936.. Unknown.. Sanskrit. 1934. The Dhatupatha Of Panini. Sanskrit. 264 pgs. T.... The Ganapatha Ascribed To Panini... The Collection of Sikshas by Yagna Valkya and Others. suryakanta. 170 pgs.venkata Charya... P Sathyavrata Samashrami. 1924. Sanskrit. Sanskrit. 1000 pgs.. Sanskrit. Unknown.. 1936. The Elements Of Darsanas Of Sriharshas Naishadha. 1949. The Danadipika. The Ganitha Kaumudi. Sanskrit. Sanskrit. Sanskrit. Upanishads. sage agnivesa. Sastri. Albrecht Weber. 1938.kanakalal Sarma. Unknown. 160 pgs. Sanskrit. The Harasastra. The Harasastra. Unknown.. 1942.. Unknown. The Devinamavilasa. The Gospel Of Advaita. 252 pgs. 516 pgs. 68 pgs. 296 pgs.. 680 pgs. Unknown. The Dipakalika.

… 75/167 .. 1957. 413 pgs. pandit bhavadatta shastri. sanskritdocuments. Sanskrit. 538 pgs. Spiritual Experience And Uysticism. 94 pgs. 280 pgs.. Upanishad.. Sanskrit. Not Available. Sanskrit. Unknown. Sanskrit.org/…/SanskritIIIT. Unknown. 446 pgs. Abhinavagupta. Sastri K S. Srish Chandra Chakravarti. The Kasyapa Samhita.. Sanskrit. Sanskrit... 1953. The Isvarapratyabijna Vivritivimarshini. Sanskrit. Pandit Durgaprasada. Unknown... 195 pgs. The Kadambari Kathasara Abhinanda. Unknown. Unknown. 186 pgs.. 1943. Sanskrit.. 1941.. Vrdddha Jivaka. The Jataka Mala. Unknown. General. 394 pgs.. 0. 1918. 446 pgs. Benerjee. B.. 539 pgs. Sanskrit. Sanskrit... The Isvarapratyabhijna Vivritivimarstni Vol Ii. Mukunda Rama Shastri. 307 pgs. 1957. Dr Hendrik Kern. Gopal Raghunath Nandargikar. Unknown. 1944. Sanskrit. 1943. Sanskrit. The Isvarapratyabhijna Vivritivimartni. Sanskrit. Unknown. The Holi Gita.. 1921. Sanskrit. Literature. 1918.. General. The Karna Sundari Of Bilhana. Sanskrit. 4008.. 190 pgs. The Kadambarikathasara Of Trivikrama. Unknown.. Unknown.. Sri Bopadeva. Sanskrit... The Kasika Vivarana Paniyaka. Sanskrit. 1930. 281 pgs. Pandit Durga Prasad... Unknown.. Rama Deva.. The Harsha Charita First Uchhvasa. Sanskrit.. Raghu Vira. Madhusudhan Kaul Shastri.. The Kalatattvavivechana. 1023 pgs. 160 pgs. 1902.. The Kadambari Kathasara Of Trivikrama. pgs. . Unknown.. Pandit Sri Nanda Kishore Sharma. 64 pgs. Spiritual Experience And Uysticism.. Sanskrit. 1933..s. The Kama Kala Vilas Of Punya Nanda. 70 pgs. B C Benerjee. 1867..pandya. 396 pgs.. Abhinava Gupta. Unknown. The Kalatattvavivechana. vrddha jivaka. 1940. Sanskrit. Abhinavagupta. 446 pgs. Sanskrit. The Kashi Sanskrit Series.. 195 pgs.. 312 pgs. Dakshina Murthy K. 1932. 1941. 349 pgs. 422 pgs. 626 pgs. Unknown.. 4008. Unknown. Sanskrit.... The Journal Of Oriental Research Madras. The Ishvarra Pratyabhijna Vimarshini of Utpaladeva.c. The Journal Of Vedic Studies Volume 1 No 1. 394 pgs.. Upanishad.. 349 pgs. Unknown. Mahamahopadhyaya. 1941. Pandit. Gudharthatattvaioka.. 1907.. 90 pgs. Unknown. Sanskrit.. Sanskrit. The Jayantavijaya Of Abhayadeva. Unknown. 178 pgs. Unknown. 1918.. K Dakshina Murthy. Sanskrit.k. The Harasastra. 1943.. Sanskrit.. The Ishvara Pratvabhijna Vimarshini Vol I. J. 1925. The Jaiminiya Or Talavakara Upanishad Brahmana. Abinava Gupta. Unknown. Sastri.. Unknown. Sanskrit. 1933. Unknown. Spiritual Experience And Uysticism. Sanskrit.j... 638 pgs.. The Isvarapratyabhijna Vivritvimarsini Vol Iii. The Janakiharanam Of Kumaradasa I X.. 1925. 1934... Pandit Madhusudan Kaul Shastri. The Isvarapratyabhijna Vivritivimarsini.2/14/2011 A list of scanned Sanskrit books at III… The Harasastra. 1933. Sanskrit. Abhinava Gupta. The Harililamrtam. 1938. The Kasyapa Samhita.. The Isvarapratyabhijna Vivriti Vimarsini By Abhinava Gupta. The Kamsavadha Of Sesakrisna Edition I I I... Sanskrit... Pandit Durga Prasada. Sanskrit. 1935. 130 pgs...

186 pgs. Sanskrit. Unknown. P P S Sastri.. The Mahanaya Prakasha Of Rajanaka Shiti Kantha. 557 pgs. Sanskrit. Mangesh Ramakrishna Telang. Unknown.. Sanskrit.. Sanskrit. Sanskrit..Revised By T Srinivas Venkatarama.. Unknown. Sanskrit.. Sanskrit. 154 pgs. The Mahabharata Vol Viii Bhisma Parvan. 974 pgs.. Surendra Nath Shastri. 0. Gopal Sastri Nane. Sanskrit.. Sanskrit. Sanskrit.l. The Mahabharatha Santi Parvan Vol X V Part I I I. Sanskrit. Unknown.. The Madhaviyadhatuvritti Of Sayanacharya.. E B Cowell. The Mahanaya Pkasha O Rajanaka Shiti Kanta. The Kausitaka Grhyasutras. Rajashekhara. Sanskrit. Vidhyasagara Vidhyavachaspati... Unknown. Literature. Unknown. 1913....ramashastri.mahadeva Sastri. Unknown.2/14/2011 A list of scanned Sanskrit books at III… The Katyayan Srauta Sutra Part Ii. 96 pgs... 609 pgs. A. Vidan N.. Sanskrit. 1931. 114 pgs. Pratap Singh. The Celebrated Vedavyasa Rishi.. Unknown... 184 pgs.. 1953. Mangesh Ramakrishna Telang. sanskritdocuments. 152 pgs. The Mahabharata Vol 9 Salya Sauptika And Stri Parvans. The Mahabharata Vol 9 Drona Parvan Part 1... Unknown. 1940. 298 pgs. The Kavya Mimamsa. The Krityasara Samuchchaya Of M M Pandit Sri Amritanatha Jha. Sanskrit.. 1961. Unknown. Sanskrit.. The Mahabharata Santi Parvan Vol Xviii Part I.. The Madhvamukhalankara. Sanskrit. 1944..s. Sanskrit.… 76/167 . 1917. 1935.org/…/SanskritIIIT. Literature.. 106 pgs. 1934. 1915. Pandurga Parad .. Sanskrit.. The Mahabharata An Epic Poem Vol 3. 486 pgs. Unknown. Pandit Mukunda Rama Shastri.. Sanskrit. 1934. Vaidya. Literature... 1100 pgs. 0. 1931. 1936. 676 pgs. P P S Shastri. Sri Gangadhara Misra... Sanskrit. 444 pgs. Unknown... Sanskrit. 362 pgs. Sanskrit. 1939.. Unknown. Unknown. K Sambasiva Sastri. Amara Chandra Yati.... Unknown.. The Mahapurana of Puspadanta Vol. Unknown. 1968...-2. Sanskrit.. Unknown.. The Celebrated Vedavyasa Rishi.. 1935. Unknown. 1918.. The Malatimadhava Of Bhavabhuti. Unknown. Unknown. Pandit Mukunda Rama Shastri. 676 pgs. Unknown. Literature. Unknown. 1935. 210 pgs. 728 pgs.. The Mahabharata Vol 10 Drona Parvan Part 2.. 442 pgs.. P P S Sastri. The Kavyalankara Sangraha Of Udaha Bhatta. 0. Unknown. Misra V. 1918. 1936. 1935. The Khadira Grihyasutra. Sanskrit. P P S Shastri. The Krityasaravol 1. The Kavyakalpalata Vrtti. The Kautiliya Arthasastra Part 1.. 390 pgs.. Unknown. Sanskrit. 696 pgs.. 154 pgs. Sanskrit. P. Sanskrit. 1960. 154 pgs. 388 pgs.. 1954. The Mahabharata An Epic Poem Vol 4. Sanskrit. 1934. Pandit Ananta Sastri. 822 pgs. 318 pgs. The Kavyarathna Of Arhaddasa.. The Malavikagnimitra Of Kalidasa Edition V I I I. 1918. Unknown. T R Chintamani. The Mahabharata An Epic Poems. The Laws And Practice Of Sanskrit Drama Vol X I V Vol I.. Sanskrit. 1935. 1936. Sanskrit. Kashinath Pandurang Parab.. The Kirtatarjuniya of Bharavi. Unknown. 587 pgs. The Mahanaya Prakasha Of Rajanaka Shiti Kantha. 640 pgs. The Celebrated Vedavyasa Rishi.. The Kausitaki Brahmana Upanisad. 268 pgs. P P S Shastri. r p kangle.

. Linguistics. 1966. 906 pgs. Sanskrit. 471 pgs. krishnaji govind oka... Unknown.. Sanskrit. 1933. Sanskrit. 1954. Unknown. The Manidarpana. The Nirukta Of Yaska Part Ii... 1921. 1926. Pandit Sri Hariram Shukla. Unknown.. Sanskrit.. 380 pgs. 212 pgs. The Nyaya Darsana. The Mimasa Kaustubha.. Sanskrit. Sanskrit.. Unknown. 1017 pgs. sri kamalakar bhatta. The Nirnayasindhu. Sanskrit... The Namalinganusasana Amarakosa Of Amarasimha. Unknown. Unknown.. Literature. 1916. 1898.. The Panchatantra 1 To 5. Ramakantha. Unknown. 297 pgs... 194 pgs.. 484 pgs... 1903... The Padyacudamani Of Buddhaghosacarya. Pandit. 138 pgs. Unknown. narayana ram charya. Pandit Kedarnatha. 1936.. Linguistics. The Nidhipradipa Of Sri Siddha Srikanthasambhu. 1940. The Niruktam Of Yaska Muni. Sanskrit.. Johannes Hertel. 195 pgs. sanskritdocuments. 1913.. The Naiskarmya Siddhi. T Ganapat Sastri. Jaimini Sutras. 80 pgs... Unknown. Dipak Bhattarcharya.. 1930. Sanskrit... 1925.. Language. 60 pgs. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… The Mandaramaranda Champu Of Sri Krishna Kavi. Language. -. Sanskrit. Sanskrit.. 297 pgs. Late M R Kale.... The Paippalada Samhita Of The Atharvaveda. Sanskrit. Sanskrit.. 1926. The Minimum Wages Central Rules 1950. 128 pgs. The Megha Duta Of Kalidasa Edition I I. 342 pgs. Sanskrit. Sushil Kumar De. 1982. 331 pgs.. The Nirsinha Prasada. R G Bhadkamkar.. Sanskrit. 1924. 126 pgs. A. The Nareshvaraperiksha.org/…/SanskritIIIT. Franklin Edgerton. Dalapati Raja. Sanskrit.. 135 pgs. Unknown. P R Subrhmanya Sarma.. T Ganapati Sastri. Ramakantha. G A Jacob. Dr V Raghavan.. Unknown. The Nyayaa Lilavati. Sanskrit.. 1981. Unknown. 676 pgs.... Unknown. Mahamahopadhyaya Gangdhare Sasatri Tailanga. Unknown. Sanskrit. 1930. The Nareshvaraperiksha. 200 pgs. Sanskrit. 529 pgs.. 0. 1957. Literature. The Nirnaya Sindhu. 1924. The Memorial Verses Of Appaya Dikshita's Kuvalayananda. Sanskrit. The Nyayavarttikat Paryatika Of Vachaspati Misra Vol Xiii. . Unknown. Literature..... The Nirsinha Prasada Tirtha Sara. 142 pgs.. The Megha Duta Of Kalidasa.. 158 pgs. Unknown. Ambadas Sastry. The Pancharatra Of Bhasa. Sanskrit.. Pandit Harihara Sastry. 134 pgs. Sanskrit. Unknown. 1925. Sanskrit. Chinnaswamy Sastri.. Unknown. K Sambasiva Sastri.. Sanskrit. 1984. 780 pgs. 475 pgs. The Mathuri Panchalakshani. 1917. 1957. 0. 52 pgs. Literature. 1953.. 0. Gopi Natha Kaviraja. The Mirichchhakatika Of Sudraka.. M Ranga Acharya. 416 pgs. Unknown. Sanskrit. Sanskrit.. Sanskrit.. 66 pgs. Linguistics. Sanskrit. 1912. Unknown. The Panchatantra Text Of Purnabhadra. Unknown. Religion Theology. The Muhurtachintamani. Unknown. 310 pgs. Language.. 1934. Kamalakar Bhatt. 542 pgs.. The Orient Pearls Indian Folklore.… The Parama Laghu Manjusha Pandith Nityananda Panta Parvatiya Unknown Sanskrit 1946 133 77/167 . Literature. Shovona Devi. Mukund Jha Bakshi. Sanskrit... 1942. The Mimamsa Slokavartika. . Sambasiva Sastri. Sanskrit.

Pandith Nityananda Panta Parvatiya. 150 pgs. History. The Rupavatara Of Dharmakirti Part I I.. Pandith Ramacharitra Tripathi. 136 pgs. 580 pgs.... The Principle Of Opposites In Sanskrit Texts. 64 pgs... T Venkatacharya.... E B Cowell.. Kshemaraja. Sanskrit. The Prasannaraghava Of Jayadeva Edition I I I. 1938. The Sabda Kaustubha.… 78/167 . Philosophy.. 1928. Sanskrit. 1980.. The Rasarnavasudhakara Of Simhabhupala. Kamalashankar Prana Sankhar Trivedi.. Pandit Shiva Datta.. 518 pgs. Mahamahopadhyaya Pandit durgaprasada. 118 pgs. 133 pgs. 553 pgs. 94 pgs. Literature. 1928. 1934. Unknown. Sanskrit... 565 pgs. E. 1935.. Unknown. Sesha Srikrishna.. Sanskrit.. Unknown. Unknown. 1911.. 259 pgs. 72 pgs. 1960. Kunhan Raja C. A Mahadeva Sastri. E.. Sanskrit. Unknown. Johnston D Litt. Unknown.. 1928. 100 pgs. The Parvati Parinaya. vaman shivaram apte.. Unknown.. Sanskrit. Sanskrit... The Ram Charitha Of Bhatti. Sanskrit. The Prakriya Prayoga Suchi. The Queset Of Enlightenment. Unknown. Unknown. Sanskrit. 150 pgs. Philosophy. Radharani Sukhawal. Unknown. The Patanjali Charita Of Rambhadra Dikshit. Linguistics Literature. 122 pgs.. 154 pgs. The Rgvedabhasya Of Skandavamin. Dr Juan Miguel De Mora.rasik Vihari Joshi.. The Philosophy Of Vallabha. 274 pgs. The Rekhaganita Or Geometry Sanskrit. The Prakriya Kaumudhi of Ramachandra Vol iii. 1911. 855 pgs. The Ratnagotravibhaga Mahayanottaratantrasastra. sanskritdocuments. 1922.. 1929. Unknown... 1926. Unknown. 1902. 54 pgs. Pandit Ram Labhaya. Sanskrit. pgs. 660 pgs. Sanskrit. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… The Parama Laghu Manjusha. 1979. The Queset Of Enlightenment.h. The Parijataharana Champu. The Phakkikaratna Manjusa.. Rao Bahadur M. Sanskrit. Unknown. Sanskrit. The Prakrta Prakasa Or The Prakrt Grammar Of Vararuchi. Sanskrit. Geography. The Phakkika Saralartha. 94 pgs. Sanskrit. Sanskrit. Thomas. Dharmasthala. Chandeswara... 1946. Dr. Sanskrit. Bhana Bhatta.. 545 pgs. Sanskrit. The Ramayana Of Valmiki Ayodya Khanda.. Unknown.j.. Sanskrit. 108 pgs. Unknown. 1931. Sanskrit. Sanskrit. The Rig Veda. Unknown.. Sanskrit.. 1950. 1936. Unknown. 1936. The Practical Sanskrit English Dictionary Volume First.. Vasudeva Laxman Shastri Paniskar. Unknown.. maithil pandit sri kanakalal sarma.. The Rasopanisat. K Sambha Shiva Shastri.. 264 pgs.org/…/SanskritIIIT. Unknown. The Purvamimamsa Darsana With Khandevas Bhatta Dipika Vol I I. Unknown... Sanskrit. 100 pgs. The Pratyabhijna Hridaya. Sanskrit... 395 pgs. Unknown. 1889... Sanskrit. 1962. 1950.. The Rajaniti Ratnakara. Unknown.. Kamalasankara Pranasankara Trivedi. Biography.. Sanskrit. 1935. Vishva Bandhu Shastri. sri nagendra narayana misra. Bhattoji Dikshit.. 1986. Unknown... 1923. 321 pgs. The Parijataharanachampu Of Sesha Srisrishna. 260 pgs. 1982. Sanskrit. Kavi Ratna Pandith Shiv Dutta... Sanskrit. 1950. The Pranjnaparijata Kavyam. 1950. 560 pgs.. 1926. Sanskrit.. Unknown. E J Thomas.

Dhundhiraja Sastri. Unknown. Unknown.. Linguistics. The Samskara Dipika Part 2.. Rangaswamy Iyengar H R. Sanskrit. 1929.. Venkata Kavi... 400 pgs. 1929. Upanishads. Sanskrit.. Sanskrit. 366 pgs. 1960. Religion. 1935.. Literature. Pandit A. The Satapathabrahamana. 216 pgs. 1950.chintamani Dikshit.. The Sahridayananda Of Krishnanada... Sanskrit... The Samgraha Chuda Mani. Art. 1950. 1921. 1936. 132 pgs. pandit nityananda panta parvatiya.. 1940.. Sanskrit.. Pandit Durgaprasad.. Sanskrit. . 510 pgs.. Sayanacarya.... Sanskrit.. The Sandilya Samhita Bhaktikhanda.. Pandith Nava Kishore Kara Sarma. 1243 pgs.mahadeva Sastri. The Saktivada. The Samnyasa Upanishads. Durgaprasa. Pandit A Mahadeva Shastri. 880 pgs. Theology. 270 pgs. 272 pgs. Unknown. Gopinath Kaviraj. Sanskrit. Sayanacarya. sanskritdocuments. dhareshvara bhojadeva. Sanskrit... Unknown. 1938. Sanskrit.. 1929. Mahadeva Shastri. 334 pgs... Sanskrit. 546 pgs. 2002. The Samayamatrika. 554 pgs. Sanskrit. P S Sundaram Aiyar. 438 pgs. 376 pgs. The Santiparvan Part Ii Apaddharma And Concordance. The Samanya Vedanta Upanishads. Sanskrit. Shripad Krishna Belvalkar. 1933. Unknown. S. 1933.. The Samskara Dipika Part 3. Sanskrit. The Sarasvata Vyakaranam. 524 pgs.. 1921. 1934. 159 pgs.. Sanskrit.r. Sanskrit. 2002. Sanskrit.. Pandit Sri Krishna Mohan Thakur. The Saiva Upanisads With The Commentary Of Sri Upanisad Brahma Yogini. Sanskrit. 315 pgs. Unknown.. The Saiva Paribhasa. 146 pgs. Unknown. 348 pgs. The Sakta Upanisads. Unknown. The Samkhya Karika. The Sajjanendra Prayogakalpadruma. The Sanskrit Third Reader. T R Krishnacharya. The Saktivada. Sanskrit.... 90 pgs. Sanskrit. 288 pgs. 1948.r. The Samskara Ganapathi.rangaswamy Iyengar. Major B. 1938. 300 pgs. Sanskrit. Sanskrit. Pandit A. The Santiparvan Part 3.org/…/SanskritIIIT. Sanskrit.. 1929... 1947. Sanskrit. 1925.. The Saraswathi Kanthabharana. The Satapathabrahmana. 241 pgs. 1954. 1930. Sanskrit. Sanskrit. Sanskrit. 1938. Sanskrit.. Unknown. 265 pgs. Sri H. Unknown. 558 pgs... 894 pgs. Sanskrit. A.r. The Sacred Books Of The Hindus Vol Viii. 1950.. Sanskrit... Unknown. Unknown... Unknown... The Samanya Vedanta Upanishads. 268 pgs. 1950.. 410 pgs. Mahadeva Sastry A. 1950.. 1938. Upanishads.. m m sri gadhadara bhattaocharya.. 1930. The Saiva Upanisads. Pandith Anantharam Sastri Vetal. The Sarasvata Vyakarana Part Ii.. Vidtasudhrakara Dr Har Dutt Sharma. . Upanishads. T.. Language.. 1954.. Literature. Unknown.subrahmanya Sastri.. The Sangita Sudha. Pandith Nava Kishore Kara Sarma.... Unknown. The Sahitya Darpana. 88 pgs.… Th S t th b h A di T Th M dh di R i U k S k it 0 694 79/167 . Unknown. 1935. 563 pgs. The Samnyasa Upanishads Vol Xii. 64 pgs. Mahadeva Sastri.. Unknown. pandit nityananda panta parvatiya.. Sanskrit. The Saiva Paribhasa. Sanskrit. 903 pgs. 671 pgs. Unknown. The Samanyanirukti.d.chintamani Dikshit.basu. T. Unknown. Unknown. Upanishads. 1951. Sanskrit. The Samgraha Cuda Mani. Linguistics Literature. Unknown.. Unknown. Shripad Krishna Belvalkar..2/14/2011 A list of scanned Sanskrit books at III… The Sabdha Kausthuba. Gopala Sastry N..

64 pgs sanskritdocuments. Vishva Bhandhu.... pgs. 622 pgs. 1934. 1965. 240 pgs. A Mahadeva Sastri. The Sriharicarita Mahakavya Of Srihari Padmanabhas Astrin. Unknown. The Siddhitrayi And The Pratyabhijna Karika Vritti Of Rajanaka Utpala Deva. M M Shri Gangeshopadhyaya. Unknown.. Philosophy.. 1909... Sanskrit. The Srautasutra Of Apastamba.. Social Sciences. Unknown.. Unknown.. 1983. 1931. Social Sciences. The Siddhanta Kaumudi With The Tattvabodhini Commentary.s. 2002.. 848 pgs. 282 pgs.. The Spanda Karikas With The Vivriti Of Ramakantha.. 652 pgs. 1944. Sanskrit. The Shantikuti Vedic Series Vol X I V. The Srungara Tilaka Bhana Of Amabhadra Deekshita. 139 pgs.. 1950. 1958. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… The Satapathabrahmana According To The Madhyandina Recension. Gita Devi Joshi. 1933. The Sri Mrgendra Tantram.. The Sidhant Shiromany.… 80/167 . -.. Sanskrit. 182 pgs. 1916.. Sanskrit. Sanskrit. 0. 1944... 830 pgs. 1937. The Siddhantalesasangraha Of Appayya Dikshita. Jayakrishna. 201 pgs... Narasimhachari. The Sivadristi Of Srisomanandanatha With The Vritti. Pandit Madhusudan Kaul Shastri.. Sanskrit.... The Shiva Upanisads. 1925. Sanskrit. .... 352 pgs.venkatacharya. 1944.. Sanskrit. 324 pgs. Sanskrit.. Sanskrit. The Spandakarikas Of Vasugupta With The Nirnaya. The Srauta Sutra Of Apastamba. 385 pgs. Sanskrit. Unknown.. 98 pgs. Sayanacarya.. 780 pgs. Viswabhandu. Chatterji J C. Unknown. 1940.. Unknown. Sanskrit. Sanskrit. 412 pgs. The Sraddhaviveka. The Sri Bhramara Gita. K Balarama Panicker.. Unknown.. Sanskrit. 440 pgs.. 1929. Unknown. Pandit Kedarnath. Philosophy.. 1963. Unknown. Sanskrit. Narasimhachar. 1937. Unknown. 0. 694 pgs. Sanskrit. 1930. Sanskrit.. 260 pgs. 1910. The Sree Narayana Vijayam. 1913.. Sanskrit.. Sanskrit. Sanskrit. 480 pgs. 156 pgs. M M Sri Rudradhara. Unknown. The Silparatna Of Sri Kumara. Sanskrit.. 1901. 1921.. 182 pgs. 809 pgs. S S Surya Narayana Sastry. 360 pgs. Unknown. Unknown.. 1971. pandit sivadatta shastri. Unknown.. 240 pgs. The Srauta Sutra Of Apastamba. Utpaladeva. 1962... Unknown. The Siva Sutra Vartika Vol Iv And V. 206 pgs.. The Shantakuti Vedic Series Vol Xv. The Smriti Kaustubha Of Anantadeva. 809 pgs. The Satapathaprahmana. Pandit Udai Narayan Singh. Sanskrit. Sanskrit... 963 pgs.. 1948.. Kavyas. The Srinivasavilasa Champu Of Venkatesa Kavi Edition Iii. Kshemaraja... The Shantakuti Vedic Series Vol X I I I. Philosophy. Sanskrit.org/…/SanskritIIIT. Pandit Madhusudan Kaul Shastri. Vishva Baandhu. Sanskrit. Unknown. Sanskrit. Unknown. Narasimhachari. Wasudev Laxman Sastri Pansikar.. K Sambasiva Sastri. -. The Siddanta Kaumudi Of Bhattoji Deekshit. The Savyabhichar Prakaranam. 884 pgs. Sanskrit. Unknown.. Sanskrit. T. Sanskrit.. 1972. Viswabhandu. Unknown.. J C Chatarji Vidhyavaridhi. Unknown. The Satapathabrahmana According To The Madhyandina Recension Vol V.. Pandit Durga Prasada.. The Shantakuti Vedic Series Vol V I I I. Philosophy. Unknown.

502 pgs.rajanaka.. Unknown. The Tautatitamatatilaka Part Ii. Sanskrit. Sanskrit. 1918. The Tattvatraya. 1928.. 232 pgs sanskritdocuments. Religion.. 1986. 1916. 0.2/14/2011 pgs. Sanskrit. 48 pgs. vaman shivram apte. Unknown.. Unknown. I S Pawate. A.. Sanskrit. A list of scanned Sanskrit books at III… The Stapathabrhmana. The Unadi Sutras. Sayanacarya.. Madhusudan Kaul Sastri. 1928. 1932. The Svacchandatantra With Uddyota Of Ksemaraja Vol Iii. Sanskrit. Unknown. 1881. Chinnaswami Sastri A. Sanskrit. 327 pgs. 1921.. Madhusudan Kaul Sastri.. Unknown. Sanskrit. The Students Guide to Sankrit Composition... A Collection Of Sanskrit Nouns. Unknown. Sanskrit.. Sri Ramachandra Panasikara Sastri. Sanskrit. Madhusudan Kaul Shastri.. The Tantraloka.. Unknown. 350 pgs.. Sanskrit. 1992. Madhusudan Kaul Sastri. The Tantraloka of Abhinava vol Ii. Unknown...m.org/…/SanskritIIIT. The Tantraloka Of Abhinava Gupta Vol I. Sanskrit. Sanskrit. Rajanaka Jayaratha. Unknown. Unknown. Unknown. The Tilaka Manjari Of Dhanapala.. 1936. Jayaratha R. Rajanaka Jayaratha.. 265 pgs.. 1943. Sanskrit. Sanskrit. 1986. Jadavji Trikumji Acharya... 242 pgs.. Seelakkhadha Maha Thera.. Sanskrit. 142 pgs. 1936. The Tandyamahabrahmana Part-ii. Religion.. Mangal Deva Shastri.. Philosophy. 1963. The Tantraloka of Abhinava-gupta vol Xii... The Sushrutasamhita Of Sushruta. Pandit Mukund Ram Shastri.. 1932. 1939. The Tripurah Rashya.. . The Trikanda Cesha. Jayaratha R. The Tantraloka Of Abhinava-gupta Vol 5. Unknown. Madhusudan Kaul Sastri. T R Chintamani. Sanskrit. Sree Mukunda Bala Sastry.. 363 pgs. The Stava Chintamani Of Bhattacharya. 1936. Sanskrit. Linguistic. Unknown.. Sanskrit. 1936.. The Tarka Sangraha Of M. Sanskrit. 630 pgs. Sanskrit. Sanskrit.. 1921. 624 pgs. 1913.. Unknown... The Students Sanskrit English Dictionary. 266 pgs. 441 pgs. Mahadeva Shastri A. 694 pgs... Sanskrit. 2002.. 368 pgs. 1938. 566 pgs. Pt. Unknown. Unknown. 1986. The Udayavarma Charita. 1986.. Jagaratha.. 170 pgs. Sanskrit. Unknown. 392 pgs. Sanskrit. 508 pgs. The Unadi Sutras In Various Recensions 2. 1942.. Sanskrit. 356 pgs. The Tantraloka Of Abhinava Gupta..annambhatta. 253 pgs. 913 pgs. 306 pgs. 788 pgs. Vaman Shivaram Apte.. Pandit Bhavadatta Sastri.… 81/167 . 412 pgs. Unknown. Religion. 366 pgs. 1950..... 695 pgs. The Taittiriya Brahmana Part Ii. The Trantraloka Of Abhinava Gupta Vol 3. The Svacchandatantra With Uddyota Of Ksemaraja Vol Iv. Philosophy. Sanskrit. Chinnaswami Sastri. Philosophy.. 1918. 1933.... The Tattvartha Deepa-nibandana. 136 pgs. Unknown. The Tautatitamatatilaka Part I. Madhusudhan Kaul. K Sambasiva Sastri.. Sanskrit. The Svacchandatantra With Uddyota Of Ksemaraja Vol I. Harishankar Onkarji Shastri. Sanskrit. 1938. Unknown. Kshem Raju... Sanskrit. Sanskrit.. The Structure Of The Ashtadhyayi. 0.guruprasad Shastri. Shri Rupagoswami. 678 pgs.. The Tantraloka Of Abhinava Gupta Vol X... 142 pgs. The Ujjwalanilamani Vol 2. Unknown. 444 pgs. Sanskrit... The Svacchandatantra With Uddyota Of Ksemaraja Vol Ii..

Sanskrit. The Upanishad Bashya Vol Ii Part I. H H Wilson. 587 pgs.. Sir Ganganatha Jah.. 285 pgs. Upanishadas. 1993. 1893. Language. 472 pgs. 1927. Dr Albrecht Weber... T R Chintamani. 388 pgs. Sanskrit... 1980.. Sanskrit.atreya.. Sanskrit... Pandit Sivadatta.. The Upanishadbhashya Vol. G K Bhat. 1891. 66 pgs sanskritdocuments. Sanskrit. 1927.. pgs. Pandit Mukunda Rama Shastri. Sanskrit. Madhusudhan Kaul. Sanskrit... The Varaha Mahapurana. Unknown. Sanskrit.. 1933. Unknown.. pandit nityananda panta parvatiya.. The Varshakrityadipika With Kalanirnaya And Vratodyapan. Sanskrit. 764 pgs.. 1932. The Vidusaka.. Sanskrit.. T R Chintamani. Hari Raghunath Bhagavath. 1918.. Sanskrit. 400 pgs. 244 pgs. Sanskrit. Acharya Baladeva Upadyaya.. 414 pgs. Sanskrit. 1917.… 82/167 . Sanskrit. 1942. Unknown. H D Velankar. K V Sarma. Unknown.I I Part. The Vikramorvasiyam Of Kalidasa. The Vivadachintamani Of Vachaspati Mishra. Sanskrit. Upanishads. 1942. Linguistics Literature. Unknown. 1961.. 279 pgs. 642 pgs. The Vatulanatha Sutras. Unknown. 1992. Hari Raghunath Bhagavat.. Unknown. The Veda Bhasya Bhumika Samagraha. The Unadisutras In Various Recensions Vi. The Vivadhachintamani Of Vachaspati Mishra. Linguistics. The Vajasaneyi Samihita. Sanskrit. Arthur Venis. Sanskrit. 1942. The Vikramorvasiya Of Kalidasa. 307 pgs.2/14/2011 pgs. 122 pgs. Sanskrit. Sanskrit... 307 pgs. B. Pandit Surendra Nath Shastri. Sanskrit. 1942.l. Vaidyasastranipunah. Unknown. 1928. The Vishnu Purana A System Of Hindu Mythology And Tradition. Unknown. Linguistics Literature. Linguistics.. 1932. 560 pgs. Prof.. A list of scanned Sanskrit books at III… The Unadisutras In Various Recensions. 1989.. 1968.. Pandit Kedharinath Sarma. 236 pgs. The Vamana Purana. 244 pgs. 1985.. 91 pgs.org/…/SanskritIIIT. 374 pgs.. Unknown. The Vasistha Darshanam.. Sanskrit.... Sanskrit. T R Chintamani.. The Unadisutras In Various Recensions 1 Of Svetavanavasin. Unknown.. Unknown.. Language. 474 pgs. 64 pgs. 400 pgs. 1984.. 1933.. 1927. Unknown. Pandit Shankar Pandurang. 1901. Pandit Sivadatta... Art. The Vakyapadiya.. 1972. Sanskrit. 338 pgs. The Vikramorvasiyam A Sanskrit Play Edition Iii... The Vikramorvasiyam Of Kalidasa Edition I. Unknown. Svetavanavasin. Sanskrit. The Vizianagram Sanskrit Series Volume Ii Part I. Literature. The Vishnu Bhakti Kalpalata Of Purushottama. The Vijnana Bhairava. Linguistics. Sanskrit. Pandit Sivadatta.. The Unadi Sutras. The Vidyaparinayana of Anandarya Makhi.. 104 pgs. Unknown. Sanskrit. 296 pgs. Language.I I. Literature.. Literature. 1959. The Unadisutras In Various Recensions. 1096 pgs. Sanskrit. Unknown.. Anand Swarup Gupta.. 1923.. ganganatha jha. The Vrishabhanuja Natika Of Mathuradasa Edition Ii.. S B Athalye.. 58 pgs. Unknown. Unknown. Sanskrit. The Vrishabhanuja Natika Of Mathuradasa... Unknown.

. Sanskrit. Linguistics. 162 pgs. 1961. The Unadi Sutras. Literature. 0. 272 pgs...... The Vyakarana Mahabhasya Part 2. Unknown. 426 pgs.. 1983. Sanskrit. Tittriyopanishat Atharaiyopanipancha. The Yudhishthiravijaya Of Vasudeva. Language. Samarapungava Dikshita... History. 1950. Biography.. 1938. W Redloff. Literature.. Thrastadyayi Bhashya Vol I. Dr P L Vaidya. Tiloya Pand-nd-attii Dditiiyo Bhaaga. 98 pgs. Art. Sanskrit. 190 pgs.srinivasagopalachar. 1948.. 622 pgs. 202 pgs. Niharranjan Ray. The Works of Sri Sankaracharya. Tiloya . 700 pgs. Geography. Tirthacintamani. 1931.. Sanskrit. Unknown. 1936. Sanskrit. Sanskrit.. Language. Thomas Hardy. 68 pgs. 1911. 99 pgs.. Sanskrit. Unknown. T T Srinivasa Gopalachar. A C Woolner.. Literature. Sanskrit.. 1883.. Brahmadattaji Jigyasu.. 0. T T Srinivasa Gopalachar. Tirthacinthamani Vol Iii. Thrikalavachedhikavadhaha. Unknown.. Sanskrit. 252 pgs.2/14/2011 pgs.. Kamalakrishna Smrititirtha..Pannatti Part Ii.. Art. . Sanskrit. 1993. Sanskrit. S C Sen Gupta.. Unknown. 634 pgs. Mahdeva Sastri. Unknown. Sanskrit. Sanskrit... Sanskrit. . Unknown. 1930. Bhagavat Patanjali. Tilakamanj-jarii Da~vitiiyaavrxtti.. A list of scanned Sanskrit books at III… The Vyakarana Mahabhasya Part 1. Kamalakrishna Smrititirtha. The Yoga Upanishads. Vishrug. 0. 1994.. Linguistics. Linguistics. Sanskrit. Tirthacinthamani Vol Ii. 1948. 305 pgs. Thorale Shaahu Maharaaja Yaan'chen' Charitra Aavrxtti Da~vitiiyaa. The Yadavabhayudaya Of Sri Vedantacharya. Sanskrit.... Sanskrit. Unknown. Archicture. Thruhan Sutr. Sanskrit... Unknown. The Yatra Prabhanda.. 1944. Burke A Hinsdale. Unknown.r.. Kamalakrishna Smrititirtha. Sanskrit. Sanskrit. Tirthacinthamani Vol 1. 1931.. T. 1911. Tinantarnavatarani.. 350 pgs. The Works of Sri Sankaracharya. Pandith Ramchandra Jha.chintamani. Sanskrit. Subrahmanyakavi S. Mahamahopadhyaya Pandit Sivadatta. 1944. Language. The Unadi Sutras. 516 pgs. Theology. Geography. 602 pgs. 524 pgs... T. 474 pgs. Geography Biography History.. Sanskrit. Philosophy. Biography. Chit'and-iisa Malhaararaamaarava. sanskritdocuments. Religion. 1952.. The Yadhavabyudaya Of Sri Vedanthacharya. 654 pgs. Biography. Sanskrit. Sanskrit. 100 pgs.. 1815. Unknown.. Unknown. Geography Biography History. 1920.. Sanskrit.. 305 pgs. The Works of Sri Sankaracharya Vol Xvi. Pandith A. 1912. 1951. History. The Unadi Sutras. The Yadavabhyudaya Of Sri Vedantacarya.. Shriidanapaala... Theravada Buddhism In Burma.org/…/SanskritIIIT. 116 pgs... History... 0. 234 pgs. 1965... 1910.. 126 pgs. 451 pgs.… 83/167 . Sanskrit. 639 pgs. Chaara~ya Yativrxshhabhaa. pgs.. 327 pgs. Thirteen Trivandrum Plays Attributed To Bhasa Vol Ii. Bhagavat Patanjali. The Works Of Sri Sankaracharya Volume Iv. Geography. Sanskrit. Tisastvustik. Sanskrit.

Language.. Theology. Chintaamand-inaa. Translation Of Siddhanta Bindu. Literature. 283 pgs. 284 pgs. Language. Theology. Theology. Simhavira Dura~ga.. Sanskrit. Trikonamithi. rajendra swarup gupta. Jagadgurvo Vijaynante Taramah. Sanskrit. 1933.. Upadesha Sahasri... Sanskrit. Art. Veeraraagaya. 1953. 1940. Dr. Shriinaarayand-ashan'karaananda.. Pandith Sri Durgadutta Tripathi. 1959. Unknown. 638 pgs. 210 pgs. 62 pgs. 1937. 1925. Unknown.. 1933. Unknown. Sanskrit. 60 pgs.. Sanskrit. 1934. Sanskrit. Religion.. Gajanana~ Shambu Sadhale Shastrii. 675 pgs. Sanskrit. 665 pgs. Linguistics... K. Sanskrit. Sanskrit. 1984. Language... Und-aadi Suutraand-ii Bhojiiyaani Shhashht'ho Bhaaga. Unknown. pgs.. V Krishnamacharya... Agama Prabhakara Muni Punyavijaya.modi. Sanskrit.. Und-aadisutraand-i Prathamo Bhaaga.. Linguistics. The Arts. Sanskrit. Benoytosh Bhattacharyya. 1933. Unknown. Naaraayand-a Dand-d'anaatha. Ukttivyaktiprakarand-a... Sanskrit. 1933... Sanskrit.. Religion. Unmattaraghava. 94 pgs. 1929.... Udararachavam of Kavimalla Mallacharya.... Sanskrit. Unknown. Unknown. Religion. 720 pgs. Sanskrit. Sanskrit. Sanskrit. Language. Linguistics. 194 pgs. 1933. 52 pgs. Literature.. 1929.. 1995. 0.. Upanishhadaan' Samuchchaya Da~vitiiyoyamang-kanaavrxtti. Sanskrit.. Und-aadi Suutraand-i Grantha 7.. Unknown. 302 pgs. 1946. 237 pgs. Theology.2/14/2011 A list of scanned Sanskrit books at III… Toegyehak Libery Part I Vol 4. 158 pgs. Itaruka. 233 pgs. Naaraayand-a. Unknown. Unknown. Toegyehak Libery Part I Vol 4. Sanskrit.. 201 pgs.. Philosophy..... Language. Aapat'e Hari Naaraayand-a.. Upanisad Vakya Maha Kosa Vol 1. Linguistics Literature. 1952. Sanskrit. Upadeshasahasri.. Sanskrit. Religion. Sanskrit. 316 pgs. Trin'shachchha~lokii Grantha 104. Sanskrit. 1961. 1952. Religion. Chintaamand-inaa. A S P Ayyar. Sanskrit. Chintaamand-ii Ti Ra..org/…/SanskritIIIT. 1925. shastri gajanan shambhu sadhale. 1941.. Sanskrit. Tripurabhaaratiilaghustava granthaan'ka 1. 1966. Unpublished Upanishads. Sanskrit. C.. 122 pgs. 97 pgs. 147 pgs. Kumham Raja. 532 pgs. Upanishhada~vaakyamahaakosha Uttaraara~dhaha~. 1953. Upadeshasahasri Part I. Literature. Krishnaswamy Iyer. Umas Mirror.. Art. 314 pgs. 1936. Und-aadisuutraand-i. Upakarma Paddhathi. Sanskrit.sudhakar Malaviya.. Psychology. 403 pgs. Somatilakasuuri... Unknown. Shaastri Shan'kara. Und-aadisuutraand-i Bhojiiyaani Shhashht'ho Bhaaga Grantha 7. Theology. P. Theology.. Ullagharaghava Nataka. Udaya Vadantha Granthamala. Tristhaliisetu 78. Dinakar Krishna Gokhle. Sri Sankaracharya. 508 pgs. 1982.. Religion.. Theology. Religion. Upanishhada Samuchchaya. 1929. Theology.. Vasudeva Lakshmana Sastri. Linguistics. 308 pgs. 1934. Literature. Chintaamand-inaa Ti Raa. Two Vajrayana Works. Linguistics. sanskritdocuments.. A. 256 pgs. Sanskrit. 1929. Damodhara Pand-d'itavara. Sanskrit....... Unknown.. Religion. Two Plays Of Bhasa. Und-aadi Suutraand-i Ditiiyo Bhaaga Grantha 7. 1941..m. 330 pgs. Sanskrit. Literature. K M Munshi. Upanishads.… 84/167 . Sanskrit. 238 pgs. 1923. Triddnimathvibhodhini. 544 pgs.

. Unknown. Vaikhanasa Gruhya Sutram vol 1. 766 pgs. 0. Philosophy. M M Pandit Deviprasada Ravichakravarti.. 200 pgs. Sanskrit. Gajaanana Shambhuputro. Vag Vallabha Of Sriduhkhabhanjanakavi. Unknown. 1941. Vaikhanasa . Sanskrit. Subramanyamu V. Unknown. Literature. Sanskrit.. 2001. Psychology. Sanskrit. Pandarinathacharya. 1949... Shriimadahobalasuuri. 1943.. Shaastri Shamaa. Vadavali. 1935.. Theology. 1981. 672 pgs.. Sanskrit.. 172 pgs. 1971.. 66 pgs. Religion Theology. Vidwan Satyadhyanacharya. 376 pgs... Srinivasamakhi Vedantadesika. Philosophy.. 1928. Utsarjano Pakarmapaddhatih. Vaishmavism. 1954. 1933. Sanskrit. 355 pgs.. Paridath Kalarama Shastri. Unknown.. 1912. Upanishhadratnaprakaasha Ratna Chhaandogyopanishhada~. 1925.. Religion.. 64 pgs. Vedas. 1932. Vaidhyachandrodaya Vol Ii.. sanskritdocuments.… 85/167 . 1949. Pandit Pannalal Jain. 142 pgs. Sanskrit. Sanskrit. Natural Sciences. 1997. Sanskrit. Unknown. Sanskrit. Theology... 210 pgs. Sanskrit. Sanskrit.. 1976. Sanskrit. Unknown. 1930. Sanskrit. Bhagva Dutt.. Unknown.2/14/2011 A list of scanned Sanskrit books at III… Upanishhadbhashhyama~ Dvitiya Bhaaga Dvitiya San'skarand-ama~. Vaidik Avem Vedottar Bharatiy Sanskruthi. Upasakadyayan. 106 pgs. Vaidik Vadgamya Ka Itihas Vol I I. Uttara Purana Of Acharya Gunabhadra. Sanskrit. Upanishhaddaakya Mahaakosha Prathama Khand-d'a. Religion. Vada Varidhi... 693 pgs. Sanskrit. Vaalmiikiiya Raamaayand-ama~ Baala Kand-d'ama~ Paqs-chimottarashaakhiiyama~.. 450 pgs. Vaakyaara~tharatnama~. Sanskrit. Unknown. Sanskrit.. 309 pgs.. Religion.. 375 pgs. Narayan Ram Acharya. Sanskrit. Urubhangam Breaking Of Thighs... 576 pgs. 296 pgs. Tirunoymozhi. Sanskrit. Sanskrit. 391 pgs. 348 pgs. 1945.. Sanskrit. Uttararamacharitra.org/…/SanskritIIIT. 411 pgs.. 1933. 1931.. Vaidika Padanukramakosa Vol 2 Part 1.. 1987. 44 pgs. Unknown. Vaiiyakarana Siddhant Laghumanjusha.. Sanskrit.. Vaikhamsa Gruhya Sutram vol Ii. W. Sanskrit. Vaaraahagrxhma Suutra Bhaaga Xviii. 408 pgs. Usaniruddha.. Sanskrit.caland. Philosophy. S Subramanya Sastri. Religion.. 1932. Vaidik Sahitya Ka Itihas. 1954. Unknown.. Sanskrit. Vaidyakiyasubhasitasahityam. Advaitam.. Vaijayanthi Kosa Volume Ii. Upanishhadratnaprakaasha Ratna Chhaandogyopanishhada~.. 1997. 420 pgs. Bhishkakavi Sri Rashachandra. Bhid'e Sadaashivashaastrii. Sri Somadev Suri. 444 pgs. Theology... Sanskrit.. 659 pgs. 1940... Vaajasaneyipraatishaakhyama~ Kaatyaayanaprand-itama~. Subramanyamu V. C R Devadhar.. Unknown. 1921. Srinivasamakhi Vedantadesika. Gruhya Sutras. Vaidik Sathya Prakasha. Visva Bhandu Sastri. Vadanakshatramala. Appayya Dikshita. Pandith Madhava Sastri Bhandari. 161 pgs... 1943. 516 pgs. Balakrishna Misra. Sanskrit.. Theology. Bhid'e Sadaashivashaastrii.... 1934.. Sanskrit.. Psychology. Sanskrit. Shriishan'karaachaara~ya. 639 pgs... 1940. Sanskrit. Vaalmiikii. 605 pgs.Srautasutram. Veng-kat'araamashara~maand-an... Unknown. Sanskrit. Psychology.. Dr Gaurishnakar Mishra. Unknown. Dr Ram Murthy Sharma. 541 pgs.

Vaiyakarana Siddhant Laghumanjusha. Vamanapurana. Sanskrit. Sri Nagesa Bhatta. Vaiyakarana Siddhanta Laghu Manjusha No 192. Sanskrit. Psychology. 1924. Unknown. Literature. 1924. 0.. Sri Ananta Sastri. Sri Achyuta Krishnananda Tirtha. sanskritdocuments.. Sanskrit. 102 pgs. Vaiyakarana Siddhanta Laghu Manjusha No 238. Unknown. Sanskrit. 508 pgs.. Vaishampaayana. Unknown. Sanskrit.... 190 pgs. 88 pgs. 326 pgs... Language. Sanskrit. Sri Nagesa Bhatta. venkatrao rayasam.. Vamana Suktam. Vaiyakarana Siddhanta Laghu Manjusha No 212. Philosophy. Sanskrit.. Pandith Sri Sitaram Sastri. Unknown. govindlal hargovind bhatta. 1929.. . Vaisakha Mahathyam.. 1927.. Sri Nagesa Bhatta.… V h h L Li i ti Lit t S k it 0 502 86/167 . Vaiyakarana Siddhanta Laghu Manjusha No 227. Unknown... Shriijat'aasin'hanandi. 110 pgs. 144 pgs. Unknown. 114 pgs. Literature. Unknown. Sanskrit. Sanskrit. 1993.. Vaiyakarana Siddhanth Laghumanjusha. 292 pgs.... Sanskrit. 110 pgs. Sanskrit. Pandari Krishnacharya. 1925. Sanskrit.. Pandith Madhava Shastri.2/14/2011 A list of scanned Sanskrit books at III… Vairagy Shatak. Vanamala... Sanskrit. Sanskrit. Sanskrit. Religion. Unknown. 1929. Vaisheshhika Dara~shana.. 1960. 1172 pgs. 0. Sanskrit. 1974.. Vanshabhaskar. 112 pgs. Language. Sanskrit. Krishna Singh ji.. Unknown. Vaiyakarana Siddhanta Laghu Manjusha No 214. 2002. 1961. 106 pgs. Literature.. 1929. 1938. Dr Dhanurdhara Jha.. 1928. Valmiki Ramayana Volume One. Sanskrit. Kand-ada Mahara~shhi.. Linguistics.. Vaiyakarana Siddhanta Laghu Manjusha No 253. Sri Nagesa Bhatta. Sanskrit. Unknown.. Vaiyakarana Siddhanta Laghu Manjusha No 211. 360 pgs. Linguistics. 314 pgs. Sri Nagesa Bhatta.. 104 pgs. 106 pgs. Sri Parameswardin Pandey. 104 pgs. Language. Unknown.... Vakrokti Jivita Of Raja Rathnakara. 1929.. 414 pgs. Vanamala A Commentatory On The Taittiriyopanishad Bhashya... 108 pgs. Varaang-gacharitama~ Prathama San'skarand-ama~. Sanskrit.. Vaisesikasutra Of Kanada. Pandith Sri Sitaram Sastri. The Arts.. Literature. Unknown. Sanskrit.... Vaiyakarana Siddhanta Laghu Manjusha No 228.. Linguistics. Sri Nagesa Bhatta. Vaiyakarana Siddhanta Laghu Manjusha No 191. 1961. Indian Logic. 1913. 104 pgs. The Arts. 354 pgs.. Unknown. Vaiyakarana Siddhanta Laghu Manjusha No 237. Vaiyakarana Siddhanta Laghumanjusha No 213. Sanskrit. Sanskrit. 1928. 106 pgs. Sanskrit.. Muni Sri Jambuvijayaji.. Sri Nagesa Bhatta. Sanskrit. 1913. Religion...org/…/SanskritIIIT. 96 pgs. 1984. Unknown. 1954. Sri Nagesa Bhatta. 1929. Vyakarnopadhyaya And Sahitya Tirthac. Sanskrit. .. Sanskrit. 0. Vaishampaayananiitiprakaashikaa. 227 pgs. Theology. 1925.. Vaiyakarana Siddhanta Laghu Manjusha No 328. Vakyartha Vivechanam. Literature. Unknown.. Unknown. Sri Achyuta Krishnananda Tirtha. 376 pgs. 0.. Unknown. Sanskrit.. 222 pgs... 186 pgs. 1953.. Sri Nagesa Bhatta.

1967. 292 pgs. Mishra B N.. Veda Pravachana.. Sanskrit. 193 pgs.2/14/2011 A list of scanned Sanskrit books at III… Varahamahapuranam. Linguistics. Religion. B. 249 pgs... Sanskrit. Pramodini Pandu. 1953. Unknown.. Namitha Garg.org/…/SanskritIIIT. Vedaantasutramukttaavali. A. Narayana A. Philosophy.. 92 pgs.. Philosophy. Vedas. Vedandak. 1948. Sanskrit. Sanskrit. Vedaanta Tattva Viveka. Sanskrit. Unknown. Sanskrit. Sanskrit. Religion.. 101 pgs. 130 pgs. R K Prapannacharya.. Dr... Vedantakaustubhaprabha Accn0 478. 2000. 236 pgs. Veda Samiksa. 81 pgs. Vararuchi Avam Hemachandra Virachitha Prakrutha Vakarna 2739. S S Suryanarayana Sastri.. Unknown.. Unknown. Shivasahaaya. Kaviraj Nagendra Nath Sen. 1838.. Sanskrit... Vararuchasangraha.. Sanskrit. Sanskrit.. Sanskrit. Literature. . 1955. Pandit Harilal Jain. 502 pgs. Sanskrit. 1973.venkatesacharya.srinivasaraghava Aiyangar.. Language. Ramananda Saraswati Swami... 425 pgs. Dr.. 2000. Sanskrit. 456 pgs. Unknown. Unknown. Aadhvrina~ Dhara~maraaja. Vedantanayabhushanam. Vedaanta Raamaayand-a Bhaashhaat'ikaa Sahita. Sanskrit. Ganga Prasad Upadhyay. Vasu Caritram. Sanskrit... 363 pgs. Vaydyak Sabdasindhu. Ganga Prasad Upadhyay. 1971. 1952.. 106 pgs. Geography. 237 pgs. Vedanta Sara Cintamani. 522 pgs. Vedanta. Unknown. Vaishmavism. 440 pgs.sree Krishna Sarma. Philosophy. Vararuchasanghrahar.. Sanskrit. History..n. Bhagavadraamaanujama.a. Unknown.. Philosophy.. Vedakhasarodhar. 0. 215 pgs. Psychology.. Unknown. Shri Brajnath Sharma. 1984... Sanskrit. Vedanta Sutramu Mdravali. Sanskrit.. Sanskrit. 413 pgs. 1976. 272 pgs..j... Sanskrit. Religion.. Psychology. 1915. 234 pgs. 2004. Unknown... Sri Yudishtara Mimansa... Unknown. Sanskrit. 1998.. 1872. 548 pgs. Varahi(bruhat) Samhita. Psychology. Sanskrit. Vasantatilakabhaand-a. 0. sanskritdocuments. 80 pgs..r. Sanskrit.… 87/167 . Sri Giridhar Sharma Chaturved. Unknown. Kaviraj Nagendra Nath Sen. Linguistics. 1986. Unknown. Vedanta Sutramu Mdravali. 190 pgs. Sanskrit. Language. Vedanta Darsana.. Sanskrit. Philosophy. 238 pgs.. Sanskrit. 1911.. Unknown. Vedanta Sutramu Mdravali. 62 pgs. Sociology. 1992. Unknown. Theology. 340 pgs. Sanskrit.. 1969. 1270 pgs. Vedanta Prakasa.n. Literature. Vatsaraaja Udayand-a... Sanskrit Samhitas. 82 pgs. Sanskrit. Narayana. Sarasvatii Bramhaananda. Vasunandi Shravakachara. 1986. 1984. 460 pgs. Baladeva Prasad. 1991. Vedakalija Narisiksha. Kaat'adare Maadhavakeshava.. 1942. Chenna Reddy.. . 0. 872 pgs. Vedaantaparibhaashaa. 1964.. Shriivaradaacharayaa.. 1951. Veda Bhasya Bhumika Samgraha. 1942. Shriinrxsin'hashrami.. Subramanya Sastri S. 1998. Sanskrit. 1986. Unknown. Psychology. Biography... 81 pgs.e. 504 pgs. Sanskrit.. Sanskrit.. Unknown...... Varivasya Rahasya Accn0 1281. Dr B Rama Raju.pandey... Vedaantasaara. Varahamihira Horasastram. Sanskrit. pgs. Vedanga Prkasa. Veda Praveshah.. 1965. Sanskrit.

Vedic Padhanukrama Kosah Vol 3 Part 2..r. Philosophy. Sanskrit. Somraj Krishna Das. 1942. Vedic Kosha. Brahmanadha Saraswathi. 1975.. 209 pgs. Krishnamurthysahastryvarya.2/14/2011 A list of scanned Sanskrit books at III… Vedantaparibhasa Accn0 583. 117 pgs. 1969. Sanskrit.... Sanskrit. Vede Ashvinau Asvins In The Vedas. Sanskrit. Sanskrit. 76 pgs. Literature.. 1969. 1955. Dr Kunwar Lal. Srimath Paramahamsa Parivrajakacharya. Vedhaththa Suthra Mukthavali. P Sambamoorthy. vishva bandhu.. Sanskrit. Language. Wasudev Laxman Sastri Pansikar. Unknown. Sanskrit. Literature. 1959. 0. Sanskrit. Unknown. Unknown. Vedic Padhanukram Kosah Vol 1. 1945. 1988. Veeramitrodaya. 55 pgs. 362 pgs. Vedharya Sangrahah Geetha Bashya Gadyayatra. Linguistics. Unknown. Vedic Padhanukrama Kosah Part 3. vishva bhandu. Unknown. Sanskrit. Sanskrit.. 1959.. 290 pgs. 366 pgs.. 1970. Sanskrit. Literature. 115 pgs.. Venkatachala Ithihasamala Anantarya. P Bhagaddatta amp Hamsaraj. Sanskrit. S N Srirama Desikan.. 1947. . 1964. visva bandhu sastri... Sanskrit. Sanskrit. Venkatadvari Tatrkuthinam Adhyayanam. Vishva Bhandu. Unknown. 1992. Vedic Padhanukrama Kosah Part 1. Vedic Padhanukrama Kosah Vol 5 Part 1. Sanskrit. Unknown. 644 pgs.. Krishnamurthysahastryvarya.. 1969. Vedanthasindantha Mukthavali.... Sanskrit. Vemanapadyamulu In Sanskrit Slokas. Vaman Bhattacharya. 1979. Sanskrit. Pandit Shada Shiv Sharma. 1958. 1867. Unknown. 1971.... Sanskrit... 666 pgs. Philosophy. Language.. Vetaalapanj-chavin'shati. 238 pgs. Visva Bandhu. Sanskrit.. Sanskrit.. Unknown. 1988... Vedic Hymns. S S Suryanarayana Sastri. Sanskrit. 846 pgs.. 2001. Linguistics. 390 pgs. 1945.. visva bandhuu sastri. Unknown.. Panchanana Bhattacharya Sastry. Unknown.. Jambhaladatta. 1962.krishnamurthy Shasthry. Unknown. G Swaminadhacharyulu.. Unknown. Sanskrit.. Vedastuti Volume Iii... 500 pgs. . 700 pgs. 260 pgs. Unknown. Vedantnamaratnasahasram. 998 pgs. Vedantha Paribashaa.. 338 pgs. 704 pgs. Vedic Padhanukrama Kosah Part 2. 1910.. Unknown. 1952. 1961. Prakasanamba. T.. Vedic Padhanukram Kosah..... 520 pgs. S. Venkateswari Thatkruthinam Adhyayanamu. Vedic Hymns.. Sanskrit.... 892 pgs.. vishva bhandu. Unknown.. Vemabhupala Charitram. Sanskrit. Veeramithrodaya.krishna Swamy Aiyar. Sanskrit. Srimithra Mishra. Sanskrit. 758 pgs. Pandit Mitra Misra. Sanskrit. vishva bandhu. Venkatasuris Nauka Charitram In Sanskrit. Visva Bandhu Sastri. 1864... Sanskrit. Sanskrit. Vamana Bhatta Bana. Sanskrit.k. 1939... Unknown.. Vedic Padhanukrama Kosah Vol 1 Part 2.. Philosophy. 1984. 1989... Vedhantha Paribhasha. Unknown. Unknown. Vedanthanamaratnasahasram... 258 pgs.. 150 pgs. Vema Bhupala Charitam.. Sanskrit. 806 pgs. 362 pgs. Vedavyasaparampara. Unknown. 292 pgs. 290 pgs.. Unknown. -.. 201 pgs. Sanskrit. 240 pgs.. Art. Dr G Swaminath Charyulu..… V t l P h Vi h tih S N Sh ti U k S k it 1949 66 88/167 . Sanskrit. Veershaivendru Shaker. Vedic Padhanukrama Kosah Vol 4.org/…/SanskritIIIT. 892 pgs. 500 pgs. 1998. sanskritdocuments. 1992. Vedardhasamgraha Geetha Bhashya. 261 pgs. Unknown. 1945.

.… 89/167 . Vidhyaamaadhaviiyama~ Trxtiiyasan'putama~ 11-15 Adhyaayaa.. 1987. -. Sanskrit.. 1867. Vimarshamruthamu. Sanskrit.. Unknown. shriramavathara sharma.. Sanskrit. Vidhi Rasyana. 677 pgs. Literature. Pandit Mukunda Shastri.org/…/SanskritIIIT. 1920.. Sanskrit..dalsukh Malvania.. Literature. Viira Vinaayaka. 1925. 124 pgs.. Jagannath Sastri Hosinga. 194 pgs. Sanskrit. Vibhaktyartha Nirnaya. Sanskrit. 1978... 110 pgs. Sanskrit.. Unknown. Literature. 156 pgs. Biography. 1954. Religion. Theology..... Vidhaanamaalaa Grantha 86.. Somraj Krishna Das. 290 pgs. Vishnu Prasad Sharma. 1997. Vikramora~vashii trot'akama~ Chatura~tha San'skarand-ama~.. Sanskrit. Vidagghamukhamand-d'anakavyama~... History. 1901. Vichara Ratnakara Kirtivijana. Sanskrit.. Sanskrit. Visesavasayakabhasya Part 1. Sanskrit. Sanskrit.. Sanskrit. Viramitrodaya Vol Xx. 168 pgs. Vimand-d'alavakravichaarah. Language. 202 pgs. 0. 172 pgs. .. Sanskrit. Nanuji Bhatt. Literature... Theology. Vidhyaamaadhava. 428 pgs.. Pandit Madhava Prasad Vyasa.. 419 pgs. Sanskrit.. 1901. Viramitrodaya Bhakti Prakasha Vol Xi.. Dalshuk Malvania. Unknown. Unknown. Unknown. Sanskrit. Giridhara Upadhy. Geography. Biography. Linguistics. Unknown. Vidhura Nithi. Swamy Vivekananda. 108 pgs. Sanskrit. Dr B R Shastry. 101 pgs. R Shama Sastry. S N Shastri.. Vibhaktyarthanirnaya Iii. Sri Paripurna Prakashnanda Bharathi Mahaswamin. Vishnu Dhrmoattara Puranam. Sanskrit.. Sanskrit. Vibhaktyarthanirnaya. Somraj Krishna Das.2/14/2011 A list of scanned Sanskrit books at III… Vetala Pancha Vimshatih. Virodha-varuthini. 1926. Sanskrit. 1966. History. 257 pgs. Vikramorvasiyam Of Kalidasa. Sri Giridhara Bhattacharya. Giridhara Upadhy. Unknown. Sanskrit. 334 pgs. Visheshik Darshan.. Vidyamadhaviyam Of Vidya Madhava. 1939. Sanskrit. Viramitrodaya Samaja Prakasha Vol X. 67 pgs. 106 pgs. Sri Giridhara Bhattacharya. 230 pgs. 0. .. Sanskrit. Vidhiviveka. Sanskrit. Sanskrit.. Unknown.. Shri Ram Sharma Acharya. 1986.. Vikrantabharatam. Pt. Unknown. 1987.. 1901... Unknown. Unknown.. 1901... Shriidhara~madaasasuuri. Unknown. Unknown... Religion. 170 pgs. Giridhara Upadhy. Sanskrit. Vibhaktyarthanirnaya V. R R Deshpande... 1923. Jyotira~vichchhridayaanaatha. Natural Sciences.. 240 pgs. Unknown.. 382 pgs. Shriikaalidasa~. 94 pgs. Vikramarkandeva Charitram. Geography. Deshapaan'd'e Ga Vi. Natural Sciences. 1952. 0. 1949. Bhat't'a Shriinrxsin'ha. Unknown. 1926.. 364 pgs. 58 pgs. V Venkataramana Reddy. 1966. Unknown. 0.. Visesavasyakabhasya With Srikotyaryavadiganis Vivarana Part Iii. 106 pgs.. 0. Unknown. 1986.. Vidura-niti.. Unknown.. 1916. Sanskrit. Sanskrit. 304 pgs.. Unknown... 66 pgs. Unknown. 1645. Sanskrit. Sanskrit. sanskritdocuments... 1901.. Vishnu Prasad Sharma. 400 pgs. Vishampadh Vakya Vritti.. Sanskrit. 0.. Sanskrit. . 151 pgs. Vishnupurana With 2 Commentry amp Tika Vishnucitta amp Sridhara... 106 pgs. 1964.. 330 pgs. Venkat Ramana Reddy. Sanskrit. Vishnu Prasad. 1948. Visakhadattas Mudraraksasa Edition I I. Unknown. Mahaprubhu Lal Goswami. Vibhaktyarthanirnaya Iv. 390 pgs. 123 pgs. V. Sanskrit.. Virodha Varuthini...

Pt. Religion. 304 pgs. Unknown. Sanskrit. Unknown. 336 pgs. Unknown. Vyavahara Nirnaya Of Varadaraja. Theology. 1942. Unknown. Pt. Ramasastri Bhagavthacharya.. 0. 1954. 1951. 284 pgs. 277 pgs. 645 pgs. Visuddhimaggo Prathama Bhaaga.. 1948. Theology. Vyasasidhanta Marthandam..krishnamacharya.. Srinivas Ayyangar. 1993. Literrature.. 1818. Sanskrit. 624 pgs. Vrittaratnakara Edition Vi. Sanskrit.... Vyakarana Koumudri. Language. Sanskrit. Unknown.. 0... Vizianagaram Sanskrit Series... 312 pgs.. . Religion. Sanskrit. Visvamitra Samhita.. 610 pgs. Vyakaran Siddhanta Kaumudi Balmanorama Pradhamabagamu.… 90/167 . Sanskrit. Viwahsopangvidhi.. 616 pgs. B V Narasimhacharya. Unknown. 668 pgs. 1954.. Linguistics.. Mahadev Chimanaji Apte. Natural Sciences. 146 pgs.. bhattoji dikshita. P Gopalachandra Vedanthashasri. 1934. Vividha tiira~thakalpa. Vyakaran Maha Bhasyam. Sanskrit. Sanskrit. Sri Ramachandra Kavi Bharati. Theology. 562 pgs. 1994. 168 pgs. 246 pgs. Sanskrit. 541 pgs. 240 pgs. 1983. Sanskrit... 0. 1948.k. Religion. Vivahapatlam Sarasamuchaya. V Rangaswami And Krishna. Sanskrit. sanskritdocuments. Visnuvilasa. 1969. Somraj Krishna Das. Mohamahapadyaya Kapisthalam Desikachariar. 909 pgs. Vyavahaaramayuukha.... 535 pgs. Visnudharmottara Mahapuranam. 1981. Sanskrit.. Pandit V. 166 pgs.. Unknown. 1943. Sanskrit.. Sanskrit. 1957. 1891.. Literature.. 837 pgs. 1926. Unknown. 81 pgs. Unknown.. Sanskrit. 1940. 1983....org/…/SanskritIIIT.. Vrataraja.. Vyutpattivada. 1964. 234 pgs. 1957.. Vyayasasidhanta Marthandam. 1935. Religion. Sri Rudradharajha. 1991.shiv Dutt Mishra.aryendra Sharma. 338 pgs. Swami Madhavananda.. 339 pgs. Philosophy. 430 pgs. 1942.. . Philosophy. Sri Giri Sharma Chathurved.. Sanskrit. Viveka Chudamani Of Sankaracharya. Sanskrit. 1914. Unknown. Vyakaranabhushanasara.shiv Dutt Mishra.narayana Pillai. P. Visnusmrti Ii. Vyutpattivada Of Gadadhara Bhattacarya.. Sanskrit.... Unknown. Sanskrit. Vyutpattivaadah Lakaaraara~thavichaarah. 506 pgs. Sanskrit. -.. Unknown. Vrttaratnavali. Sanskrit. Vyaakarand-amahaabhaashyama~ Tatraang-gaghikaara Da~vitiiyo Bhaaga. Vrttaratnakara. Sanskrit. Sanskrit. Sanskrit. Buddhaghosaachariya. 1988. Vishyanukramanika. Vyakarana Mahabhasyam Of Patanjali Muni. Sanskrit.. Somraj Krishna Das.. . ..2/14/2011 A list of scanned Sanskrit books at III… 1967.. Bhat't'aachaara~ya Gadaaghara. Religion. Visukipuranam. Sanskrit. Anant Ram Shastri. .. Psychology. 245 pgs. 115 pgs. Shriibhagavatpatan'jala. Literature.. Sanskrit.. Undemane Shankara Bhatta. 538 pgs.. Dr. 605 pgs. Sanskrit.. 228 pgs. Unknown.... sri vasudev dikshit. Veng-kat'araamashara~maa Ve.. Vritharatnakaram. Unknown... Vyakarana Siddhanta Kaumudi... 1929. 1921. Sanskrit.. Ganga Vishnu Sri Krishnadas. 362 pgs. Vyavahaaramaalaa. Acharya Madhusudhan Shastry. Eluu Eluu. Unknown. 865 pgs. Unknown.. 1929. Sanskrit.. Sanskrit. Psychology. Sanskrit. Unknown. Jinaprabhasuuri.

Yoga Chikista. Sanskrit. 176 pgs... 1904. Religion. Theology. Literature.k. Yatindramatadipika.. Sanskrit. Religion. 1945.... 136 pgs.. Sanskrit. 1981.. 1954. Sanskrit. Sanskrit. 2000. 186 pgs.. Sanskrit. 1868... Sahibji Maharaj Sir Anand Sarup.. . Sudarsanacharya. Sri Swami Sivanandh. Religion. .. Shriinivasadaasa. Philosophy... 266 pgs. Sanskrit. . -.. 0. 1949. Sanskrit. Yathiraja Vijaya Natakam. 1864. Yoga Karnika. 132 pgs. Pandit A.. 152 pgs... Philosophy-22. Unknown. .t. Yekankastakamu. 548 pgs. Philosophy.. 1930.. 246 pgs. Yayathi Aakhyaan. Yekankavalih. Theology.. 0. Yadavabhyudayam Sargas I To I V. Aapat'e Vinayaka Gand-esha. 89 pgs. Umesh Chandra Pandey. Yajura~vediiya Maitraayand-ii San'hita. Language. Religion. Sanskrit.. . Damodar Bhattasununa. 746 pgs. Sanskrit..chinnaswami Sastri... Yajnavalkyasmrti.. Unknown. Yajna Valky Smtuthi. Sanskrit... Yagavasista Vuthu Paryay Prakasika Part 3. 1934.. Sanskrit. Maiva Ram Kattara Padka. 162 pgs. Unknown. 1998. Sanskrit. Mukunda Sharma.. Yogachintamani Ki Anukramanika. 1950.. 748 pgs.... 1164 pgs. 0. Yashodhara Mahakavyam. Theology. Parashuram Shastri.. Philosophy. 331 pgs. .. 1953... 2000. 183 pgs. 600 pgs. Narendra Nath Sharma. 0. 196 pgs. Philosophy. Sanskrit. .. Yajura~veda San'hitaa Dditiiya Vaaran.. Yatidhara~masan'grah Grantha 60. 258 pgs. 1951. 1977. Yoga Vedanta Dictionary. 124 pgs. Yajnavaikya Smrti. Philosophy. Sanskrit. 506 pgs. 360 pgs. Psychology. Unknown.org/…/SanskritIIIT.v.. 439 pgs. Sanskrit. Yathara Prakasa Part 1. 0. Sanskrit.. . sanskritdocuments. Sanskrit. 2003. Sanskrit. 508 pgs.. Yagavasista Vuthu Paryay Prakasika Part 4.o. 1980. Taitriya Samhita. . Sripad Damodar Saatvalekar. Yajhu Shakiyasanthikanda Pradeepa. Yajura~vediiya Kaat'haka San'hitaa.. Parikshit Sharma. 635 pgs.. 0. . 0.. Yajurvedha Maithrayani Samhitha.... Yagavasista Vuthu Paryay Prakasika Part 2. 1927. Sanskrit. Unknown. Dhamodar. 598 pgs. Philosophy. 1976. Sanskrit. Sanskrit. Theology. Sanskrit.. . Yekanki Saptakam. 196 pgs. Acharaya Ram Kishore Misra. 1953. 204 pgs. Yajurvedasanhita Vol Iv. Srinivasadasa. Religion. Yatiindramatadiipikaa. 119 pgs. 1953.. Unknown.. 0. Sanskrit. Philosophy.. 162 pgs. Yaanj-avalkya Smrxti Granth 46. Sanskrit.. Philosophy. Sanskrit. 1956. Sanskrit. 202 pgs. Kesava Rao Sarma. 1936. 251 pgs. Appayya Dikshita. Philosophy. Philosophy. Narayana Shastri Khiste. . Theology. Sanskrit. Sanskrit... 0.. Linguistics. Sanskrit.. Saan'tavalekara.. Yajna Tattva Prakasa. Wasudev Laxman Sastri Paniskar. Yagavasista Vuthu Paryay Prakasika Part 1. Unknown. Yatinder Matdipika... Literature. Sanskrit. Bhat't'a Daamodara.… 91/167 .. 716 pgs.2/14/2011 A list of scanned Sanskrit books at III… Word Index To Taittriya Samhita. Saatavalekara~ vi esa~. Sanskrit. 529 pgs.. Unknown. Paraaditya.. Yajurvediya Kataka Samhita. Yadnyavalkyasmriti Of Yogishvara Yadnyavalkya Fourth Edition. Sanskrit. Sanskrit.. Girish Chandra Sharma. 1924. 101 pgs... Unknown. Unknown.

. Literature. 1950. yamunaachaarya svaami. Sanskrit.. 526 pgs. 1908. Ganga Vishanu Sri Krishana Dasini. Linguistics. appayyadiikshita. Sanskrit. 142 pgs. Language. Yogi Nihrdayam. 1964.… 92/167 . Linguistics..2/14/2011 A list of scanned Sanskrit books at III… Yogavashishtahah Panchama Bhaga. 1912. aadaitabrahmasid'i. Language. Social Sciences. 1979. 1987.. 1979.. Linguistics. gurucharana. Not available. 1970. Language. Language. Language. Sanskrit.. Yogavasishtu Dwithiya Bagamu. Literature. Sanskrit. Unknown. 408 pgs. a sanskrit reader. aanandaashramasn'skrxtagranthaavali gran'nthaang-ka 70. 0.. 740 pgs. 1909. 1932. Sanskrit. Sanskrit. Sanskrit.. 1067 pgs.. Language. charles rockwell lanman... 1932....m. Sanskrit.. 40 pgs. Sanskrit. Linguistics. Sanskrit. 1929.. 370 pgs. Shri Krishna Patna Shasthri. Philosophy. 346 pgs.org/…/SanskritIIIT. aagniveshyagrxhyasuutramn.. sanskritdocuments. Literature. Kesav Srinivasulachari Kati. pandit sarada prasad bidyabhushan. aagamarahasyamu vaatulashuddhaaravyamu.m. Philosophy. 0. Sanskrit.. 172 pgs. 220 pgs. Literature. 906 pgs. Vasu Deva. Theology. Unknown. LITERATURE. Art. a sanskrit primer. Language. Sanskrit. khemraj sri krishna das.. 392 pgs. miimaan'sakashriiniilakan't'habhat't'a. LINGUISTICS. Yukthi Mallika Guna Saurabham. L. Aathrideva Vidhyalanker. Language.. aadunika san'skrxta naat'aka nae tathya nayaa itihaasa bhaaga 1. Shriibhoja Mahaaraaja~. Ravi Varma.. Religion. p.. Sanskrit.. Unknown. Yougachikithsa Indication Of Drugs. Sri Pahvadatthareya Sastri. Literature.. Sanskrit. 576 pgs. Yuddhakandam Part Ii. Theology. Sanskrit. Linguistics. edward delavan perry. aabhaarapradashainamu. 1915. Pandit Dinanad. Language.2. 440 pgs. Linguistics. a sanskrit composition and translation manual. Sanskrit. aanandamaalaa.. Sanskrit... aachaarendu. Literature. 1888.. Pandit Navya Chandidasa.padmanaabha. Social Sciences. 1917.. Linguistics. Sanskrit.. Sri Krishnupanthshakina. Gandhi. Yudhishthira Vijaya. 0... 319 pgs. 1614 pgs.k. raamajii upaadhyaaya... Bhagavadgita.. Language. 352 pgs. 248 pgs. shriidharaachaarya. Linguistics. 1937. Sanskrit.. Literature. Gopinatha Kaviraja. Sanskrit. Literature. Philosophy. 183 pgs.m. Language.. 288 pgs. 1943. Literature. 456 pgs. 0. Sanskrit. 1983. 1953. 854 pgs.a.. 105 pgs. Sanskrit. 268 pgs. Unknown. Yogavasista Vol 1. Unknown.. Sri Madra Namikmaharshi. Yogini Jatakam. 244 pgs.. Sanskrit. Linguistics. Sanskrit. 321 pgs.. Linguistics. Unknown. Linguistics. Literature. bhat't'aachaaryend-a vidhushekharend-a. Language. Philosophy. Language.. aachaaramayuukha dvitiiya. Sanskrit. 100 pgs.. 1089 pgs. Bannanje Govindacharya. 1500. aanan'dalahari No. Yogavasisht Bhasha.. Sanskrit.. Literature.. Religion. Youginithantr..... 1961.. Yukttikalpataru. Linguistics. ... Jaggu Venkatachari. Sanskrit.. Literature. 0. a consolidated glossary of technical terms. aahnikapaddhati. 0. Sanskrit.. 0.. aagamapraamaand-yamu.. LANGUAGE. 172 pgs. Linguistics. Sanskrit.. 1940. aagamashaastramu gaud'apaadiiyamu. Sanskrit. 0... 98 pgs. aadipuraanama. Literature.

Brahmasri Subrahmanya Suri.. 742 pgs. Sanskrit. aasechanakaraamaayand-amu. Sanskrit. 177 pgs. aaryemanju qs-imulakalpa prathamoo bhaaga. 1953. 307 pgs. Linguistics.. 0. Linguistics. 1932. d srinivaasaacharya. Sanskrit. Unknown. Sanskrit. 370 pgs. Science.. Linguistics. Language. Pandith Sri Seetharam Bhakruth. aapastambadharmasuutramanj-jarii. 1930. Ganapathi Sastri. 513 pgs. 278 pgs... 308 pgs. Sanskrit.. Sanskrit.. aashvalaayanagrxhyasuutran' shriiharadattamishravirachita anaavilaakhyayaa vrxttyaa sametn. Narasimhachar. Language.. 130 pgs. 1931. aangiirasasmrxtii. Literature. Linguistics. Literature. Srinivasachar.. not availabe. Sri Bhavani Shankara Sharma. T..viswanatha Sarma. Sanskrit. Linguistics.. 472 pgs.org/…/SanskritIIIT. aashvalaayanagrxhyasuutran. 233 pgs. Literature.. -. n. Linguistics.. Language. Linguistics. Science. Language. Sri Ganapathi Sastri. Sanskrit.. 0. Literature... Sanskrit. suryanarayana. S.2/14/2011 A list of scanned Sanskrit books at III… aanandamathaadhikarand-amaaramya pradhaman' paadan.. Language.… aatma kathaa prathama khand-d'a mahaatmaa gaan'dhii General Sanskrit 0 421 pgs 93/167 . 1931. Literature. 1940. Religion.. Linguistics. aapastambadharmasuutramanj-jarii. Sanskrit. Dr.. T. Ganapathi Sastri. 1970. aapastambadharmasuutramu... Language. Linguistics. Literature. not availabe. Literature. Sanskrit. Theology. Linguistics.. Linguistics. 814 pgs. aashvalaayaniiyaguhaasutraand-aa suchiipatramu.. 122 pgs.. r. 90 pgs. 1922. Language. D. aaryemanju qs-imulakalpa tuutiyo bhaaga. Religion. Literature. Linguistics. Sanskrit. 1924. Sanskrit. 402 pgs. n.. a n krishna aiyangar... aaryaividhaasudhaakaran. Yasneswara cimana Bhatta. Language. Language. Language.. Ganapathi Sastri. .. Literature. 236 pgs.. 1893. Sanskrit. 1933. Linguistics. aanandananandinii. Language. aapastambiiya dharmasuutramu. Sri Ganapathi Sastri.. 314 pgs. Sanskrit. 130 pgs. 1933. aapastambasulbasuutran' kapaaradibhaashhyend-a karavindi sundararajavyaakhyaabhyan' cha sahitan. Sanskrit. 0. aapastambiiyam' shraotasuutram..mlampalli Chandra Sekhar Sarma. Literature. aapastambhagrihyasuutra anakula tatparyadarshana. Theology. Sanskrit. Sanskrit. . Linguistics. Literature. Linguistics.. aapastambashulbasuutramu. 270 pgs. 1923. Literature..... Sanskrit. Sanskrit.. 216 pgs. r.. Sanskrit. aapastambiiya dharmasuutramu. sanskritdocuments. Literature. 1944. 1909. 1951. Religion.. Language. 318 pgs. 0. Sanskrit.. 196 pgs. aatakam. Psychology. Philosophy. e.. shriimanmuraarimishra. Language. Sanskrit. haradatta mishra.. aaryemanju qs-imulakalpa ddhitiiya bhaaga. Sanskrit.. mahaadevashaastri. Language. aaryabhadt'iiyam'of Aryabhattacarya Part 1 gaanitapaada... Bhattacharya. 340 pgs. aang-agatvanirukti naama prabandha etatpustakan. kapardisvaami. T. Sanskrit.. aatha sankhya darshana bhashanuvaada. 1970. Language. .. aarogyachintaamand-ii. Literature.. 0. Language. 228 pgs. 76 pgs. 373 pgs. 1928. Literature.. Literature. Linguistics. 340 pgs. 1898.. Natural Sciences. Sanskrit. suryanarayana. 1920.. aapastambaparibhaashaasuutramuu. 1973.

336 pgs. 1972. Sanskrit. bhagavatiprasaada vaajapeiyi. Linguistics. Literature... Sanskrit. LITERATURE. Language.. Linguistics. Language. Literature. abhijnaashaakuntala. Sanskrit. Language. abhinava chandrikaayaamu. 42 pgs. aatmatattva vivekaa. 440 pgs. sanskritdocuments.. Literature. 1926.. Sri Natesh. 242 pgs. Psychology. 1957. Sanskrit..... 1948. 1925.. 385 pgs.. kalidasa. Sanskrit.. Literature. Linguistics. Psychology. 829 pgs... 1916... mukula bhatta.. Sharma Sastri. Not available.org/…/SanskritIIIT.. 498 pgs. addvatatarand-i. Sanskrit. shrii kaasinaatha dviveidi. 268 pgs. 1973. 1973. Literature. LINGUISTICS. Literature. mahaatmaa gaan dhii. 1974. soomeishvara deva. General. Philosophy. adbud vijay. 174 pgs. 216 pgs. LINGUISTICS. Sanskrit.. Language. Sanskrit. Sanskrit. Literature. abhijnana sakuntalam of kalidasa. 288 pgs.. 1926. 1875.… adhikarand asaaraavali shriivand shat'hakopashriilaqs 94/167 . 0. Lakshmidhar. aatmoduugaara. pandit shri bellakonda ramaraya kavindra. 276 pgs...2/14/2011 A list of scanned Sanskrit books at III… aatma kathaa prathama khand d a. Religion. Sanskrit. Sri Udayana. abhidhaavrittimaatrika shabdavyaapaara vichaara.. Language. vaidha yaadavaji trikamaji aachaaryai. 92 pgs. Literature. addvatamaatend-d'a. 1895. Religion.. LITERATURE. Linguistics. Literature.. Literature. abhilashhitaartaaryaichintaamand-in. Linguistics. vendaachanalaala. Language. ma shri deshapaan'd'e.. Rajasekhara. addvataamakaranda.. 1926. 136 pgs.. abhaavavimarsha. Literature. Sanskrit. Sanskrit. Sanskrit.. 428 pgs. Linguistics. Language. 161 pgs.. Sanskrit. Literature. 1942. Psychology. aavyamimaan'saa. abhiraajasahastrakamu. Sanskrit. 296 pgs.. LANGUAGE. 238 pgs. 1926. Sanskrit. Murari Mishra. ad'agatvanirukitan.. ramanath jha.. LANGUAGE.. LINGUISTICS. 154 pgs. Linguistics... R.. Language. 0. abhinava vikrutivignaana. 1944. Literature. Sanskrit. adhikarand-asaaraalalin. 1969. 131 pgs. Satya Nidhi Theertha. ven'kat'a subramand-ya shaastri...... aayurveidamahoodadhau annapaanavidhi. 440 pgs. Sanskrit. 561 pgs.. pan' ramaakaanta jhaa. abhilaashhitaarthachintaamand-i prathamabhaaga aadita trxtiiyaprakarand-antamu. Psychology. LANGUAGE. shriigovadhainaachayai. abhilashhitaayrachintaamand-i. Language. 1926. Philosophy. 438 pgs. abhilekhamaalaa vishvavidhyaalayapariqs-aanirdhaarita abhilekhasan'graha raama hindiivyaakhyopetaa. 421 pgs. Theology. Sanskrit. 158 pgs. 62 pgs.. adhikaara kaa prashna. Triveni Kavi. achala meraa koii. Religion. diipikaa ghosha. Sanskrit. 2000. 100 pgs. 1934. aatmatattvaviveka...... 0. Sanskrit. Language. 0. Unknown. someshvaradeva. Sanskrit. Linguistics. 142 pgs. virachitayaa. Technology. Sanskrit. Technology. Theology. srimad vedaanta desikulu. Sri Ananta Krishna Sastri. Sanskrit.... Sanskrit. aayaisaptashati. Philosophy. Sanskrit. Literature.. Philosophy. 1984.. abhinava san'skrta pravesha. Linguistics.. Sanskrit. General. 1950. Sanskrit. Kumaravedantacharya. abhinana shakuntalam. 1630. 72 pgs. LITERATURE. Linguistics. 0... adhikaarand-a saaraaval'i. Linguistics. Sanskrit. 1926.. Language.

491 pgs. 44 pgs. 386 pgs. Sri Ganapathy Sastri. Language. Religion. advatamajjarii nyaayaraqs-aamand-in. sanskritdocuments.. Language. Theology. adhyaatmakalpadruma adhirohand-iit'ippand-isahita. Mahamahopadyaya Hariprasad Sastri. Literature. 1939. Language. Sanskrit.. Linguistics..2/14/2011 A list of scanned Sanskrit books at III… adhikarand-asaaraavali.. 0. Literature. Religion. Language. 118 pgs. Sanskrit.. advaita siddi Vol. 1960. Pandit Anantha Krishna Sastri.. 445 pgs. 524 pgs. shriimunisundarasuuri. advaitibhraan'tiprakaasha.. advaitamanj-jarii brahmavidhyaabharand-amu. Not available. 660 pgs. Philosophy. Theology.. Linguistics. Literature. Psychology.. 252 pgs. Language. Language. advaitasiddhi. Literature. Linguistics. Ganapathi Sastry. Language. Chintamani. advaitaaqs-aramaalikaa. advaitasabhaasuvarnd-amahotsave.. Sanskrit. guruchandriikaa. 1940. advatatatvasudhaa prathamoo bhaaga. 1905. 0.. Linguistics.. Literature. 0. Psychology. 1915. Not available.. adhyaatmapat'alamam.. Sanskrit. Art. Psychology. advaitaamoda.. 678 pgs. shiromand-ishriimadhusuudanasarasvatii. 617 pgs. Language. advaitasiddhi guruchanddrikaasavyakhyaayasamalang-krxtaa dvitiiyasamput'amu.. Sanskrit. Literature.. advatacsiddddhaantagurucchandrikaa. 0.. Philosophy. Literature. Not available. Literature. Sanskrit.. Not available. Literature.. advatadipikaa dhvitiyo bhaagan. adhyaatmaraamaayand-amu. Theology. Not available.… agamakoshaa dvadasho bhaagan S k ramachandra Rao History Sanskrit 1994 402 pgs 95/167 . 1997. Linguistics. Literature. 1960. Sanskrit. Sanskrit. 0.. 882 pgs. 204 pgs. Not available. Linguistics.. Philosophy. advatatatvasudhaa prathamoo bhaaga. 78 pgs. Sanskrit. 1987. shriinivaasaachaari. vaasudevashaastrii. Narayanasrama. 1893. 120 pgs. Social Sciences.. Language. Not available. I. Sanskrit. Linguistics. 1935. shriivand-shat hakopashriilaqsmiinrxsin'vashat'hakopayatiindramahaadeshikaa. 1969. Sanskrit. Sanskrit..org/…/SanskritIIIT. advaitaanyamatakhand-d'anamu.. 487 pgs.. 250 pgs. Not available.. Literature. 1933. advatatatvasudhaa dvitiiya bhaaga. advaitibhraan'tiprakaasha. Not available. Linguistics. advaitasiddhi mithyatvamithyaatvaanto bhaaga.. Religion. d'i. advaitadiipikaa dvitiiyobhaaga... Literature. 120 pgs. 1984. 1928.. adhvaramiimaan'saa kutuuhalavrxtti. Linguistics. 1915. shriimatparamahan'samadhusuudanasarasvatii. 362 pgs.. Narasimha Sarma. 302 pgs.. adhikarand-asaraavali. Sanskrit. Literature. advayavajrasan'graha. Sanskrit. Language.. 77 pgs. 195 pgs. advatasiddhaantasaarasam'grah.. 92 pgs. Linguistics. Religion. d'aa bii gopaalared'd'ii. 92 pgs. sri Paramahamsa perivrajaka Chandrikacharya. Sanskrit. Sanskrit. Language. 1962. Sanskrit.. Sanskrit. 1927.. 373 pgs.. Sanskrit.. advaitasiddhi trxtiiyaasamput'amu. Sanskrit.... Literature. Sanskrit. Narayana Sharma. Theology... Linguistics.. 396 pgs.. Sanskrit. 0. Language. 0. 1937.. vidvan s narayanaswami shastri. Literature. Sanskrit. 1946. 891 pgs. Language. Language. Literature. Linguistics.... Linguistics.. 99 pgs.. 0. Sanskrit. Language. Sanskrit.. Sanskrit. Linguistics.. 842 pgs. Religion.. advatadipikaa. Sanskrit. Literature. Linguistics. 0.. Language. Linguistics. Literature. advatadipikaa tutiiyo bhaagan. Sanskrit.

Sanskrit.aar. alang-kaaramand-ihaara chaturtho bhaaga.. Sanskrit. aitareyabraahmand-amam. Theology.. Language.. Language.. Linguistics.. anang-garang-ga kaamakalaa hindiivyaa gopaniiyama.. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… agamakoshaa dvadasho bhaagan. Language. 0. LITERATURE.. Literature. Sanskrit. LANGUAGE. LITERATURE. r. Literature.k. alang-kaaramand-ihaara prathamo bhaaga. 1956. 750 pgs. 1967. ajit' gaamaa Vol. Religion. Language. vaamana shaastri. Sanskrit. LINGUISTICS.. ananthabharathi. 1958. Baba Sastri Padake. amarakoshhan. Literature. Sanskrit. 1898. Sanskrit.. Literature. Literature. Linguistics.. Sanskrit.. jiivana.. an'bigara chaud'ayyana vachanagal'u.ii. shriikrxshhnd-abrahmatantraparakaalasan'yamiindrai.. Not available. Linguistics. Sanskrit. 1923. 0. Linguistics. agnipuraand-amu vedikaa. 505 pgs. 100 pgs. Not available. 1968. Sanskrit.. 139 pgs.. 226 pgs.. 1973.. Sanskrit. Language. agnihotrachandrikaa vaamana shaastri krxtaa. Language. Linguistics. vinaayaka gand-esha aapat'e.. Language. Literature. Literature.. Sanskrit. Sanskrit.a. LINGUISTICS. mahaakavikalyaand-amalla... dr. 321 pgs. amrxtavaand-i.. Sanskrit. 1994.. anargharaaghavamuu. Language. Literature... aitareyaarand-yakan. bhat't'a. History. Literature. Language. 222 pgs. Linguistics.. shiivadatta. banerji projesh. 386 pgs. 1906. ambikaalaapa umaalaapa. sanskritdocuments. Linguistics... Sanskrit. LINGUISTICS. pro laqs-mand-adata gautama. Linguistics. Language.. d'urghaprasaada.… 96/167 . Language. Sanskrit. Literature.. alang-kaaramand-ihaara dvitiiyobhaaga. History. Literature. Sanskrit. 1917... Acharya Satyavrata Samasrami. Haragovinda Sastri. LITERATURE. 1921. Language. 230 pgs. an'cdhaa yuga samiiqs-a. agniveshyagruhaasutre. LANGUAGE. aitareiya brahmanama. Sanskrit.. 402 pgs... 732 pgs. parakaalasan'yamiindrai. 1921.. en' .. yashapaala. shriikrxshhnd-abrahmatantraparakaalasan'yamindai. 884 pgs.. Literature. Literature. Linguistics. Literature. 1937. Sanskrit. aitareyabraahmand-a. aitareyabraahmand-a. The Arts.. Not available. Linguistics. amarkosh. Sanskrit. Sanskrit. Sanskrit. Linguistics. Vishvanatha Balakrishna Sastri. 358 pgs. shriikrxshhnd-abrahmatantraparakaalasan'yamindai. Sanskrit.. 30 pgs. Language. 39 pgs.. not available. Literature. yan. Language. S. Linguistics. Linguistics.. 874 pgs. Language.. aitareyaalochanan. agnihotrachandrikaa. 1929. ananthakrishna sharma.. 1942.. Linguistics.. 1968. 306 pgs. 443 pgs. amitaa. Language.. 1937. Sanskrit. Literature. Sri Mathsayana Aacharya. 550 pgs. Linguistics.. Literature. 1977.. Literature. 236 pgs. 1898..ramachandra Rao.. L. Sanskrit. 302 pgs. Language. Literature. 1944. alang-kaaramand-ihaara trxtiiyobhaaga. 312 pgs. Linguistics. 0. Linguistics. 104 pgs... 1957.org/…/SanskritIIIT. aln'kaarakaustubhamuu.. Sanskrit. Language. LANGUAGE.. Religion. akalanka grandhatrayamu. Literature. 0.ravi Varma. 54 pgs. Jinvijaya Muni. 238 pgs.. Sanskrit. 1916. Maharshi Vedavyas. Sanskrit. 512 pgs. 1940. Linguistics. 1921. 540 pgs.

432 pgs. Linguistics. Language. Language. 320 pgs.... Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… 399 pgs. 0. 1998.. shriimadvidhyaarand-ayasvaami. 400 pgs. Not available. 252 pgs. 258 pgs. 871 pgs. Sanskrit. 145 pgs. Literature.... Religion.. Linguistics... 1990. Literature. H. asatmatattvodhyotaprakarand-amu. 274 pgs. 1964. george buhler dr... Sanskrit. Religion.. 1950. 142 pgs. Linguistics. Philosophy. 194 pgs.. Theology. 1925. Language. raajya jyootishhi pan' devaraaja jii. 448 pgs.. 1921. Linguistics. apastamba s aphorisms. ashht'adashapuraand-aparichayan. 2002.. Sanskrit... arya san'graha. Religion.. 1912.. Theology. Sanskrit. Sri Laugakshibhaskara. 143 pgs. 1980. anekartha sangraha. shri laugakshi bhaskara.. Sanskrit. ashht'aadashasmrxtaya ang-gira aadi 18 smrxtiyon' kaa san'graha. Sanskrit.. Not available... Literature.. 1932. Sanskrit. Linguistics. Sanskrit. Literature. Literature. ashht'adhyaayii bhaashhya pradamaavuti.. Language.. 1951. 291 pgs. charu deva shastry. . 224 pgs. Athridev Gupta. Sanskrit. ashht'aaadashapuraand-aparichaya pauraand-ikaprabhaaparishiilanamu.malledevaru. Sanskrit. 1932. Sanskrit. Language... ashht'adashapuraand-a darpaind-a.. Sri Ganapathy Sastri. 0.... Literature. General. 138 pgs. Language. Unknown. asalii tejii mandii sat't'aa. Linguistics.. Psychology. Religion. suryanarayana shastri.. Theology.. 0. Linguistics. 1985. Sanskrit. d'aa shriikrxshhnd-amanditripaat'hii. anubhaashya baalaboodinii bhaaga 2. Literature.. acharya hema chandra. Literature. Religion. Sanskrit. ar^thashaastram' Part Iii. vaachaspatii upaadyaaya. Literature. 82 pgs. pandit r v krishnamaachaarya. Sanskrit. anuvaad kala. Language. 1955. apastambagrxhyasuutran. Sanskrit. Language. varnasi ramamurty renu.. 0. Social Sciences. Sanskrit. 292 pgs. Sri Vidyaranya. andhra baghvath parimal. Lakshminarayana. andhradesiahasyakatha... 1926. 346 pgs. 182 pgs. Sanskrit.. 672 pgs. 789 pgs.. 1985. shriimadvallabhaachaarya. 88 pgs. Literature. Sanskrit. Not available. Athridev Gupta.. Linguistics. Sanskrit.. Chinnaswami Sastri. Sri Krishna Tripati. Linguistics.… 97/167 . ashht'aad'asagrand'aha. shriimadvaagbhat't'a. Yudishtar Mimamasat.org/…/SanskritIIIT. Language.. 139 pgs. arpand-a patrikaa. Sanskrit. 1915. Sanskrit. Literature. ashht'adashashmutuyahan. Ramaswami Aiyar... Philosophy.. Sanskrit. Literature. archaavaatara vaibhavam.p. Religion. Theology. aramelakalanidi. 459 pgs. 504 pgs. 258 pgs... and-ubhaashhyamu. A.. H P Malledevaru. arthasamgraha. Sanskrit. 438 pgs. anubhuutiprakaasha. Language. Sanskrit. ar^thasan'graha. Sanskrit. 0. 1929. 1964. 254 pgs.. Religion.. Sanskrit. Not available. 1928. aparoqs-aanubhuuti savyaaravyaa. Linguistics.. 92 pgs.. Sanskrit... Sanskrit. 0. anubhuutiprakaasha. Theology. 1935. Religion.. 1983. sanskritdocuments. Theology. Religion. ashht'aan'gatddadayamu suutra shariira nidaana chikitsaa kalpa uttarasthaanavibhaktamu. 1844. Literature.. 1931. 312 pgs. Linguistics. Literature. Religion. Sanskrit. Psychology. anyottayullaasan.. Language. . ashht'aadashapuraand-a darpand-a.

621 pgs. asvaalayaana gruhama suutramu.. . Literature. Sanskrit. vagbhatta. Acharya Sri Pandith Laxmanlal. Treble. atakam. 0. Somraj Krishna Das. Religion.. 1983. Sanskrit.. Literature. Sanskrit.. Ramalingam. 0. Treble... 0. Ramachandra Savath. Literature. atha shriikaalalokprakaasho ashht'avishatitaman. Language. Religion. kaviraj shrii athrii dhev guru. 1962. Theology. Treble. Sanskrit. 267 pgs. Linguistics. Somraj Krishna Das.. 1936. atha pramaand-apudvatan.a.. Sanskrit. atha maanasasaqs-aipaddatii. 156 pgs. 0. Linguistics.. 342 pgs. 1929. Linguistics.g. Literature. Sanskrit. Theology. 1917. Language.a... 512 pgs. Sanskrit. atha shraamadbhagavataan't'oppand-ii man'danan'diniisaptaman' sn'kadhan. 558 pgs. 474 pgs. Sanskrit. 0.. Somraj Krishna Das. Savanur. Sanskrit..org/…/SanskritIIIT. Literature. atha haayanarantapurvaihai.. . . 1950. 0.. Sanskrit.. Religion. 348 pgs. 213 pgs. 0. 196 pgs.a. -.. 0. Unknown. . Sanskrit. 1858. . Linguistics. .... Language.. . Literature. Somraj Krishna Das. 338 pgs. atha gurubhavaprakaashikaa rukminishaa vijayamu... 1968. 1867. asvasastram.2/14/2011 A list of scanned Sanskrit books at III… ashht'apraasashatakatrayamu. 638 pgs. 258 pgs.m. Sanskrit. . dr p srinivaasarao. atha jaatakaabharand-an' praarabyate.. 1146 pgs. 0. not available. atha bruhjjyaatishhaand-aivaishhashht'omishhrasakandhochakaavalisan'grahaa. 1892. .. Not Available. 195 pgs. Literature.. atha kiiraanya keshoyammatrasamhitaa. atha kaasi khandaa dhvitiyo bhaagan. Linguistics.r.. Literature. atha govidrchanaa chandrikaa.. Linguistics. Sanskrit. ashtajai bhashya pradamavruti.. Literature. 1867. 1929. Linguistics.. Sri G Ramaswami Sastrigal. Sanskrit. Sri Krishna Das. 602 pgs.. atha shriibhaavataat'appand-ii satyadhamayan'tikrutaadvadaso kandhan. Sanskrit. H.... Sanskrit. Language.. Sanskrit.. 800 pgs. Literature.. Language. Sanskrit.. Theology... atha krumaimahaapurand-an. 177 pgs. 466 pgs. Sanskrit. . ..... 810 pgs. Language.. 311 pgs. Language. H. . Religion. Religion.. 254 pgs.. atha dugaipaasanaakalpadgumaavishhayaanukramand-ikaa. . Sanskrit. . atha pradhamaadi chaturdaishaadhyaayaanaan. Literature.. Sanskrit. Sanskrit. Literature. astaangahridaya.. Sanskrit. 379 pgs. atha shriibhaavataat'appand-ii satyadhamayan'tikrutaa. atha shriikaashakhid'an' puvaathai.. 278 pgs. Sanskrit. vaagbhata.. Sanskrit. 974 pgs. Linguistics. Sanskrit. Sanskrit. 0. not Available. sanskritdocuments. atha shikqs-aadiveidaang-gachatushhuta praaran'bha.. Sanskrit. atha saamaanyakakqs-and-aa prakarand-amu. 95 pgs. atha pradhamamudrand-akaalikiiprastaavanikaa.. 1939. 0. . Theology. 1929. Somraj Krishna Das. Sanskrit. 0.. Theology. . ashtangahridaya. H. 279 pgs... atha shraamadbhagavataan't'oppand-ii chet'tityaakhyaa. Sanskrit.. ashtan'daghadhyaayam. . 46 pgs. 1960. 0. 630 pgs. Technology. . 146 pgs.. . atha kalikaa puraand-amu. 0.… 98/167 . Language. 1948...

554 pgs. Linguistics. . 1860.a. Savanur. athashriimadgagavatat'ippand-ii yadupativirachitaa ekadaso skadhan. Religion. Literature. Sanskrit. ..… 99/167 .. 627 pgs... athashriibhaagavatat'ippand-ii t'ikaa shriidharaa... Sanskrit. 1898. 197 pgs. H.. atha shriimannyaayasudhaa.. 395 pgs.. 0. atha tatpurushhaprakarand-amu. atha shriimannyaayasudhaa. athabadariimaahaatmya.. atha shriimadbhagavate ashht'amaskan'dhan. saayand-aachaarya.. 1858. Sanskrit. 342 pgs.g. 484 pgs. . Literature. Somraj Krishna Das. Treble.a.. 327 pgs. 0. 565 pgs.. Sanskrit. 258 pgs. Theology... 0. 41 pgs. Literature. .. Theology. atha shriimannyaayasudhaa. 1929. athamn'tramahodadhit'okaanokaayan'trasahita.... saayand-aachaarya. Gangavishnu amp Khemaraj.. 0..g. atha shriimadhbagavataa vijayadavaaja ekaadasobhaagan..a. Language. Sanskrit..r. H.. 0. atha shriimudgalpuraand-an. 1929.org/…/SanskritIIIT. Literature. atharvaveida san'hitaa rxshhyaadi savalitaa. . atharvaveda san'hitaa. Sanskrit. Linguistics.. Sanskrit. krishna Das.. 0. Sanskrit. 206 pgs.r. Savanur. bhat't'aachaarya.. H. 352 pgs. not available. Not available. Sanskrit. atha shriimadvagavate dvadashaskan'dha. 1929. Linguistics. sadaachaara. Literature. atha shriimadhyaayasudhaat'ippand-i. Sanskrit. Religion. saan'tabalekarakulajena daamodarabhat't'asuununaa shriipaadasharmand-aa. Sanskrit. . Language.. Sanskrit. Language.g.. Religion. Literature. .a. athabrahaapuraand-asithatavishhayaanukramand-ikha. 620 pgs.2/14/2011 A list of scanned Sanskrit books at III… atha shriimadbhagavadgiitaa. Treble. 398 pgs. 1989. Literature. athaa hymaratanaa baalabhaadraa. 1963. Linguistics. Sanskrit.. 203 pgs. 342 pgs. ... 370 pgs. 0. Sanskrit. Literature. Sanskrit. Literature. .. Literature.. Linguistics. Sanskrit.. Linguistics. atharvaveida san'hita. 390 pgs. 64 pgs.. . Language. atharvaveda san'hitaa. Sanskrit. Sanskrit. . 0. sanskritdocuments. 1093 pgs. 475 pgs.... 1929. 600 pgs. Language. Savanur. 190 pgs. . athabrahaasutrabhaashhyan. Literature. Sanskrit. H. Language. 184 pgs.. 0. 1957. Sanskrit.. Theology. Linguistics. 0. Sanskrit.... Language. Sanskrit. . Sanskrit... atharvavedasan'hitaa bhaaga 3. ... 0. Sanskrit. 538 pgs.. Language.. 1939. athashriimadgagavatat'ippand-ii yadupativirachitaa chatuthai skadhan. Sanskrit. Literature... athaaprabdhanoyaanamimaan'saa... Sanskrit. . Literature. Literature. athaitareyopatishhatu. 0. Religion. 0. . 0.. Shankar Panduranga Pandit. 1858.. atharvaveidasan'hitaa bhaaga 4. 0. athashriimadgagavatat'ippand-ii shriinivaasatiithaiyaa ekaadashan. Treble. Treble. athashriibhagavathat'ippanii karmakat'ikaa vijayavaad'aa tirtaa trayodase kandan. General. atharvaipraatishaakhayamu. Not available. saan'tabalekarakulajena daamodarabhat't'asuununaa shriipaadasharmand-aa. 856 pgs. Sanskrit. Venkatachala Sastry. Sanskrit. . athamn'tramahodadhigranthasyasyaivashhayaanukramand-ikaa. 353 pgs. 1959. 88 pgs..r.. .. 1898. Surya Kantha. Sanskrit.k. 0.. athashriibhaagavatat'ippand-ii satsadhamaikrutaa. 1860.. 549 pgs. Linguistics. Literature. Sanskrit. 579 pgs.. Sanskrit. . 460 pgs. .

shriiabhinavakaalidaasa. 0.. 1933. Language.. 1934.. . 1985. 0. Technology. 298 pgs. Jithendra Bajaj. bhaamahiiya kaavyaalang-kaara udyaana vritti. Technology. Sanskrit. Sanskrit. athashriimatsayapuraand-akramaand-ikaa. 1954. Religion.. 590 pgs. Language. Language. binod lall sen. Sanskrit. 864 pgs. -. Linguistics. 727 pgs.. 142 pgs. Psychology.. Sanskrit. 2000.2/14/2011 A list of scanned Sanskrit books at III… athashriimadgagavatat'ippand-ii yadupativirachitaa trutiyo skadhan. 672 pgs. 1996. Religion.. Religion.. Sanskrit.. athavaiveda san'hitaa. avadaanakalpalataayaa mand-ichuud'aavadaanan' naama trutiiya pallava. shriigang-geshopaadhyaaya.t.. Theology.. Sanskrit. Religion... Literature. Sanskrit. K Vasudeva Sastri.l. Sri Raghunathasiromani. Religion... Sanskrit. t. Linguistics... Language. Religion. 2000. 110 pgs.… 100/167 .. shriimadamarachandrasuri. 1908. avantisundarii.. Sanskrit. Sanskrit. 675 pgs.....r. Not Available. athavaiveda san'hitaa trutigo bhaagan. athashriimadgagavatat'ippand-ii yadupativirachitaapanchamo skadhan. Sanskrit.. Literature. 1869. 122 pgs.. shrii machchhang-karaachaarya. RELIGION.. Religion. Religion. baalabodha san'graha. Sanskrit. Acharya Mukunddevagya.. athavaivediiyaa poppalaada san'hitaa navii kaandaa. Shankar Panduranga Pandit. 1901.. aumaapatamu. Religion. athashriimatryaayaamutodhvitiyan'parichchhaidan. Sanskrit. 2000. 1929. Sanskrit. 810 pgs. Unknown. tataachaarya siroomani. Linguistics. K. Literature. athavaivedasan'hitaa tisaraa bhaagan. K.k. . Krishnacharya.joshi. sanskritdocuments.l. 26 pgs.. 447 pgs. Theology.. 126 pgs. 77 pgs.. Sanskrit. vaachaspati. bhaamatii brahmasuutrabhaashya katusuutri. Sanskrit. 856 pgs. baalabhaaratamu... Literature. 26 pgs. 257 pgs. krishna Das. Sanskrit. bhaagavatachampuu. Panduranga Pandit. 323 pgs. Sanskrit. bahudarmaipuraand-amu. avachchhedakataaniruktti diidhityaasaha. 2000. Sanskrit. Sanskrit. 0. athavaiveda san'hitaa.joshi. Linguistics. Literature.. Language. 1894.. avataaravaadaavalin' pradamo bhaagan. 358 pgs. 0.. Literature... Sanskrit.joshi.. athavaivediiyaa poppalaada san'hitaa ek kaandaa. Sanskrit. 1977.. 0. 644 pgs... Raghu Veera. 351 pgs..org/…/SanskritIIIT. 1973. govindadeva. baalaraamaayand-aannama. d. Linguistics. avayava diidhityaa diidhitiprakaashikamu. Linguistics. Sanskrit. Sanskrit. Sanskrit. avmanjari. baadhan. Linguistics. P Beniram Sarama Gaup. Sanskrit. athavaiveda san'hitaa pehalaa bhaagan. 284 pgs. Literature. Linguistics. Art.. 1916. 613 pgs. Not available. 170 pgs. 1959.. Sanskrit. Literature. 351 pgs. K. . Religion... Theology. Sanskrit. 515 pgs.. 1940. 122 pgs. mahaamahoopaadhyaaya shriigadaadharabhat't'achaarya. 1908.. Literature... Raghu Veera.... Sanskrit.. . THEOLOGY. 1936. athavaivedasan'hitaa dusara bhaagan. 34 pgs. aachaarya dand-d'i. Religion.l. 639 pgs. atran' bahu kurviita. . Language. 0. 1989.. Literature. 1985. Sanskrit. Philosophy. ayurveda vijnanam. Language.. Goswami. 1957.. 171 pgs.. ayurveda bhashym panch khandm.. Language.

bhaat't'amiimaan'sakaanaan' sarvasvamu shabdapramaand-asya vaishiptyamu. anantakushhnd-a. Linguistics. Psychology. bhagavaan daasa. Psychology. Sanskrit. 0. Literature. Sri Subramanya. Sanskrit.. 194 pgs... Embar Krishnamacharya. 82 pgs. Anantha Krishna Sastri.. Language.. 1998. 332 pgs. Language. 156 pgs.. LANGUAGE. Language. p. Philosophy. laqs-mand-a sin'ha khanna. -. Sanskrit. bhaaminivilaasan.. Literature. sanskritdocuments.. p. Linguistics.. bhagavadanudhaavananaamaa champuprabandha.. bhaat't'adiipikaa shriimatkhand-d'adevaprand-iitaa. 1999.. 439 pgs.. Literature.. Literature.. Religion.. Psychology. Venkararaghavan Sastri... 432 pgs. Sanskrit... 230 pgs. bhaaratiiya vana adhiniyam miimaan'sa. Philosophy. Sanskrit.. Literature. Literature. Literature. shrii gn-aanaanandendrasarasvatiisvaamii. Literature. 70 pgs. Philosophy. Sanskrit. Psychology.. 0. bhaarata charitra pariikqs-aa. 708 pgs. Sanskrit.. bhaarata ko janagananaa 1981 part Iii B. Linguistics. Sanskrit.padmanaabha.padmanaabha. 0. 1914. 0. 560 pgs. 0. shriijagatraaya.… 101/167 . 300 pgs. bhaavaprakaasha bhaavabodhiniihindiivyaakhyaayopeta. Social Sciences. vaasishht'a gand-apati. Biography. 1915. Language. 174 pgs. 584 pgs. Language. bhaarata ko janagananaa 1981. Sanskrit. 206 pgs. Linguistics. Sanskrit. Philosophy.. bhagavadgiitaa. Theology. mand-d'anamishra... 1280 pgs. Geography. Sanskrit. Linguistics... Sanskrit.s.. Sanskrit. Literature.. gaanjan chintaman deo. 1961. Literature. bhaaratiiyamu athaishaastramu. bhaashhyaayairatnamaalaa. Sanskrit. bhaaskarodayaa tarkasan'grahadiipikaa prakaashasya vyaakhyaa padavaakyapramaandapaaraavaariind-a.. Literature. Not available. Language.. 1936. Linguistics. 426 pgs. Literature. Sanskrit. Psychology. Sanskrit. 144 pgs... 1951. Philosophy. 0. niilakand-t'habhat't'asuunupand-d'ita... Sanskrit. Sanskrit. 902 pgs. Sanskrit. History. 1913. Linguistics. Language. bhaat't'adiipikaa uttarashhat'ahamam. Linguistics. Sanskrit. Language. Linguistics. 0. Not Available. Sanskrit. LINGUISTICS. 1894.. bhaavanaaviveka sat'iika. Sanskrit. 387 pgs. Literature. Literature. bhaat't'adiipikaa Part I. Language.. bhadranyaka upanishad. p. 156 pgs. Language.. 90 pgs. 0. bhaarata ko janagananaa 1981. u krxshhnd-ashaastrii. Sanskrit. 1921. bhaaratiiya raajaniiti prakaasha. shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru. 430 pgs. bhaarata chaampuu. Linguistics. 0.. Dravida Rajesvar Sastri. Language. Language. 1921. Literature.. bhagavadgiitaya luupanyaasagal'u eran'd'anaya bhaaga.org/…/SanskritIIIT.padmanaabha.. bhaashhyaatheratnamaalaa.... 348 pgs. 0.. N. bhaashhyaartharatnamaala.. 310 pgs. Not available. 1955. 146 pgs. Linguistics. Sanskrit.. 1938. LITERATURE. 0. 1926. Linguistics. Language. Pachamukhi. Linguistics. Language. bhaashhyagaambhiiyothenind-eyamand-d'anaaraye grantha.. Sanskrit.. Literature. bhagadattajalhand-a virachitaa sukttimukttaavalii.. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… bhaamatiisamaaloochanamuu. Sanskrit. 0. Literature. Language. harinaaraayand-a. 624 pgs. Linguistics. Hari Narayan Apte...

Sanskrit. LITERATURE.. 511 pgs... Literature. Sri Ranga Ramanuja Desikan. Sanskrit. Linguistics. 130 pgs. god'avarti shat'hakopaachaarya. Language.. Literature. 1938. Philosophy. Theology. Philosophy. bhat't'ikaavyamu chandrakalaa vidyotinii san'skrxta hindii vyaakhyaadvayopetamu dvaadashaadi dvaabin'shatisarmaparyantamu.. Not Available. Sanskrit. bhavana viveka. Literature. 1904.. 138 pgs. Psychology.. Literature.. Sanskrit. Literature. Psychology. bhat't'akalpataru.. 1912. Sanskrit. bhiimaparaakraman. Literature. 1983. bhat't'achintaamand-i. Language. 1961.t. Literature. Sanskrit.. bhartrxharisubhaashhitamu. 1933. 1915. Literature. Language. Literature. Literature.. 424 pgs. Literature... g k bhatt ed. 1947. 0. 670 pgs. 462 pgs... Philosophy. Language. bhaishhajyaratnaavalii. Language.... LANGUAGE. Sri Tarkavagisa Bhatta Venidattacharya. Psychology... Sanskrit.… 102/167 . 252 pgs. 128 pgs. venkat'asubrahmand-ya. Psychology. Language. Psychology. Psychology. -. Linguistics.. Sanskrit. Language. 260 pgs. Linguistics... d.. 2000.. Literature. Language. 282 pgs. Linguistics. Sanskrit. Language. bhedasaamraajyamu. mand-d'ikala raamashaastriind-a. 74 pgs. Linguistics. Mandana Misra. Religion.. 96 pgs.. Philosophy. shaataanandasunu. Language. 0. Sanskrit. naanyabhupal.. Not available. bhedajayaqs-i. 1942.. 580 pgs. Literature.. Language. Sri Visvesvara Siddi. Sanskrit. 857 pgs.. Linguistics. The Arts. shriivatsaangkamishra. bhat't'ikaavyamuu. bhaktamaalaa raamarasikaavalii. Linguistics... 1169 pgs.. sanskritdocuments.. mahaakavishriibhat't'i. 661 pgs. shrii koliyaalamu svaamina:. Theology. 0. 1934. 1952. 294 pgs... 1930.. Linguistics. 1964. Philosophy.. Literature. bhedadhikkaara upakaaramapaarkarma vyaakhyaayasahitamu. bhedasaamrajyamuu vedaantabhaaga. bhat't'achintaamand-estar^kapaada.. bhatta bhasha prakash.. 1898. Sanskrit..org/…/SanskritIIIT.. 188 pgs. Linguistics. Linguistics. Language. tatachary siromani. Sanskrit. shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru. bhakttisudhaataran'gand-ii. khemaraaja shriikrxshhnd-adaasa. Sanskrit. Sanskrit. venkata ramana sastri. Language. Language. bharatamajjari. Sanskrit. Religion. 1952. Philosophy. shriigovindadaasa. Sanskrit.. bhamahas kavyalankara. shriimannrxsin'gaashramamuni. 0. Linguistics. 1914. Sanskrit. 1957. Literature. 1954.. 178 pgs.. 96 pgs. jayamangalayaa. 420 pgs... 1914. Language. Krishhnd-akumaari. bhasasastrapravesini. Linguistics. Linguistics. 0. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… bhagavadgiitaya luupanyaasagal'u on'danaya bhaaga. Literature.. Sanskrit. bhasa svapnavasavadatta. 71 pgs. bharatabhasyam part 1 chapt 1 5. 1271 pgs. 84 pgs.. Sanskrit.. 1934. Language. bhagavadgund-adapand-aakhyamu shriivishhnd-usahastranaamabhaashhyamu.. Linguistics. bhaimiiparind-ayannaama naat'akamu nalavijayaaparanaamakamu. bhagavadraamaanujavijaya gadhyaprabandha. shriimadbhat't'i.. Sanskrit.. Sanskrit. 1999. Sanskrit. Sanskrit. Religion. LINGUISTICS. bhedojjiivana. 120 pgs. 1900.. bhat't'ikaavyamu. 66 pgs. 322 pgs. bhagavadgiyaanasopaanamu. Sanskrit. Religion. Sanskrit. 222 pgs. Not available. Sanskrit. Linguistics. Sri Rama Subramanya Sastri. shriikshemendra. Linguistics.. Theology.

Literature. brahaasureabhaashhyamu. Language. Linguistics. brahaasutrashaakarabhaashhyamu bhaamatiikalpataruparimalopetamu.. 354 pgs. Linguistics. .. Philosophy.s. Sanskrit. 0. 534 pgs. Literature.. Literature.. Sanskrit. Sri Nimbakacharya... Linguistics.. Psychology.. 557 pgs. Language.. Philosophy.. Literature.. Linguistics. LINGUISTICS. Sanskrit. Biography. Sanskrit. Sanskrit. Sri Subramanya Sastri. raghunaatha. 1991. bhramasuutrabhaashya bhaaga 1. 1933. shaama shaastri. Sanskrit. 1951. Philosophy. sanskritdocuments. Sanskrit. Sanskrit. Geography.... Philosophy. Rangaswami. Sanskrit. LANGUAGE.. Linguistics.. Sri Sankara Bhagavatpadacharya. Linguistics... Sanskrit. bhushanam. hech. Language. brahaasutrabhaashhyamu. Linguistics.. 938 pgs. Linguistics. Literature.p. Psychology. Sri Anantha Krishna Sastri. Linguistics. brahamiimaan'saabhaashhyamuu. Literature. Mahadeva Sastri Bakre. 0. Psychology. 106 pgs. Philosophy. LITERATURE. 42 pgs.. Sanskrit. shriiballaala. Sanskrit. bodhaayaniiyagrxhyasuutra. brahaasuutrashaan'karabhaashhyamuu Vol I Chatussutri. Philosophy. boodhaayanaguhaya suutramu. gokarnd-a saan'badiiqs-ita. 1956. 494 pgs. brahaasuutrashaan'karabhaashhyamuu With Commentaries of Shri Givindananda Vachaspati Anandagiri. bhramasuutrabhaashya bhaaga 1.. Sanskrit.. t'haakuur.. Unknown.. Psychology.. Literature. 1941. 1959. Language. 1923. 1984. Sanskrit. Sanskrit. Bhaskaracharya. Dr Sureshchandra Mishra. brahaasuutrabhashhyamuu Text with Tippanis. Geography. boddhi san'skruta grandaavalii 21.. brahaamanhikamuu. Sanskrit. Not available. bhuukailaasanaat'akamu. Sri Anantha Krishna Sastri. bhoojaprabandha.. Sanskrit. Psychology. Sanskrit.. Linguistics. Language. Sanskrit. 269 pgs. 355 pgs. Brahmasutras.. shrii madhvaachaarya. Wasudev Laxman Shastri Pansikar. 306 pgs.. 1901. 1984.l. Literature. Literature... Sanskrit.. 1937. Psychology. Linguistics. brahaasuutrashaan'karabhaashhyamuu Part Iii With 5 Commentaries.d'i alan'kaar. Literature. bijn'panaya. 73 pgs. 646 pgs. Language. 649 pgs. 324 pgs. Language. Vaidya. bhuddhabhuushhana. 1932.org/…/SanskritIIIT. Psychology. vi. shrii madhvaachaarya. Literature. Sanskrit. History... 1926. Sri Sankara Bhagavatpadacharya.panchamukhi. Language.. 344 pgs. 1949. 0. 1927. 0.. gopalan s tr. 1989.. 524 pgs... Philosophy. 708 pgs. 80 pgs. Sanskrit. brahaasuutrabhashhyamuu. brahaasuutrashaan'karabhaashhyamuu Part Iii With 9 Commentaries. baskaraachaarya... bhoojanakutuuhalamuu. Sanskrit. brahaasutrashaan'karabhaashhyamu dusaraa bhaagan. Philosophy. Theology. 1908.… 103/167 . 1920. 994 pgs. 441 pgs. aar. Sri Gnana Bikshu. bhucvaneishalaukikanyaayasaahastrii. 452 pgs. brahamiman'shatrishati.. 126 pgs.. Sanskrit. 100 pgs. brahadhogatarad'ugind-i asyaan' dhvitiyo bhaagan. Religion.. 357 pgs. 1934.. 650 pgs.. Narayana. Philosophy.2/14/2011 A list of scanned Sanskrit books at III… bhonsle vamsa charitra. Sanskrit... Language. Sri Vasudeva Brahmendra Sarasvati Swamigal. Religion.. 1977. Psychology... Sanskrit... Psychology. R.subramanyasaastri.. Sanskrit. 1918. 1929. Language. 90 pgs. Sanskrit. 0. Language. bhuhajjaatakamu. 1955.. 236 pgs. 444 pgs.

246 pgs. balagangadar tilak l. 1984. 441 pgs. brahmasutrabhasya of sri madhvacharya vol 1.yal. 596 pgs. 1894.t. Sanskrit. Religion.. Language. Linguistics. brahmasuutrabhaashhyamu prathamo bhaaga.. Yogeswara Dutta Sharma. Religion. Language. gan'gaavishhnd-u shriikrxshhnd-adaasa. 278 pgs. sanskritdocuments. Language. Language. 1922. Sanskrit. Literature. Not available. Literature. Chandrasekharan. 1984. Brahmasutras..... Linguistics. Psychology... Sanskrit.... 198 pgs. Madanmohan Agarwal. Sanskrit. 441 pgs. brahmaand-d'apuraand-ettarabhaagiiyan' lalitaasahasranaama saubhaagyabhaaskaraaravyabhaashhyan. t'i gand-apati saastri. 461 pgs. 2002. Psychology. 530 pgs.. Linguistics. 0. Krishnasastri. 1937. Not available. 1967. Literature. Sanskrit. Philosophy. Sanskrit. vaasudevasharma. Literature. Prof. Sanskrit. 200 pgs.org/…/SanskritIIIT. Linguistics. brahmasiddhi Of mand-namishra Vol 1 brahmakaandaa... Linguistics. bhaaskararaaya. 2000. 1923. T. brahmasutraa nimbaakaibhaashhyamu panchamo bhagan. 1927.. 1909. Sanskrit. brahmasuutrashaan'karabhaashhyamuu. Brahmasutras.. Sanskrit. Psychology. brahmasutraa nimbaakaibhaashhyamu charma bhagan. 315 pgs.. Literature. 1933. Philosophy. Sanskrit.. brahma sutra sariraka bhaaga 1.. Vira Raghavachaya. Madanmohan Agarwal.. Sanskrit.. 203 pgs. brajavilaasa. 266 pgs. Theology. je.. Philosophy.. Sanskrit. 1954. Sanskrit. Sanskrit. Religion. 30 pgs. Hari Narayana Apte.. V. shriimajjayatiirtha vyaasatiirtha. brahmasuutrabhaashhyaalochanasya prathama chatu suutrii... Sanskrit. brahmatatvaprakashika. Language. Language. S.. Sanskrit.. brahmasuutrabhaashhyamuu samalang-krxtamu. 191 pgs.. Sanskrit. 1957. hari naaraayand-a. Theology.… bh ti ti k i i L Li i ti Lit t S k it 1941 188 104/167 . brahmamiimaan'saabhaashhyamu. Sanskrit. 1981. brahmaasuutraand-i. Literature. Language.. Linguistics.. Language.. Not available. Linguistics. Philosophy.. 510 pgs. Theology.prabanjanacharya.. Language. brhadaarand-yakopanishhatu. 453 pgs. Sanskrit.. Sanskrit. Literature. 0. brahmasutraa nimbaakaibhaashhyamu. 322 pgs. Religion. Sanskrit. shriinimbaarkaachaarya. 340 pgs.. Sanskrit. Venkataramana Reddy. Linguistics. Brahmasutras. Brahmasutras. Sanskrit. 1983. 185 pgs. Literature. Language.. 340 pgs. Sanskrit. Sanskrit. Kuppuswami Sastri... Language. Upanishads. brahmavidaashiirvaada. 2003.. 245 pgs. 604 pgs. shaastri.. V.. brahmasutraa nimbaakaibhaashhyamu. Brahmasutras. Theology.. 1991. vidhyaabhaaskara shriimand-ishang-karo vasantaraamaatmaja upaadhyaaya. shriividhyaarand-ya. 2000. Linguistics. Literature. 0. Literature. 416 pgs.. bran'hmaan'd'a puraand-amu. sri bhagavad ramaanuja. brhamasuutra vrutti. brahmasutraavabhavamu. Linguistics.. 1963.. 290 pgs. brahmasuutrashaang-karabhaashhyamu sat'ippanan' muulakaatramu... Literature.. 102 pgs. 1915.. 1991. brahma suutraand-i. brahmasutraavabhavamu vrittimit'aksaraa. Linguistics.2/14/2011 g A list of scanned Sanskrit books at III… p y y gy pg brahasuutraanugund-yashiddhi.

Sanskrit. brxhadhdaan'turuupaavali.. Language. Literature. v. 0. sanskritdocuments. Sanskrit. Sanskrit... Psychology. LITERATURE. Unknown. Sanskrit. 110 pgs. Linguistics.. Literature. chaalukyacharitamu. THEOLOGY. 0. Language. brxhatakathaaman'jarii. Linguistics. 1895. brihadaranyakopanishhat'a khandarthaa. 158 pgs.. kaviraj shrii athrii dhev guru..padmanaabha.... LANGUAGE. THEOLOGY.. census of india 1981 series 1 part V A amp B. Art. p. Linguistics. 460 pgs. Linguistics. 552 pgs. Language. 1326 pgs. qs-hemendra. chalaraashikalanama.viswanatha Nayak.... RELIGION. chimand-aajii aapat'e. 188 pgs. Not available.. Language.org/…/SanskritIIIT. Linguistics. Sanskrit.. Language. 643 pgs. Linguistics. Not available.padmanaabha.. 1901.. Language. Literature... Sanskrit. brxhatii shaabarabhaashhyavyaakhyaa. Literature. Sanskrit. Not available. Linguistics. ma. t'ii aara krxshhnd-aachaaryand-a. budhabhuushhand-aman. Social Sciences. 132 pgs. 32 pgs. Literature. 1843..2/14/2011 A list of scanned Sanskrit books at III… brhaspatismrti. rangaswami aiyangar. Jwalaprasad Misra. Sanskrit. Sanskrit. Sanskrit. 1941. Literature. shriibhoojaraajasaarvabhauma. Linguistics. k. Literature. champuuraamaayand-amu ayodhyaakaand-d'amu. 1943.. chaand-akyashatakam... Linguistics. 0. 256 pgs. Literature.. Sanskrit. Religion. 0. 0.. Natural Sciences. Sanskrit. Sanskrit. 560 pgs. 1941. 0. 1246 pgs... champuramayana.... 0. 330 pgs. buhadaarnd-yakopanishhanmitaaqs-araa. Linguistics. RELIGION. Literature. bhoja.ma. Linguistics. Language.. Sanskrit.. t. 0. prabhaakaramishra. trimallabhat't'a. Language. champuramayana kiskindha kanda and sundara kanda.. Theology. 1891. Linguistics. buhadaarand-yakopanishhadushhyavaatokamuu. Philosophy. Sanskrit. Not available. 0.. Language. Literature... 122 pgs. Literature. 1955. P. 295 pgs..… 105/167 . Sanskrit. shriibhojaraajasaarvabhauma. hari naaraayand-a.... Sanskrit. Language. Language. 664 pgs. 643 pgs. 480 pgs. 290 pgs. t'i aar krxshhnd-aachaarya. Literature. narayana raam acharya. champuuraamaayand-amu yuddhakaand-d'amu vyakhyaaya sametamu.. Literature.sudhaakara diveidi.. 650 pgs. 256 pgs. Language. champuuraamaayand-amu kalyaand-ii san'skrxta hindiivyaakhyaadvayopetamu. champubhaaratamu. Sanskrit. p. bulletin of the goverment oriental manuscripts library madras. 1875. 290 pgs.. Sanskrit.. Literature. chandrashekhran. 1933... shriiraamachandra budheindra. Linguistics. Sanskrit. Sanskrit. brxhaddhaan'turuupaavali. brxhatstotraratnaakara sachitra. Language. 1979. Literature. Sanskrit.. Sri Raghavendra Tirtha. King Sambhu. Sanskrit.. budgat 1966-67 finance minister's speech part -a. 1979. 1946.. Language. 1926.. Literature. brxhadaarand-yakopanishhatkhan'd'a.. Language. 1924. 82 pgs. 34 pgs. Linguistics.. bruhadhyaavanaajaathakama. brxhadhyogatarang-agind-ii dvitiiyobhaaga. Sanskrit. census of india 1981 series 1 part Viii. Sanskrit. 1914. LINGUISTICS. Linguistics. Linguistics. Language. 283 pgs.

chatushshlekii stotraratnanj-cha. Literature. Sanskrit.. Language. Sanskrit. Not available. 127 pgs. Language. 526 pgs. Not available. paurnamasi katha bhatta. Not available.. Sanskrit.. Sanskrit. chan'drikaaprakaashaprasara. chaukhambaa saahitya... Linguistics.. Literature. Not available.. 112 pgs. Literature. LANGUAGE. LANGUAGE. Social Sciences. Language. Linguistics. chaukhambaa saahitya 1996 97. Literature. Linguistics.. charakasn'hitaa by agnivesha. viiranandii. Sanskrit. LINGUISTICS. Linguistics. 461 pgs. Sanskrit. chaturvin'shatiimatasan'graha. 1941. LITERATURE.. 112 pgs. Sanskrit. Sanskrit. chaturvaand-ii. shriimattaatparya. 0. Not available. 1934.. Not available. 0. Language..r. 1999.. Language. 1993. Linguistics.. Language. chandrakaantaa santati saatavaan' hissaa. Religion. Sanskrit. devakiinandana. Sanskrit. Language. shriimadyaamunamuni. Language. Not Available. chatur^var^gachintaamand-e Part Ii.. Krishnacharya. 0. Sanskrit. 0. LITERATURE. Not available. Literature... Sanskrit. champuuraamaayand-amuu baalakaand-d'amuu. Unknown... chaukhambaa saahitya 1996 97. Literature. Literature. 386 pgs. 108 pgs. LINGUISTICS. 112 pgs. Literature. Language. Linguistics.. 142 pgs. 1843. Sanskrit. Sanskrit.. Literature. chatun'shlokii. Literature. Language. Sanskrit. 0. Sanskrit. Not available. 1907. Literature. chatur^thiikar^mapaddhati. 156 pgs... devakiinandana. Linguistics. Literature. 1843. 1926. chandraaloka savimarsha prakaasha hindiivyaakhyaya panj-chamo mayuukha. 86 pgs. Sanskrit.. Linguistics. Not available. 0. chandrakaantaa santati paan'chavaan' hissaa.. Literature. Not available. Literature.. Sanskrit. Religion.. Technology.. Sanskrit. Language.. 142 pgs. Language. Literature. Literature. Language.. chandraprabha charita. Linguistics. Literature. chandra loka. Literature. Linguistics. Sanskrit. 106/167 . Sanskrit. subramanya shastri s.. chaukhambaa siiriija saahitya 1999 ii. 251 pgs. Linguistics. Linguistics. Literature. Language. shriijayadevakavi. 184 pgs. 37 pgs. 115 pgs.. Sanskrit. chaukhaambaa sahitya. Linguistics. Theology. . Sanskrit. Literature. Language.. 394 pgs.2/14/2011 A list of scanned Sanskrit books at III… Language.t. chandrakalodaahaara. Linguistics. chan'drikaaprakaashaprasara. 322 pgs. Linguistics. 342 pgs.. chaturvaand-ii.. 1904. sanskritdocuments. Sanskrit. devadhar g r tr. Gopala Lala. 398 pgs. 0. Hemadri. Linguistics. Not available. charudattam. Linguistics. Language. 1861. 1914.. chhaan'dogyavedeshiiyat'iikaa. shriibhoojaraaja. 1959. 0.. Chakripanidatta.. Sanskrit. 0. 194 pgs. bhat't'oojidiikqs-ita. chhaan'dogyopanishhatkhan'd'aartha.org/…/SanskritIIIT. Literature. Language.. 1962. Sri Vallabhacharya. Sanskrit. Sanskrit. Language.. Sanskrit. Linguistics... chhaan'dogyavedeshiiyat'iikaa..... Linguistics. 1977. 1937. Language. 1960. Social Sciences. 0.. chaturdandi prakaashika... 190 pgs. Not available. 1962. 106 pgs. 672 pgs.. 126 pgs. Linguistics. 1912... 230 pgs. 88 pgs. Theology.. 0. Language.. Linguistics.. chandrasyasaarand-iiraashyaadi 321404..… chhaandogya braamhand-amu trxtiiyobhaaga. 810 pgs.. Sanskrit... 112 pgs.

chitraprabhaa. 628 pgs. Literature. Language. 232 pgs. shriitaaraanaathatakivaacha..v..sharma. Literature... 212 pgs. Literature.. Sri Gopala Shastri Darsanakesari. shivadat't'a. Sanskrit.. chhanda shaastramu mrxtasan'jiivanyaa vrxttii. 1908. Literature.. 2002. Not available.. Ananthanarayana. 1932. Psychology. Sanskrit.. LINGUISTICS. Language.2/14/2011 A list of scanned Sanskrit books at III… chhaandogya braamhand amu trxtiiyobhaaga.. 2001. Literature. 0. Linguistics.. 530 pgs. 209 pgs. 411 pgs. divaakara. 120 pgs. Language.. 1980. Ayurveda.t. chidagaganachanddrikaa kramaprakaashikaavyaakhyaaya.. Language. Sanskrit. Language. hari naaraayand-a aapat'e.org/…/SanskritIIIT.. chhaandoogyabraahmand-amuu. Linguistics. Literature. chhandashaastramu. shriiping-kalanaaga. chitramiimaan'saa sudhaa vyaakhyaasamalang-krxtaa.. LANGUAGE. daanachanddrikaa. 645 pgs. The History Of Philosophy. Literature.. daanakelichintaamand-in. 90 pgs. K. 1943.r. LINGUISTICS. 0. 82 pgs. chhandobhyastaa. 256 pgs. Language. 125 pgs. Sanskrit. 208 pgs. 579 pgs. Language.. Linguistics. Sanskrit... Sanskrit. Sanskrit. daasakuut'a. The History Of Philosophy. shrii durgaamoohanabhat't'aachaaryaind-a. chhandovichitin. Sanskrit. Linguistics. Language. Linguistics. THEOLOGY.. Linguistics. 1989. Technology. LITERATURE.. B. kalidasa. 244 pgs. Banamali Biswal. Sanskrit. 1941. chitramiimaan'saakhand-d'anamu marmakaashena vimarshinyaa baalakriid'ayaa.... Sanskrit. 1962. daasacharitamu. Literature. 1980.. 218 pgs... daarshaanik pancham varshik shanaak. Linguistics. chikitsaa saahitya. 322 pgs. Sanskrit.. Philosophy. Language. Sanskrit. daanakaand-d'amu panchamo bhaagan. vord'ana d'ila.. 1932. 80 pgs. Linguistics. LITERATURE. chhaandogyopanishhatuu saamaveidaa. Sanskrit. Sri Paramasivendra Saraswati. d'anavaara kii ghaat'ii. Sanskrit. Sanskrit.. Theology.. Psychology. pan' harishang-kara sharmma.. Sanskrit. Literature. chitranibandhaavalin... raamaraaju b. 0.. Language. Bhabgavata Hari Sastri. daharavidhyaaprakaashikaa. Sanskrit. 326 pgs. 127 pgs.. Sanskrit. subrahand-ya shaastrii.. Literature.. Literature. Language.... Linguistics. ching-iyaaghara. yash dev shaalya. 1938. Language.. Vacant..s.. 366 pgs. 470 pgs. Sanskrit. Language. Sanskrit.. chitramiimaan'saa. 213 pgs. 160 pgs. mahaakavikaalidaasa. 830 pgs. Literature. Language. 1971. shriijovaanandavidyasaagarabhat't'aachaaryaa. 0.. contribution of andhra to sanskrit literature... 162 pgs. Literature. Sanskrit. Linguistics.. Sanskrit. Sanskrit. Linguistics. chhaandogyopanishhatuu... 1964. Linguistics. LANGUAGE. 1937. sanskritdocuments. 1956. chidagana chandrika sanskrit commentry and english translation. Religion.. Sanskrit.m. 152 pgs. Literature..… 107/167 .. chitraprabhaa. mand-d'itaraaja shriijagannatha. sri pingalanaga. RELIGION. Linguistics Literature. 1958. 1941. Linguistics. 459 pgs. Sanskrit. Raghunath Sharma. 1902. 2000. 1873. Sanskrit. 1991. 1948. bhiqs-u. Linguistics. 1965.. Religion. Literature. The Four Vedas. 1938. Language. chhandas sastra. Sanskrit. shriimadappayadiiqs-ita. daarubrahaa. 282 pgs.. Sanskrit.. Sharma. shriiping-galaachaarya.. Rangaswamy. Sanskrit. Linguistics.

shriikaakhanaayai.. dashaavataarastotramu. 290 pgs. Language. Theology. shriiraama. dasha upanishhadan' pradamo bhaagan. 1936. 402 pgs. Language. devabhaashhaa. 106 pgs. 101 pgs. Upanishads. 1934.. 1983.... 1996.achari. 0. 1998. 352 pgs. dhaaturuupa prakaashikoopoodhghaata.. dharmaakuutamu 2 ayodhyaakaand-d'a prathamo bhaaga. 1998. shrii upanishhadbrahmayogi. Literature. Not available. 0. Sanskrit. G.ramachandra Sharma. Sanskrit. Religion.. Sanskrit. 24 pgs... 1895.. 652 pgs. 1898... vinaayaka gand-esha aapat'e... Linguistics. Literature. Linguistics.. Sanskrit. Linguistics. Literature.. 1987.. 126 pgs. Linguistics. Language. Art.shashibala Gouda.. Language. dhanan'jayavijayan. Sanskrit. LINGUISTICS. dashainashaastrasyaitihaasan. Sanskrit. 518 pgs. 1936. Sanskrit. Psychology... dasha upanishhadan' dhvitiyo bhaagan. 976 pgs. 0. dharmaakuutamu 1 baalakaand-d'a. Language. C. 1954. Literature.2/14/2011 A list of scanned Sanskrit books at III… dakikhanii kaa padha aura. dhananj-jaya.. Philosophy. Linguistics. 1933.. 519 pgs. Sanskrit. 1935. Language. 1928. LANGUAGE. Dr.. 341 pgs. vaad'iilaala.. 545 pgs. Theology. 1935. Religion. Religion... Sanskrit. Literature. The History Of Philosophy. dhamaupadeshaamaalaa vivarand-a.. 98 pgs. LANGUAGE. kaviraja rakhaldaasa kavyaatiirtha. 602 pgs. 352 pgs. Sanskrit. lakshmipuram srinivasachar. Sanskrit. 426 pgs. 254 pgs.. 0. Literature. dashanirnd-ayii. dharma shastra. dashanind-aiyai. dharma kuut'amu Vol.. 1111 pgs. Linguistics. Bhagavdgita.. Kunham Raja. LINGUISTICS. ddvaitokttiratnamaalaa.org/…/SanskritIIIT. Linguistics... tryamn'baka raayamakhi. Theology. 631 pgs. deshopadesha namaimaalaagrantho. Social Sciences. 520 pgs... Sanskrit.. dasha upanishhada prathamabhaaga vyaakhyaayutaa. Language.. 120 pgs. Religion. shriivaidikasaarvabhaumai. deha prakriti vignyan. mahaadeiva chimand-aajii aapt'e. Sri Jayasimha Suri. Sanskrit. naabaadarsgabaoaranaachaaryya.. 1909. Language. B. Manmatha Nath Dutt. dattaka chan'drika. ke. 575 pgs.kunhan Raja. Linguistics.. 1947. Sanskrit. darsanodaya. Not available.… 108/167 . 370 pgs. Sanskrit.. Language. 1924.. Sanskrit.. 1878. dhaaturatnaakara. Sanskrit. 1949.. Kashmir. 363 pgs. pan'd'it chamaraajanagar shriikaan'ta shaastri. 130 pgs. Literature. Sanskrit. Theology. 1926. LITERATURE. Linguistics.. Sanskrit. Language. yashaavanth vaasudhev paatnkar.. Theology. maarulkarashaastri... LITERATURE. Literature. Sanskrit.. 202 pgs. Language.. 1976. Sanskrit. Sanskrit. Philosophy. Literature. devataadhyaaya san'hitopanishhadu van'sha braahamand-aani. dhar^masaastraa Part Ii. dasha upanishhadan' pradhamo bhaagan. Upanishads. sanskritdocuments. Unknown. Literature. Linguistics Literature.. Sanskrit. dasharuupakamu kaavalokaaravya t'iikaa sahitamu. Not available. Literature. darshapuurnd-amaasaprakaasha prathamo bhaaga. C.. Iii Part Ii. C.. Linguistics.. Sanskrit. Religion. 0. Sanskrit. Sanskrit.. Linguistics..kunham Raja.. Venkatanathacharya.. 1924. Sanskrit. 131 pgs. Sanskrit. dattakamimaan'saa 1976.

. . dhatu sagara tarani. 1968. 1937. Sanskrit. Literature. Sanskrit. 1832. 20 pgs.. Language. laqs-mand-a shaastrii. 1988. mahaamahopaadhyaaya vaasudevashaastrii.. Literature. Sanskrit. Literature. Language. Linguistics. gautama. Literature. sanskritdocuments. Literature. 1922. 116 pgs. Literature. Not available.. Ganesha Sastri Ghokle. Linguistics. Theology.. 1937. Linguistics..... p. 1933.. laqs-mandashaastrii joshii. Sanskrit. 1940... Linguistics. Literature.. Sanskrit. ravisheikhara pan'd'ita badariinaatha sharma. 107 pgs.. dharmoottarapradiipa volume Ii. dhvanyaalooka.. vaidhyamahaamahopaadhyaayashriichakrapaand-idatta. dharmasindhu dharmadiipiikaa vishaadahindiivyaakhyaaya sudhaat'iippand-ya. 1954. Literature. Language. Sanskrit. 162 pgs. LINGUISTICS. Sanskrit.. Sanskrit.. 1972. draahyaayand-agrxhyasuutramu rudraskandavrxttisahitamu. Linguistics. 1954. 250 pgs. laqs-mand-a shaastrii.. 1935. dharmasuutra. sripati sastry. dhvanyaalokasaara.. Language. Language. Language. Linguistics. Language. Religion. Sanskrit. lakshminarayana. diipikaasaahitamuu. Language. Language. 390 pgs. thakur udayanarayana singh. Literature. draahyayaand-agrxhyasuutravrxtti. Linguistics. 855 pgs.. gautama. 1050 pgs... dharmakosha varnd-aashramadharmakaand-d'amu prathamo bhaaga kramaanka 5. mahaakavishriiharichandra. Sanskrit. 526 pgs. 694 pgs. kurugan't'i shriiraamashaastri.. Literature. LANGUAGE. Vacant. 0. Literature. diinaarkaraajakukaarahemalekhamu. Language. diipikaasarvasvamuu. 200 pgs.. shriimadaanandavardhanaachaarya. shrii badhiriinaatha sharma. 1900. Language. dhatu sagara tarani. Linguistics. sripati sastry.2/14/2011 A list of scanned Sanskrit books at III… dharmaishaastrasan'graha. Sanskrit. 1938. dharmakosha Vol I Part II. 831 pgs... 1934. shriisubhat'a. Literature... Linguistics. LINGUISTICS. Sanskrit. Sanskrit. 640 pgs. Literature. Sanskrit. Sanskrit.. shriipurushhottamasharma chaturveda. 1971. 1968.. LANGUAGE. Sanskrit. 712 pgs. LITERATURE. Language. Sanskrit.. pan'd'ita durveika mishraa. Religion. Language.. 0... dhvanyaa looka. Sanskrit. 504 pgs. 0. dhvanyaaloka baalapriyaadivyaanj-janaabhyaan' lochanena. Linguistics. dharmakosha Vol I Part I. Sanskrit. Language.. Linguistics.. dravyagund-asan'graha dravyagund-asan'grahat'iikaaravyakhyaaya trxtiiyavrxtti. 1968. 224 pgs. p. Linguistics. Linguistics. Literature.. Language. Literature.. Vacant.. dhvaivajnj-abharanamu.. Sanskrit. mahaakavishriiseqs-apivara. Sanskrit. 98 pgs. LITERATURE. Language. dharmatattvanirnd-ayaparishishht'amu. dharmasuutramu bhaashhya sahitamu. dharmasharmaabhyudayamu..… 109/167 . 601 pgs. Linguistics.. Linguistics. Theology.. Literature.. dutaangadamu.org/…/SanskritIIIT. Sanskrit. 373 pgs. Linguistics. 1955. 114 pgs.. 120 pgs.. Language. 1914. Linguistics.. shriikaashiinaathopaadhyaaya.. Literature. 270 pgs. 214 pgs. Literature. 1969. Sanskrit. Sanskrit. Language. Linguistics. 1056 pgs.

epika Bhavaarth Bodhini. badarinaada.. 1895.. Literature.yam. Language. sanskritdocuments. Theology. 1929. Religion.. T. Sanskrit. Linguistics.. jotindra mohan chatterjee. gautamaprand-iita dharmasuutraand-ii. gathaa bhrxgvajirasaatmakasya atharvavedasya upasthaanaamake bhrxgukhand-d'e. Literature. mitaddara. 458 pgs. Anantakrishna Sastri. 1940. eitareya braamhand-aa. 1881... Sanskrit. M. Language. eitareya braamhand-aa. Linguistics. K Vasudeva Sastri. 1908. 240 pgs.. Literature. Literature. 190 pgs... Sanskrit.. Sanskrit. ekaagnikaand-d'a. Sanskrit.. omaprakaasha.m. RELIGION. Sanskrit. 1932. dvatadhumand-in. Language. 680 pgs. 516 pgs. Religion.. jayadeva.. Literature.. Sri Mad Ramanuja. 72 pgs. shriinivaasachaarya. 1998. Religion. 298 pgs. Sanskrit. 1927. Linguistics. Sanskrit. Language. Art. 1942.krishnacharya. Linguistics. eitareyaarand-yakamu.. 202 pgs. 1978. Hulagi Sripathyacharya. Linguistics. THEOLOGY. 240 pgs. Sanskrit. gaayatriivyaakhayaa. giita govinda rasikapriya rasamanjari. 1912. Literature. Sanskrit... 1983.r.. Language. 1969. Language.. 1902.. Sanskrit. Religion.. 1970. Linguistics. Sanskrit. Literature. Literature. 452 pgs.mathuranath Shastri... Linguistics. Linguistics. gaathaashaptashaatii. Literature. Language. Linguistics. gadya bhaaratii. 0. 666 pgs.pi vandeishvari. -. Linguistics.. 1911. .. Sanskrit. 120 pgs. Sathavahana. c. Literature. Religion. Sanskrit. chimand-aajii aapt'e. omaprakaasha.. gadaadhaarii. Literature. kavisaamraat'u vishvanaatha satyaanaaraayand-a. 149 pgs.. Language. eitareya taamaraaparinayamu.. 1910. 232 pgs. Shadguru.. 276 pgs.. d. Language. gaadaadharii. ekaviiraa.. Social Sciences.. gand-akaarikaa. 1950.r. Language. gadya bhaaratii. Language. 1920. 1908. Sanskrit.. Munichaturvijay Pandit lalchandrsrva Bhagavan Sresthitanuj.. Literature. 168 pgs.. Linguistics.. 149 pgs. gadhatrayamuu. 82 pgs. Linguistics.. 522 pgs.. 134 pgs. dvisan'dhaanamu. dvatasiddaantasaaran. Religion. Language.raghuthamacharya. Sanskrit. Literature. shyamasastry r.. 380 pgs. 770 pgs. Aurobindo.. yam.. 1915. Linguistics. 1906. 0.. gaadaadharii tattvachintaamand-yaa diidhityaa cha garbhitaa. Psychology. Sanskrit.. Sanskrit. shriigadaadharabhat't'aachaaryachakravartti. gadaadharapadvatau aachaarasaara. gand-itaadhyaaya vyaakhyaaya samanvita. 1942. Sanskrit. 240 pgs.. Gadadhara Rajaguru.. dvijakanyaanamu vivaahakaalivimarsha. Sanskrit. Sanskrit. 1944... ti ve shriinivaasaashaastrind-aa. 446 pgs. eclipse cult in veda's bible and koran. Sanskrit.. 262 pgs. Language. Literature.. Sanskrit... Sritaranath. 1978. Sanskrit. 228 pgs. Language.… giitaagn aana prathama adhyaaya arjuna kaa vishhaada pan' diinaanaatha bhaargava dinesha 110/167 . Literature. 554 pgs. gaathaasaptashaatii. 766 pgs. dalal. 0. Sanskrit.org/…/SanskritIIIT. Religion.. Sri Aurobino. 108 pgs... Unknown.. giita goovinda aur abhinaya. B. ganesh siddi. Sanskrit...2/14/2011 A list of scanned Sanskrit books at III… dvadashaaran' nayachakramu. Philosophy. Sanskrit.vindhyeswari Prasada Dvivedi. S. 1875. Literature. 432 pgs. 1950. Sanskrit. Linguistics. Sanskrit.. Sanskrit. Pandith Gopeshkumar... Language. Linguistics.

. giitaasamiqs-aa.. shriidevaboodha.. Linguistics. guhyasamaajatantamuu. Language. 0. Sanskrit.. 45 pgs. pan diinaanaatha bhaargava dinesha. jayadeva.. Sri Rama Sharmacharya. Sri Mukunda Jha Bakshi. Linguistics.. 188 pgs. 814 pgs. Not available.. 38 pgs. gopurasandesaa. Sanskrit. LINGUISTICS. Language. shriimadaanandatiirthabhaagavatpaadaachaarya. Bhagavadgita. gootaavalii sat'iik. Language. Benoytosh Bhattacharyya. giitaashaastraarthaviveka. Linguistics.s. Literature. Linguistics. Language. Language. Literature. Sanskrit. Literature. 0.. Literature. LITERATURE. Sanskrit. svaamii raamadaasajii kahaaraaja. 1948. 1846. 186 pgs. Sanskrit. Ramamurthi. Not available. Language. shuuranaad'uu krxnjanuu pilla... LANGUAGE. Literature.2/14/2011 A list of scanned Sanskrit books at III… giitaagn-aana prathama adhyaaya arjuna kaa vishhaada. gobhilagrxhyasuutran. Shambhusinghji Suthaliyadheeshkruth. Linguistics.. 34 pgs. gramaand-avaatikabhaashhyamu pradhama puraand-amu.. Linguistics.. Sanskrit. Theology. Language.. 182 pgs. Literature. Literature. Linguistics. Linguistics. gand-eshadaivagn-aani.. 288 pgs.. Linguistics. 1986. Sanskrit. Bommakanti.. 504 pgs. Language.. Literature. 422 pgs. 1971. Language. 170 pgs. goopikoonmaada. Language.. 1955. M. 0.. Linguistics. grahalaadhavan' karand-amu t'iikaa. Linguistics. 1869. Theology. 266 pgs.... Linguistics. gitagovinda mahakavyam... gruhaasutra san'graha.. Literature.. 219 pgs. Linguistics. goobhila graahya suutra. 0.. Language. 140 pgs. h Kalpmudram. ma daa khare.. Sanskrit.. gn-aanadiipikaa mahaabhaarata bhiishhmaparva. 1936. 514 pgs. Marunda. 1931. Tripitakacharya Mahapandita. 1909.. Linguistics. Social Sciences. 0.. gobhiliiyagrxhyasuutramuu. 228 pgs. Literature. haaralataa.… 111/167 . Sanskrit.. 1936. Art. Literature. sanskritdocuments.. Sanskrit. han'sasan'desha. Linguistics.. gopeenauth pathuk. 374 pgs. 0. Sanskrit. Unknown. 0. Language. guptapaashupatamu amrxtasharmishht'hamu. Literature. gurushushruubaa san'vargavidhyopadeshashcha. Linguistics.. 352 pgs. grantharatnamaalaa. Sanskrit.. 390 pgs. Linguistics. Literature.. subrahand-ya vidushha. Not available.. 57 pgs. Literature. K.. Sanskrit. Religion. giitaapadmavikaasa.. chintaamaand-i bhat't'aa. 43 pgs.. 1936. Linguistics. 0.... 1956. Religion.m. Language. Sanskrit. goomiliiyaguhakarmaprakaashikaa. giitopadesha. Aniruddha Bhatta.org/…/SanskritIIIT. 384 pgs. Language. Language. Religion. guurvarthadiipikaa prathamaadhyaaya. Literature. grxhyasuutramu grxhyaparishishht'amu grxhyakaarikaashcha. Sanskrit. Sanskrit. 1995. 226 pgs. Literature.. 662 pgs. Language. Srinivasacharyulu. 62 pgs.. 1947. Sanskrit. guurvaarthadiipikaa dvitiiya pushhpamuu. Sanskrit.. Sanskrit. Literature. 256 pgs. Sanskrit. 1969.. Literature. Language.. Literature.. kavisamraat'a vishvanaatha satyanaaraayand-a. 1892. Sanskrit. Sanskrit.. 1815. 0. Not available. Sanskrit.. 330 pgs. 1952. Sanskrit. Sanskrit. Sanskrit. Sanskrit.. Literature. 257 pgs. Language. Sanskrit. Anil Varan Roy. bhat't'akumaarilasvaami. Language. Not Available.. giitaasandesha. 1972.. Linguistics.

Literature. Literature. 476 pgs. Sanskrit... shriivibhuutibhuushhand-aabhat't'aachaarya. 1967. harivaasamu. Language.. 190 pgs. hariharadvaita bhusanam with karika. parushuram lakshman vaidya... Sudarsana Sarma And Sahitya Siromani. 1932. Sanskrit.. Language. hastalikhitagranthaanukramand-ikaa. Linguistics. Hathayoga.. 1960. Linguistics.. Hari Narayana Apte.. Hari Narayan Apte. Theology. 414 pgs. 238 pgs.. Psychology. shrii manimshradaamodarene. heitriiyoopanishhadi shiqs-aavalli.. Literature. Philosophy.... Sanskrit. k.. Linguistics. Linguistics. Language. 372 pgs. 218 pgs. 112 pgs. goodaavaramishra. 934 pgs. Sanskrit. 0.. Language. Linguistics. hashhachaaratasan'grahan. Sanskrit. Literature.. Religion. Sanskrit. 1954.. Linguistics.. Theology. harikavi alias bhanubhatta. Theology. hashhaicharitamu. 272 pgs. Language. hariharachaturang-gamuu. 1917.. 1934. ramchandra kale m. Sanskrit.. Religion.. 336 pgs. 97 pgs. . 198 pgs. 1900. 1933. 268 pgs.. Philosophy.. Linguistics. 246 pgs. haridiqs-atakrutaa buhaasutravutin..samba Shiva Sastri. Language. Linguistics.. harshcharitamu.. Sanskrit. Language. Bhana Bhatta. bodhendrasarasvati. hanumannaat'akamuu. 1933. Literature. Linguistics. harivamsa. 1954. Religion...s. 1897. Theology. 108 pgs.. ramaswami shastri. Literature. shan'karakrutayaa san'ketaakhyayaa. Sanskrit. Sanskrit. Linguistics Literature. 1935. Linguistics Literature. hat'hayogapradiipikaa dhvitiyo bhaagan. Religion. 102 sanskritdocuments. Bhana Bhatta.. hashhaicharitan. 262 pgs. 249 pgs. 0.org/…/SanskritIIIT. 900 pgs. Literature. Language. shriidevimalagand-i.... Religion.. Psychology.. Linguistics Literature. Sanskrit.. Linguistics. Sanskrit. 264 pgs. hayata. 0. hariharaadotabhushhand-amu.. Sanskrit.... 197 pgs. Linguistics. R. K. Bhana Bhatta. Sanskrit. T P Upadhyaya.. Sanskrit. 1822. 196 pgs. Vasudeva Agarwal. harameikhalaa maahukaviracchitaa sat'ikaa. Linguistics. hashhacharitasan'grahan. haridiiqs-itakrutaa brahaasuutravt'anti.. 336 pgs. Sanskrit. Literature. Sanskrit. Sanskrit.. Religion. 1946. harishrchandropaakhyaanama~. Literature. Literature. 1950. Not Available. Language. hashhaicharitan' eka saan'skrutika gradhyayana. 96 pgs. Sanskrit. hanumanatakam. 941 pgs.2/14/2011 A list of scanned Sanskrit books at III… hanumada rahasyamu hindiivyaakhyaaya vibhuushhitamu hanumatpuujaapaddhati. Language. Literature. Sanskrit. Literature. hariharaadvatabhushhand-amu. Linguistics. Sanskrit. hindhi patra lekhan. 1938. Language. hastalikhitagrandhavivarand-apajjikaayaan. harisowbhaagyamu. higher sanskrit grammar. Sanskrit. 1791.. 0. 1772.. Sanskrit. Sanskrit. bodhendrasarasvati.. 1971. Linguistics. khare kulotpanna harisuunu gand-esha. Bodhendrasarasvati.. gode p k. 1960. 1946.. Theology. shriikrxshhnd-adaasaa..… 112/167 . Language. 1850. 1964. bhanabatta. 718 pgs. Sanskrit. Language. Language. Sanskrit. Sanskrit.. Sanskrit. Subramanya Sastry. 0. 93 pgs.. aachaarya pandd'ita shriishivadattamishrashaastrii.. Literature. Literature.. 38 pgs. Literature... Literature.

382 pgs. Sanskrit. K . Literature. Literature. Linguistics..2/14/2011 A list of scanned Sanskrit books at III… pgs. Literature. Language. shriimadugadgasheipaadhpaadhhyaya. 1931.. Philosophy. Literature... Linguistics. 1825. Sanskrit. 1020 pgs. 1894. 42 pgs. Linguistics. 456 pgs. Sanskrit. 445 pgs. Linguistics. shrii shang-karaachaarya. Vishnu Sarma. hitopadeshan. shrii naaraayand-a pan'nd-d'it'a. Not available. Language. Psychology. iishaavaasyat'iikaaraghunaathariirthiiya. Not Available. Linguistics. iishaadhyaashht'ottarashatopanishhada aadhyantatattachchhaantiyuja.... Sanskrit. Literature.. Sanskrit. Literature.… 113/167 .. Linguistics. paalakaapyamuni. hrxdayapriya of parameshvara. 145 pgs.. Literature. 1981. Language.. Language.. 1928. Sanskrit. Language. Sambasiva Sastri.. Literature. Language. Sanskrit. 122 pgs. 1964.. 62 pgs... Sanskrit. Linguistics. Literature. Linguistics. Sanskrit.... hstyaayuveda book 1. Language. pand-d'ita baladeivapraasaada. 231 pgs. 1932.. 1916. Theology. iishaadyashht'itarashtopanishhada aadyantatatachchhaantiyuj. 1972. Language. Language.. Language. 1933. Sanskrit.. sanskritdocuments. iishvaraanumaanan. Literature. iishaavaasyoopanishhada. Sanskrit...org/…/SanskritIIIT. 192 pgs. hindi zou vacabulary. Psychology. 1935. 1975. ishht'aasiddhi savivarand-aa.. Linguistics. Language. 238 pgs. Linguistics.. Philosophy.... 64 pgs.. 1963. Literature. Language. Sanskrit. ht'hayoogapradiipikaa. hitoopadeisha. 26 pgs. 335 pgs. T. indrajaalavidyaasan'graha. Language. 55 pgs. Religion.. Linguistics. hrxdayaamrxtamu.. Religion. 0. Linguistics. Religion. Sanskrit. Linguistics.. Sanskrit.. shriimatparamahan'sabrahmaanan'dasvaaminaa. 750 pgs. 1917. 1959. jayakaanta mishra. 0. Ganapathi Sastri. iishvaradarshanamu tachchaitatu. Language. 1980. hitopadeshan. Philosophy. shriijaganaathapand-d'ita. 1915. 152 pgs.. Literature. yashaavanth vaasudhev paatnkar. 103 pgs. Hiriyanna. Sanskrit.. khemaraaja shriikrxshhnd-adaasashreshht'inaa. 0. Language. Literature. 306 pgs. Sanskrit.. 266 pgs. Sanskrit. pandashiikaropahvavidvadddaralaqs-kand-asharma. Literature. Not available. 42 pgs. Sanskrit. Theology. hindusthaanakaa dand-d'asn'grah. Linguistics. Technology. i tsin'ga aura bhaarata yaatra. 0. Sanskrit. 166 pgs. M. hitopdesh. 574 pgs. 0. ishaadidashopanishhada bhaashhya sametamu. Psychology. 413 pgs. Sanskrit. 138 pgs. hoorabijnaanrahasyam jyotishkalpabriksha.. 0. iishaavaasyopanishhatuu khan'd'aartha.. 163 pgs.. Technology. 1908. naarayanachandra jyotirbhushan bhattacharya. Sanskrit. Sanskrit.. vasudevasharamand-aa. irishadi dashopanishada. Theology. shriinaaraayand-apand-ita. Not available. Literature... Linguistics.. shankar bhashya.. Sanskrit. iishvarapratipattiprakaasha qs-imadhusudanasarasvatiprand-ita.. indraprasthaprabandha. Sanskrit. dasharatha sharma. Linguistics. Sanskrit. Literature. Sanskrit. pandit narayanan. Literature.. vimuktaatma. Language. Linguistics. Language.. Language. 1933. ishht'asiddhi. Linguistics.. 1921.... Literature.

.. Madhvacharya. 242 pgs. be raamachanddrasharmand-aa.. Literature. 357 pgs. maharshhi shriijaiminimuni. shriimadvachaasa. Language. shrii shaantisuuriisvaraji. Literature. 1938.... 42 pgs.. Language. aachaarya shrii pan' lashhand-alaala bhvaa. 0. Linguistics. 1918.. v. 0. Linguistics.. Dr R Latcha Raman. Theology. Sanskrit. ishvara pratyabhijna vimarshini vyaakyaayasahitamu bhaaga 2. Philosophy. 1992. jaatakapaarijaata adhyaaya 11 15. kai jyotishhaachaarya dvaarakaanaatha naaraayand-a raaje.org/…/SanskritIIIT. Sanskrit. 1873. 0. jaiminiiyasuutraand-i subodhiniit'iikaasametaani prathamamadhyaayadvayan' sat'iikamagriman. jyotirgand-itamu.. Literature. sanskritdocuments. Literature.. Linguistics. 0. Linguistics. 352 pgs. Sanskrit. 405 pgs.. 178 pgs. shriikaalidaasa. jiind-iidvarahavanapaddatin' san'praaqs-and-avidhitra. Venkataramaiah. LANGUAGE. Sanskrit. utpaladeva. Raghavendra Acharya. Sanskrit. jiivasaj'jivijnaat'akamu. Linguistics Literature. Vacant. Psychology. Unknown. Linguistics... krishnadevaraaya. 1973.. jaataka ratnaakara. Language.. Religion. jiivavichaara prakarand-amuu. jauminiiyanyaayamaalaa Part I... jaiminiiyashrotasutravrutin. 1934.. sa raajavallabha sastrigala. LINGUISTICS. Linguistics. 380 pgs. Language. Literature. Sanskrit. Ramakrishna Bhatt. 1969... Language. jaambavati parinayam. itihaasasamuchchaya. Literature. Literature. Linguistics. jaanakiiparind-ayanaat'akamu.. Language. Literature. jaa ta ka t'a ka thaa padamo bhaago. Vacant. jyotirvidaabharand-aamu sukhabodhikaa. 1980. Sanskrit. 397 pgs... Geography. jaagadiishiivyadhikarand-amu. 428 pgs. Sanskrit. Theology. Sanskrit. 290 pgs. Sanskrit. Literature. 296 pgs. Sanskrit. pundit ramanatha anda sarma.. Sanskrit. 1921... 0. Pannalal Jain.. 1921. Sanskrit. 84 pgs. 1844. 1937.. 1957. Literature. jaiminiiyaarshheya jaiminiiyopanishhada braahmand-e. History. ishwarapratyabhijnaa vimarshinii. Religion. Theology.... Religion.. 468 pgs. Raghu Veera. pn' . 160 pgs. Sanskrit.. 295 pgs. Biography. jiivandharachampun.. Literature. 133 pgs. Literature. 322 pgs. 1969. Religion. Language. Sanskrit.… 114/167 . Language... Sanskrit. jaatakaabharan. Language. Linguistics. Sanskrit. Sanskrit. Not available. Sanskrit. Not Available. 288 pgs. subrahmanyashastri. 1890. jayapura raja vamsyavali.. Vacant.. R. Linguistics. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… ishvara pratyabhijna vimarshini vyaakyaayasahitamu bhaaga 1.. Language. 476 pgs. -. 52 pgs. 0. Sanskrit. Sanskrit. 1891. 178 pgs.. 0. 365 pgs.. Language.. utpaladeva. -. iya Kunadali Vigyan. 428 pgs.. 1947. 1996. jaatakaabharan. Literature.. jaiminiiyanyaaya maalaavi.. Sanskrit. 298 pgs. LITERATURE. 434 pgs.. 1904. Sanskrit. utpaladeva. Linguistics.. Sanskrit. Sanskrit.. Language. Theology. Philosophy.... jaagadiishiisaamaanyaniruttki (manuscript). pat't'abhiraama... 82 pgs. Linguistics.. Sanskrit. Sanskrit. Linguistics.. jagadaguru shriisachchidaanandasivaabhinava nusin'habhaaratiivijayakaavyamu. Sri Meethalal Himmatram Oojha. Religion. 446 pgs. Sri Kasinatha Sastri. janmapatra vidhaanamu sodaaharand-a tattvaprabhaa hindiivyaakhyaaya. 1966. A Collection Of Essays On 21 Temples Located In Tamil Nadu.

0. Vishwanatha Panchanan Bhattacharya. 1803. Mahadev Shivaram Apte. 1984. Sanskrit. Literature. Literature. Literature. kaalidaasakaavyasaurabhamu.org/…/SanskritIIIT.... kaashaakrxtsna dhaatuvyaakhyaanamu naat'akat'ikaa san'skrxtaruupaantaramu. kaashiikhan'd'an' t'iikaa.... Sanskrit. 422 pgs. Sanskrit. Language. Sanskrit. 194 pgs.. 0. kaarakasan'bandhodhyota. 854 pgs. kaadambarii kalikaataaraajadhaanyaan. manubhai s. Not available. Philosophy. 1951. 1939. Literature.. Literature. Literature. Linguistics.. shriichannaviirakavi. Linguistics.. kaalatattvavivechanamam' Part I. 0. shah. Psychology. Linguistics. 1956. Linguistics. Literature. Linguistics. Literature. 419 pgs. Raghunatha Bhatta. Literature. 218 pgs. vishvanaatha panchaanana bhatta. sanskritdocuments.. Sanskrit. 0. 1973. Language. Sanskrit.... Language.. kaamasuutramu t'ikayaa sametamu. Sanskrit. Not available. Linguistics. 1895. kaadambarisaaraa.. shriiraamaanan'dayativara. 344 pgs. 0. Sanskrit. Literature. 1932. Sanskrit. 516 pgs.... Literature. Sanskrit... Literature. LANGUAGE. kaamandakiiyaniitisaara bhaashhaat'iikaasahita. 1965. Language. kaalagn-aanamu bhaashhaat'iikaasametamu. 556 pgs.2/14/2011 A list of scanned Sanskrit books at III… 1988. Language. Linguistics.. 64 pgs.. rabhaasanan'di.. Sanskrit.. Sanskrit. Sanskrit. Linguistics. 1900. Literature.. Not available. Language. kaarikaavalii. Sanskrit.. 0.. 98 pgs. shriimanmahaamahopaadhyaayavidhyaanaathapanjchaananabhat't'aachaarya.. Linguistics. Not available... Literature.. Social Sciences. jyotishhatattvasudhaarnd-ava bhaashhaat'ikayaa. 374 pgs... Raghunatha Bhatta.… 115/167 . kaarikaavali nyaayasiddhaantamuttkaavalii cha chitravali. Sanskrit. Religion. Sanskrit. kaamasuutramu. 280 pgs. kaashikaa. kaadambarii. Social Sciences. 286 pgs. kaalaamrxtei savyaakhyaanei.. Literature. Linguistics. 89 pgs.. Sanskrit. LITERATURE. 596 pgs. 108 pgs. shriivishvanaathapanj-chaananabhat't'aachaarya. vishvanaathapachaana.. Language. kaarikaavali siddhanta muktavali. 338 pgs. Language. Language. Sanskrit. Linguistics. Sanskrit. 350 pgs. Sanskrit. Language.. Sanskrit. kaarikaavalii muktaavalii. shriivaatsyaayanamuni. Language. shriivishvanaathapanj-jaananabhat't'aachaarya. 90 pgs. kaalatattvavivechanamam' Part Ii.. Literature. 228 pgs. kaarikaavali nyaayasiddhaantamuttkaavalii... Natural Sciences. 0. Language. 0. Peterson... 1915. Literature.. kaarikaavali siddhaantamukttaavali t'ippand-ii. Sanskrit. Linguistics. 560 pgs. 392 pgs. daralaalasharmand-a. 1903. Linguistics. 0. 1933. Linguistics.. jyotishha shiromand-i bhaaga duusaraa drxshht'aan'ta vibhaaga 4625 janmakun'd'alike shaata nirayana chitraan'sha. Language. Linguistics. Language. Psychology. 1924. Theology.. 1848. shrii chokkanaatha makhi. 675 pgs.. kaarikaavalii nyaayasiddhaantamuktaavali. 360 pgs. 1889. kaan'timati parind-ayamu. Vishwanatha Panchanan Bhattacharya. durgaaprasaada. Sanskrit. Sanskrit. Language. Theology. Religion... Language. 534 pgs. Linguistics. Sanskrit. Not available.. Philosophy. vidvaanu khan'd'avilli suuryanaaraayand-ashaastrii. 306 pgs. LINGUISTICS.

Language. Literature. kaavyadapaind-an. 1933. Econo Politics. Ranga Swamy.. Linguistics. kaashyapa san'hitaa. Sanskrit. aaryeindhra sharma. kaavyamaalaa ashht'amoguchchhakan. Literature. Sanskrit. Language.. Ranga Swamy. 1938. 1952... sanskritdocuments. 540 pgs. 1953. Linguistics. Sanskrit. mahaamahopaadhyaaya shriikarkaachaarya... kaavyaalaa chatudaishoo gun'chchhakan. 1948.. kaavyaavali ke ratnaapaanchaalikaa. Sanskrit. Sanskrit. Literature. Sanskrit. kaashmiirasandhaanasamudyama. 1948.. Literature. 32 pgs. 1933. shriijagadiishachandra chat't'opaadhyaaya. kaashikaa dvitiiya bhaaga.. Not Available. Philosophy. LITERATURE. LANGUAGE. shriiratnaakara. 1941. Literature... . Language. 100 pgs. Linguistics. 1908. Literature.. Linguistics. 220 pgs.. kaasmiiragranthaavali Vol. Sanskrit. kaatyaayanashrautasuutramu bhaashhyasahitamu. 82 pgs. kaavyadiipikaa. 312 pgs.. 0. Literature. Sanskrit. Sanskrit. Linguistics. Language. Sanskrit. Language. chat'arjii. Language. Language. 160 pgs.. Sanskrit.. 102 pgs. Sanskrit. 122 pgs. 1936.. Sanskrit. 1903. Literature. 1292 pgs.. Literature.. kaavyaanushaasanamuu.. Narayana Iyyar. durgaiprasaadena. Sanskrit.. Literature. kaashmiiragranthaavalii prathamakhand-d'amu. -.. Sanskrit. J. 69 pgs. Linguistics. kaavyaadarsha. Language. 174 pgs. 624 pgs. Sanskrit.. 1941. Sanskrit. S. Literature. Language. kaashikaand-d'a grantha. Linguistics. kaavyaalan'kaarasaarasan'grahan. 1911. Sanskrit. 905 pgs. Sanskrit. Language. 1924.. Psychology.. 400 pgs. 214 pgs.. parameshvaraananda.. Singabhupala. Narayana Daso Banhatti. Language. durgaiprasaadena. Linguistics. Language. 484 pgs.singaraiyengar. Not available. 238 pgs. 712 pgs.. kaavyadarshanamulyam. Not available. Sri Yathiraja Sampathkumaramuni. Sanskrit.. Linguistics.. LINGUISTICS. pand-d'itavaravaamana. 70 pgs. 1953. kaavyaalan'kaarasuutrand-i svavrxttisamalan'krxtaani.. 246 pgs. Linguistics. Linguistics. maithilashriigang-gaanandakavindra. Linguistics.. kaavyad'aakinii... Literature. Theology. Sanskrit. vaagbhat't'aa. LITERATURE.. 114 pgs. S. kaavyamaalaa dashamoguchchhakan. 176 pgs.2/14/2011 A list of scanned Sanskrit books at III… kaashikaa.iii.. Linguistics. kaashyapajnaanakaand-d'an. Linguistics. Linguistics Literature.. kaavyamaalaa haravijayamu.. Linguistics. 1894. Language. Linguistics. Literature...si. kaavya ke ruupa. Language. 0. kaavyaalan'kaarasuutrand-i svavrxttisamalan'krxtaani. 235 pgs.. 1958.. Temples. Literature... pand-d'itavaravaamana. kaashyapasan'hitaa. 1925. Temples. shivad'at't'a. Literature.. 1968. kaavyakalaapan. Sanskrit. 216 pgs... 1915. kaasyapasan'hitaa.. Sanskrit. Sanskrit... Not available. 1911. Sanskrit. Literature.org/…/SanskritIIIT. Religion.. LINGUISTICS. 327 pgs. 0... 1970. Literature. Sanskrit.. Literature. gulaabaraaya. 270 pgs. Language. Language. Sanskrit. Linguistics. Linguistics.… 116/167 . Language.. 359 pgs. 1891. aachaaryadand-d'i. Banhatti N d. Language. Linguistics. kaavyamaalaa Part X.. Sanskrit. LANGUAGE. je. 0. 0.

268 pgs. 165 pgs.g. Literature. kaavyaprakaasha krxtayaa vivrxtti. 80 pgs. Literature. 244 pgs. Literature.. mammat'aachaarya. kamakalavilas. 280 pgs. Sanskrit. kalaamaadhavaa. 184 pgs.. Sanskrit. Natosa sastri. suryanarayana sastri.org/…/SanskritIIIT.. kanadasiddaantachandrika. Linguistics. Language.. Language.. Sanskrit.. 1932. 207 pgs.. Sanskrit.. Literature. 1936. Linguistics. shriimammat'aachaarya. Religion.. Sanskrit. 608 pgs. kaing-karyaratnaavali. 39 pgs. LANGUAGE. sanskritdocuments.... Theology.. Literature. Linguistics.. 0.. Sanskrit. naaraayand-aacharya. Literature. Not Available. Literature. Sanskrit.. Language. Linguistics.. Sanskrit. Literature. kalyaand-avaartikamuusiddhaantaniddddaana.. kaavyasaarasan'graha. 68 pgs. Literature. kaavyaprakaashakhand-d'ana.… 117/167 . 1963... Language. vinnakoot'a maadhava raavu.. kalyaand-apiiyuushhavyaakhyaasametaa pan'chadashii tattvavivekaprakarand-amu. 1895. Sanskrit. 477 pgs. LITERATURE. Sanskrit. Technology. topalli ven'kat'araamadaivagn-ena. Sanskrit.. Not available.. Linguistics. 1893.. Sanskrit. durgaiprasaadena. kaavyaprakaasha naageshvarii t'iikayaa samalang-krxta... Literature. 1967. Sanskrit. kadambari kalyanam. Sanskrit.. kaavyaprakaasha kaavyaprakaashavistaarakaaravyayaa vyaakhyaaya vibhuushhita. Literature. Linguistics. Sanskrit. LINGUISTICS.. Literature. Poems. 2002. Language. Not available. 1986. mahaamahopaadhyaayashriigovinda. Somashambhu. 1939. kaavyashilpamu.. narasimhakavi... Language. kaavyapradiipa. . 1838... kadambari. kaavyonmoshhan.... LINGUISTICS.. 1968. Sanskrit. Literature.. 1812.. Linguistics. kaavyaprakaasha. kadhambari. Language. 143 pgs.. kadaliimanj-junaathamaahaatmyamuu. 0. 372 pgs. 178 pgs. Linguistics.. paravastukrxshhnd-amaachaarya. 296 pgs. Sri Krupa Chanda.. Language. 1993. 299 pgs.. Language. Language. . keshava. 0. -. kalapasuutramu. Language. Literature. shriimammat'aachaarya. bhaaradvaja. Sanskrit. Sanskrit. 1918. Literature. 584 pgs. Linguistics. Sanskrit. K. 0. 0. 1913. 1932. kand-aisundarii. 280 pgs. Rasikalal Chotalal Parikh. Linguistics. Not Available. punyananda. Language. 524 pgs. 1918. banabhatta.. Linguistics. Linguistics. . Language.. Sanskrit. 1976. Linguistics. Linguistics. Chandrakanth.. 329 pgs. 0. kamaikaarad'akramaavalii. Language. 166 pgs. Linguistics. Sanskrit. Linguistics. Language. karand-aratnamu subodhinii samaakhyavyaakhyaaya. Language. Sanskrit. Literature. kar^mapradiipa. 224 pgs. Language. mammat'a. Linguistics. Sanskrit. kalpadrukosha Vol II. t'i gand-apati saastri.. 1947. 0. 770 pgs. Literature.. Harishchandra Renupurakar. 1967.. Language. Literature. Linguistics. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… kaavyamaalaa navamoguchchhakan.. 60 pgs. Sanskrit. LANGUAGE. Sanskrit. Sanskrit.. Sanskrit. kalapurnodaya. Sanskrit. 1980. kanakaavalii. Language. 329 pgs... Social Sciences. kaavyaprakaasha naageshvarii t'iikayaa samalang-krxta. 616 pgs.. 502 pgs. 1932.. 311 pgs. shriibihand-a. Linguistics.. LITERATURE.. Natural Sciences. 631 pgs. Literature..

seetharam Jayramjoshi... Linguistics. Linguistics. Language. kenoo upanishad. 512 pgs. 0. rudraskanda. 1911. Sanskrit.. Sarat Chandra Sastry. Linguistics. 1913. 730 pgs. 480 pgs. Sanskrit.. rangaraamanuja. Language. 54 pgs. Language. Linguistics.. 396 pgs. Language.. 57 pgs. bhat't'a someshvara. Linguistics. bilhana. Shriipat't'abhiramachara~ya. Language.. 1921. keshava saahitya mein' samaaja san'skrxti evn' darshan. 230 pgs. Willem Caland. Language.. Language. kathaakallolini paand-iniiyalaukikavyaakarand-asamaapaniiyaa. rudraskanda. khaadiragrxhyasutrama~. 0. Sanskrit.. 174 pgs. 184 pgs... Theology. Literature. 104 pgs.. 133 pgs. Sanskrit. kavyaprakash Rahasyam.k ramachandra aiyar... kaumarabhrityam with navya balaroga. Language.. Sanskrit.. 1978. ubhata.. Literature. kat'hakagrxhyasuutran' bhaashhyatrayasaarayutan.. 1925.. Dr.. Linguistics. Language. Sanskrit.. khaadiragrxhyasuutramu vyaakhyaayasahitamu. Language. 190 pgs. Literature. 1968.. Linguistics. t'i ara chintaamani. Language. vikrama deiva varma. Language. Language. kaushhiitaki braahmand-opanishhatu diipikaa. 1925. Linguistics.. swami satchidanandendra saraswathi. Linguistics. 344 pgs.. d'aa en gn-aanappa naayud'u. Sanskrit. 1987.… 118/167 . 1966. 1881. 158 pgs. Sanskrit. 1942. aar. Philosophy. 0. Psychology. puraatattvaachaarya jinavijaya muni. kaviindraacharyasuchi patramu. 322 pgs. keivalyaratnamuu.. Sanskrit.. Literature. sanskritdocuments. Literature. Linguistics. Literature. 2000. Linguistics. raghuveera prasad trivedi. Linguistics. 106 pgs. khaadiragrxhyasuutramu vyaakhyaayasahitamu. Linguistics. 61 pgs. 152 pgs. karnd-aamrxta prapaa. Language. Sanskrit. Literature. Literature. shang-karaananda. 368 pgs. Theology. Linguistics. Linguistics. pandit durgaprasada ed. Literature. Literature.. Theology. Literature. Sanskrit.... kavayadarsha. 217 pgs. swami satchidanandendra saraswathi. 1964.. Sanskrit... Literature. kaun'shhiitakagrxhya suutraand-i. Literature. Unknown. 204 pgs. 78 pgs.org/…/SanskritIIIT. Literature. Sanskrit. Not available. kavyanusasana. Technology. Literature. Sanskrit. Linguistics.. siitaaraaamasuuri.. 98 pgs. Linguistics. Sanskrit. 62 pgs. Literature. Religion.. 1956. T. Religion. Linguistics. Sanskrit... Sanskrit.anann'ta krishhana saastri. Literature. Linguistics. mahaakavi shriideveshvara.. Literature. 1913.. kavimanoranjakachampu.. Pt. kathaka upanishad. 185 pgs. 1963. kenopanishad bhashya. Sanskrit. 194 pgs... Language. Language.. sankara rama sastry c. kavikalpalataa. Vasudeva Jnana Muni. Sanskrit.. Literature. Literature. 1895. Language.. Sanskrit. Sanskrit.. Sanskrit. Linguistics. Sanskrit. Religion. Language. raamasharand-ashaastrii.. Sanskrit. 1885. Literature.. kavikalpalataa. Sanskrit. karnd-akutuhala.. kaumudiisharadaagamamu dvitiiya bhaagamu. kelikutuuhale prathamastarang-ga. 1913.. 1942. kavalamkara sara samgraha.. kavalayananda. Sanskrit.. kavyamala. Language. Language. 1950. 1932. Sanskrit. 1955. Linguistics.. 1944. 1961... Language. 402 pgs. Sanskrit. Literature. acharya hemachandra.2/14/2011 A list of scanned Sanskrit books at III… karnasundari. 140 pgs.

Sanskrit. Religion. 204 pgs.. kriyaasaara upadeshachatushht'ayaatmaka prathamo bhaaga. Sanskrit. kiraataarjuniyamu.. 1917. Sanskrit. Sanskrit..v.. 428 pgs. Linguistics. Economics. Language. shriiniilakand-t'hashivaachaarya. Language.. Linguistics.. 217 pgs. Language. Sanskrit. 442 pgs. Linguistics. shriiniilakand-t'hashivaachaarya. Sanskrit. sanskritdocuments.. Sanskrit.. 434 pgs. kinkind-ii maalaa. 1966. rudraskanda.2/14/2011 . Language. Language.. kruushhnd-ayajuvaidiyataittiriiyasan'hitaa bhaaga 8. 502 pgs. shriishriiharshha. 1905... Linguistics. 580 pgs. 294 pgs. hari naaraayand-a aapat'e. Language.. 1940. Language.. Bhrga Samhita. Literature.t. Theology. khilaadhikaaran' bugusan'hitaa. Ramanuja Swamy.. Sanskrit... Language. 438 pgs. valmiki. 315 pgs. Bhrugu Maharshi.... 1904. Linguistics. kanhaiyaalaala krxshhnd-adaasa. 586 pgs. Linguistics... 100 pgs. Literature. kriyatmaka ausadahiparichaya vijnan.. 128 pgs. shriiniilakand-t'hashivaachaarya. Linguistics. Literature. krxshhnd-a bhakti saahitya vastu srota aura san'rachana.. Literature. Language. 1997. Literature. 586 pgs. kowt'iliiyan' arthaishaastramu.… 119/167 .. Linguistics... 1905. kriyaasaara upadeshachatushht'ayaatmaka prathamobhaaga. THEOLOGY. khand-d'anakhand-d'akhaadhyamu. Literature.... Sanskrit. chan'd'iiprasaada sukla. Religion. Linguistics.. krishhnd-a yajurveidiya taitiriiya san'hita. 1954.... Language. Jha. Sanskrit... Sanskrit.. 1934. Language. Theology. Kasinatha Sastri Agase. 0. Literature. Sanskrit. 1917. 642 pgs. 1954. Sanskrit. Language. Language.p. pg A list of scanned Sanskrit books at III… khaadiragrxhyasuutramu vyaakhyaayasahitamu. Mahadeva Sastri. G. Literature. 1913. Theology. A. Literature. khaadiragrxhyasuutrn' rudraskandavyaakhyaasahitan. 1905. Sanskrit. Sanskrit. 522 pgs. Psychology. Language. kaasmiirika keishava bhat't'a. Linguistics. Language. 542 pgs... Sanskrit. Sanskrit. Sanskrit. 868 pgs. krama diipika. Literature. 1964... 584 pgs. 318 pgs. 248 pgs. visnutrata. kiraataarjunaayamu. kokasandesa..y. 1901. kishhkin'dhaa kaand-d'amuu.. 0.. 1957. Ganapati Sastri. bhaaravi. Sanskrit. Literature. Linguistics. Sanskrit. 1924. Technology. Sanskrit. Samhita. khand-anakhand-akhaadhamu. 1954. 125 pgs. sri vishvanath divedi. Linguistics. 1937. bhaaravi. Sanskrit.. Philosophy. kiskindhakanda. Linguistics. 1913. RELIGION. Literature. Literature.. Literature. Sanskrit. 1936. kriyaasaara panj-chamaadichaturdashopadeshaanta dvitiiyobhaaga.... RELIGION. kriyaadhikaaran' bugusan'hitaa. Literature. Linguistics.org/…/SanskritIIIT. 88 pgs. Sanskrit. Sanskrit. 1965. 1953. khand-d'anakhand-d'akhaadya Part 1. hari naaraayand-a aapat'e.. d'an' chandrabhaana raavata. Sanskrit. kaashinaatha saastri. krxshhnd-aayajuvediiyataittiriiyasan'hitaa Kanda Ii Part Iv. 584 pgs. 588 pgs. shriiniilakand-t'hashivaachaarya.. Literature.. Religion. krishhnd-a yajurveidiya taitiriiya san'hita. 180 pgs.. kruushhnd-ayajuvaidiiyataittiriiyasan'hitaa_bhaaga_7. Linguistics. Mahalinga Sastry. kriyaasaara upadeshachatushht'ayaatmaka prathamo bhaaga. 0. THEOLOGY. kaashinaatha saastri.

A listpg of scanned Sanskrit books at III… krxshhnd-aayajuvediiyataittiriiyasan'hitaa Part Ii. 0. Sanskrit. 1956. Sanskrit. Sanskrit. bhakta Darshan. kusumaanj-jali shriimadudayanaachaar^yavitachita. Sanskrit. 1901. Linguistics... Linguistics.. Sanskrit. Literature. Literature. 646 pgs.. Linguistics.. kutuuhala vrxtti. kun'damaala.. Language. 300 pgs.. Bhatta Lakshmidhara. 420 pgs. 1912. krxshhnd-ayajuvaidiiya taittiriiyasan'hitaa ddhitiiyo bhaaga. 1977. Literature. Language. Sanskrit. ayendra sharma gen ed. 1960.. krxshhnd-ollaasa champuukaavyaprakaand-d'amu. krxyajuraveda. Theology.... 297 pgs. shriimatsaayandaachaarya. Linguistics.. krxshhnd-ayajuvaidiiya taittiriiyasan'hitaa prathamo bhaaga. Bhatta Lakshmidhara. Linguistics. bhat't'a lakshmidhara. Linguistics.org/…/SanskritIIIT. Sanskrit. ksemendra. Language.. Kasinatha Sastri Agase. Sanskrit. krxtyakalpataru niyatakaalakaand-d'an' Vol 3. Literature.. 358 pgs.2/14/2011 g . Literature. Sanskrit. 478 pgs.. Language. Psychology.. 1922... Linguistics. 1901. 1941. Theology. Literature.. krxtyakalpataru shraddhakaand-d'an' Vol 4. Literature.. 0. kutuuhalavrxtti. shriiratnapaand-i.. Literature.… 120/167 . Language.. Language. kalidasa.. 1961. Sanskrit. krxshhnd-ayajurvediiyataittiriiyasan'hitaa bhaashhyasametaa etatpustakamu. Sanskrit.. 1901. kundmala. ksemendralahukavya sangrha. Sanskrit. Linguistics. kusumaanj-ajalibodhanii. 468 pgs. 390 pgs. Language. krxshhnd-ayajura~vediiyataittiriyasan'hitaa Shhashht'ho Bhaagah.. Sanskrit. Literature. Linguistics. Literature. Linguistics. sanskritdocuments. 1932. Sanskrit. 646 pgs. Philosophy.. Religion. kumarasambhava. Language. Sanskrit. 1950. Sanskrit. 1944. krxshhnd-ayajuvaidiiya taittiriiyasan'hitaa trxtiiyo bhaaga. Language. kumaarasambhavan' mahaakaavyamu pun'savaniivyaakhyaaya sanaathiikrxtamu. Sanskrit. Sanskrit. 268 pgs. Sri Kasinath Sastri. Literature. 486 pgs... Linguistics. 32 pgs. krxtyakalpataru grahasthakan'd'aa vol 2. 1948.. Religion. Sanskrit. Bhatta Lakshmidhara. 402 pgs. Literature.. Literature.. Sanskrit. Religion.. 580 pgs. Literature. Linguistics. Bhatta Lakshmidhara. Sanskrit. Sri Varadaraja Mishra. Language... Social Sciences. Theology. Linguistics. 545 pgs... krishna kumar davan. Sanskrit.. Philosophy. Pandit Laxman Sastri Dravid. Sanskrit. 354 pgs. Sanskrit.. 566 pgs. 1961. 1901. Linguistics. soomanaatha. ksemendra. krxshhnd-ayajuravediiyaa kapishht'ala kat'ha san'hitaa. Language. krxtyasaagara. Not Available. Linguistics. Literature. 178 pgs. 308 pgs. 0.. 1951.. krxtyakalpataru daanakaand-d'an' Vol 5. 1908. Social Sciences.. Literature. Sanskrit. 659 pgs. 1950. dinnaaga. 406 pgs. Language. mahaakavishriikaalidaasa. Linguistics.. 1962. 276 pgs.. Raghu Vira. shri paa raa subrahmand-yashaastriind-aa.... Social Sciences. 1922. varadaraaja. krxtyakalpataru raajadhar^makaand-d'an' Vol 11. 1943. Sanskrit. Sanskrit. 1900. 58 pgs. Language. 646 pgs. 340 pgs. Language. Language. Social Sciences. Linguistics.. Language.. Religion. 176 pgs. Sri Kasinath Sastri. kusumaanj-jalibodhani. 1937. Language. shrii vaasudeivadiiqs-ita.. Shriimatsaayand-aachaara~yaa. kushhnd-agiiti. Theology. Psychology.. Sri Kasinath Sastri..... Literature. 422 pgs.

2/14/2011

A list of scanned Sanskrit books at III…

kutuuhalavrxtti... bhakta Darshan, Language. Linguistics. Literature. Sanskrit, 1960. 526 pgs. kutuuhalavrxttisaarasam'graha... Not Available, Philosophy. Psychology. Sanskrit, 0. 368 pgs. kuvalayaananda chanddraalokasahita alang-kaarachandrikaavyaakhyaaya cha vibhuushhita... budhavarashriimadappayyadiiqs-ita, Language. Linguistics. Literature. Sanskrit, 1833. 282 pgs. kuvalayaanandachandrikaachakairan'alad'akaaratatvaj'ja... Venkatachari, Art. Sanskrit, 1943. 319 pgs. kuvalayaanandakaarikaa alan'kaaradiipikaavyaakhyaayaa san'valitaa trxtiiyaavrxtti... shriiyutaashaadharabhat't'a, Language. Linguistics. Literature. Sanskrit, 1927. 114 pgs. kyo uttaraadhai... Madavacharya Sastri, Religion. Sanskrit, 1982. 693 pgs. laayanashrautasuutramu vrxtti... naaraayand-a, Language. Linguistics. Literature. Sanskrit, 1917. 471 pgs. laghu upanishad... narayana swamy aiyar k tr, Religion. Theology. Sanskrit, 1967. 302 pgs. laghukaumudii... varadaraaja, Language. Linguistics. Literature. Sanskrit, 0. 415 pgs. laghukomudii... 0000, Linguistics Literature. Sanskrit, 0. 147 pgs. laghumaanasamuu... Gangadhar Bapurao Kale, Philosophy. Psychology. Sanskrit, 1944. 40 pgs. laghupaaniiyamu... Rajaraja Varma, Sanskrit Grammer. Sanskrit, 1911. 228 pgs. laghupaaraasharii bhaashhya... diivaana raamachandar kapuura, Religion. Theology. Sanskrit, 0. 396 pgs. laghusabendusekjara... nagojibhatta, Language. Linguistics. Literature. Sanskrit, 1927. 846 pgs. laghushabdedndushekhara vyaakarand-avibhaage saptadasan'pushhpamu napadaantasuutraanto bhaaga... mahaamahopaadhyaayashriinaageshabhat't'a, Language. Linguistics. Literature. Sanskrit, 0. 264 pgs. laghushabdendukalaa... pand-d'ita shrii shobhaakaanta jhaa, Religion. Theology. Sanskrit, 1970. 144 pgs. laghushabdendusekhara... khuhiijhaa, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1938. 264 pgs. laghushabdondushokhanamulapuvedhve... , . Sanskrit, 0. 163 pgs. laghushabdondushokhanamulapuvedhve dvitiyo bhaagaha... , . Sanskrit, 0. 163 pgs. laghusiddaantakomudii... Kaushika Venkatanarasimhachari, Linguistics Literature. Sanskrit, 1937. 186 pgs. laghusiddanta kaumudi... varda raja, Language. Linguistics. Literature. Sanskrit, 1948. 180 pgs. laghusiddhaantakaumudii anuvrxttyaadisuuchakena t'ippand-ena pratyaahaara varnd-avyavahaaragnaapaka koshht'akau... shriivaradaraajapand-d'ita, Language. Linguistics. Literature. Sanskrit, 1894. 176 pgs. laghusiddhaantakaumudii san'skrxta hindiit'iikaa... shriivaradaraajaachaarya, Language. Linguistics. Literature. Sanskrit, 1970. 382 pgs. laghusiddhaantakaumuditattvaprakaasha sottaraa prashnaavali 20 varshhaand-aan' prashnapatrasahita... pand-d'itashriiraamagovindashukla, Language. Linguistics. Literature. Sanskrit, 1974. 248 pgs. laghustuti... t'i gand-apati saastri, Language. Linguistics. Literature. Sanskrit, 1917. 63 pgs. lalitamaadhavan' naat'akamu t'ikayaa... shriiruupagoosvaamiprabhupaada, Language. Linguistics. Literature. Sanskrit, 1969. 310 pgs. lalleishvariivaakyaani... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 36 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

laqs-and-aavimashe... V. Subrahmanya Sastri, Philosophy. Psychology. Sanskrit, 0. 32 pgs.

121/167

2/14/2011 A Sastri, list of scanned Sanskrit books at III… laqs and aavimashe... V. Subrahmanya Philosophy. Psychology. Sanskrit, 0. 32 pgs.

laqs-miisahasramu... Not available, Religion. Theology. Sanskrit, 0. 813 pgs. laqs-miitantramu... vi. krishhnd-amaachaarya, Language. Linguistics. Literature. Sanskrit, 1959. 389 pgs. laqs-miitantramuu volume 87... pan'dita vi krxshhnd-amaachaarya, Language. Linguistics. Literature. Sanskrit, 1959. 391 pgs. lat'akamelakamu... shriishadgadhara, Language. Linguistics. Literature. Sanskrit, 1900. 36 pgs. laugaaqs-i grxhya suutraand-i bhaashhyopetaani dvitiiyobhaaga uttaraarthamu... devapaala, Language. Linguistics. Literature. Sanskrit, 1937. 460 pgs. laugaaqs-i grxhya suutraand-i devapaalakrxtabhaashhyopetaani Vol 2... Madhusudan Kaul Shastri, Language. Linguistics. Literature. Sanskrit, 1934. 448 pgs. laukikanyaayaanj-jali dvitiiyobhaaga... colonel g a jacob, Language. Linguistics. Literature. Sanskrit, 1925. 94 pgs. laukikanyaayaanj-jali trxtiiyobhaaga... colonel g a jacob, Language. Linguistics. Literature. Sanskrit, 1911. 158 pgs. lectures on patanjali s mahabhasya vol I... subrmanya sastry p s, Language. Linguistics. Literature. Sanskrit, 1944. 384 pgs. life divine... aurobindo, Language. Linguistics. Literature. Sanskrit, 1942. 160 pgs. liilaavatii uttaraardharuupo dvitiiyobhaaga... shriimadbhaaskaraachaarya, Language. Linguistics. Literature. Sanskrit, 1937. 180 pgs. ling-ganushaasanamam... Panini, Philosophy. Psychology. Sanskrit, 1885. 192 pgs. ling-kapuraand-amuu... mahaarshhi vedavyaasa, Religion. Theology. Sanskrit, 1885. 848 pgs. list'as aaph manuscript's... Not Available, General. Sanskrit, 1925. 106 pgs. lokaparalokakaasudhaara bhaaga 2... hanumaana prasaada, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 0. 244 pgs. lokaparalokakaasudhaara bhaaga 4... hanumaana prasaada, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 0. 288 pgs. lokikanyaayaatralin' tutiyo bhaagan... jaakobha, Language. Linguistics. Literature. Sanskrit, 1904. 169 pgs. maadava vijaya... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 457 pgs. maadhamaahaatmaya... , Religion. Theology. Sanskrit, 0. 134 pgs. maadhavanala kaamakn'dalaa... shriikrxshhnd-adaasaatmaja, Language. Linguistics. Literature. Sanskrit, 1889. 214 pgs. maadhaviiyaa dhaatuvrxtti paand-iniiyadhaatupaat'havyaakhyaanaatmikaa... shriisaayand-aachaarya, Language. Linguistics. Literature. Sanskrit, 1964. 720 pgs. maadhurii darshanamu... raayaproolu subbaaraavu, Language. Linguistics. Literature. Sanskrit, 0. 69 pgs. maadhvamukhabhad'ga... Sri Surya Narayana Shyam Sukhla, Philosophy. Psychology. Sanskrit, 0. 48 pgs. maal'avikaan'gnimitramu naamanaat'akamu... shriimatkavikulashiromand-inaa shriikaal'idaasamahaakavi, Language. Linguistics. Literature. Sanskrit, 1892. 282 pgs. maalatiimaadhavan' prakarand-amu vyaakhyaaya... mahaakavishriibhavabhuuti, Language. Linguistics. Literature. Sanskrit, 1864. 500 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 122/167

2/14/2011

A list of scanned Sanskrit books at III…

maalatiimaadhavan' prakarand-amu vyaakhyaaya... mahaakavishriibhavabhuuti, Language. Linguistics. Literature. Sanskrit, 1864. 310 pgs. maanameyarahasyalokavaatvikamu... Srinivasa Charya. L, Sanskit Sastras. Sanskrit, 1925. 672 pgs. maanameyoodaya... t'i. ganapati saastri, Language. Linguistics. Literature. Sanskrit, 1912. 133 pgs. maanasaprachaarikaa... Not available, Language. Linguistics. Literature. Sanskrit, 1885. 156 pgs. maanava dharma saara... Not Available, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1943. 285 pgs. maand-d'uukyaadhupanishhatrayii... pn'. raamadevaachaaye, RELIGION. THEOLOGY. Sanskrit, 0. 474 pgs. maatukaabhedatantramu... Pandit Amareswar Thakur, Lord Hanuman. Sanskrit, 1933. 153 pgs. maayaavaadakhan'd'anamu... Srimadananda Theertha, Art. Sanskrit, 1875. 165 pgs. madanapaamnidhant... krishna das, Technology. Sanskrit, 1954. 192 pgs. madanapaamnidhant... krishna das, Technology. Sanskrit, 1954. 328 pgs. maddhvamukhaalankaara... Vanamali Misra, Philosophy. Psychology. Sanskrit, 1936. 148 pgs. madhthasida ntakaumudii... prabhaakara, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1939. 693 pgs. madhuraan'jali... G.ramacharya, Literature. Sanskrit, 1996. 346 pgs. madhusuudanasarasvati kruti advatasiddhi... Sri Harihara Sastri, Philosophy. Psychology. Sanskrit, 1893. 344 pgs. madhuvidhyaa shriivishvakarmapaaramyaparend-a sauparnd-ena vyaakhyaanena samaalin'gitaa... durishet'i ven'kat'araamaachaarya, Language. Linguistics. Literature. Sanskrit, 0. 70 pgs. madhvanidanmu... shrii sudarshan sharma, Technology. Sanskrit, 0. 530 pgs. madhvasiddaan'tasaarasan'grahada vishhanurxmand-ii... Not available, Language. Linguistics. Literature. Sanskrit, 0. 253 pgs. madhvatantramukhamadarnamu... shriimadappayadiiqs-ita, Language. Linguistics. Literature. Sanskrit, 1940. 156 pgs. madhyakaaliina san'skrxta naat'aka... raamjii upaadhyaaya, Language. Linguistics. Literature. Sanskrit, 1974. 516 pgs. madhyamavyayoga... bhasa, Language. Linguistics. Literature. Sanskrit, 1948. 56 pgs. madhyasiddhaantakaumudii... shriimadvaradaraaja, Religion. Theology. Sanskrit, 1906. 312 pgs. madyakalin sanskrit natak... ramji upadya, Language. Linguistics. Literature. Sanskrit, 0. 522 pgs. mahaaban'dho... Sripati Sharada Misra, Literature. Sanskrit, 2001. 493 pgs. mahaabhaarata aranyakaparvam bhaaga 4... vishnu s sukthankar, Language. Linguistics. Literature. Sanskrit, 1942. 610 pgs. mahaabhaarata sabhaaparvamu gn-aanadiipikaa... shriidevabodha, Religion. Theology. Sanskrit, 1949. 55 pgs. mahaabhaarata san'skrxta muula hindii anuvaada... Not available, Religion. Theology. Sanskrit, 0. 1282 pgs. mahaabhaaratama~ shaantipar^vand-i Part I... P. P. Subramanya Sastri, Language. Linguistics. Literature. Sanskrit, 1935. 690 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

h

bh

hh

k

j hik

d

bh

d d' l

t

t'h

d'hii

i

i

d

123/167

vi... Language. mahaaradha padakooshaa. 1901.. . Linguistics. 1914. mantramahaidadhigrandhahaa. mahaabhaashhyat'iikaa chaturthaanhikaparyantaa bhaaga 1. t'ii aara krxshhnd-achaarya.. Sanskrit. pandd'itashriiharishang-karatbhaasharmand-aa.. 482 pgs. 0. 1828. sanskritdocuments. mahaaviiracharitamu. Language.. Linguistics.. mahaavidhyaavid'ambanamu t'ikaabhyaan' dashashlokii vivarand-a t'ippand-i. 1891. 1961. Linguistics. shrimadhusuudanasarasvatii. RELIGION.. 795 pgs. Literature. Linguistics. Sanskrit... Language. Sanskrit. sridhar venkatesh kethkar. Linguistics. Linguistics. Linguistics. 442 pgs. 1971. Language.2/14/2011 A list of scanned Sanskrit books at III… mahaabhaashhyakunj-chikaa darabhang-gaamand-d'alaantargara t'haad'hii graamanivaasinaa. mantraayechandodaya.. Linguistics. Linguistics. Linguistics. 48 pgs. 1926. Sanskrit. goopiinaatha. malayamaarutan' dhvitiyan' spandan. Literature.. Religion. manusambhava. mahabharat sahitha pradma kand.. 1965. 1926.. Religion. Sanskrit. maitraayand-iiyamaanavagrxhyasuutarman.. Literature.. Sanskrit. Linguistics. Language. Theology.. Literature. mand-d'ala braahmand-opanishhatuu. shriidaqs-ind-aamuurti. Linguistics. 1896. Sanskrit. Language. majamuuaajaabtaa phaujadaarii. Linguistics. 456 pgs. 112 pgs. 170 pgs. Sanskrit. mahaapuraand-apanachamapathalakaand'aa. Language... . 1920. Literature. Linguistics. 151 pgs. 894 pgs. Linguistics. bhat't'avaadiindra.. Language.. Theology. king someswara.... 0. mahaakaavyaa ratnaavalii. General. Sanskrit.. 50 pgs. Literature..... 1970. 1066 pgs.. Ramakrishna Harshaji Sastri. 1941.. manoramaashabdaratna praqs-aittaraava liipradhamakhand-d'an. Not available.. Sanskrit. Sanskrit. 310 pgs. 1979. Literature. Literature.. Literature. -. 50 pgs.. Sanskrit. . Sanskrit. V. manu. 0. Spiritual Experience And Mysticism. Language. Linguistics. ke. 302 pgs. mantroddhaarakosha saubhaagya tantrashcha. 301 pgs.. Not available. 248 pgs. 1964. 0.. 1982. 190 pgs. Sanskrit.. Linguistics. Language... Sanskrit. manasollasa vol Iii. Not available. 110 pgs. Language. 173 pgs. 1968. THEOLOGY.. malavikamitra naatakamu. Literature. 0. Literature... Language. shrii raajanaaraayand-a shaastri.. Somraj Krishna Das. mahinmastotramu madhusuudanii vyaakhyaa trxtiiyan' san'skarand-amu.. mand-isaara anumaanakhand-d'a. 575 pgs. 166 pgs.… i t N t il bl L Li i ti Lit t S k it 0 350 124/167 . shrii vii svaaminaathana. Language. Language. trivikramabhat't'aaraka. 554 pgs.. Literature. Language.. maharastriya gyan kosh sharir khand. Sanskrit. Sanskrit.. 163 pgs. Literature. 1971. manu smruti. Linguistics. 0. mal'aya maaruta part Ii.org/…/SanskritIIIT. Linguistics.raghavan. Language. Sanskrit... Literature. mantraratna manjushhaa. shriibhavabhuti. Sanskrit. Sanskrit.. Language. Language. mahaakavibhaasa eka adhyayana. Literature. Damodar Jha. Language. 0. Sanskrit. 1971. Language. Literature. Linguistics. mahadeva. Sanskrit.. Sanskrit. mahaabhaashhyamuu. . 330 pgs.. Linguistics. raaghavan. Sanskrit.. 202 pgs. manmahaabhaaratamu bhiishhmaparva 6. vyasa. 790 pgs. Literature. 804 pgs... 190 pgs. Literature. Sanskrit. Sanskrit. 1928. Literature. baladeva upaadhyaaya. Literature. Sanskrit. Pandit. Literature. Sanskrit. Language. sheishhasharma. 0..

. 214 pgs. Literature. Malkuluka Bhatta. Language. LINGUISTICS... 536 pgs. 1940.… 125/167 . LANGUAGE. Language. miimaan'saanyaayaprakaasha aapodevii. Sanskrit. Literature. 1898. 86 pgs. 238 pgs.. Theology. Sanskrit. miimaan'saadarshani.. 120 pgs. miimaan'saanyaayaprakaasha saaravivechinyaakhyaayaa. 427 pgs. Linguistics. Language. 0. miimaan'saaprakarand-agrantha miimaan'saanyaayaprakaasha t'ippand-yaadisamalan'krxta. 0. LINGUISTICS.. gan'ganatha jaha. 1928. Literature. Literature. Language. Sanskrit. Language. manusmuuti Vol I. Linguistics.. Sanskrit. Sanskrit.. maraat'i gran'thaan'chii bayaajavaara yaadi bhaaga nowlaa. LINGUISTICS. LITERATURE.d.. Not available.. 531 pgs. LINGUISTICS. gan'ganatha. miimaan'sasaarasang-graha. LANGUAGE. LANGUAGE. Sanskrit. Linguistics.. 1961. 1980. 210 pgs. Language. not available. 1930.. 1914. Sanskrit. miimaan'saanyaayaprakaasha saaravivechinyaakhyaayaa. sabhara bhaasya. mimaan'saanukramand-ikaa. Language. Linguistics. mandana mishra. mimaan'saamand-d'anena mand-id'ataa. Language. Language. Not available... 539 pgs... Language. LANGUAGE. Linguistics...t.org/…/SanskritIIIT. 502 pgs.. 238 pgs... Linguistics. LITERATURE. kalidasa. Religion. Sanskrit. miimaan'saakoshha Part 3. Sanskrit. 90 pgs. Sanskrit. shriimatkrxmaarilabhat't'a. Sanskrit. Language. Sanskrit. miimaan'saadarshanamuu.. 1953. 1934. 1925. LITERATURE. miimaan'saabhyudayan. Literature. shriimadaapadeva.2/14/2011 A list of scanned Sanskrit books at III… manuscripts. LINGUISTICS. Philosophy. Linguistics.. LITERATURE. 0. Theology. Literature. Sanskrit. Ganganatha Jha. Halayudha. Philosophy. 1948. . Religion.. Not available. 570 pgs.. Sanskrit. Linguistics. shriimadaapadeva. Psychology.. 1021 pgs.. 638 pgs. General.. 0. raamachandra. Sanskrit... 1940. miimaan'saashlokavaartikamu nyaayaratnaakaraaravyayaa vyaakhyayaa... Sanskrit. Sanskrit. manusmrxtivishhayaanukramand-ikaa. meghasandesa. miimaan'saashlokavaartikama.... kevalaanandasarasvati.. 1930. Literature.. shriishang-karabhat't'a. Sanskrit.. Linguistics. Sanskrit.. 216 pgs.. 1898. Linguistics. 1943. 541 pgs. Language. LANGUAGE. 1909. mimaan'sha darshanam pada I. mimaan'saanukramand-ika.. Sanskrit. 96 pgs. Linguistics. Literature. LITERATURE. miimaan'saakoshha Part II. 405 pgs. 1956. 645 pgs. Tatacharya. Literature.. kevalaanandasarasvatii. LINGUISTICS. shrimajjaimini... 1948.. aapadeva. 350 pgs. Linguistics. LANGUAGE. 1831. Literature. 246 pgs. sanskritdocuments.. Literature. Literature.. Sanskrit. 48 pgs.. Linguistics. Sanskrit. 0. miimaan'saakoshha Part IV. LITERATURE. 551 pgs.. 740 pgs. kevalaanandasarasvatii. 142 pgs. 1948. 1954. mediniikosha.. manuscripts. Sanskrit.. kevalaanandasarasvatii. 1932.. 554 pgs. Language. mevad'a patana.. 0.. LITERATURE. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Language. manusmaruthihi. miimam'saashaastrasavasve. Literature. manusmrxte. . shriimatkumaarilabhat't'apaada. Literature. Linguistics. aapadeva. Literature. LINGUISTICS. LANGUAGE.. 613 pgs. shriikrxshhnd-adaasaatmaja..

Literature. Literature. mnut'iikaasad'gahan. Sanskrit. muulaavidyaniraasa.. Language. Theology. 0. muhutairatnamu. 382 pgs. Sanskrit. Linguistics. . mundaka upanishad. na ii hindii rachana pahalaa bhaaga. 501 pgs. Julius Jolly. 1970. 433 pgs. 1962. mudrakshasa. Literature. 386 pgs. sanskritdocuments.. 1918. LANGUAGE. 274 pgs. Language.. Sanskrit. mudraraksasa. mulagadaadhariyo shabdakhand-d'an. Sanskrit. LINGUISTICS. Linguistics. 580 pgs. Linguistics. Sanskrit. Not Available.... muchchhakat'ikan. 1882. 1999. Literature. 107 pgs. Linguistics Literature. mugendraagaman. Not available.… 126/167 .. 798 pgs.. 1925. mrxchchhakat'ikei.. ke e krxshhnd-asvaani ayyara. 130 pgs. 84 pgs. mitaaqs-araat'iikaayaa... swami satchidanandendra saraswati. Language.rangaswami. Language. -. mukundaanandabhaand-an. Sripada Bhat. Astrology.. 146 pgs... Sanskrit.. Sanskrit. Linguistics. Sanskrit. Language. 228 pgs. saahityabhuushhand-a shriijonnalagad'd'a satyanaaraayand-amuurti. 1943. Language.. Literature. mitralaab.. Sanskrit. Language.. Language. Linguistics. mumuksu savasvaasaraa sangrahaa. Visadhadatta. 390 pgs. Linguistics.. 1894.. Linguistics. Not available. Sanskrit. Literature.. Linguistics. bhatta naaraayand-akaant'a. 1893. shrudrakavi.. Literature. 128 pgs. Literature.... 0.... mudraaraaqs-ase pradhamo kand'khaha. N R Bhatt. General. 156 pgs. Language. 380 pgs. 394 pgs. Sanskrit. Literature. Not Available. Sanskrit.. K. Literature.. Sanskrit. Sanskrit. mrxgendragam.. Sanskrit.. mruchhakatikamu.. Linguistics. Language. Mimamsa Shastram.. Not Available.. 1918. 278 pgs. 1882. Literature.... Language. 0. shriikaashipati. . naaraayand-araam aachaarya. Literature. mishrabandhuvinoda bhaaga 1... muhuurtachintaamand-i pramitaaqs-araat'iikaasameta. LANGUAGE. 1986. varashudrakaraaja. 1948. muulavidayaa niraasa. Linguistics. Religion. Sanskrit. Language.. subramanyasharmand-a. Sri Gadadara Battacharya. 1937. Language. Sanskrit...2/14/2011 A list of scanned Sanskrit books at III… miman'sadarshanei... Linguistics.. Literature. 2000.. Language. 1962. not available... Linguistics. mukttipradiipa. Linguistics. LANGUAGE. Not Available. 330 pgs. Literature. 382 pgs. Linguistics. mishrabandhuvinoda bhaaga 3.. Language. 1975. Literature. Sanskrit.. 0. shriiraamaachaarya. Linguistics. Sanskrit. Linguistics. Sanskrit. 82 pgs. muhurta chintaamand-i. 336 pgs. 320 pgs. Sanskrit. mulaavidhaa bhaashhyavaartikavirudva. mudraaraaqs-ase. Sanskrit.v. 433 pgs. moqs-akaand-d'amu chatudaisho bhaagan. Literature. visakhadatta. Language. 1850. Language.. 1961. Sanskrit. LITERATURE.. Sanskrit. 0.. LINGUISTICS. 490 pgs.. Sanskrit. naa mahaaraashht'ra yaatra. Language.. Literature. 30 pgs. Sanskrit.a. 1904. Sanskrit. General. Linguistics. 453 pgs. 466 pgs. muuhuurtamaartan'd'a maartad'avallabhaaravyavyaakhyaasahita. LITERATURE. 1970.. 1945. 138 pgs. Visakadatta. LINGUISTICS.org/…/SanskritIIIT. Sanskrit.. Kastnath Trimbak Telano. Not available. 0. ramnaraya lal beni madhav. 0. Literature. LITERATURE. Literature. Sanskrit.. Linguistics..

. Literature. naaraayand-abhat't'a.. Linguistics.. Language. Linguistics. 84 pgs. Literature. 1940. Sanskrit. dharmasuri. sanskritdocuments. 460 pgs.. Language. Sanskrit. naushada charitam.. 270 pgs. Sanskrit. Sanskrit. 1951. Language. shriimachchhiromand-isudhii. c. Linguistics. naaraayand-iiyan. 252 pgs. Linguistics. natyasastra. 1913.. Literature. Literature. Sanskrit. Sanskrit. 1954. naishhadhakaavya.. 1965. Linguistics. Biography. Linguistics.. Linguistics. 1956. shriimadvedavyaasa. 274 pgs. Sanskrit. 1962.. Language. nanj-avaada nanj-avaadasan'gn-akayinaddigajatna t'ikayaa. raamachandra.… 127/167 . 292 pgs. 1964. Language. 2005. Language. raamachandra.2/14/2011 A list of scanned Sanskrit books at III… Language. Language. 184 pgs.. 265 pgs. Language. Literature. Sankara Rama Sastri C. Sanskrit. Literature. Literature. Literature. narakasuravijaya vyayoga.. naat'uuyadarpand-amu prathamoo bhaaga.. natyasastra with the commentary of abhinavagupta vol-iii. -.. 18 pgs.. Language.. K. Linguistics. naat'yadarpeind-amuu volume 1.. nagananda. Language.. 676 pgs. 0. 54 pgs. -. Literature. 204 pgs.. 0. Sanskrit. 216 pgs. Sanskrit. Literature. Literature. History. mahaakavi shriiharshha. Linguistics. Language. shriimannarapatikavi. Literature. naanaartharnd-avasan'qs-eipa. Narayana Sastrigal. 0. . Literature. m. -. The Arts.. amarasimhudu. Linguistics. 1932.. nalopakhyanam. chan'drika. Literature. 0. 1956. Sanskrit. Linguistics.. Language. Language. 366 pgs. Linguistics. naaradhiya mahaapuraand-amu. Sanskrit. Literature. Literature. Language. 550 pgs. Linguistics. 584 pgs. Sanskrit. Linguistics.. Language. namalinga sasanam. naatyashaastram.. 1966. navagiitaakusumaanj-jali. ta gand-apatishaastrii. The Arts.. nandisuttram.org/…/SanskritIIIT. Linguistics. Sanskrit.. Linguistics. 1943. Linguistics. 90 pgs.. Sanskrit. 1912. bharata. Literature.. Sanskrit. Language. 242 pgs. Sanskrit. naishhakarmya sidhdhi. Literature. naasikeita paakhyaanamu. Sanskrit. Language. 1911. Language.. naishhadhakaavyam vyaakhyayaa sameitam.. 1899. venkataramaniah... 1927... 518 pgs.. 1961. 267 pgs. 0. Linguistics. 1817. kheimaraaja shriikrxshhnd-adaasane. Sanskrit. Sanskrit. Language.... 724 pgs. Not available.. naageshaashayanind-aiyan' pradhamo skandhahan. Sanskrit. Sanskrit. 1925. Geography.. naaradapancharaatran. baabulaal shukla.. Sanskrit. Linguistics.. Language. Sanskrit. Theology. Sanskrit. Linguistics. narapatijayacharyaasvarodaya jayalaqs-miit'iikaasameta. Language.. nalacharitranaat'akamu. Sanskrit.. 77 pgs. Sanskrit. Literature. 220 pgs. Linguistics. 135 pgs.. Literature. Linguistics. Literature. 612 pgs.. shri suresvaracarya. nalooparavyaanamuu. vyasa. naat'yashaastramu vivrxtisametamu bhaaga 1. Sanskrit. bharatamuni. Literature. 1506 pgs. Language. Sanskrit.. 1903. 0.. 350 pgs.. shri devavaccaka. 396 pgs. Literature. Linguistics. Sanskrit. Literature... 380 pgs.. Language. naat'akachandrikaa. sri bharatamuni.. 1929. naishkarmya siddhi.krishna Das. Religion. 1929. 254 pgs. Literature.. 0.... narasin'gapuraand-amu. Literature. Linguistics.ramakrishna kavi...

76 pgs... Language. 1937. Bhavanatha Misra. Literature. Literature. 1967. nayaviveika. nirnayasindu. 1936. Social Sciences. Linguistics Literature. Psychology.. Social Sciences. 365 pgs. Literature.r.... Sanskrit. niilakand-t'havijayan.. Bhatta Nilakantha.. niruktan' nighand-t'upaat'hasamupetan' dvitiiyobhaaga. Sanskrit..rangaswami. swetaranyam narayana sastriar. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… nayaayaamrutamu dhvitiyo bhaagan. niitimayuukha. Language. Social Sciences. niitipaat'han.. Linguistics. 1930.. 1967. naaraayana bhat't'aa. Sanskrit.. Language. 456 pgs. 1908. Language. Sanskrit.. Literature. Sanskrit. 1951.. Literature. Theology. 1926. 85 pgs. Literature. Sanskrit.. Religion. raamanaathashaastri. 1941. 1940. 1955. Mahamuni Vyasakcharya. 248 pgs. A..viraraghavacharya. Narasimha Vajapeyin. nayadviveka. Narasimha Vijapeyt Vol Ii... Literature. Linguistics. Sanskrit. nityotsavan. Sanskrit. nayaviveka.. Thallahtanath Pandit. Language.. Literature. 1972. nir^nd-ayasindhau. Sanskrit. nrxgamooqs-aprabandha. niruttkmn. 1928. 0. Mahesvara. neetisataka.. 226 pgs. 283 pgs. Sanskrit. 746 pgs.. Sanskrit.. Sanskrit.. Linguistics. 321 pgs.. Sanskrit. T.. 0.. nayamanjarii. Philosophy. 1950. nidraa vign-aana kyon' kahaan' kaise aura kaba sonaa chaahiye. Sanskrit. .. 1918. Language. 76 pgs. Sanskrit. Sanskrit. nirnayasin'd'hu. Literature.. Sanskrit. Vasudeva Sarma. nipaataavyayopasagaivuttin. Linguistics. Linguistics. 166 pgs. Theology..t. 1951.. 1941.. 91 pgs. Linguistics.. Religion. Sanskrit. Language.... nipaataavyayopasagraivuttin' t'ilaka.. Linguistics. Sanskrit. Sanskrit. 1949. niruttkalaghuvivrxti panj-chapaadikaa. Psychology. shriimanmaharshhivarayaaskiiya. Language... 133 pgs..shankara Rama Sastri. 1827. Pandith Priyanath Vidyabhushan. shrii kamlakar bhatt. Sanskrit. Linguistics. Psychology. 1937.… 128/167 . Language. 482 pgs.. 1925.... Philosophy.. Psychology. Linguistics. Someswara Sarma. niitimaalaa. 140 pgs. 174 pgs. Language. Sanskrit. nagesha bhatta. LITERATURE.. 1940. 1912. Literature. 545 pgs.v. 330 pgs. sanskritdocuments. LANGUAGE. 86 pgs. Linguistics. Sanskrit. .. 320 pgs. vaagbhatta. Literature. P V Ramanujaswami..org/…/SanskritIIIT.. nir^nd-ayaamrxtamam. nayadhyumand-i. Language. A.. meighanaadaarisuuri. niyatakaalakaand-d'amu trutiyo bhaagan. Language. LINGUISTICS. C. 1926. 1942. 179 pgs. nityaachaarapradopan.mahadeva Sastri. Literature. jvaalaapraasaada mishra.. nityaachaarapradiipa Part I. bhaavanaatha mishraa.. Linguistics. 127 pgs. Literature. Linguistics. Philosophy. 1907. 86 pgs. Narayanarya.. K. kuu... 649 pgs. niruttk bhaashhyat'iikaa.. 625 pgs. Linguistics. 1956. nayaayakusumajjalii. Sanskrit. Krishnacharya... Literature.. Social Sciences. pan' prabhunaaraayand-a tripaat'hii sushiila.. 286 pgs. Philosophy. Sanskrit. 68 pgs. Natural Sciences. Srimad Appaya Diksita. 768 pgs. nayachandrikaa praaramyate. 158 pgs. 768 pgs. Brahmanandaji. Language. shriimadhyaarakaachaarya. 1937. Linguistics Literature. Sanskrit. Language. Literature... Linguistics. se . Sanskrit. nityaachaaradapaind-an. Sanskrit. Sanskrit. Literature. neiminirvaana. Literature. ng-aapakaasan'grahamuu. 480 pgs. 1951. Sanskrit. Sanskrit.. 246 pgs.. 1927.

Sanskrit. Sanskrit. 1941.. Linguistics. Language.. Philosophy. 426 pgs.. nyaayarakqs-aamand-i.. 1912. Sanskrit... 534 pgs..sambashiva Sastri. si.. Sanskrit. 461 pgs. Literature. Sanskrit.. shekhara. Philosophy. 315 pgs. Sri Appayah Dikshita.. LITERATURE.. Religion. Philosophy. nyaayakalaapasan'graha. 1937. Sanskrit.. 1915. 1938. 1953. Linguistics. 96 pgs. Sanskrit. nyaayakulishamuu. Parthasarathi Misra. nyaayadarshanamu bhaashhya vrxttisahitamu. pat't'aabhiraama. Sanskrit. Psychology. 592 pgs. 168 pgs. Sanskrit. Saktism. Philosophy. Religion. 68 pgs. 444 pgs. lakqs-mand-aachaaryand-a. shrii vallabhaachaarya. T. 222 pgs. nyaayabodhinii vaakyavrxtti nirukti. Sanskrit. d'aa priyabaala shhaa.. anuruddhaachaarya.. Theology. Philosophy... nyaayaparishudin. Linguistics. nyaaya jaagadiishiivyadhikarand-amu. K. 1935. Not available. LANGUAGE. 1919. Atreya Ramanuja. Sanskrit. Psychology.. Sanskrit. Sanskrit. nyaaya muktaavali raaghavendra yati. nyaayakulishamu. Religion. 90 pgs. nyaayakusumaanj-jali Vol I. Language.. 1970. nyaayabodhinii niilakan't'hiiya vishhauamaalaa. Psychology. shriiseneshvaraaryai. Literature. Theology. Sanskrit. 622 pgs. chidaghanaanandagiri. Language... 291 pgs. Linguistics... Nyayasar.2/14/2011 A list of scanned Sanskrit books at III… nrxtta san'grng-aha. Literature. 379 pgs. nyaayabindu qs-idhamakiirti prand-iita. 0000. 0. Literature. Linguistics. 0. nyaayaratnaakarakhyaavyaakhyaasahite shlokavaartike. Linguistics. 1010 pgs. nuutanadhrmmaniyamasya. Linguistics. nyaaya parishuddii.. Linguistics. Sanskrit. Philosophy. Language. Psychology... 1924. Not Available. nyaayanibandhaavalii. Sri Kamakshi Amma. Dwaita Philosophy. 1918. 1941..… nyaayasudhaamand-d'anamu.. 0. Sanskrit. Sanskrit.. Sanskrit. Psychology. Psychology.. Language. Literature.. Not available. Linguistics. 218 pgs. 1937.. Literature. Language.. Sanskrit. Psychology. 1940... 1969. Language. Sri Senesvaracharya. 0. nyaayadarshana suutras bhasya.org/…/SanskritIIIT. Viraraghavacharya. Sanskrit. Viraraghavacharya. nyaayakaalaapasang-agraha.. 0. 1941.. nyaayaprakaasha nyaayashaastra. nyaayakusumaanj-jali Vol 1. 1923. 94 pgs. Philosophy. Venkatanath Sri Vedantacharya. nyaayakusumaanj-jali Part 2.. Sanskrit.. Linguistics. Linguistics. 432 pgs. 421 pgs. 1925. Athreya Ramanuya. . Sanskrit.. 91 pgs. Sanskrit. 1956. Sanskrit.. 350 pgs. nyaayasaara shrii bhaasar^vagn-aprand-iita.. 178 pgs. Sanskrit. nyaayabhaashhyavaarttikataapyarya vivarand-apanj-jikaa 2 5. Language. Theology.. 426 pgs. LINGUISTICS. 524 pgs. Sanskrit. Sanskrit.. nyaayaratnamaala.. 432 pgs.. Sanskrit. Language. 1931.. Philosophy. 118 pgs.. Not available... Sanskrit. Language. nyaayaliilaavati. Psychology. viiraraaghavachaayaund-a. 204 pgs. nyaayaashiddhaajnaamuu. Literature. 298 pgs.. Chandrashekhar Shastri. 1934. Literature. nyaayaboodhini baakyavrxtti. 299 pgs.. ti . . Psychology. T.. Literature.. 1962. nyaayaratnamala.. Theology. 1938. Literature. 0. Literature. Philosophy. vaatsayaayanamuni. 0..... gautama.. Philosophy. Satyapramotheertha sripada. Religion. paarthasaarathimishraa. sanskritdocuments. Psychology. 363 129/167 . Language. Sanskrit..

342 pgs.… 130/167 . Dwaita Sanskrit. palitipitakasassanukkamanika part 2. 0. panchatantramu 1. Kishore Nath Bha.. Sanskrit.org/…/SanskritIIIT. 1992. shriibaand-abhat't'a... 487 pgs. paadukaapat't'aabhishhokamu. Natural Sciences.. paavaitiiparind-ayamu. Linguistics... Psychology.. Linguistics. Literature. not availabe. 118 pgs. Literature. Sanskrit. 204 pgs. Literature. Language. pachchatantrakamuu. Sanskrit. ruupalaala kapuur. vishhnd-u sharma... Not available. paand-iniiyavyaakarand-ebhinavavaarttikaani... Psychology.... Sanskrit. Sanskrit. Not available. Vacant.. 144 pgs. Sri Sadasiva. 1983.. 0. Philosophy. 258 pgs. 1104 pgs. Literature... 54 pgs. 0. Literature... Sanskrit Grammer. Linguistics.. Satyapramotheertha sripada. Literature. 0. paarijaataharand-achampu. Sanskrit. pajjadashii. paaribhaashhikapadaaryasan'graha. Language. Language. paarabhaashondradipikaa. Sanskrit.. Sanskrit. 1930. 363 pgs.. Literature. Sanskrit.. 324 pgs. panchadashagiitaa.2/14/2011 A list of scanned Sanskrit books Philosophy. Literature. Sri Koliyalam Swami. Literature. Sanskrit. .. Literature. Linguistics. kielhorna.. padmapuraand-amu tatraadimamaadikhand-d'an' dvitiiyan' bhuumikhand-d'an' chetyetaddvayaruupa prathamabhaaga. Sanskrit.. pandit durgaprasaada. nyaayasudhaamand-d'anamuu. paat'hakamukhavispot'akamu.. paaia sadda mahand-nd-aavo praakrxta shabdamahaarnd-ava. Literature. varaaha mihiraa. Linguistics. khemaraaja shriikrxshhnd-adaasa. Sri Mad Ramakrishna. 338 pgs. 64 pgs. 1953. Sanskrit.. 77 pgs.. Literature. Literature. Sanskrit. Sanskrit. Sanskrit. kurugand-t'i suryanaaraayand-ashaastri. LINGUISTICS. pan'chaprakriyaa. 0.s. Psychology. 1893. depatment of pali. 175 pgs. Language. Sanskrit. 172 pgs. 38 pgs. Sanskrit. paarijaataharanachampu.. vishvabhandhu. Linguistics. Literature. Sanskrit. History. 568 pgs. pancharatnakaarikaa. 716 pgs.. Chintamani. 1939... T. Language. Biography.. 1874. LITERATURE. 579 pgs. Linguistics. 538 pgs. panchasiddaantikaa. sanskritdocuments. Linguistics. paarijaatahrnacampa. Literature.. Geography.. padasan'grahan' bhaaga pahilaa.. Philosophy. Linguistics. bhimacharya jhalakikar.... Linguistics.. 1941. nyaayatatvaalokan.r.. Language.. Vamana Daji Oka. Psychology. Ramakrishna. Linguistics. 1918. 1894.. Linguistics. Rama Murti. 64 pgs. Philosophy. 1818.k. Sanskrit. Sanskrit. Language. LANGUAGE. saishasrikrishna. 408 pgs.. 1946. Philosophy. Language. Linguistics. Literature. Sanskrit. Psychology... Language.. Vidyasekharalu. 654 pgs. shriivaasudevaanandasarasvatiit'embesvaami. Language. Language. pan'chaadashi bai vidyaarand-ya. 56 pgs.. 1953. Sanskrit. Sanskrit. 88 pgs. mahaamunishriimadvyaasa... pan'chamapushhpamu shriiguruchartrikaavyan' shriidattachan'puu sat'iikaa. Linguistics Literature. trinaatha sharma. 390 pgs. 1926. paat'hashodhanamuu.. 364 pgs. Linguistics. nyayakhosh. Sanskrit.. 1900. at III… nyaayasudhaamand d anamu.. Philosophy.. Sanskrit.u. Language. Language.. 1972.. panchaman' pushhyamu. 1200 pgs. Linguistics. 1973. 1962. Literature. 1902. panchadashii. 1954. Language. 1944. 0. 1889. 60 pgs. Language. 1896. Sanskrit. Sanskrit. Sanskrit.

1938. Sanskrit.. 1923. Literature. Krishnaswami Aiyangar. 1946.. 505 pgs. paramasan'hitaa. shrii viiraraaghavaachaaryaind-a. Language. Language.. 280 pgs.. Padmanabhan. 60 pgs. 1959. paribhaashendusekharaa. paramaarthasaaramu vivarand-ena sametamu. Sanskrit.. Linguistics. Sanskrit... 370 pgs... 140 pgs. Literature. 60 pgs. Literature. Sanskrit. Sanskrit. Linguistics.. Sanskrit.. Abhinava Gupta. Sanskrit. vishhnusharmaa... Linguistics. Literature. 1923. Linguistics. 412 pgs.. Sanskrit. Sanskrit. 1940.. Linguistics. Linguistics. 1989.. 581 pgs. Parasara Samhita. parayaayaratnamaalaa. Language. Language. 1923. 1935. S. veind-imaadhava shaastri. 1934.. parishhkaaradapaind-an.. vaiyaakarand-ashiromand-i sukla shrii vendiimaadhavashaastrii. 0. not available. vinaayaka gand-esha aapat'e. panj-chalaqs-and-iisarvasve.. 0000. Philosophy Psycology. 114 pgs. Sanskrit. Language. Linguistics. Sanskrit. Theology.. Linguistics. Sanskrit. Sanskrit.. Literature.. 1911. Philosophy. vinaayaka gand-eish. paramaayesaaran. 68 pgs.. Language. Literature. parashuraamakalpautramu. Religion.. 216 pgs. Philosophy. 518 pgs.. Sanskrit. 234 pgs. Sanskrit. 1923. parijataharanachampu. Theology. Linguistics. 578 pgs. 1926.. Literature.. Linguistics. Religion.. panj-chatantramu.. Linguistics. Linguistics. 1943. Abhinava Gupta. Sanskrit.. 0. Language. Ropahavvamana Sastri.. 1900.. 1833. Language. shriibhagavadaadisheshha. paribhaashheindu sheikhar 1938. Language. . 1916. Psychology. Literature. panj-chatantramu. paribhaashheindu sheikhar vyaakarand-a vibhaagamu. Language. pashht'aalambhamiimaam'saa. maadhavakaravirachitaa. 136 pgs... Sanskrit. 1898. parijata natakam. Literature. Literature. Literature. Language.. sanskritdocuments. Sri Bhagavad Adesesha. 1949. paraashara san'hitaa. Literature. jayadeivasharma mishra. kumaratatacarya.. paqs-ataaprakarand-amuu. 282 pgs. shivadatta. shriimadhdighaarand-yamuni.. Language. pashavalaan'ba mimaan'sa. Literature. Linguistics. Literature. sayana madhvacharya. Linguistics. Sanskrit. shriiraamashaastriind-aa. LINGUISTICS. Linguistics.. 434 pgs. paraasharadharmasn'hitaa vyavahaarakaand-d'amu practhamoodhyaaya. 56 pgs. 62 pgs. Dr. Literature. 1995. Psychology. Language. Linguistics.. Sanskrit. Sanskrit. Language. Sanskrit. 0.. 162 pgs. paramaarthabhuushhand-amuu.… 131/167 . Psychology. 1992. Linguistics.. paribhaashhendrashokharan. Linguistics.. 344 pgs. pashvaalambhamiimaan'saa.. Sanskrit. 202 pgs.2/14/2011 A list of scanned Sanskrit books at III… panj-chadashii. 1868. Sanskrit. Sanskrit. parasara dharma samhita vol 2 part 1. Mahadeva sastry. parishhkaaradarpand-a saastraarthakalaasahita. paribhaashheindu sheikhar. 2000. LITERATURE. 1958. Sanskrit. Language. Language. 1105 pgs.. Saktism. 144 pgs.. Literature.. Literature. nagojibhatta.. 389 pgs.. 200 pgs. Philosophy. Language. paramaarthasaara. Literature. Sanskrit. Sri Venumadhava Sukla... Sanskrit. vaamanasharma. paramaarthasaara.. Not available. Sanskrit. LANGUAGE.a. 1306 pgs.s.. Language.... sesha srikrishna. 1916. 1114 pgs..org/…/SanskritIIIT.

71 pgs.. prakarand-apajjikaa. Language... Sanskrit. 0. 292 pgs. shriibhat't'aniilakand-t'ha... Sanskrit. pragnaapaaramitaasa pradhamo bhaagan. Sanskrit..org/…/SanskritIIIT. Psychology... 670 pgs. prakiirnd-aaprabandhaa prathama khand-d'a. 1932. Sanskrit. Linguistics. 365 pgs. 256 pgs. Sanskrit. Sanskrit. 1949... swmi vivekananda. shriimatkrxshhnd-amishrayati. Sanskrit. LITERATURE. 1894.. 116 pgs. 1956. Language....2/14/2011 A list of scanned Sanskrit books at III… patanj-jalayogasuutraand-i vaachaspatimishravirachita t'iikaavyaasabhaashhya sametaani. Psychology.. LITERATURE. 585 pgs. d'aakt'aru jagadiishachandra jaina. 230 pgs. LANGUAGE. Language. Linguistics. Philosophy. 1953. 174 pgs. krishna chandra acharya. bhattacharya. Literature... 101 pgs... prabodhachandrodayamuu. Linguistics. Psychology... prabodhachandrodayamu chandrikaavyaakhyaa prakaashaakhyavyaakhyaabhyaan' shhashht'haavrxtti. Language. LINGUISTICS. 0. patyadarshii. praaryavidhaanamuu. prajnapaaramitaas abhisamayalankaaralooka bhaaga 1. 132/167 . T. Linguistics. -. 246 pgs.. 1937. 1932. Sanskrit.. Literature. Sanskrit. Linguistics. mantreshvaraa. 1915. yas n shriiraama deishikana.. praakrxta pushhkarind-ii prastaavanaa sahita.. 160 pgs.. prakrita sarvasva. Linguistics.. Sanskrit.... T. Linguistics.. Sanskrit.chinatamani. 280 pgs. Sri Ramnath Sastri. 1968. Language. 1935. Language. Sanskrit. Sanskrit.. Language..… prakriyaasarvasvan' savyaakhyamu prathamo bhaaga. pand-d'ita vishveishvaranaaya reit'ha. pattuppaat't'u san'skrxtaanuvaada.. shriimaddidhaarand-yamuni.. 470 pgs. Sanskrit.. Language. Literature. Language. 1961. Sanskrit. prakat'aathaivivarand-amu. Sanskrit. prabhakaradijaya. 1972. 0... Literature. LANGUAGE. Vaishnavism. Linguistics. Language. Sanskrit. Psychology. 134 pgs. praayashvattamayuukha dashaman. prakaasha shriimadbhaagavatadashamaskandha. Literature.. Literature.. praakrxtasarvasvamu. Linguistics.. 259 pgs. Linguistics.. 1935. 252 pgs. praakrutapingalasutraand-i. Philosophy.. 1862.t. Literature. 0. Not available. Psychology. 119 pgs. Sanskrit. Sanskrit. 1974..srinivasagopalacharya. 308 pgs. praathamika san'giita. Kasi Nath Sastri. Language. 1973.. 1968.. 1904. pand-t'itapravara shriiraamaavataarasharma. LINGUISTICS. Sanskrit. Sanskrit.. B. 285 pgs. Language. pro shan'kara gand-eisha vyaasa. Literature. Language. prakriyaasarvasvan' dvitiiyo bhaaga. Language. Philosophy. Philosophy. phaladiipikaa adhyaaya 1 28. prakrita sarvasva. mukunda.. Linguistics.r. Literature. The Arts. Literature. sanskritdocuments. praakrutamand-idipan. bhagavatiiprasaada vaajapeiyii. 612 pgs. Sanskrit. 1968. 292 pgs. Bhattacharyya. Linguistics.. Literature. Philosophy. Religion. Language. Sanskrit. raamadaasa. Buddhism. Sanskrit.. Literature. Literature.. pracya pascattyam. Literature. laqs-minaadabhat'a. Linguistics. shriinaaraayand-abhat't'apaada. Linguistics. 257 pgs. shriipurushhottamajiisahaaraaja. patanjali yoga sutrani. Literature. 674 pgs. Sanskrit. 430 pgs.. Language. 132 pgs. shriinaaraayand-abhat't'apaada. pradhikaara kaa prashna. b... 1908. Linguistics. 1940. Theology. Sanskrit. 1935. krishna chandra acharya.

Linguistics. 104 pgs. vidhyaanaatha. Language.. pramaand-amajjarii granthaan'ka 4. Jayadeva..org/…/SanskritIIIT. Language. Sanskrit. sanskritdocuments. prashnashiromand-i bhaavaarthabodhiniibhaashhaat'iikaasahita... Language.. Sanskrit. Linguistics. Sanskrit. Linguistics. Tantras. 350 pgs. prasthaanaratnaakara. Sanskrit. pan'd'itarudramund-i. 1992. 1942. 1950. Sanskrit.. 223 pgs. 0. Literature. Linguistics. Sanskrit. Language. Literature. shriividhyaanaatha. 126 pgs.. Sanskrit. 1979. Language. prashnootararatnamaalikaa. Linguistics. prasannaraaghavamu sat'iikamu. Religion. 342 pgs. Bellokoth Ramachandra Sharma.. 1973. 391 pgs.. Sanskrit. . pramaand-ayavaada. 106 pgs. Religion. 48 pgs. Sanskrit. Linguistics. prameiyakamalamaarttaand-d'a. Literature.. 146 pgs. Sanskrit.. Literature. 1984. RELIGION.. Theology.. prajnaakaragupta. Language.. Sanskrit. Literature.. Jinaviya Muni. 0. . pramaand-ayavaada. 1896. Sanskrit. Literature. maheindrakumaar shaastri..k. Sanskrit.. Language. prapannaparijatam. 194 pgs. 1950. hari naaraayand-a. T. Linguistics. Language. Sanskrit. 215 pgs. Linguistics.. Not available. Sanskrit. 916 pgs. Sanskrit. Linguistics. H. prakrutaananda. Sanskrit. prapan'chasaara saara san'graha bhaaga 2... pramaanavaartikabhaashyam vartikalankaarah. Literature. 1949. 360 pgs. 160 pgs. Vaishnavism. Theology. Sanskrit. prashropanishhatan't'iikaasan'valita san'karabhaashhyasametaa. LITERATURE.. 1945. 121 pgs. . Sreenivasachariar.. 0.. prataaparudrayashobhuushhand-an' ratnaapand-aaravyat'iikayaa.. Sanskrit. 323 pgs. prashanj-aanamu. Linguistics. 1954. 1953... Literature... Literature. Literature. Literature.. Literature. Sanskrit.. 694 pgs. pramaand-avaattaka bhaashhyamuu. pramaand-aprameyakalikaa. Language. Sudara Chary. 1964. LINGUISTICS.. Religion.. Sanskrit. 858 pgs.. .v. Theology. 1909. . LANGUAGE. 426 pgs. Linguistics.… 133/167 .v... Linguistics. Pandurangacharya Srinivasacharya Waiker. 690 pgs. Language. Not available. 0.. prameya kaamalamaarthanda prabhaachandraan.n. 1953. 668 pgs. Philosophy. prasnopanishhatuu. pramaand-amajjarii. Language. girvanendra saraswathi. K. prand-avavaadan' pradhamabhaagan.. 123 pgs. Sanskrit. Language. 106 pgs. Not available. 121 pgs.. 1973.. 0. Pattabhiram Sastri.. Sanskrit. Sanskrit. T. 1896. ratna gopala bhat't'a. prasannaraaghavaa. 140 pgs. 1915. 1964. THEOLOGY.. Linguistics. 1954..... Sanskrit. Literature. Jayadeva. The Arts... 73 pgs.. 82 pgs.. san'kara bhagavatpaada. 390 pgs. Literature.. prataaparudriiyamu alan'kaarashaastramu vyaakhyaaya. raghunaatha kavi. Sanskrit.. 0. Literature. subramand-ya saastri.shastri. sri vatsya vardacharya. Pandit. Literature. prapatrapaarijaatan.. prameyakamalamaarataand'aa. Literature. Language. Linguistics. 1963. Linguistics. pratidvarasutramu.. Anandagiri. Not Available. Sanskrit... prasang-kavign-aanaatsiddhamu. 529 pgs.. Sanskrit. Language. Language.. scanned Sanskrit books at III… prakriyaasarvasvan savyaakhyamu prathamo shriinaaraayand abhat t apaada. Sanskrit. pramaand-a vachana sadgahan' tutiyan'samput'amu.2/14/2011 A list ofbhaaga. 1894. Language. 1999. Linguistics..

Language. prayogaratnamaalaa. 1917. Sanskrit. Literature. puraand-aparyaloochanamu bhaag Ii. Linguistics.. puraand-akaavya stootra sudhaa.… 134/167 . pravachanasaara.. 138 pgs. Sanskrit. 100 pgs. 324 pgs.Religion. emil baer ed. Literature. 1962.. 0. Sanskrit. Sanskrit. 174 pgs. Linguistics. si ar deivadhar. Literature. e pi karmaarkara. Linguistics.. Literature.. Sanskrit. Linguistics.. Sanskrit.. Language. Religion. 248 pgs.. 1941.. 320 pgs.. Literature.. 608 pgs.. puurvamiimaan'saadarshanamu dvitiiyasamput'amu.. 17 pgs. 679 pgs. 1955... Sanskrit. 0. Sanskrit. pratistaa sangrahn.. 1911. visvanaatha pandit. pratyaqs-attvachintaamand-ivimashain. 0. premarasaayana.. 1991. purchryarnav.. Linguistics. Language.. Literature.. Literature.. Psychology. 1976. prodamanoramaa. purushhasitramu. Linguistics. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… pratijnj-ayaugan'dharaayand-amu. pratyakatvachintaamand-i Vol 2. Language. 1935. hari naaraayand-a. puraand-aparyaloochanamu.. .. 109 pgs. prayaaga mahaatyamu. 1956.. No.. Linguistics. Linguistics. 1975. 432 pgs.. sayaana kaarya. sundareisha sharma. Literature. pratyabhijnahrdayam.. purushhaarthachintaamand-isthavishhayaanukrama. Sanskrit.. sanskritdocuments. shriikund'akund'aachaarya.. krxshhnd-adatta maithila. Unknown. shriikhand-d'adeva. Language. Sanskrit. 1938. purushhaarthachintaamand-i. 488 pgs. T.. Literature. Language. Sanskrit. Language. priitilataakusumopetaa vrxttamaalaa. Linguistics. 0. praud'hamanooramaakhand-d'anagranthasya. Religion.. Language. K. 646 pgs. Sanskrit.. Sanskrit. Sanskrit. 64 pgs... 674 pgs. Sanskrit. Language. Language. Literature. not available. 0. Sanskrit. . purushhaathaisudhaanidhin. Shaacharya Shidarajamaloki. Pandit Ramlal. . Vasudeva Sarma.. Theology. Sanskrit. 1922.. 596 pgs. 1961. Linguistics. 35 pgs. 388 pgs. 608 pgs. Unknown. shriikushhnd-amand-itripaat'hii.. 134 pgs. 140 pgs. Linguistics.chandrasekharan. 392 pgs.. 1955. preimavijaya. Language.. Linguistics. 1943. Sanskrit. Linguistics Literature. Language.. 454 pgs. Literature.. 626 pgs... shrikhand-d'adeva.ramanuja Tatacharya. Sanskrit. Language.. 1942. Sanskrit Grammer.. Linguistics.. Sanskrit. Sanskrit. shriikushhnd-amand-itripaat'hii. 443 pgs. 1928. 1955. Hanumacharya. Linguistics. Sanskrit. Literature. N S Ramanuja Tatacharya. Philosophy. Sanskrit. Sanskrit. Language.org/…/SanskritIIIT.. 0. purajjanacharita naat'akamuu... Linguistics.. 0. Sanskrit... Not available. purushhaarthasudhaanidhi. . Linguistics. Unknown. 346 pgs. purushhaathaichin'taamand-o. 319 pgs. 1992. 1914.. Literature.. Sanskrit. Literature. Language. Sri Sadanandha Vidyadhar. puurvamiimaan'saadarshanamu trxtiiyasamput'amu. Literature. Language. puraand-amu. Sanskrit . pratap singh. Literature.

2/14/2011

A list of scanned Sanskrit books at III… puurvamiimaan'saadarshanamuu chaturthasamput'amuu... shriikhand-d'adeva, Language. Linguistics. Literature. Sanskrit, 1916. 428 pgs.

puurvamimaan'saa darshanamu Vol.i... e mahaadeiva saastri, Language. Linguistics. Literature. Sanskrit, 1908. 372 pgs. qs-airatarad'agnd-ii... Kshira Swami, Sanskrit Grammer. Sanskrit, 1955. 417 pgs. qs-i bhagavadraamaanujavirachite qs-ishaarirakamiimaan'shaabhaashhye Part 1... Sri Lakshmi Narasimhakumar, Philosophy. Psychology. Sanskrit, 1936. 434 pgs. qs-i bhuvanadevaachaayevirachitaa aparaajitaprachha... Popatbhai Ambashankar Mankad, Religion. Theology. Sanskrit, 1950. 791 pgs. qs-ibhaashhyamuu chatushuutribhaaga... Maha Mahopadya Sudarshana Vyasabhatta, Philosophy. Psychology. Sanskrit, 1916. 290 pgs. qs-iimada naarand-yamuniprand-iitaa panchadashii... Narayana Ram Acharya, Philosophy. Psychology. Sanskrit, 1949. 580 pgs. qs-imaddhekhaanasekaasyapajaanakaand-d'a... Parthasarathi Bhattachar, Philosophy. Psychology. Sanskrit, 1948. 214 pgs. qs-imadraamaanujaachaayeprand-iitan' qs-ibhaashhyamuu Part Ii Introduction And Notes... Vasudev Shastri Abhyankar, Philosophy. Psychology. Sanskrit, 1916. 368 pgs. qs-imatsanatsujaatiiyamuu... B. Gururaja Rao, Religion. Theology. Sanskrit, 1940. 144 pgs. qs-inad'apaadavirachitaa seikodheshat'iikaa... Mario E. Carelli, Religion. Theology. Sanskrit, 1941. 148 pgs. qs-ivanamaalivirachitaabrahaasuutrasiddhaantamuktaavali... Not Available, Religion. Theology. Sanskrit, 1942. 252 pgs. qs-utiratnaprakaasha qs-itimateudyota... Tryambaka Sastri, Philosophy. Psychology. Sanskrit, 1910. 102 pgs. raadhaaparind-aayamuu mahaakaavyamuu... Not Available, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1931. 304 pgs. raagaratnaakara... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 706 pgs. raagaratnaakaraa... khemaraaja shriikrxshhnd-adaasane, Language. Linguistics. Literature. Sanskrit, 1966. 702 pgs. raagatattvaviboodha... shriinivaasa, Language. Linguistics. Literature. Sanskrit, 0. 84 pgs. raaghavanaishhadhiiyamu savisheshhavimarshinii prakaashasan'skrxta hindiivyaakhyopetamu... shriiharadattasuuri, Language. Linguistics. Literature. Sanskrit, 1969. 95 pgs. raaghavanaishhadhiyamu... shriiharadattasuri, Language. Linguistics. Literature. Sanskrit, 1896. 74 pgs. raaghavapaand-d'aviyamu... shriikaviraaja, Language. Linguistics. Literature. Sanskrit, 1897. 216 pgs. raajadhamaikaand-d'amu... K.v. Rangaswami, Language. Linguistics. Literature. Sanskrit, 1944. 117 pgs. raajadhamaikaand-d'amu ekaadasho bhaagan... K.v.rangaswami, Language. Linguistics. Literature. Sanskrit, 1943. 410 pgs. raajatarangind-i... durgaprasada, Language. Linguistics. Literature. Sanskrit, 1892. 393 pgs. raajatarangind-i Ii... durgaprasada, Language. Linguistics. Literature. Sanskrit, 1894. 308 pgs. raajatarangind-i Iii... durgaprasada, Language. Linguistics. Literature. Sanskrit, 1896. 410 pgs. raama charchaa... premachanda, Language. Linguistics. Literature. Sanskrit, 1948. 168 pgs.
sanskritdocuments.org/…/SanskritIIIT.…

d

kh

j

h iik

hh d d

L

Li

i ti

Lit

t

S

k it 0 920

135/167

2/14/2011

A list of scanned Sanskrit books at III… raamaayand-a... khemaraaja shriikrxshhnd-adaasa, Language. Linguistics. Literature. Sanskrit, 0. 920 pgs.

raamaayand-a baalakaand-ad'a... tulasiidaasa, Language. Linguistics. Literature. Sanskrit, 1886. 553 pgs. raamaayand-a sampuurnd-a qs-epaka... khemaraja shriikrxshnd-adaasa, Language. Linguistics. Literature. Sanskrit, 1827. 753 pgs. raamaayand-amajjari... shriikshemendra, Language. Linguistics. Literature. Sanskrit, 1903. 519 pgs. raamaayand-amu ayoodhyaakaand-d'amuu... shriimayaakavishrivaalmiiki, Language. Linguistics. Literature. Sanskrit, 1923. 316 pgs. raamaayand-amu baalakaand-d'amuu... shriimayaakavishrivaalmiiki, Language. Linguistics. Literature. Sanskrit, 1867. 224 pgs. raamaayand-amu kishhkindhaakaand-d'amu... shriimadvalmiiki mahaamuni, Religion. Theology. Sanskrit, 1915. 318 pgs. raamaayand-amuu arand-yakaand-d'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 0. 342 pgs. raamaayand-amuu baalakaand-ad'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 1912. 426 pgs. raamaayand-amuu sundarakaand-d'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 1916. 354 pgs. raamaayand-amuu uttarakaand-d'amuu... shriimadvalmiikimahaamuni, Language. Linguistics. Literature. Sanskrit, 1920. 362 pgs. raamaayand-asan'qs-eipasagrarasasvaada... Not Availble, Language. Linguistics. Literature. Sanskrit, 0. 124 pgs. raamakarnd-arasaayanamu prathamo nishhyanda... Not available, Language. Linguistics. Literature. Sanskrit, 0. 74 pgs. raamakathaa... vaasudeva, Language. Linguistics. Literature. Sanskrit, 1929. 66 pgs. raamasandesha padaarthaprakaashaakhyayaa t'iikaayaa sameta... shriiraajaraajeshvarapuujyacharanda, Language. Linguistics. Literature. Sanskrit, 1917. 140 pgs. raamasvayan'varsya vishhayaanukramand-ikaapraarambha... mahaaraaja shriiraghuraajasen'hajii deiva, Language. Linguistics. Literature. Sanskrit, 1822. 1006 pgs. raavand-aarjuniyamu... shriibhat't'abhima, Language. Linguistics. Literature. Sanskrit, 1900. 218 pgs. raghunaathavilaasamu naama naat'akamu... yagn-anaaraayand-adiiqs-ita, Language. Linguistics. Literature. Sanskrit, 1958. 174 pgs. raghuvan'shamuu... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 576 pgs. raghuvan'shavimarsha... ra. krxshhnd-amaachaaryend-aa, Language. Linguistics. Literature. Sanskrit, 1908. 168 pgs. raghuvansh... kalidasa, Language. Linguistics. Literature. Sanskrit, 1944. 360 pgs. rasa mitra... tryambak nath sharma, Technology. Sanskrit, 1965. 276 pgs. rasa mitra... tryambak nath sharma, Technology. Sanskrit, 1965. 382 pgs. rasachandrika... pande v, Language. Linguistics. Literature. Sanskrit, 1913. 110 pgs. rasachandrika... parbatiya pandita vishweswara pandeya, Language. Linguistics. Literature. Sanskrit, 1926. 108 pgs. rasadiirdhikaa... kavi vidhyaaraama, Language. Linguistics. Literature. Sanskrit, 0. 102 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 136/167

2/14/2011

A list of scanned Sanskrit books at III… rasadiparigyan... jaganath prasada shukla vaid, Natural Sciences. Sanskrit, 0. 174 pgs.

rasagan'gaadharahrudayamu... jnj-aanachandrastyaagii, Language. Linguistics. Literature. Sanskrit, 1964. 138 pgs. rasagangadhar... jaganath, Language. Linguistics. Literature. Sanskrit, 0. 430 pgs. rasamajjarii... bad'ri natha, LANGUAGE. LINGUISTICS. LITERATURE. Sanskrit, 1929. 222 pgs. rasamiimaan'sa... aachaarya raamachandrashuklaa, Language. Linguistics. Literature. Sanskrit, 0. 516 pgs. rasasadanabhaand-an... yuvaraaja, Language. Linguistics. Literature. Sanskrit, 1893. 70 pgs. rasavilas... bhudeva sukla, Language. Linguistics. Literature. Sanskrit, 1952. 162 pgs. rasen'drasaarasan'graha bhaashhaat'iikaasahita... mahaamahopaadhyaaya gopaalakrxshhnd-abhat't'a suuri, Religion. Theology. Sanskrit, 1844. 528 pgs. ratiratna Pradiipika... liilaadhara sharma, Language. Linguistics. Literature. Sanskrit, 1930. 148 pgs. ratna samuchchaya... not availabe, Language. Linguistics. Literature. Sanskrit, 1928. 504 pgs. ratnaavali kii kathaavastu... Not available, Language. Linguistics. Literature. Sanskrit, 0. 366 pgs. ratnaavalinaat'ikaa... shriiharshhadeva, Language. Linguistics. Literature. Sanskrit, 1953. 216 pgs. ratnaavalinaat'ikaa... shriiharshhadeva, Language. Linguistics. Literature. Sanskrit, 1953. 270 pgs. ratnakiirtinibandhaavalii volume Iii... anantalala t'haakuura, Religion. Theology. Sanskrit, 1957. 220 pgs. rattamatam... h. sesha iyengar, Language. Linguistics. Literature. Sanskrit, 1950. 174 pgs. rauravaagaamaa Vol.i... yan.aar bhat't'a, Language. Linguistics. Literature. Sanskrit, 1961. 277 pgs. rauravaagaamaa Vol.ii... yan.aar bhat't'a, Language. Linguistics. Literature. Sanskrit, 1972. 366 pgs. rig veda samhita volume Iv mandala X... max muller f ed, Religion. Theology. Sanskrit, 1892. 732 pgs. rigbhaashhya bhuumika... vi. kapaali saastri, Language. Linguistics. Literature. Sanskrit, 1952. 284 pgs. rigveda samahita (manuscript)... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 830 pgs. rigveda samhita... f max muller ed, Religion. Theology. Sanskrit, 1890. 974 pgs. rigvedasanhitoupanishadchatakam... -, Religion. Theology. Sanskrit, 0. 490 pgs. riitikaalina kavitaa men' abhivyaan'janaa evan' shilya... Not available, Language. Linguistics. Literature. Sanskrit, 1966. 491 pgs. rudraadhyaaya bhaashhya etatpustakan... saayand-aachaaryabhat't'a, Language. Linguistics. Literature. Sanskrit, 1976. 186 pgs. ruupamaalaayaamu bhaage Iii... not Available, Language. Linguistics. Literature. Sanskrit, 1982. 70 pgs. rxgbhaashhya... Not available, Religion. Theology. Sanskrit, 0. 73 pgs. rxgbhaashhyasan'graha... sva d'aa devaraaja chaananaa, Language. Linguistics. Literature. Sanskrit, 0. 440 pgs. rxgveda prathamos-shht'aka chatuthes-shht'ake shhashht'os-dhyaaya... Not Available, Language. Linguistics. Literature. Sanskrit, 0. 952 pgs. rxgveda san'hitaa Part I... daamodara bhat't'a, RELIGION. THEOLOGY. Sanskrit, 0. 776 pgs. rxgveda san'hitaa Part II... daamodara bhat't'a, RELIGION. THEOLOGY. Sanskrit, 1940. 978 pgs. rxgvedaanukramand-ii... kunjanuu raajena, RELIGION. THEOLOGY. Sanskrit, 1932. 160 pgs. rxgveida bhaashhyamu volume 15... udgita aachaarya, Language. Linguistics. Literature. Sanskrit, 1935. 124 pgs.
sanskritdocuments.org/…/SanskritIIIT.… 137/167

. 2002. Literature... 0. Literature. 1148 pgs. Linguistics. Linguistics.. Sanskrit. saamaanyaniruktti. Language. 1955. Language. rxkuusuuchii.. 1858. saahityavimarsha sakalasaahityaan'shasang-grahatmaka. saahityaratnamanj-jushhaa. 0.. LANGUAGE. prof.. rxtuvarnd-ana vyaakhyaaya. vidhyabhushand-a. 0. 1933. 1947. Not available. Linguistics. Linguistics. 1111 pgs. Literature. Literature.. shrii vai raamamuurtishrautii. 1941. 426 pgs. 1863. Sanskrit. saamavediiya ashht'a braahmand-e saamavidhaanan' aarshheyan'cha gn-iiqs-aadi san'valitamu dvitiiyo bhaaga.... durlabhaa. Literature.. Sanskrit.. Sanskrit. rxgveidasan'hitaa panchamoo bhaaga. Literature... rxgveidasan'hitaa trxtiiyoo bhaaga.. Sanskrit... shriikrxshhnd-asuurind-a. Not available. Literature. Linguistics. Literature.v. Linguistics. Language. Sanskrit. saamavedasan'hitaa. Surya Kanta Shastri. Sanskrit. Language. Language. Sanskrit. shrii vai raamamuurtishrautii.. Language... Linguistics.. 313 pgs.. 180 pgs.. Indology. Literature. saahitya darpand-a.. 1024 pgs. Linguistics Literature Sanskrit 1973 327 pgs sanskritdocuments. Literature. 362 pgs.. Prof. Language. 100 pgs. Kunhan Raja. Linguistics.. 639 pgs. Literature. Not available.chenna reddy. Sanskrit. saamaveda uuhauuhyagaanamu anubandhasahita trxtiiyo bhaaga san'put'amu 1. 1147 pgs. Linguistics. 234 pgs. krxshhnd-amoohan shaastri.. 516 pgs.u oriental journal vol-1.. Linguistics. 299 pgs.. Sanskrit. 1056 pgs.. s. rxvedavyaakhyaa bhaaga 2 ashtaka 1 adhyaaya 5 8. Literature.j. uppalla someshvarasharma. Not available. rxktantran' saamapraatishaakhyam. 1951. saamaveda uuhauuhyagaanamu anubandhasahita trxtiiyo bhaaga san'put'amu 2. Linguistics. 1062 pgs. 1981. Theology. 630 pgs. LITERATURE. saahityadarpand-amu.. Literature. Linguistics. saahityadarpand-amu vyaakhyaamavalambaa samudbhaasitamu panj-chamasan'skarand-amu. rxgveidasan'hitaa chaturthoo bhaaga. rxveda san'hitaa bhaaga 1. t'iikaachatushht'ayasanaathii. 217 pgs. shriimadhvaachaarya. Religion. 500 pgs. Language. Sanskrit. Language... Sanskrit. 644 pgs. 2002.. madhava.… 138/167 . Language. Linguistics. Language. Linguistics. Theology. C. 1867. Sanskrit. 1933. 1908. Language. Sanskrit. 1897. 193 pgs. Linguistics.. 0. raamachandravinaayaka pat'avardhana.2/14/2011 A list of scanned Sanskrit books at III… rxgveida prathamoshht'aka. Sanskrit. Literature. Sanskrit. Religion. Sanskrit.. Sanskrit. Theology. 20 pgs.... Religion. Sanskrit. Not available. Not available. 1958. Literature. LINGUISTICS. Sanskrit.. shrisaayand-aachaarya. saahityakaumudi. Literature. Literature.. Language. Language. Linguistics. saamaveidasan'hitaa aagneiyakaand-akamuu prathamoo bhaaga... Language.. Literature. Literature.org/…/SanskritIIIT. rxgveidasan'hitaa prathamoo bhaaga. saamavediiya ashht'a braahmand-e taand-d'yamu pad'avin'shabraahmand-an' prathamo bhaaga. shriivishvanaathakaviraaja. Not available. 1873. Language. 1969... shriimatsaayand-aachaarya. Not available. Sanskrit. Sanskrit. Linguistics. Sanskrit.. Linguistics. rxgveidasan'hitaa dvitiiyoo bhaaga. Language. Language. 939 pgs. Linguistics. 0. 1982. Language.. Language. 64 pgs. Sanskrit.. 1900. 772 pgs.

Linguistics. Literature.. Language. Theology. Linguistics. saamavidhaana braahmanamuu. 1919. Philosophy. Sanskrit. laqs-and-a. sabhaashhyarxksan'hitaayaa varnd-anukramasuuchii.. 1940. Linguistics. saang-kaadarshanamu. 1983. Literature. Theology.. LANGUAGE.. brahmha charya raam... d'aa bii aar sharmaa. Sanskrit.. Sanskrit. 327 pgs.2/14/2011 A list of scanned Sanskrit books at III… Linguistics. 342 pgs. sahityaratnakosh pradama kand. sachitra jyotishha-shiqs-aa.. Language. Language. Linguistics. 1913. 252 pgs. Sanskrit. saastradiipikaa. Language.. Theology. Sanskrit. LANGUAGE. 370 pgs. 1907. Sanskrit. 1989. Language. 1908. 1930. Religion. Sanskrit. Sanskrit. Literature. sadaashivendrastuti. 1941.. Sanskrit. Literature. thibaut'a. 108 pgs. 310 pgs. kausun'varavaastavyapand-d'itavara vaasudeva.. saarasvatiikand-t'haabharand-amu. Sanskrit. Linguistics. Language. Literature.. Not available.. Language. 751 pgs. Linguistics. Psychology. 164 pgs.. Sanskrit. 98 pgs. 1973. saaraavalii. Theology.. Sanskrit. 96 pgs. shriimatkalyaand-avarma. Literature.. Religion. Language. shriipataraaya. Literature.. Language. saang-khachaayanagrxhyasang-graha. Literature. Philosophy. Sanskrit. 1906. Language. t'haakura jyotishhaachaariyaa... Linguistics. saariirakanyaayasan'graha By Prakasatmayati. Religion..r. Literature. 272 pgs.. pan' shriitrilokanaathamishra. Language... Literature. 0. naaraayand-a raama aachaarya. shriivaasudevavidvadvara. 194 pgs.. Sri Amalananda. 0.v.chintamani. Sanskrit. ji.. Literature. saaraavali kaantimati hindii vyaakhyaa sahitaa. Language. Sanskrit. Language. 1966. 138 pgs.... Literature.. Linguistics. 580 pgs. Linguistics. 0. Literature. sanskritdocuments.. Literature. Sanskrit. Language. LITERATURE. bhadhur chand chhabra. Literature. 222 pgs. Sanskrit. Religion. 511 pgs. baabuu raamachandra. kai pan' vishhnd-u naaraayand-a bhaatakhan'd'ei.. 430 pgs. Sanskrit.. 1908. V... Linguistics. Linguistics.. 0. saata inakalaabii itavaar bhaaga tiisaraa.. saamyavaada. saarasiddhaantakaumudii raakaa san'skrxta hndiivyaakhyaaya dvitiiya khand-d'a. Sanskrit. LINGUISTICS. Sanskrit. Philosophy.. 1939. saan'khyaakaarikaa. Linguistics.. 202 pgs. saariirakavyaaravyaaprasthaanaani. 1992. Psychology. 1916. saarasvatavyaakarand-amuu.. Linguistics.. Linguistics. 414 pgs.. 1890. 1937. LINGUISTICS. 476 pgs. vishva bhandu ed. 208 pgs. T. Sanskrit.. shriisachchidaanandashivaabhinava. not Available. saaravyaayanagrxhyasang-graga kaushhiitakigrxhyasuutrand-i.. Psychology..org/…/SanskritIIIT. Linguistics. shriimatkalyaand-avarmaa.. Sanskrit.. 572 pgs. Sanskrit. sahityaratnakosh abhilekha sangrha. sachithra yogaasan. Literature. 140 pgs. 1964. saayand-iiyargvedabhaashhyabhuumikaayaa vaadashiinaathii t'iikaa. shriimadvaradaraajaachaarya. 266 pgs... Language. sahaavein' pustaka.. Sanskrit.s. Language. saambapuuraand-amu upapuraand-amu. 0. Not available. 62 pgs.… 139/167 . 0. Linguistics. Sanskrit. Literature. saastradapend-amuu. 1942. d'aa shriikrxshhnd-amand-i tripaat'hii. LITERATURE. Guruswamy. 208 pgs. Sanskrit..

1938...... LINGUISTICS. gangadhara krishna draavida.. 1948.2/14/2011 y p A list of scanned books gy at III… .. 490 pgs. 236 pgs. Literature.. Sanskrit. Sanskrit. 296 pgs. Sanskrit.. Sanskrit. Language.. Language. san'qs-epashaarirakamuu with Thatvabhodini Part 3. Language. Linguistics.. 0. 1919. 143 pgs. 514 pgs. san'qs-epa shaarirakamuu Vol 2 Adhayas 2 . LANGUAGE. Literature. 75 pgs. Kasinath Sastri. sam'skaaragand-apati Fasciculas Vi and Vii. 1899. Social Sciences.. san'kalpa suuryoodaya. 1948. 600 pgs.org/…/SanskritIIIT. Sanskrit. samayochita padamaalika. krishnamacharya. Language. Literature. shriini shang-kashaang-giideva... Literature. 1864. mahaamahopaadhyaaya pan' raamashaastribhaagavataachaarya svaamii. 1955. Language. Social Sciences.. Sanskrit. Sanskrit. Not available. Literature. Yajnika Srirama Krishna Sarma. 202 pgs. shrii kuruganti veinkataramand-a shaastri. 1910. Literature. Language.. Linguistics. Linguistics.. Language.. Literature. Language. Mahamahopadhyaya. Language. Literature. Literature. Language. 250 pgs. san'kalpasuuryodayanaat'akamuu Part I. samraat'uu shubhaagamana. Psychology. 1953. Linguistics. 194 pgs. shriimatsarvagn-amuni.. jaiminii. Sanskrit. 830 pgs.. Language. Language. 1974. 820 pgs.. Sri Ramnath Sastri Vaidye.. 460 pgs. Sanskrit. Linguistics. 255 pgs. 1899. Social Sciences. san'giitaratnaakara etatpustakan' kalaanidhyaaravyat'iikaasan'valita... Sanskrit. 110 pgs. samskruthapadamaala trutiiya kusumam.. sanskritdocuments.. Literature. Linguistics. 1912. san'karshha kaand-d'amu shhod'ashaadhyaaya sheshhachaturadhyaayiisvaruupamu. sampaadhya prakaashataan' niita.... Sanskrit.. samkalpa suryodaya part-2. Sanskrit. Language. Literature. Literature.. shri kunda kunda acharya. Sanskrit.. Sanskrit. Sanskrit... 1936. vimand-d'alavakra. 1896. sakhyakarikaa.. Philosophy.4.. 48 pgs. Theology. 644 pgs. Sanskrit. Literature. Literature. sam'skaaragand-apati Kandika Xii Of Kanda Ii. Literature. samasyaasamajyaa. shrii vein'kat'anaatha. Linguistics. shriinirang-kashaang-giideva.. krishand-amaachaari... 855 pgs. 1973. Language. Linguistics. raajen'dranaatha pan'd'ita. Linguistics. LITERATURE. Psychology. sam'skaaradiipaka Part I. sakalapuraand-aabhyarhita shriibhaagavata dashamaskandha puurvaardhamu. 1937. Linguistics.. Religion. samayasaara bhaaga 8. Sanskrit.… 140/167 . Srirama Krishna. sam'skaararatnamaalaa Part I.. Linguistics. 508 pgs.. Linguistics. shrii a vi narasin'haachaarya. Sanskrit. Sanskrit. sakalaagama saara sang-graha shaiva aagama.. 263 pgs. sam'skaararatnamaalaa Part Ii. Literature. pg saitubandhamu. 1897.. 84 pgs. Linguistics. Sarvajnatma Muni.v. Sanskrit. Language. Kasinath Sastri... 82 pgs. san'giitaratnaakara kalaanidhyaaravyat'ikaa prathamo bhaaga. san'qs-epasaariirakamu vyaakhyaasamalang-krxtamu prathamobhaaga. Sanskrit. Philosophy. 1917. Linguistics. adi sankaracharya. 417 pgs. 1930. 1895. Sanskrit. Sanskrit. shriiraamadaasabhupatiprand-itadhaa. Sanskrit g . 1971. Language. Literature. Linguistics. Linguistics... 1932.

. san'skrxtadvitiiyapaat'ha san'skrxtabhaashhaayaan' san'bhaashhand-ashiqs-aka.. Pandit Sri Rama Krishna..... LANGUAGE. Sanskrit. 528 pgs.. Sanskrit. Linguistics.. vyasacala. Not available. Literature. Language. sanskrit pravaahini shabd kosh. 650 pgs. Language. 183 pgs. Sarvajnatma Muni. 0. malliyan' raamaachaaryasuununaa.. 308 pgs. 1934. san'skrxta kavi jiivitamu. Linguistics. 1926... Theology.. Literature. Sanskrit... Sanskrit. sangeethgnan ke sansmar.. Language. Sanskrit... 68 pgs.… k it lf t h t2 d t l k L Li i ti Lit t S k it 1971 60 141/167 . LINGUISTICS. 1958. 1956. Sanskrit. san'skruta saahitya itihaasan.. Linguistics. suuryanaaraayand-a shaastri. 1954. san'skaaragand-apati. san'skuuta kal'aapuurnd-odaya. The Arts. Language. Not available. Sanskrit. 439 pgs. 338 pgs. Language. Language. shriiveng-kat'aramand-aaryend-a. d'aa brahmaananda sharmaa. 1939. Religion. Linguistics. 1946. Sarvajnatma Muni. san'skaaravidhi shhod'ashasan'skaarai. 498 pgs. shriisholataataachaayaind-a. Linguistics. 172 pgs. 340 pgs. 86 pgs. sanshipt mahabharath dritya kand. Language. miimaan'sakashriinilakand-t'habhat't'a.. Sanskrit. 274 pgs.org/…/SanskritIIIT.. Literature. Sanskrit. Linguistics. san'qs-epashaarirakamuu with Thatvabhodini Part 5.. 1979. 0. isvara karikas. Literature.. Psychology. san'skrxta naat'aka udabhava aura vikaasa siddhaan'ta aura prayoga. san'skrxta vyaakarand-ashaastra kaa itihaasa prathamabhaaga.. Sanskrit. anjinyea murthi. Literature. Sanskrit. Literature. 0.. Psychology.. Linguistics. berriedale keith. Language. 76 pgs. Sanskrit.. Sanskrit. Not available. san'skrutaavataaran... Literature. 0.. Linguistics. Theology.. san'skaaramayuukha ekaadasha. Sanskrit. Psychology.. Literature. Philosophy. Sanskrit. Linguistics. Sanskrit. sanaatana vign-aana samudaya. yagn-adatta... Literature. 48 pgs. 430 pgs. 127 pgs. 1984. san'skrxta vyaakarand-a shaastra kaa itihaasa dvitiiyabhaaga. 370 pgs.. sang-aameshar krodamu. sankshepa sarirpaka. san'skrutakaadambarikathaa.. 1938. sankaravijaya... 100 pgs. Sanskrit. 1884. 1941. Language. Sanskrit.. mallikaarjuna raavu. 1950. Sanskrit. sankhya karikas. Linguistics. Literature. 1934. not availabe. 858 pgs.. Language. 292 pgs. 1996. Venkataramana Sastri. sankhya sara. 0. General. Literature. 1913. Linguistics. Vijnana Bhikshu. Philosophy. Literature. a.. Literature. Linguistics. Sanskrit. Literature. Sanskrit. Language. 248 pgs. 1955. 432 pgs. Language.. Language. 264 pgs. 1933.. 126 pgs.. Linguistics. Linguistics. vilayat hussian khan... Language. 630 pgs. savanjatma muni. yam. Religion. sanskritdocuments. 522 pgs. Language. 1977. san'skrxta saahitya men' saadrxshyamuulaka alan'kaaron' kaa vikaasa. Sanskrit. Sanskrit.... LITERATURE. 770 pgs. Language.. Neelakanta Shankar. Sanskrit. Literature.. Literature. Linguistics. Linguistics. Sanskrit. vyasa.. Sanskrit. san'qs-epashaarirakamuu with Thatvabhodini Part 4. san'skrxta vyaakarand-a shaastra itihaasa trxtiiya bhaaga.2/14/2011 A list of scanned Sanskrit books at III… Sanskrit. 1965. Literature.. san'skrxtaan'dhranighan't'uvu. 1947. Philosophy. Literature. Not available. 1959.

0. Sanskrit. 60 pgs. Language. Sanskrit... Linguistics. Sanskrit. Biography. mahtma gandhi. Sanskrit. Sri Shankaracharya.. Sanskrit.. Sanskrit. Literature. Language. Sanskrit. Linguistics. Literature... Language. 0. shriimanmaadhavaachaarya. -. Sanskrit. 150 pgs. Literature.. Not Available. 724 pgs. 162 pgs. Literature. 0. 222 pgs. LITERATURE. Linguistics. bhiqs-ugauriishang-karend-a. 1962. santhrajshakunam. Not Avaliable.. LINGUISTICS. Philosophy.2/14/2011 A list of scanned Sanskrit books at III… sanskrit self teacher part 2. Literature. Language. shriiprataaparudramahaadevamahaaraaja.. 0. Linguistics. 438 pgs. 52 pgs. 1965. Sanskrit. sri sarangadhara acharya. 1932. LITERATURE. Sanskrit. sarvaveidaan'tha sidhaan'ta saara san'graham. Sanskrit. saral sanskrit shikshak bagh 2. Sanskrit. Literature.. sarvalaqs-and-asang-graha hitachintaka. Linguistics... sarasvatiivilaasa vyavahaarakaand-d'a. Literature. Sanskrit. 202 pgs. History. Literature. Shankara Sastri Marulkar. Language. 426 pgs. Sanskrit. Linguistics. 130 pgs... Not available. 1942. Not Available. saral sanskrit bala bhodh. Literature.. LANGUAGE. 0. Language. 1965... Literature. LANGUAGE. Sankara Sastri Marulkar. 468 pgs. Sanskrit. Language.. Sanskrit. Literature. sat'iikaamarakoshasya... satyaashhaad'haavirachitan'shrotasuutran' saptadashaashht'adashaa prashraatmaka saptamo bhaaga. Literature. 1928. 1970. 166 pgs.. Sanskrit. LANGUAGE. 150 pgs. Literature. satyaashhaad'haavirachitan'shrotasuutran' ekaadashaadichatudeshaantaprashraatmaka panchchamo bhaaga.. Geography.. Literature. 1927. arya bhadanta asvaghosa. sarvadarshanasan'graha prasthaanabhedashcha... 0. sarangadhara samhita. satyaashhaad'haavirachitan' shrotasuutran' tatraas-s. 1971. satya shodhanam. Linguistics. sapal jiivan ki mahatvapoorn gatnaaye. Sanskrit.... Literature. 60 pgs. Literature. satyaartha prakaasha.. Language. -. 1997..... 0.. Sanskrit. satyaashhaad'haavirachitan'shrotasuutran' dashamo bhaaga. Language.… 142/167 . satyashhaad'havirachitan' shootasuutran. Shankara Sastri Marulkar. Linguistics. saral sanskrit sikshak baag 8. sarvavedaanta siddhantasaarasan'graha. Language. Linguistics. 155 pgs.. Linguistics. Sanskrit. jayantkrishna h dave. 60 pgs. Not available... -. 537 pgs. satyaatheprakaasha. Language.. Language. Sanskrit. Sanskrit. Psychology.. Language. 1907. Language. 88 pgs. 62 pgs. s d satwalekar.. 1939. 1928.. Sanskrit... Literature. Linguistics. Sanskrit. -. 394 pgs. LINGUISTICS. Vacant. Sanskrit. sarakaara tumhaarii aan'khon'men'. LINGUISTICS. sarala kahaaniyan' bhaaga 2. paand'eya bechana sharma. 60 pgs.. 1927. Sanskrit. 1912.. Unknown. Linguistics..org/…/SanskritIIIT.dhaprashratrayaatmaka prathamo bhaaga. satyaashhaad'haavirachitan'shrotasuutran' panchchadashashhod'ashaprashraatmaka shhashht'amo bhaaga. Sri Kasinatha Sastri Ahhore. m. Language. 1994. 0. 930 pgs. Linguistics. Language. 1937. Linguistics. 1908. harinaaraayand-a aapt'e. Linguistics. 308 pgs. Language.. satapathabrahmana.. LITERATURE.chennareddy. Literature. sanskritdocuments. Literature. Sankara Sastri Marulkar. 396 pgs. Sanskrit... Psychology. Linguistics.. saundarananda kaavya. 204 pgs. 1927. Linguistics. 600 pgs. -.... Linguistics. saral sanskrit shikshak bhag 4. 372 pgs. Language. Linguistics. Philosophy. Language.

1924. 238 pgs.. Literature.. LITERATURE. 320 pgs. Sanskrit. 1921. Literature. Literature.. Sanskrit. 414 pgs. Literature. Sanskrit. Theology. LITERATURE. Linguistics. shabdaarthachan'drika aan'dhranighan't'uvu. Sanskrit. Linguistics. 1974. 0. Appaya Dikshita. 1917. saurapuraand-a. Linguistics. Sri Radhanath Suri. 1052 pgs.. 1913. Sanskrit. LINGUISTICS. shabdakaustubha trxtiiyobhaaga. Literature. 1915.. 98 pgs. 1971. 383 pgs.… shabdashaktiprakaashikaa shriijagadosha takailadkaara Language Linguistics Literature Sanskrit 143/167 ... LANGUAGE. 1913.. Not Available. 356 pgs.. 1822. Linguistics.. Literature.. Not Available. 2258 pgs. Language. Psychology. 476 pgs. 1992. Psychology.. Linguistics. 294 pgs. 1971. Sanskrit. Sanskrit.. Literature. gn-aastradarpand-amu. shaastradiipikaa. Sanskrit. 152 pgs. 0. Sanskrit. 174 pgs.. Sanskrit.. 1930. Somanatha.. Literature. 400 pgs. Sanskrit. vyaasa. Language. Sanskrit. Not available. shaan'karapaadabhuushhand-amuu... Sanskrit.. 1896. Language. Religion. Language.. sautasuutramu san'kalitaprayokachandrikaa.. Sanskrit. Linguistics. 394 pgs.. 1933... Sanskrit. shaatpit'akamu. Language. Literature. Linguistics. bhagavadamalaananda. seshvaramiimaan'sa miimaan'saapaaduke. laqs-mand-a shaastri. Language. savyaakhyonind-aiyasindhoo pradhaman' parichchodan. Sanskrit. Language. Sanskrit. shabdakaustubha Vol II. shaastramuktaval'ii. 1982. Sri Venkatraman.... Sanskrit. 563 pgs. 141 pgs. . Sanskrit. 0. bhat't'ojiidiiqs-ita. seshvaramiimaan'saa miimaan'saapaaduke miimaan'saapaadukaa parittraand-amu. Language. shaastrarambhasamarthanamu. 0. 0. LITERATURE. pat't'abhirama. Literature.. shaastrashuddhapan'chaan'ga ayanaan'sha nirnd-aya.org/…/SanskritIIIT. 386 pgs. shaastradarpand-amu. sri shankaraacharya. Philosophy. Theology. Linguistics. satyashhaad'ha.. 1935. gand-apati.. Religion. LINGUISTICS. Language. Sanskrit. Sanskrit.. 240 pgs. Sanskrit. 1938.. 510 pgs. Linguistics. shaarirakanyaayasadgagrahan' pradhamodhyaayan..2/14/2011 A list of scanned Sanskrit books at III… saundaryalahari bhaavanopanishad devi panchastavi vyakhyaaya sahita. Literature. shriimadden'kat'anaatha vedaantadeshikulu. 307 pgs.. Linguistics. sevantikaaparind-ayamuu. shaastradiipikaa. 296 pgs.... shaastrasiddhantaleshaasan'graha of Appaya Dikshita. Literature. Literature. Language. shriimadabhat't'ojiidiiqs-ita. Social Sciences. Linguistics... Linguistics.. mahaakaal'isubbaaraaya. LINGUISTICS. 1281 pgs. shrii shriisachchidaanandendrasarasvatii. shriimadven'kat'anaatha vedaantadeshika. Philosophy. Language. shaastradarpand-amuu. Linguistics. Literature. LANGUAGE.. shabdakaustubhe.. 0. 1937. Language.. Language. 51 pgs.. Linguistics. LANGUAGE. Linguistics.... Psychology. Sanskrit. shaastrasiddhaantaleshasan'graha. Language.. savesamavrxttaprabhaava. Not available. sanskritdocuments. Language. Philosophy. 1969. shaang-karn' vedaantamiimaan'saabhaashhyamuu kramaang-ka 1. Sanskrit. Not available. 1074 pgs. 560 pgs.. Literature. Sanskrit. Lokesh Chandra. Linguistics. Language.. Literature.

Literature. 182 pgs. aanandagiri. 0.. 1952. Linguistics. 1825. 1951. Philosophy. sanskritdocuments. Sanskrit. Linguistics. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… shabdashaktiprakaashikaa. shaindravilasa. 1927. Sanskrit.. khemaraaja shriikrxshhnd-adaasane shreshht'inaa. shivaadvaita nirnd-ya. 1900. Philosophy... shhood'asa raamaayand-a san'grah a. shaktivaada manjusha vivrxtti vinoodhini. Sanskrit. 188 pgs. Sanskrit. Sanskrit. Sanskrit. Sanskrit. shriimadiishvarapratyavitgnakacharyachakravarthi. Psychology. shiqs-aamanovinj-aanamu.s.. 1956. Linguistics. Linguistics. Literature. 0. Linguistics. Literature. shabdashittkprakaashikaa. Sanskrit. Literature. Narasimhacharya. Linguistics. Language.. shhad'ashiiti. 124 pgs. Sanskrit. jagadiish. shhrii vishnusahasranama.. shivasan'hitaa. Sanskrit... 239 pgs. Language.org/…/SanskritIIIT. 1960. Sanskrit. shhrii aniirud'ha samn'hita. 218 pgs. 226 pgs.. Linguistics. Theology. Sanskrit. Sanskrit.. Sanskrit. Language. Linguistics.. Sanskrit. Sanskrit. shrii sridahara venkateshakrutha. aadityaachaarya. Linguistics. 169 pgs.. shatakataryam shrii bhatrxharivitachitam. shabdendusudhaa. Sri Uttamur Viraraghavacharya. 1956. shivastotraavalii. shatapathabraahaand-a Part 3. 1947. 567 pgs. shrii dattakasuunumahaakavi shriimaaghaprand-iitan. 1927. Literature..venkata Raghavacharya. 186 pgs. shriilallaachaarya. 0. Literature. Language. Motilal Sharma Bradwaj. 1973. shatapathabraahaand-a Part 5. shishupaalavadhamuu. 421 pgs. Psychology. shrii chokkaanaatha. Philosophy.. Not Available.. 1340 pgs. Linguistics. Language... shiroomand-iikutadiidhitya anumitigrantha. Linguistics. not available. 1958.. A Sreeenivasa Iyengar. Linguistics. 0. 264 pgs.. Language. Sanskrit. S N Sriramadesikan. Literature. Literature.. Language. Philosophy. shriimajjagadiishatarkaalang-kaarabhat't'aachaarya. Psychology. 1981.. Religion. 194 pgs... Literature. Sri Barthruhari. Language. 1904. shishht'aprayegasn'graha. khemaraja shriikrxshnd-adaasa. Sanskrit.. Literature. 386 pgs.. Language. Language. 29 pgs.. Literature.… hi t ttik bh k R li i Th l S k it 1970 210 144/167 . pan' raamalochanashaastrii. Sanskrit. Linguistics. Language. Language.. 240 pgs. 0. 90 pgs.. shhrii an'daal tiruppavai. Sanskrit... shang-karavijaya. Language.. appayya diiqs-ita. Religion. 185 pgs.. Sri Gadadhara Bhattacharya. 1984. 1971. Sanskrit. Linguistics... 1929. Language.. Language. 1961.. 1881. Literature. Religion. 1935.. Linguistics.. 334 pgs. Sanskrit... 100 pgs.. shishhyadhiivrxddhidamu vivarand-a. Psychology. Literature. shevan'tikaaparind-aya naat'akamu. Literature. 68 pgs. Linguistics. Language. 148 pgs. Theology.. Sri Yamuna Muni. Literature. Sanskrit. Linguistics. shriijagadosha takailadkaara. V. Literature. 249 pgs.. Language. Literature... 484 pgs.. Literature. 1911. Linguistics. shabdashakttiprakaashikaa krxshhnd-akaanti t'ikayaa prabodhinii vyaakhyaaya tippand-yaa. shiddhitaryamuu.. 104 pgs. Language. shattlivaada. Literature. 260 pgs. Language. sri gadadhara bhattacharya. Sanskrit. Sanskrit... Sanskrit...

1970. Linguistics.. 99 pgs. Language. shrii ramakrishna maha kavayam. shri vyaasa paanini bhavanirnaya.… 145/167 . Sanskrit.. Language. shivavilaasakaavyamuu. 96 pgs. Sanskrit. Linguistics.. Language. 1920. Language. 0. shivatatvaratnaakara. Linguistics.. Linguistics. K. 1946. Theology. shrii bhaaskaroodaya. shonakiiyamn' rxgaveda pratishaakhayamn. Sanskrit. 253 pgs. Literature. 1972. Language... 212 pgs. shriimanmaharshhikaatyaayana.. Language.. Sri Pasupathi Sastri. 200 pgs.2/14/2011 A list of scanned Sanskrit books at III… shivasuutravaarttikamu. K. san'patkumaar. shivatatva ratnakaramu. Sri Bhattaputra Jayamishra. 500 pgs. Literature. Language. Literature. Language.. Theology... 0. shrii prabhudev vachanamrut. Psychology. Language. shrii phakkika ratna manjusha. Not available. 0. 616 pgs. Literature. Sanskrit. 256 pgs.. shriiniilakand-t'habhat't'a. Sanskrit. Linguistics. shrii raamaayand-aasaar kaavya tilakamu.. Sanskrit. shraadvakaand-ad'amu chatutho bhaagan.. Theology.. Language. not available. ramarayakavi bellamkonda. shrii hanumat shahastri naamaan'jali. narayanadasa adi bhatta. Linguistics. Linguistics. 0. 528 pgs.. Venkata Raman. Linguistics. daamoodara. 1950. Language.. shlokavaar^tikat'iikaa shar^karikaa. shraaddhamayuukha chaturtha. Sanskrit. Language. Sanskrit. shrii guruvaayupureishvara.org/…/SanskritIIIT. sethumadhavaacharya. Literature. Sanskrit. 300 pgs. Sanskrit.. Sanskrit.. Linguistics. 132 pgs. 64 pgs. Literature. Sanskrit. 34 pgs.. Sanskrit. shrauta sutras and prayogas. Theology... Philosophy. 176 pgs. shrii dgargaachaaryasan'hitaa dashakhand-d'atmikaa mahaatmyasametaa. Sanskrit. 1927. 1946. Sanskrit. Sanskrit.. Literature. narayanadasa adi bhatta. Sanskrit.. shrii mahaabhaaratamuu. amrxtaanandayogivaryand-a. Linguistics.. 421 pgs. Sanskrit. 1955. 244 pgs. Language... Sanskrit. not availabe.... Literature. Religion. Not available. The Arts.. shrii krishna leela tarangini. Linguistics. 242 pgs.... ubhayabhaashhaasanaatha dvibhaashhi somanaatha. shrii paanj-charaatre mahoopanipadi utsava san'graha prathama bhaaga. ramaswami shastri. 1942. Literature. Literature. Literature. Literature. Rangaswamy. Literature. 266 pgs. Linguistics. Religion. Linguistics. Religion.. shrii harikathamrutham. Literature. Language. 0. 1933. 210 pgs. Sanskrit. Sanskrit.. k.. Religion. Literature.. Theology.. Language. Language.. bhaaskaraa. 1956. 0. Sanskrit. Sanskrit. 1968... 1959. styanarayana raju... Literature. 566 pgs. sanskritdocuments. s. aar krxshhnd-asvaami ayyar. gopinath kaviraj. Linguistics. 104 pgs.. Linguistics.. Language. 530 pgs. suryakant tripathi. 1939. 1960. 77 pgs. s.r. Religion. Language. shri deisikaashatakamu. 1939. 322 pgs. Linguistics. ramtej pandeyan. shrii harikathamrutham. 1942. 1962. Linguistics. 0. shrautasuutramu devayaagn-ikapaddhati. Not avilable. Literature. Sanskrit. Sanskrit.. Literature.. 232 pgs. Sanskrit. 475 pgs.v. shrii raajaratnakaamaachampuu. 0... The Arts. Sanskrit. Linguistics.. Linguistics.. 188 pgs. shrii raamakrishnavachanaamruth. madhuravaand-i. 1972. Literature... Language.

. Linguistics. Sanskrit.... Sanskrit. Sanskrit. Literature. shriibhaashhyamuu.. Sanskrit. 746 pgs. Linguistics. Religion. 1960. 0. General. vinaayaka gand-esha aapat'e. 727 pgs. 210 pgs. Sanskrit. shriibhagavadraamaanuja. 1942.. Literature. 1362 pgs.. 856 pgs. shriibhagavannaamakaumudii miimaan'saa prakaashat'ikayaa sahitaa. Sanskrit. 1989. 1926.. Language. 564 pgs. Language. Sanskrit. bellamkonda ramaraya kavi. shriimadhusuudanasarasvatii. Linguistics.. Psychology. 1917. Philosophy.. Linguistics. 286 pgs. Theology. Linguistics. Language. shriimachchrakachaturaanana shriichakrapaand-idatta. Language. Linguistics. Sri Padmaprasad Sastri. 1954. Linguistics.. 0. Sanskrit.... 234 pgs.… shriigurucharitamu dvisaahastrii sat'iikamu sachuurnd ikan'cha shriivaasudevaanandasarasvatii 146/167 . Literature. 1972. Linguistics. Sanskrit... shriiyuta raa raa mootiilaala ravishan'kara ghood'aa... 1944. Literature. 1926. sanskritdocuments. Linguistics. shrii vimaanaa charna kalp. Literature. yas seitumaadavaachaarya.. Sanskrit. shriigiitaagovindakaavyamu. 735 pgs. 222 pgs. 1989. shrii tyaagaraaja shatavaarshhika smrxti gran'thaaval'i 1947. bhagiirathaatmajena.. Sanskrit. Sanskrit. Theology.. 690 pgs.. Linguistics. Sanskrit. 1954. Literature. Literature. 0. Linguistics. 0. shrii shankara shankara bhasya vimarsha. Literature. Literature. Language. shriigitaa bhaavachandrikaa. 1948.. Not available. Religion. shrii keshri kant sharma. Language. Sanskrit. shriiprxthviidharaachaarya. 1943. Religion.. madhuravani. shriibhagavadraamaanuja. 0.. Literature.2/14/2011 A list of scanned Sanskrit books at III… shrii ramayanasaar kaatha tilakamu. Lakshmana Suri. Linguistics. shriigautamamuniprand-iitan' nyaayadar^shanan... Sanskrit. 74 pgs. Not available. Language. tyagaraja.. shriibhagavatpaadaabhyudayamu. Sanskrit. shrii sitarmayanam.. shrii vyaasa panni bhavanaaraayand-a.. Linguistics. shriidattapuraand-amu sat'iikamu.. Literature. 448 pgs. shrii shaang-akhaayana grxhyasuutra. Language. shriilaqs-miidhara. Language. Language. -.. 240 pgs. Literature. shriivaasudevaanandasarasvatiit'en'besvaami. shrii vishhnd-uchitiiyamuu.. Literature. Language. 111 pgs. Language. 159 pgs. Literature. sii ema paadmanaabhaachaarya. Theology. 478 pgs.. Linguistics. Religion.. Linguistics. 186 pgs. Language. Sanskrit. 255 pgs. Literature. 1922.. Sanskrit. shriigiitaasvaamivijaya. Linguistics.. Sanskrit. esa anantaachaaryand-a. Literature. 1974. 222 pgs. Sanskrit. Theology. Theology.. 1947.. Literature. shrii kun't'imahi sheshhasharma. shriibhaashhyamuu shrutaprakaashikaaravya.org/…/SanskritIIIT. shriicharakasan'hitaa taatparyetyaparaparyaaya aayurvedadipikaakhya vyaakhyaaya samalang-krxtaa prathamavrxtti.. 266 pgs. Language. 1984. 1922. 170 pgs... shriigautamamuniprand-iitanyaayasuutraand-i. aar ran'garaamaanuja ayyan'gaaru bi ye yal t'i. Religion. Sanskrit.. Language. shrii venkatachalamahatyam.. 145 pgs. 1989... Sanskrit. Sanskrit. shriibhagavadbhakttirasaayanamu t'ikayaa premaprapayaa.. Language. Sanskrit. shriibhuvaneshvariimahaastotramu. shrii yatipativaibhavadiipikaa cha. 416 pgs.. shrii rxgyaju shaavri vaishhnd-avaanaan' brahmakarma.

156 pgs. 2004. Language. shriikand-t'hacharitamu t'iikayaa. Sanskrit. shriimadbhagavadgiitaa bha t't'aatmajasham'karashaastrind-aa sam'shodhitam. 1997.. 1997.. Literature. Literature... Linguistics. Literature. Literature. Sanskrit.. LINGUISTICS. Sanskrit.. Literature. Linguistics. shriimadbhagavadgiita san'put'a 2 ( 10 rin'da 19 adhyaayagal'u ). Not available. shriimadbhaashhyat'iikaabhaavadiipedditiiyaadhyaaya.. 0. 274 pgs. maharshhipravara shriikrxshhnd-aadvaipaayana. Linguistics. 279 pgs. 768 pgs. Sanskrit. Literature. Literature. 492 pgs.. shriimabrahmasuutrand-i saadhanaadhyaaya. Sanskrit. Linguistics.. shriikoshha. shriiharivan'shachampu. Language. shrii shrii sachchidaanan'dein'drasarasvatisvaamigal'avaru. 570 pgs. Religion. 748 pgs. Linguistics... 467 pgs. 114 pgs. Language.. Sanskrit... 1928. Linguistics. sukumaara kavi. 166 pgs.org/…/SanskritIIIT. 1997. Psychology. Sanskrit. Sanskrit. Language. 1954. maharshhi vedavyaasa. Religion. pand-d'itaratna rayapaalya raaghavendraachaarya. Literature. Sanskrit. Language. Not available. Sanskrit. kedaaranatha. Sanskrit. shriimadbhagavadagiigaa. 0. shriikarabhaashhyamuu.. Linguistics.. Literature.. 284 pgs. 0. shriikand-t'hacharitamu t'iikayaa. Literature. Sanskrit. 614 pgs.. 1923. Sanskrit.. Sanskrit. Philosophy. Not available. Religion. 601 pgs. shriimaatrxtattvaprakaasha. Religion.. 1953.... 610 pgs. 120 pgs. shriivaasudevaanandasarasvatii. 1921.2/14/2011 A list of scanned Sanskrit books at III… shriigurucharitamu dvisaahastrii sat iikamu sachuurnd-ikan cha... Theology.. Theology. 233 pgs. Linguistics. shriimadbhagavadgiitaa. Linguistics. Sanskrit. 1946. Language... Language. shriimadadvaita siddhaanta krama prasthaanatraya bhaashhyaanusarend-a. Linguistics. 1985. Linguistics. 0. Sanskrit. 1902.. Sri Madramanujacharya. shriimadaand-ubhaashhyamu... Language. sanskritdocuments.. 0.. Sanskrit.. shriimadbhaagavatamahaapuraand-amu muulamaatramu. shriimadbhagavadgiitaa. shriikushhnd-avilaasakaavyamu. shriilokaprakaashan.. 330 pgs. shriilokaprakaashan' dhvitiya bhaagan. Language.. Language. shriimadbhagavadgiitaa.… h ii dbh d iit bh hh kh b dhi ii d'h th t tt l k 147/167 . 1958. shriimadbhagavadgiitaa. Literature. 317 pgs.. Linguistics. Theology. shriimadvallabhaachaarya. Theology. 26 pgs. Linguistics. shriimatpuujya shang-kara bhagavatpaadaachaarya. Language. shriimadraamaanujaachaarya. Linguistics... Religion. Not available. LITERATURE. shriilalitaasahasranaamastootramu.. Literature. si . Linguistics.. Language. 1942.. Literature. maagad'i shriiveng-kaachaarya.. Language. 0. 397 pgs. 1935. 1110 pgs. Sanskrit. moot'e aqs-aravaalii. 1923. shriimadamarasin'havirachitei.. Literature. 599 pgs. 1983. .. 1936. Literature. Sanskrit. hayavadanaravuu. Linguistics. kaaluuri hanumantaraavu. Not available. Sanskrit. Literature.... Linguistics. Literature. Not Available. GENERALITIES. Language. Sri Rajagopal Shastri. . 590 pgs. Sanskrit.. Language. Sanskrit. Sanskrit. kapaali shaatri. shriimadbhaagaravamu pan'chama khand-d'a. Sanskrit. Literature. 67 pgs. shriimadanuvyaaravyaanan. Language. 62 pgs.. 0. Sanskrit. Language... Language. Linguistics. Sanskrit. LANGUAGE. 1987. shriimadavaalmiikiraamaayand-amu saralagadyatmakam. 480 pgs. Theology.

392 pgs. Religion. 1917. 0. Not available. 144 pgs. Sanskrit.. 1965... 202 pgs. Sanskrit. Religion.. Religion.. 0. 0. Linguistics. 783 pgs.. Philosophy. 1912. 476 pgs. 782 pgs. 591 pgs.. Linguistics. shriimadgand-eshagiitaa.. shriimaddeidaantadeishika granthamaalaayaan. 1955. Literature. Language. Sanskrit. 338 pgs.. 0.. yadupatii. shriimadvalmiikiraamaayand-ama~ uttarakaand-d'a~.. Language. 273 pgs. Linguistics. Theology.. Not Available. 270 pgs. Literature. Sanskrit.. Language. shriimadvalmiikiraamaayand-amuu yuddakaand-d'amu 6.. Sanskrit. 1834. 807 pgs. 353 pgs. Sanskrit. shriimadvadiraajiiyagrandamaalikaayaan' ashht'aman. shriimadbhagavadgiitaa dvitiiyyashhat'kamu.. Sanskrit. t'ii aar krxshhnd-aachaarya. 1911. Psychology. shriimadbhagavata pan'chama skan'dha. shriijagannadthaya. shriijagannathayatii... Language. Language. shriimadvalmiikiraamaayand-amu prathamoo bhaaga. Theology. 346 pgs. shriimachchhaang-kara. Vadiraja. Literature. Linguistics... 155 pgs.. Sanskrit. vidvaanu a san'patkumaaraachaarya. Linguistics. Not available. Language. shriimadbhahavadgiitaas-r^thaprakaashikaa. Sanskrit.. shriimadvalmiikiraamaayand-amu yuddakaand-amuu 6.. 1941.. shriimadbhagavadgiitaa shriimachchhang-karabhaashhyayutaa. Linguistics. 1827. Literature.. Language.. shriimadbhagavatamu ashht'ama skn'dha. Theology. Sri Valmiki. Literature. Language.. Linguistics. shriimadbhagavadgiitaa gn-aanakarmasamuchchayaakhyayaa vyaakhyayaa samaln'krxtaa. t'ii aar krxshhnd-aachaarya. 1917. Sanskrit. Sanskrit. Language. Linguistics. Not available.. Linguistics. Sri Valmiki.. shriimadbrahmasuutratadaabhaashhya trxtiiyaadhyaaya. Sanskrit. 1903. 0. t'ii aara krxshhnd-achaaryand-a. Sanskrit. Literature. 170 pgs. Literature.… shriimadveidaantadeishikagranthamaalaa shrii kan'chi pi bi annangaraachaaryaara Language 148/167 . Sri Brahma Yogin. sanskritdocuments. shriimaddeidaantadeishikagranthamaalaayaan. vidvaan a san'patkrxmaaraachaarya. 1941. 309 pgs. 449 pgs. Sanskrit. Sanskrit.. 386 pgs. 1926.org/…/SanskritIIIT. Language. Sanskrit.. 1940.. Theology. Linguistics. Literature. shriimadbhagavatgiitaa. shriimadvalmiikiraamaayand-ama~ ayodhyaakaand-d'a Part I.. Religion. Linguistics. shriijakannatha. harinaaraayand-a aapat'e. Sanskrit. Sanskrit. Literature. Religion. Sanskrit. Sanskrit.. shriimadbhrahmasuutraand-i saadhanaadyaya. shriimadragavadraitaa... 949 pgs. Linguistics... Philosophy. 0. Theology. Language. Literature.. Linguistics. 0. 1941. shriimadbhraahmasuutraand-i samanvayaadhyaaya.. Not available. 1834. Language. shriimadvalmiikiraamaayand-ama arand-yakaand-d'a.. Literature. 324 pgs.. 1964. Theology. Linguistics.. Literature.. Sanskrit. Sanskrit. Linguistics. Religion. Sanskrit. 1887. bala gangadhara tilak. Language.. Literature. Language. Language. 958 pgs. Sanskrit. Literature.. aanandavardhana.2/14/2011 A list of scanned Sanskrit books at III… shriimadbhagavadgiitaa bhaashhya vyaakhyaaya subodhinii guud'haarthatattvalokan.. shriimadbhahmasuutraand-i saadhanaadhyaaya. 420 pgs.. 130 pgs. Theology. aanandagiri. 492 pgs. Religion.. shriimadveidaantadeishikagran'thamaalaa. Literature. viddaanu a san'patkumaaraachaarya.

0. 0. 1912. Sanskrit.… 149/167 . Sanskrit. Not Available. 0.. shriimahaalaqs-myupaaravyaana. shriijaanakiivallabha. shriikaanj-chi prativaadibhayang-kara and-ndan'garaachaarya. 0. 207 pgs. Linguistics. Language.. Linguistics.. shriimallalitaraamacharitramu baalakaand-d'an' sat'iikamu. Linguistics. vinaayaka gand-esh. Theology. shriimanmantraarthamanj-jarii. Not Available... Religion. Theology. Literature. Religion. pan' jvaalaaprasaadajii sharma. Not available.. shrii kan chi pi bi annangaraachaaryaara. Theology. 238 pgs. Religion. Religion. Sanskrit. Sanskrit. 1901. 341 pgs. 0. Sanskrit... 508 pgs. 540 pgs..... Sanskrit. Sanskrit. Linguistics. shriimadvishhnd-utattvavinirnd-aya. Religion... Not available. 722 pgs.. Sanskrit. Linguistics. 1846. Linguistics. 368 pgs. shriiman mahaabhaaratamu upoodghaatamu. 0.. Literature. t r krishnaachaarya. 419 pgs. shriiman mahaabhaaratamu anushaasanaparva 13.org/…/SanskritIIIT. t r krishnaacharya. Linguistics. 292 pgs. Linguistics. 0.. Linguistics. shriimahaabhaaratamutoojeirina 1901.. 276 pgs. shriimata jayatiirtha.. 200 pgs.. Sanskrit.. 431 pgs. Religion. shriimanmaharaaja san'skrxta mahaapaat'hashaalaa patrikaa. 822 pgs. aara krxshhnd-aachaaryan. Sanskrit. 0. 1932. 225 pgs. Sanskrit. 215 pgs. 727 pgs.. Literature. Not available.. Literature. Theology. Language. Language. shriimahaabhaaratamuu drond-aparvamu. shriimaath kapilananda swamy. t'ii. P. Sanskrit.. Literature.2/14/2011 A list of scanned Sanskrit books at III… shriimadveidaantadeishikagranthamaalaa. Sanskrit. shriimahaabhaaratamu shaan'tiparvamu. Language. Theology. Language. shriimanmantrarthamanj-jarthaa. 1907.. Religion. Not available. Language. Sanskrit. shriimahaabaarataantargata shriimadbhagavadgiitaa dvitiiyyashhat'kamu. 716 pgs. Language. Literature. 1909.. 538 pgs.. shriimanmahaabhaaratama~ anushaasanar^vand-i. Linguistics. Religion. Literature. Sanskrit. shriiman mahaabhaaratamu vishhayaanukramand-i.. Language. Literature. shriimaggavth kapila githa. Language. shriimanmahaabhaaratamu. Not available. Linguistics. 842 pgs. Sanskrit.. Sanskrit. Not available. Not available. Literature. 789 pgs. Linguistics. 1911. 310 pgs.. yer'r'aapreggad'a rachiyin'chinadi. Sanskrit. Not available. Theology. shriimanmahaabhaarahamu.. Religion.. Theology. 262 pgs.. Language. P. Theology. Theology. Sanskrit. 86 pgs. Theology. Theology. 1832. Sanskrit. Religion.... 0. shrii a vi narasin'haachaarya. shriimahaabhaaratamu shaan'tiparvamu. Sanskrit.. Literature. 0.. shriimadviddyapayonidhitiirtha shriipaa... Sanskrit. 1934. 860 pgs. Linguistics. shriimanmahaabhaaratama~ bhiishhmapar^va. Subramanya Sastri. Language. 1940. Sanskrit. shriimajjeiminiiprand-iite mimaan'sadarshind-i. Sanskrit. sanskritdocuments. Language. Literature. Linguistics.. 1951. 1941. Language. 1811. shriimadveidaantadeshikagranthamaalaa. Maharshi Vedavyasa. Sanskrit.. 251 pgs.. Literature. shriimanmahaabhaaratamu udyoogaparvamu. Language. 1905. Not available... shriimana nyaayasudhaa.. Literature.... 1914.. Literature. Religion.

Language. Sanskrit. Sanskrit. Language.. 1952. Sanskrit.. 1942. shriiraamaliilaa raamaayand-a sat'iika. khemaraaja shriikrxshhnd-adaasa. Sanskrit. 244 pgs. shriiraajaratnamaalaachampuu. Linguistics. shriimatyaagaraajavijayamu prathama sn'skarand-amu. Language. Linguistics. 1956. Language. 0. Sanskrit.. 0. shrii vaadiraajabhagavatpaada. Linguistics. Literature. n ramaswamy iyer.. Sanskrit. saqs-mand-a raamachan'dra paan'gaarakara. Literature. Literature. 260 pgs. 408 pgs. 128 pgs. Linguistics. 1940. 48 pgs. 1987. RELIGION. shriipanj-charaatraraqs-aa paanj-charaatragamasya. Sanskrit. 1974. 0.. Language. 0. Language.. 0.... Linguistics... Sanskrit. Religion.. shriinarasimhapuraanamu. Literature.. shriiraamaayand-asaara kaavya tilakamu. 267 pgs... . 1958. Literature. Linguistics. Sanskrit. shriiraamalin'gheishvarasthavaraaja. shriirahasyatrayasaarasan'graha. 0. 1930. Not available.. 1929.. shriimannigamaantamahaadeshikaa. Literature. shriiraamadaasasvaamiin'che samagra gran'tha shriisamarthagran'thabhaan'd'aara. 0. shriimattan'trasaara chhallaarii vyaakhyaana. Sanskrit. Literature. Linguistics. Linguistics. Literature.2/14/2011 A list of scanned Sanskrit books at III… shriimannaaraayand-iiyamu. Language. LANGUAGE. Religion. Linguistics. shriinaaraayand-iiyamuu. Theology. Literature... raamachan'dra. Language. 120 pgs.. shriimanyaamutan. Linguistics. shriiraamaayand-a mahaakaavya bhaaga 5. Not available. shri direndra tirth... shriimanu nyaayasudhaa prathamoobhaaga. THEOLOGY... not availabe. 424 pgs.… 150/167 ... Linguistics. Language. Sanskrit. Not available.. Literature. shriimatsarvamulan'san'puurnd-a... shriipaadukaasahasramu muulamaatramu. Sanskrit. shriimatuu saathand-aachray. ... shriimannyaayasuudhaa sheshhavaakyaarthachan'drikaat'ippand-i. LITERATURE. Linguistics.. 402 pgs. Theology. 1829. Sri Raghvendra Swami. shriimannyaayamrxtataran'gind-i. Literature.. Sanskrit. Not available. Literature. 0. Sanskrit. 1960. LINGUISTICS. 391 pgs. Not available. Linguistics. 240 pgs.. dvibhaashhi somanaatha. shriimatsanatsujaatiyamuu kramaang-ka 8. Sanskrit. Literature. Sanskrit. Language. Sanskrit. daamodara saatavalekara. 617 pgs. Not Availble. Language. Literature. Theology. 226 pgs. Language. 0. Literature. 1986. Language.. Sanskrit. Linguistics. 1100 pgs.. shriimannyaayasudhaaparimal'e dvitiiyadhyaaya prathamapaada. Language. Psychology. Language. Sanskrit.. Philosophy. 0. 411 pgs. Language. sanskritdocuments. 584 pgs... Pandit R. Dwaita Philosophy. Religion. Sanskrit. Literature. shriimadvedaantadeshika.. mootiilaala jaalaan. 1972.org/…/SanskritIIIT.. Language. 153 pgs. 0.. Sanskrit. 228 pgs. Sanskrit. Linguistics. Linguistics. Sanskrit. Literature. 485 pgs. shrii mudigond-d'a subrahmand-yasharmand-aa.. siddheswar jena. 240 pgs. 0. shriiraamaayanama. Linguistics. m. Sanskrit. 760 pgs. 308 pgs... madhuravaand-ii. . 1110 pgs. Linguistics.. Sanskrit. shriimadraaghavendragurusaarvabhauma. Seshasayi Iyengar. shriinyaayamutttaavalin. shriimatryaayasudhaaparimat't'an.. 1968... 38 pgs.... Sanskrit. Literature. 101 pgs. shriinaaraayaneupanishad. Language. 248 pgs.

Linguistics. 0. Theology. Sanskrit... Sanskrit. Sanskrit. Not available. Literature. Sanskrit. Sanskrit. sanskritdocuments.… 151/167 . Literature.. Linguistics. Literature. 299 pgs. Sanskrit.. Language.. Language.. Linguistics.. LITERATURE. Literature.. Religion. Linguistics. LINGUISTICS. Linguistics. LINGUISTICS. shriishriichaitanya charitaavalii bhaaga 4. shriitantralooka vivekaakhyat'iikopeta dvaadashobhaaga. 244 pgs. Sanskrit. Linguistics. 230 pgs. 338 pgs. 1918. Literature. Sanskrit. 279 pgs. Sanskrit.... shriiveidaantaachaaryavijaya. Language.. shriisvachchhandatantramu. shriirang-garaamaanujamuniiprand-iitaa. Sanskrit. 224 pgs. 0. Linguistics. Hari Raghunath Bhagavat. 1937. shriishang-karadigvijaya hindii anuvaada vistrxta t'ippand-e tathaa vivechanaatmaka bhuumikaa. Literature..org/…/SanskritIIIT. 749 pgs. shriivign-aanabhairava. Language.. shriisubodhinii t'ippand-isahita sampradaayavidushhaa. shriivishhnd-uyaagapaddhati navagrahamakhasahitaa. 108 pgs. Sanskrit.. Sanskrit.. maadhavaachaarya.. Linguistics.. Language. shriiven'kat'aachaletihaasamaalaa. Sanskrit. Sanskrit. 376 pgs. shriiveng-kat'aachalamaahaatmya dvitiiyobhaaga hindiibhaashhaamayt'ikopeta.. shriimadabhinavagupta. 1986. 0. ti viiraraaghavaachaaryaind-a. Sanskrit.. 814 pgs. Language. 0.. Language.. Literature. shriishriichaitanya charitaavalii bhaaga 1. Linguistics.. Language. prabhudatta brahmachaarii.. shriishan'karaachaayaivirachitagran'thasan'grahan'prakarand-agran'thaan. Literature. shaaravot't'ai kushhnd-aasvaamyayya.. 384 pgs.. Literature. 1929. LITERATURE. 568 pgs. 0. 318 pgs. LINGUISTICS. shriikrxshhnd-adaasaatmaja. Literature. shriishivasvaroodaya.. prabhudatta brahmachaarii. 190 pgs. shriiupaasanaatrayasidddhaan'ta. Theology. 1972. 789 pgs. 1921. Language. 340 pgs. LINGUISTICS. shriimahaamaheshvarachaarya. shriishriichaitanya charitaavalii bhaaga 2.. Sanskrit. 170 pgs. Not Available.. 120 pgs. Linguistics. ramaraju b ed. LITERATURE. Language. 1950. shriivallabhaachaarya. LANGUAGE. LINGUISTICS. shriishriichaitanya charitaavalii bhaaga 3. bhaalachandra jagannaatha dvivedii. Language. 300 pgs. 288 pgs.2/14/2011 pg A list of scanned Sanskrit books at III… shriiramayansaar kavya tilakam madhurvani.. LANGUAGE. Literature. prabhudatta brahmachaarii. 1947. Linguistics.. shriishriichaitanya charitaavalii bhaaga 5. jagannaatha parashuraama dvivedi. 274 pgs. Literature.. Linguistics... Literature. LANGUAGE. 0.. Sanskrit. Language. Literature. Language. 2000. Literature. shriishaantikalpadruma vaastushaantisahita. shriiveng-kat'aachalamaahaatmya prathamabhaaga hindii anuvaada sahita. Sanskrit. 1955... 0. Sanskrit. Sanskrit. 368 pgs. Linguistics. Not available. LITERATURE.... 1852. prabhudatta brahmachaarii. pand-d'itavara shriikeshariikaantajiisharma. 0.. 1938. Sanskrit.. LANGUAGE. Sanskrit. Religion. Language. shriivishhnd-enaamasahasramu.. 0. 1925.. Not available. shriiyaajnj-avalkyasmrxti.. LANGUAGE. 242 pgs. Linguistics. Linguistics.. prabhudatta brahmachaarii. 1898. Language. shrii krxshhnd-adaasa. Literature. LITERATURE. khemaraaja shriikrxshhnd-adaasa. Sanskrit.

shrishang-karabhagavatpaadiiyaprakarand-aprabandhavali trxtiiyasan'put'amu. 1968. Linguistics. Theology.... Sanskrit. Literature. 0.. Rangasawami Aiyangar. Linguistics.. Sanskrit.. Linguistics. Language. Psychology. Literature. 480 pgs.. hiiraalaala. Linguistics.. 946 pgs. shuklayajurvediiya kaand-va san'hitaa.. mahaadeivashaastri. Not Available. Linguistics. shripati. shrii harshha. shrudhikaand-d'amu dashamo bhaagan. 108 pgs.v. Sanskrit. K. siddaantalaqs-and-amu. Sanskrit.rangaswami.. shrungarabhushhand-amu. Language.. 1902.. shuklayajurveda sahitpani shachhtakamu. LITERATURE. e. 0.. 1945. Literature. THEOLOGY. Sanskrit. shriimadgang-geshopaadhyaaya. LINGUISTICS. Language. 486 pgs. shuudrakamalaakaramu. 1964. shukasaptati agn-aatakartrxkaa kathaakrxti. Literature.. Sanskrit. 846 pgs. K.. 283 pgs.. Theology. shriiraamabhadra.. shrxn'gaara haaraavalii. shukraniitisaara. Literature. shung-garatilaka. 232 pgs. 200 pgs.... 1862. 0. Linguistics. jiivaanandavidhaasaagara.. Linguistics. Linguistics. 0. shrikaara bhaashya vol 1. shrungarasarvasvasvabhaand-an. Literature. Literature. Literature. gad'gan'prasaadajii. Sanskrit. 171 pgs.. Sanskrit. Sanskrit. Religion. sahadayaaliila. 1919. iishvarasharma. Sanskrit.. 154 pgs. siddaantaratnamusat'iikamu. ilaivilli jagguu veng-kat'aachaarya. Not available. Linguistics.2/14/2011 y j j y A list of Sanskrit books at III… gscanned g g pg shriiyatiindrapravand-aprabhaava. Sanskrit. shuddhiprakaasha. 1959... maagad'i shriirang-ganaathaachaarya. sanskritdocuments. pn' . Philosophy. Language.. Language. Language. Sanskrit.. Language.. v. vi . Linguistics.. shripatipaddhati adhyaaya 1 8 bhaaga 7.. 294 pgs. 744 pgs. Sanskrit.. Not available. Sanskrit. LANGUAGE.. 107 pgs. 352 pgs. Literature. shukraniiti. Language. shriivaamanabhat't'a. LANGUAGE. 164 pgs.. Linguistics. 1956. 65 pgs.. Literature. Language. Linguistics. Religion. Sanskrit. Literature. 282 pgs. 240 pgs. 1937. 23 pgs. 1923. 1950. Religion. bhat't'aachaaryend-a shrii paadasharmand-a. Literature.. Linguistics. Language. shrii madanan'da jagapati. 1965. Sanskrit. 640 pgs. 68 pgs. Language.. Sanskrit... Language. RELIGION.org/…/SanskritIIIT.. Literature. Sanskrit. Sanskrit. Sanskrit. Sanskrit.. Linguistics.. Sanskrit. Linguistics.. shrundgaratilakamu. shriinallaa. subrahmanya shastri..v. Theology. 240 pgs. 1890. Bhrga Samhita. shrxng-gaarasundarabhaand-a. shrishivamahaapuraand-mu. Language. 1932. Literature. Theology. shrudikaand-d'amu dashamo bhaagan. LITERATURE. 1894. Sanskrit. 1968. 1936. 232 pgs. Literature. swamy maheshvarananda giri.. 46 pgs. Religion.… 152/167 . Sanskrit. e . Language.. shuddhadhar^ma mand-d'alam' shriimadbhagavadgiitaa. Linguistics. shrimadbhrahmasuutraand-i.. Language.. 1912. Sanskrit. Literature. 1896.... shriibaladevavidhyaabhuushhand-a. 1899. Language. 1950. sidantabindu. krishnajanth panth. LINGUISTICS. 632 pgs.

. 1916. Linguistics. Not available. 152 pgs. Linguistics. Literature.. siddhaantaleshasan'graha sat'ippand-abhaashhaanuvaada. 54 pgs. 1917. Language. LINGUISTICS. siddhaantasiddhaanj-janan' trxtiiyo bhaaga. LANGUAGE. 1917..… smrxtichandrikaa shraaghdakaand-ad'a. 596 pgs. Philosophy. siitaaraavand-asan'vaadajharyu ttarabhaaga. 380 pgs. Language. Literature. RELIGION. Language.. Theology. Sanskrit. Sanskrit. Not available. Linguistics. Linguistics. shriimadappayyadiiqs-ita. Language. vasudev lakshman shastri pansikar ed. shriikrxshhnd-aanandasarasvatii. LITERATURE.. Language.. pan' svaamishriiraamamishrashaastrind-aa.. Sanskrit. siddhaantachandrikaa san'qs-iptabaalabodhinii t'iikaa.. sri ramnatha shastri tr. Philosophy. Not Available. Not available. 0. Sanskrit. 469 pgs.. smritichandrika 3 vyavahaara khanka bhaaga 2. 358 pgs... Sri Krishnananda Sarasvati. 170 pgs. Tryambakam Sastri. 810 pgs.. 242 pgs. 1919. Literature.. Sanskrit. Linguistics. 1928. nilakanta dikshita.. Literature.. Sanskrit. Literature. Linguistics.. 146 pgs. Linguistics. wasudev laxman sastri pansikar ed. Language. shrii yaagn-ikadevand-abhat't'opaadhyaaya. Language. 132 pgs. Literature.2/14/2011 A list of scanned Sanskrit books at III… siddanta kaumudi. Linguistics. Sanskrit. sidditrayii... siddhantasiddhaajann'part 4. Sanskrit. Sanskrit. Linguistics. 490 pgs. Sanskrit. 90 pgs. Psychology. pandit durgaprasada ed.. Sanskrit. shrii yaagn-ikadevand-abhat't'opaadhyaaya. 170 pgs. Sanskrit. Linguistics.. 1911. shrii yaagn-ikadevand-abhat't'opaadhyaaya... Psychology. Religion. Language. Sri Krishnananda Sarasvati. balabhadra.. sitaaraavand-asamvadaajharya uttarabhaaga. 1921. devana bhatta. siddhanta kaumudi. Literature. Literature. Language. sindhukaustubha. 156 pgs. Linguistics. Language.. sisupalavadha of magha... siddhaantasiddhaanj-janamu. smrxtichandrikaa aahnikakaand-d'amuu 2. siddhantabindu nyayaratnavali laghuyakhya.. 0. Language.. Sanskrit. Linguistics. Literature... sanskritdocuments. prataap sin'ha. 153/167 . 1940. 1917. parashuraama shaatri. 1919. 1993. Language. Literature. Literature. 0. 1929.org/…/SanskritIIIT. Sanskrit. Linguistics. Linguistics... Philosophy. riitaaraamashaastrii. Sanskrit. siddhaantashiromand-e gorlaadhyaayo vaasanaabhaashhyasahita.. 1914.. Philosophy. Not available. 410 pgs. 1932. sivalilarnava. 1918.. Literature.. Literature. Language. 112 pgs.. 1928. Literature. Language. smrxtichandrikaa san'skaarakaand-d'a 1. 156 pgs. sidditrayamu vedaantaprakarand-amu vishishht'aadvaita brahmaniruupand-aparamu. siddhaanta shiromand-e grahargand-itaadhyaayo vaasanaabhaashhyasahita. Literature. siddanta rahasyam. siddhantasiddhaajann'part 2. siddhaantabindu of madhusuudanasarasvati. Language.. 236 pgs. 562 pgs. Sanskrit. Sanskrit. Sanskrit. Language.. Sanskrit. Linguistics... Linguistics. Psychology. Sanskrit.. Sanskrit.. 1925. Psychology.. 0. Language. Sanskrit... siddhasiddhaantasan'graha. madhusudana sarasvati. Psychology. 1914. 0. Sanskrit. 102 pgs.. 566 pgs. THEOLOGY. 810 pgs. Sanskrit. Philosophy... 404 pgs. Literature.. 0.

Linguistics. smurichandrikaa asaucha kaanda. Linguistics. raamaanujaachaarya... Theology. Linguistics. 1914. 1931.. sri tuurvaasamunivar.… 154/167 . Sanskrit. sri vemageeta prathama sahasram. Linguistics. sri raama giita. Religion. srimad bhagavatam tasya chatutho bhag. Linguistics.. Literature. 1918. 1244 pgs. Language.. Linguistics. Sanskrit. Literature. damodar s.. Linguistics. Literature. Theology. Literature. Theology.. shrii yaagn-ikadevand-abhat't'opaadhyaaya. 514 pgs. aapstaan'baa. veda vyas... Literature. Srinivasagarya. Language. Linguistics. shriimadvidhanaada... khemaraaja shriikrxshhnd-adaasane shreshht'inaa. Language. spandakaarikaa. devanabhatta. Language. Sanskrit. Sanskrit. Sanskrit. spandakaarikaa.. Sanskrit. veda vyas.. Literature. 1885.. 1902.. 1909. 222 pgs.. Literature. srimad bhagavadgita purushaarth bodhani bhaasha tika. Sanskrit. Language. 1930... 1835. 1969. sri suresvaracarya. Not available. Language. 1969... Literature. Linguistics. Language... spandakaarikaa. 809 pgs. Sanskrit. 824 pgs. Literature.. Literature.. Language.. Literature.. sri raamaanuja champu. Literature. srautasuutra 1-5.. Religion. Linguistics. 236 pgs. 1986.. Language. Language.. Not available. Language. Sanskrit.. Theology. 490 pgs. smrxtyarthasaagara. vinaayaka jand-esha aapat'e. 1970.. Sanskrit. Sanskrit. 1961... 386 pgs. 158 pgs. Language. sottaraaprashnaavalii dvitiiya khand-d'a 23 varshhaand-aan' prashnapatrasahita.2/14/2011 A list of scanned Sanskrit books III… smrxtichandrikaa shraaghdakaand ad a. 232 pgs. sragii. Language. Sanskrit. vemana. Linguistics. 222 pgs. aachaarya mand-d'anaamishra. smrxtikaustubha. 1921.. Linguistics. g krishna shaastri.. Religion. sri bhaashhya paart' I. Literature. sribhasyaprakasika. smuti kaustubhan. Sanskrit. 1852. Literature.. Literature. 776 pgs. Sanskrit. 1942.. 1970. Sanskrit. 0. Linguistics.. Sanskrit.. Sanskrit. Literature. Not available. Language. sanskritdocuments. 148 pgs. Literature. Linguistics. 326 pgs. 0. 1974.. Literature. veda vyas. ramanujacharya.. 0. 29 pgs. shriimada aapadevatmaja anantadeva. Linguistics. Linguistics. Sanskrit. Sanskrit. 439 pgs. Language. Literature. sowgandhikaaharand-amu. 0. Language.org/…/SanskritIIIT. 852 pgs.. Sanskrit. 1902. Linguistics. Language. Language.. sphoot'asiddhi. Language... Sanskrit. Language. Linguistics. Religion. Linguistics. Language. 1914. smrxtichandrikaa yaamaashauchakaand-d'e.. shrii yaagn ikadevand abhatat t opaadhyaaya. sri svayamvaraa paarvatii man'tramaalaa stootram. Sanskrit. kallat'a.. 610 pgs. prashnapatrasahita. 314 pgs. srimad bhagavatam... 0. Linguistics. tukaaraam.. Literature. Linguistics. Sanskrit. 478 pgs. Not available. 339 pgs.. Sanskrit. 230 pgs. Linguistics. Literature. srimad bhagavatam tasya dritya bagh. Literature. smrxtichandrikaa vyavahaarakaand-d'a 3 bhaaga 1. 42 pgs. 184 pgs. Literature.. 40 pgs.. Sanskrit. Linguistics. 0.. -. Language. 208 pgs. Sanskrit. Sanskrit. smrxtinaan' samuchchaya. Language. 1944. 497 pgs.

86 pgs. Linguistics.. 84 pgs. Linguistics. Linguistics. Literature. Theology.. suutraarthaamrxtalaharii. abhinava kalidasa. Literature..v. Literature. Literature. chandrashekarana. sanskritdocuments. Literature. Language. 1951.. 812 pgs. suurasaagara. 218 pgs. Unknown... abhinava kaalidaasa. shriirang-kanaatha.. 74 pgs. srngarasekhara bhana. Language. Language. veidaantadeishikulu. subhashita niva... 1988. 170 pgs. Sanskrit. Sanskrit. sushrata sanhita sharira staanamu.. ti. sutravt'ati. 0.. Linguistics. subhaashita trishaati vyaakhyaayasahita. t. Literature. Literature. Religion. 569 pgs. Linguistics. Linguistics. Literature. kulashekara varmaa.. Pandith Laxmikanth Kanyaal. Not available. 416 pgs. subod sanskrit vyakhan pradhama bhag. 412 pgs. 258 pgs. sundararaamaayand-amu aura satiivilasitamu. 138 pgs. Sanskrit.. Sanskrit. 322 pgs. Linguistics. 999 pgs. valmiki. Literature.. Literature. Sanskrit. Sanskrit. Literature..2/14/2011 A list of scanned Sanskrit books at III… srimad ramayan dritya bagh. Sanskrit. Language.. 25 pgs.… 155/167 . 0. 584 pgs. Literature. 238 pgs. Literature. 1971. Technology. 890 pgs. Sanskrit. Language. 1912. Linguistics. Literature. Language.bapat. 0. Literature. Language. subhaashhitaniivii. Sanskrit. 1961. 1925. Literature. 1916... suttanipaato.. Language. Literature. Sanskrit. 260 pgs.. subhaashita ratna bhaand'aagaara. Linguistics. 1968. Literature.org/…/SanskritIIIT. srngara sekhra bhana. Literature.. Linguistics. Language. sugamaa. subhaashhitaniivyaan' durvrxttapaddatishchaturthii 4. Language.. shriinigamaantamahaadeshikaa. 142 pgs. Language. Sanskrit. suuryyasidddhaanta.. sumadhvavijaya. 0. Linguistics. Literature.. 192 pgs. Sanskrit.. Sanskrit.. Language. 1941. subhadraaharand-amu. Sanskrit.. Language. 1924. subhaashhita sudhaanidhi..12. naaraayan ram acharya. subhashita ratna bhaandaagaaram. Sanskrit. saayand-a. subhaashhitaniivii. Sanskrit.. Not Available. Philosophy. Literature. 1931. Psychology. 1935.. Linguistics.. srimadbhaagavatam skandhas 8 . Sanskrit. Sanskrit. Linguistics.. Philosophy. statvaprakash... 498 pgs. Sanskrit. subhaashhitaavalin. 1911. shriisachchidaanadendrasarasvatii.. bhartrihari. Language. Sanskrit. Psychology.. 422 pgs. Sanskrit. Sanskrit. Linguistics.... 1891. si sundara shaastriyaara. 1933. Literature.. Language. Linguistics. Sanskrit. 1134 pgs. -.. kaasiinaatha paan'd'uran'ga paraab.. Linguistics. 1886... srimad valmiki ramayanam.. 1955. Linguistics. shriimaadhavabhat't'a. 1940. Linguistics. P.. 0. 1971. 350 pgs. 111 pgs. Linguistics. Sanskrit. Philosophy. Language... 916 pgs. sushrutasan'hitaayaa. Sanskrit. Sanskrit. Linguistics. kaashinaatha panduranga paraba. Linguistics. subhaasita ratna bhaand'aagaaramu. Linguistics. Language. Literature. shriimadullabhadeva.. Sanskrit.. 556 pgs.. Language. r. 198 pgs. subhadraadhananj-jayamu. 1899. Language. Not Available... sri vedanta desika. Sanskrit.. Psychology. Language. 1917. krishnaachaarya.. valmiki. Language. 1961. Linguistics. pandita nilakanta devarao deshpande. Language. Language.. 0. 156 pgs... Not available. 1952. Not available. Sanskrit.

1983. Language. 360 pgs. 1896. Sanskrit. Linguistics. 0. shriiniilakand-t'haachaarya. Language. 0. e. Sanskrit. sanskritdocuments. 346 pgs.. svarasiddaanta chandrikaa. Sri Ganapathi Sastri. 471 pgs. 101 pgs.. A. Psychology. svaravyaajjanamu. Linguistics. 34 pgs. kaashiinaatha vaasudeivashaastrii. Language. 126 pgs. Linguistics. Literature. 170 pgs. taittiriiya rand-yakan' bhat't'abhaaskara bhaashhyasahitan' Vol 3. svayambhupuraand-amu. Sanskrit.. 1956. Linguistics. Literature.. e. Theology. Sanskrit.iii. Sanskrit. vyaasatiirtha. 1948. Literature. Sanskrit. Literature. Language.. 1926. Linguistics. taajika niilakand-t'hii t'ikayaa savisheshhopapatti sodaaharand-a bhaashhaabhaavaarthana. Sanskrit. Linguistics.. 1898. Linguistics... Literature. Sanskrit.. Language. taddhitaantaa kechanashabdaa. shriimadgrund-i shan'bhubhat't'a. Mahadeva Sastri. 1896. 570 pgs.. qs-emaraajaa. Literature. siitaaraama shaastri. 0. Sanskrit. Linguistics. Linguistics. Literature. Not Available. 224 pgs. Theology. Religion.. Linguistics.. Literature. Language. Linguistics.… 156/167 . Religion.. 1895.. mahaadeiva saastri. ke maadhava krxshhnd-a sharma. svaraajyasiddhi qs-igagd'adharendra sarasvati virachitaa. Psychology. Language. Language. Linguistics. shriisambhavai jyothorupaaya.. Linguistics. svasthavrxttasamuchchaya bhaashhat'iikaasahita. Sanskrit.. 1896.. Literature... Not available. Language. Sanskrit.. 374 pgs. 89 pgs. Literature.. 550 pgs. svaanandavanavihaarakaavyamu.. Language. 470 pgs. 221 pgs. svaanubhavaadarsha.. mahaadeiva saastri... Philosophy. Language. Sanskrit..org/…/SanskritIIIT. Sanskrit. taajiiraatahinda. 480 pgs..ix. Sanskrit. 1917. Literature. taatparyachandrikaa. Literature. 1964... Language. Language. Literature.. Not available. 470 pgs.. Linguistics. Literature. 1927. mahaadeiva saastri.. Linguistics. taaraanaayatarkavaachaspati jiivanacharitamu. shivaraamakushhnd-ashaastri.. 1904. d'aa maagiirathapraasaadatripaat'hii vaagiisha shaastrii.iv. Sanskrit. 0.. Literature. 1961..2/14/2011 A list of scanned Sanskrit books at III… suutrabhaashhyaarthatatvavivechani. Literature. Sanskrit. Linguistics. Sanskrit. Literature. 540 pgs.. Language. Literature. e. svaraprakriyaa. pan'd'ita harishan'kara. taitiriiya san'hitaa krishna yajurveida Vol.. Literature. Sanskrit. Language. Language. 454 pgs. taitiriiya san'hitaa. Language. Language. Bhatta Kumarila. Sanskrit. Linguistics.. Linguistics. Sanskrit. Language. Not Available. Language. aachaariyaraghuviirend-a. taitiriiya san'hitaa krishna yajurveida Vol.v. 0. taatparyachandrikaa dvitiiyasamput'amuu. Literature. 1898.. 478 pgs. Sanskrit.. 362 pgs... Sanskrit. Sanskrit.. 454 pgs. 288 pgs. ramanujacharya.. 1902. taitiriiya san'hitaa krishhnd-a yajurveida Vol. t'ood'araanandamuu volume 1. Linguistics. 362 pgs. Sanskrit. t'upuut'iikaa. shriisachchidaanadendrasarasvatii. 0. Sanskrit.. Linguistics. Philosophy.. 306 pgs.. Language. svachchanda tantramu Vol.... Linguistics. 0. taitiriiya san'hitaa krishhnd-a yajurveida Vol. 0. mahadeiva saastri. taitiriiya brahmand-a baashha part Ii. 136 pgs.iii. Literature. 0.

216 pgs. Not available.. Language.. Theology. Theology. Theology. 512 pgs.. 1989. Linguistics..… 157/167 . 244 pgs. Language. Theology. 480 pgs. 425 pgs. Literature. Literature. tantrasaara. Religion. Linguistics.. RELIGION. bhat't'abhaaskaramishraa. Literature... 1971 512 pgs sanskritdocuments. Language.. 1923. Sanskrit.. 1930. raghu vir. tantraprakaashikaasamete mimaaman'sa ar^thasan'graha.. Theology. taittiriiyasan'hitaa bhaaga 2. Philosophy.. taittiriiyasan'hitaa bhaaga 10. Linguistics. Language. 239 pgs. Religion. Linguistics. Sanskrit. tan'jaavuurupatanamu. Sanskrit. Sanskrit. 558 pgs. tarkabhaashhaa. 102 pgs.. Sanskrit. 0. tantrasaara. 1924. shrii sachchidaanadendrasarasvatii. Theology. tantralooka Volume Iii... 443 pgs. Sanskrit.annanagarachari. Religion. tantraadhikaaranirnd-aya. 1934. swami satchidaanandendra saraswathi.. Literature.. Psychology. Psychology. -. 370 pgs.. tarkakutuuhalamu.. 374 pgs. Sanskrit. 1918. tantralooka bhaaga 1. Religion. Psychology. tantralooka bhaaga 8. 271 pgs. P. 454 pgs. Philosophy. 1894. Sanskrit... 1930. Ramanujacharya. Linguistics.... tantralooka bhaaga 2. Sanskrit. Psychology.. 104 pgs.. Sanskrit. shriikeshavamishra. Sanskrit. 186 pgs. Philosophy... Religion. tantrarahasyamn.org/…/SanskritIIIT. Sanskrit.. Literature. Language. 1894. mallaadi vasun'dhara. tantrayeprasuunamaalikaa. takra sangra.. 227 pgs. Sanskrit.. -. 280 pgs. 0. taittiriiyasan'hitaa bhaaga 12.. bhat't'abhaaskaramishraa. Sanskrit. Psychology. taittiriyopanishhata.. Sanskrit.. abhinava gupta. Theology.. Religion... 1882. Language. Religion. 230 pgs. taittiriya upanishad. mahaamahopaadhyaaya parashuraamashaastrind-aa. 1917.. parvatiiya shriivishveshvarapaand-d'eya. 1952. T. 333 pgs.. Sanskrit.b. 72 pgs. Religion. 1962. Linguistics. tarka sangrah. Not Available.. Literature. 1918. 98 pgs.. Literature.. 66 pgs. Psychology. abhinavagupta. Narayana Sastri. taittiriyasan'hitaayaa padaanukramand-ii prathama khand-d'a. 140 pgs.. Sanskrit. Ganapathi Sastri. Madhusudhan Kaul Sastri. Psychology. Literature. Language. tark shastra terminology of logic part 1.2/14/2011 A list of scanned Sanskrit books at III… taittiriiya san'hitaa Vol II. Sri Lowgakshi Bhaskara.. Linguistics. 48 pgs. THEOLOGY. taittiriiyabraahmand-amu prathamaashht'akamu. abhinavagupta. Sanskrit. 1922. bhat't'abhaaskaramishra. 206 pgs. 1918. Philosophy. 1949. Religion. Religion. 1953. 1921. Language.. Sanskrit. bhat't'abhaaskaramishra. Theology. Sanskrit. Religion. Not available.. 238 pgs. Religion. Sanskrit. Theology. Literature. Theology.. Sanskrit. bhat't'abhaaskaramishraa. Linguistics... 361 pgs. mahadeva shaastri.. Philosophy. Theology. Religion.. Language. Philosophy. Sanskrit. Sanskrit.. 1921. Sanskrit. 0. tantralooka bhaaga 4. 1952. 1898. taittiriiyabraahmand-amu trxtiiyaashht'ake prathamabhaaga 1 7 prashnaa.... taittiriya upanishad anandavalli bhriguvalli... Sanskrit. abhinavagupta. 1915. 1911. tantrashuddvaya prakarand-an' bhat't'aarakaqs-ivedottama prand-itan. 1897. 0.. Sanskrit. Linguistics. tarkai shaastra nirupand-amu. 38 pgs.. 102 pgs. Philosophy. taittiriiyabraah-hmrxnd-amam.. abhinavagupta. Sanskrit. Sanskrit.. abhinavagupta. Sanskrit. Theology.

401 pgs. tatvabodhanyaa uttaraardhda. Language.. sanskritdocuments. 1969.. Sanskrit. 520 pgs. 552 pgs. 32 pgs. tattvabindu. Sanskrit. Not available.. aanandajnana. Linguistics. 612 pgs. Linguistics. tattvapradiipikaa chitsuravi nayanaprasaadiniisamaakhyayaa vyaakhyaaya sahitaa. yativarashriignaanendrasarasvatii. 1940. Language.. Sanskrit.. jvaalaa prasaada kaanod'iya. Literature.. Language. Language. shrii vyaasatiirtha. Literature. tattvasaara samanugrxhita. tattvasan'graha volume 1.. jayadayaala. Language. 278 pgs. 1932. tatva vichaar. 0. tatvabiidhinyaa uttaraardha subiidhinyaakhyan' svaravaidikaprakarand-an. Jayarasi Bhatta. 1992. Linguistics. Literature. Sanskrit. 0. 1917.. 216 pgs. Sanskrit. 1932.. tattvopaplavasin'ha. Language. Linguistics. Philosophy. Language.. 1915. Literature.. 360 pgs. tattvatrayamuu. jayadayaala... Sanskrit.. tarkataand-d'avamu trxtiiyan' san'put'amu. 386 pgs. Sanskrit.. tarkasan'graha nyaayabodhini vaakyavrxtti niruktti t'iippand-yaa. 448 pgs.. Language. Language.. 116 pgs. Literature. 214 pgs. Language. Sanskrit. LITERATURE. Sanskrit. Sanskrit. 1926.. 1916. LANGUAGE.. Literature. Literature. Language. tattvabodhinii puurvaarddha viyaakarand-asiddhaantakaumudiivyaakhyaaruupan. Linguistics.. janaardanashaastrii paand-d'eya.. Sanskrit.. 364 pgs. tattvachintamand-i Part I. LINGUISTICS.. Sanskrit. Literature.. 0.. Literature. Psychology. Sanskrit. LINGUISTICS.. Psychology.. Sanskrit. Sanskrit. 398 pgs. Linguistics. 0. 349 pgs. shriimadannan'bhat't'a. 1003 pgs. shriimadannambhat't'a. 1953.. 518 pgs. 1974. Linguistics.2/14/2011 A list of scanned Sanskrit books at III… 1971. Sanskrit. tarkasangraha. Sanskrit. Literature. 456 pgs. 523 pgs. 0. Sanskrit. tarkasan'graha diipikaa nyaayabodhiniisamalan'krxta. Literature. Language. Linguistics. pan' shriiaanandabhtaa nyaayachaarya. Language.... Literature. 192 pgs. Language. tattvachintaamand-e saamaanyalaqs-and-aprakarand-amu. kamalashiila. Gangesopadhayaya. 830 pgs. Linguistics. Linguistics. Linguistics. shriimadavedaantadeshika. tattva chintaamand-i bhaaga 7. tarkakutuuhalamuu. shriivyaasatiirtha... janaardanashaastrii paand-d'eya.. LANGUAGE. Sanskrit.. 1924. Language.. Linguistics. 2003. LITERATURE. tarkakutuuhalamuu. Language. Linguistics. Literature. Linguistics. Sanskrit.org/…/SanskritIIIT.. Literature. 52 pgs. 0.. Linguistics. Language. Sanskrit. 315 pgs.. 60 pgs. Linguistics. llokaacharya. Sanskrit. 1888.. Linguistics. s chandrasekhara sastrigal. Literature. tarkataand-d'avamu prathamasamput'amu nyaayadiipaaravyaakhyaaya. tarkasangraha. Literature. Sanskrit.. 200 pgs. sri vachaspati mishra. 1938.… 158/167 .. Literature... Linguistics. Philosophy. shriimadannabhat't'a. Linguistics. Sanskrit. tattva chintaamand-i bhaaga 6.. LANGUAGE. tarkasang-grahasarvasvamu tarkasan'grahavyaakhyaa t'ippand-yaacha samalan'krxtamu.. mahaamahopaadhyaaya shrii ganggeshopaadhyaaya. Literature.. Literature.. Not avilable. Language. 512 pgs. LINGUISTICS.. 1938. 1917. LITERATURE. Literature. Language. Linguistics.. tattvat'iikaa shataduushhand-ii. shriimadvaradaachaarya. Language. 1944. 0. shriimachchitsuravaachaaryamunivara. tarkasan'graha nyaayabodhinii siitaa padmaabhyaan' san'skrxta hindii vyaakhyaaya. Sanskrit.

moreshwar ramachandra kale tr.. Linguistics. Psychology. 50 pgs. 1941. Language.org/…/SanskritIIIT.2/14/2011 y A list. Sri Bhattoji Dikshita. 466 pgs. Literature..i. Philosophy. Literature. Language. the saundarananda. S.. Literature.. Language.. Sanskrit. Language. 60 pgs.. Iv... 1953 262 pgs sanskritdocuments.. Sanskrit. Language. the students sanskrit-english dictionary. 1937. 0. Philosophy. 1926. Literature.. 1933. 1928. 830 pgs.. sambasiva sastry k. the jnanadipika tika mahabharata tatparya tika. Sanskrit. pg tatvakostubha Part 1. Suryanarayana Sastri. tatvat'iikaa.. Sanskrit.. 212 pgs. Language. Sanskrit. Sanskrit. Language.. Literature. 0. 670 pgs. 298 pgs... 1989. 1917. 1975. 1936. 1925. the essential gaudapada. Language.s. t'i.. Literature. 29 pgs. 0. tatvamuktakalaapa Vol. 1944. 542 pgs. tatvasan'khyaanaraaghaven'dratiirthiiyat'ippand-ii. narayana balakrishna godbole. ramaswami shastri. 306 pgs.... 428 pgs. 670 pgs. 1955. of scanned books at III… g g Sanskrit g . Literature. Linguistics. 254 pgs. Linguistics. Language. Psychology. srisa chandra vasu. Philosophy. Linguistics. tatvamukta kalaapa Vol. Sanskrit. the pratyabhijna hridaya. 1900. Language. vaman shivaram apte. Sanskrit. Language. Sanskrit. kshemaraja. devabodhacarya. Sanskrit. di. the meghaduta. Language. 750 pgs.ii. 1954. 356 pgs. Language. Linguistics. the ranadipika of kumaraganaka. Sanskrit..iii.. tatvamukta kalaapa Vol. Literature. Literature. Linguistics. 362 pgs.. Religion.. the panchatantrika of vishnu raman. Psychology. Literature. 946 pgs.. Dr Suresh Chandra Mishra. Literature. Psychology. Literature. tatvatrayamuu. the anargharaaghava of murari. Language. kasinath pandurang parab. thakavarg Mahanibandh.. 152 pgs. Linguistics. Sanskrit. Linguistics.. shriinivaasagopaalaachaarya. the dasakumaracharita of dandin. 406 pgs... Sanskrit. swami satchidanandendra saraswati. krishhnd-amaachaarya. 746 pgs. Sri Mallikacharya... Psychology. Sanskrit. Psychology. Language. t'i. Linguistics. asvaghosa. 1956. Linguistics. shriinivaasaachaar. Linguistics. Linguistics..suryanarayana Sastri... Literature. Srinivasachar. k. Linguistics. tatvasan'graha. Linguistics. 1997.. Literature.. veidaan'taachaarya. Sanskrit.. tatvashuddhijaanadhanapuujyapaadavirachitaa.. Sanskrit. Literature. not avaliable.s. tatvamuktaakalaapa Vol 1... the supreme epic of devotion. the students guide to sanskrit composition. 106 pgs.s.. 0. Linguistics.. Literature. Unknown. Sanskrit. Theology. pandit durgaprasad. 1945. 1941.. 100 pgs. D. Philosophy. Language. tatvashuddhi. Language.. 0. 448 pgs.. S. Sanskrit.. 1933. Sanskrit. Literature. Sanskrit. Linguistics. Not available. the ashtadhyayi of panini vol . Sanskrit. the raghuvamsa of kalidasa. 1938. Sanskrit. Sri Nigamantha Mahadesikar... Linguistics.. 430 pgs. Psychology.. 330 pgs.… 159/167 . Philosophy. Philosophy... kalidasa. Sanskrit. Sanskrit. Sanskrit. Sanskrit. Philosophy.

Literature. Literature.... Sanskrit. Psychology. Linguistics.. tithisaamaanyanirnd-aya.. 394 pgs. 1937..2/14/2011 1953. 1977. 19 pgs. 0. Language. trin'shachchhulokii. Sanskrit. upaakhyaanamaalaa. Literature. kalidasa. Literature. unmattaraaghavamu.. Philosophy. Sanskrit. Bhrga Samhita. Literature. Language. 63 pgs... 20 pgs. Srimad Bhagawatpadacharya. Language. pand-d'ita shriishashinaatha bhkaa.. 1947..... Linguistics. Not available.. Literature. Not Available. 0.. Language... Sanskrit. Religion.. 1930... 443 pgs. Sri Rama Pisharoti And Subrahmanya Sastri. 380 pgs. Sanskrit.. ung-ad'aamareshvaratantramu. Sanskrit.. the uttararamacharita of bhavabutta. 135 pgs. Literature.. Literature. 0.. 1899. Literature. shriibhaaskara. Language. 1997. Sanskrit. Sanskrit. suranada kunjan pillai. Linguistics. 473 pgs.. Linguistics.. 0.. tritalaavachchhedakataavaada. Sanskrit.. 360 pgs.. Language. 1922.. Linguistics.. tithaivivechanakaand-d'avishhayasuchikaa. 0. Linguistics. Literature. Sanskrit. 1924. 90 pgs. Linguistics. Sanskrit. sanskritdocuments.. Literature.. Sanskrit. 389 pgs. Philosophy. Sanskrit. Rangaswami Aiyangar. 346 pgs. Psychology.v. Sanskrit.. the vikramorvasiy. 1918. tripuradahanamu.. Literature.. Linguistics. trin'shachchhlokii sat'iikaa. the vikramorvasiyam of kalidasa. 0. 112 pgs. Psychology.... 298 pgs. Not available. 1922. 1962. Sanskrit. upakramaparaakrama. Sanskrit. 1914. 1934. 1903. Sanskrit. Literature. I. Language. 1942. 1954.. Srinivasachariar.. Language. 144 pgs. Linguistics.. Sanskrit.. 262 pgs. 160 pgs.. Language. Badi Mudgara Kuthara Kumara Swami. Language. 124 pgs. 178 pgs. LITERATURE.. Not available. 1936. Philosophy. Linguistics. trikaakhaad'amakhad'ana. Language. Sanskrit. 107 pgs.m. 140 pgs.org/…/SanskritIIIT. Language. tisarii kitaaba. Language. kalidasa... kalidasa. Literature. Philosophy. LANGUAGE. Psychology. 446 pgs. Literature. swami satchidanandendra saraswati.. 1915. Sanskrit. LINGUISTICS. Linguistics. Philosophy. trishaati seituhu. upadeshasahasri Part I and Ii (prose and Poetry). 1915. veidaantaachaaryaa. Language. 262 pgs. Literature. Linguistics. Sanskrit.. Sanskrit.. upadeshasahastrii gadyaruupa sat'iikaa. Psychology. Psychology. 1942. Sanskrit. shriiharisin'hajii.… upanishhadaan' samuchchaya hari naaraayand a aapat'e RELIGION THEOLOGY Sanskrit 1895 160/167 . Literature. Narayana Bhatt. 52 pgs. Sanskrit. Sanskrit. Pandit A. A list of scanned Sanskrit books at III… the taittiriya upanishad. Literature. 154 pgs. vinaayaka gand-esha aapat'e. 382 pgs. hari raghunaath. srimad ramatirtha. shriibhagavadramand-amaharshhi.. upanishhad'asa Vol. Linguistics. 1957. Language. naaraayand-abatta. Sanskrit. bhava butta. Linguistics. bhat't'ojidiiqs-ita. Language. Not available.. Not Available. Philosophy. Social Sciences.. the vikramorvasiya of kalidasa. upadeshasaara bhaashhyasahita. 413 pgs. 1949. tristhaliisetu tiirthendushekhara kaashiimoqs-avichaara. Sanskrit. 194 pgs. trim'shaachchhalokii pat't'aabhiraamat'ikaasahitaa. Linguistics. 73 pgs. Linguistics. tristhaliisetu. upadesasahasri. Sanskrit.. Linguistics. K.. Language. tithichintaamand-i. Linguistics. Theology. Language. udhaanapatrikaa.

1912. Literature... bhartrxhari. Linguistics. vaakyapadiiyamuu brahmakaand-d'amuu.. Language. Sanskrit. 1912. Psychology. Linguistics... Literature.. 0. Sanskrit. Language. 62 pgs. Linguistics. uttaragitha.. Language.. ushhaaparind-ayaprabandha.. 467 pgs. 126 pgs. appaya diiqs-itaa. Literature. 384 pgs.. Sanskrit. 1891. 1956.. vaadaavalii. Sanskrit.. uttaragiitaa.2/14/2011 A list of scanned Sanskrit books at III… upanishhadaan samuchchaya. Linguistics. 1103 pgs.. LANGUAGE. bhartrxhari. vaakyaatharatnam.. Literature. shuuranaad'a krxjjanuu pilla. Sanskrit.org/…/SanskritIIIT. Language. 1944.. upanishhadddakya koosha. 475 pgs. 1895. Language. Literature. shriibhavabhuti. vaadanaqs-atramaalaa. 1988. ushhaaparind-ayaprabandha.. Language. Sanskrit. Theology. mahaakavi shrobhavabhuuti.. shriibhaaskararaayonnitasetubandhaara.. suuyranaaraayand-aa. vaakyapadiiyamu dvitiiyobhaaga vaakyakaand-d'amu t'ikayaa ambaakartriivyaakhyayaa. vaadaavalii praaran'bhaha. Linguistics. veimuuriraamagovindashaastrii. Sanskrit..e. 56 pgs. 0... Literature.. 618 pgs. Literature. LITERATURE. Linguistics. Sanskrit. 1934. LINGUISTICS. Sanskrit. Sanskrit. THEOLOGY. 536 pgs. Language. Sanskrit. Literature. Sanskrit.. shriimadvedavyaasa. 1835.. Literature. Literature. Language. Literature. vaajaneyipraatishaakhyan' kaatyaayanaprand-iitan. Literature.. 1966. -. vaakyavrxtti. Linguistics. uttaramiimaan'saa vidaantadarshanamu shaariirakanaamnaabhaashhyan' t'ippand-ii. jagadguru vijendra trtha. 214 pgs. 0. Sanskrit. Sri Madahobala Suri. uttararamacharitam.. mahaakavishriibhavabhuuti. aachaarya karapuut'ugala shrii dharmmashrii. 38 pgs. 392 pgs. 182 pgs. Linguistics.. Literature. vaamadeshvaratantraantargatanityaashhod'ashikaarnd-ava vyaakhyaaya. Literature. Sanskrit. 0. 1823. Language. Literature. 572 pgs.. not availabe. Sanskrit.. 187 pgs. uttararaamacharitamu t'iikayaa sametamu. Religion. uttararaamacharitamu naat'akamu. uttararaamacharitamu. Language. 1908. Language. 1926. utsargapatrtramu. shriimadgod'apaadachaarya. Linguistics. 212 pgs. Language. Sanskrit... Sri Venkatarama Sharma. Linguistics. Linguistics.. Not available. Sanskrit. Appaya Dikshita.. Sanskrit. 82 pgs. sanskritdocuments. Sanskrit. uttararaamacharitamu. Literature. Language.. 1957.. 1903. Language. Linguistics... Philosophy. 1977.. upasamhara vijaya. Language. Literature. Language. Sanskrit. Psychology. Language. 1943. 128 pgs. Sanskrit. 491 pgs. jaakooba. RELIGION. Linguistics. Linguistics.. Literature. mahakavi bhavabhuti. pand-d'ita brahmashang-karamishra. Linguistics. 1937. vaakyapadiiyamu trxtiiyakand-d'amu vrxttisamuddesaatmakamu ambaakartriivyaakhyaaya samalangkrxtamu. 216 pgs.. Sanskrit. shuuranaad'a krxjjanuu pilla. Linguistics. Sanskrit. 164 pgs.. Language. shriimachchhan'karaachaarya. Sanskrit. 1956. Literature.. Linguistics. Linguistics. gi.. Linguistics. Literature. uttarapaqs-aavali. 84 pgs.. hari naaraayand-a aapat e. Language.. 1915.... 374 pgs. 500 pgs.. Philosophy. Linguistics... 154 pgs.. Linguistics. Language. 1980. Literature.… 161/167 . 0. Sanskrit. 366 pgs. Sanskrit. Language. vaadanaakshatramaalaa puurvoottaramiimaamsa.

. 1458 pgs.. vaishhnd-avadharmaratnaakara. 380 pgs. Language.. 198 pgs. T. Linguistics. Linguistics. hamsaraaja. Literature. Religion. 1932. 0. Sanskrit. Sanskrit. Linguistics.. 568 pgs. 166 pgs. P. 270 pgs.. Sanskrit. 1872. Language. P. Language.. 1913. 65 pgs. a mahaadevashaastriind-a.. vikhaanas.. 1952. Theology.. Linguistics.. 1937. Language. vaiyaakarand-asiddhaantakaumuti paand-iniiyavyaakarand-asuutravrxtti. Literature.. Literature. Sanskrit.. Dr. Sanskrit. 1953. Literature. bhat't'ojidiiqs-ita. Sanskrit. Sanskrit. vaiyaakarand-a bhuushhand-asaara.. C. 1927.. 65 pgs.. bhaskararaya makhin. Sanskrit. Linguistics. 55 pgs.. Sanskrit. Language. subramanya shastri p p. 1828. vaatulanatha sutras vritti.… 162/167 . sri t viraraghavacharya. vararainugrxhiteshhu panj-chasuvijayeshhu. 619 pgs. 375 pgs. pi bii annangarachaarya. gan'gaavishhnd-u shriikrxshhnd-adaasane. sanskritdocuments.. 1927. vakrottkijiivitamu khopagn-avrxtti.. Sanskrit. 270 pgs. shriikaund-d'abhat't'a... Sanskrit. vaiyaakarand-asiddhaantakaarikaa vaiyaakarabhuushhand-asaaravyavyaakhyaaya. 240 pgs. shriimatkaund-d'abhat't'a. 134 pgs. Literature. Linguistics.. vaasavadattaa.. vaishhnd-ava upanishhada. 1822. varivasya rahasya. Sanskrit. General. Literature. 374 pgs. 1933. maadhava vaasudeiva. 1901. var^shhakrxdiipaka. Theology.... vararuchaniruktasamuchchaya.. Sanskrit. Linguistics. Theology. mahaakavi subandhu. Sanskrit.. L. Linguistics.. Sanskrit. V. Linguistics... Language. vaidikakoshha prathamo bhaaga.. Linguistics. Literature.org/…/SanskritIIIT. vaiyaakarand-abhuushhand-asaara abhinavasaralaa vyaakhyaaya t'ippand-ayaa samalang-krxtya. Linguistics. Language. vallabhapushht'ipradkaasha chaaroon' bhaaga. 1828. Language. Literature. Theology. Language. 704 pgs. 105 pgs. 0. Linguistics. vaishampaayananitipraashikaa. Language. Not available. Religion. Sastri. Linguistics.. shriimadraajaanakakuntaka.. 122 pgs.. Sastri and K. vaiyaakarand-asiddhaantakaumudii. vaidik sahitya charitram... vaikhaanasadharmaprasna. Linguistics. 1923. Language. Literature. Sanskrit. Kunhan Raja. Religion.. Sanskrit. Theology. 1957.. 1961. Language. Sanskrit. Sanskrit.. Literature. Linguistics.. Sanskrit. vasu charitam. 1965. Sanskrit.. khemaraaja shriikrxshhnd-adaasa. 1926. Linguistics. Sanskrit. Language. bhat't'ojidiiqs-itulu... Language. 1961.. Linguistics. Literature. Chandrasekharan. Language.. Sanskrit. Literature. kalahasti kavi. Religion. Literature. bhat't'ojiidiiqs-ita.... vadavali. Sanskrit. Language. Literature. shriimadvaadhulamahaachaarya. Literature. vallabhapushht'iprakaasha chaaroon' bhaaga. 406 pgs. Literature.. Language. Sanskrit. 1938. Linguistics. Religion.. Mahamahopadhyaya.. 1923. 1892. 804 pgs. anantashaktipada. 68 pgs. taranatha tarkavachaspati. 476 pgs. Linguistics. 1958. 144 pgs. Social Sciences. Literature. Sanskrit.. khemaraaja shriikrxshhnd-adaasa.. vaidikamanoharaa. 1288 pgs.. 1873. 75 pgs. vachaspatya part 1. Language. Language. jayatirtha. 442 pgs. vaiseshika darsana.. vaididasaahityacharitrama'm. Literature. Sanskrit.. Sanskrit.2/14/2011 A list of scanned Sanskrit books at III… vaaraahagrxhyasuutramu. Literature. S. 222 pgs. Religion. 1943. vajjaalaggan. Theology. 407 pgs. 1934. Literature.

vedaantadeepa bhaagha 2. Sanskrit... Language. Language.. vedaanta darshana. Language. 1992. Language. Sanskrit. Literature.. veidaantabaalaboocdhini kramaan'ka 99. veidaantaraqs-aamand-ivimarsha trxtiiyabhaaga. Sri Madhusudan Prabhuji.. 0. 233 pgs. Language. Linguistics. Language.. 620 pgs. Sanskrit.. Literature. 370 pgs. 230 pgs. rayaprolu l somyaji. Swami Govindasingh Sadhu. Literature. Literature. 106 pgs. Linguistics.. Psychology. vedaantaparibhaashhaa. Linguistics. Linguistics. Philosophy.. Language. 1942. 1934. Language. 617 pgs.v.. Language. Philosophy. Sanskrit. veidaantavijayamang-galadiipikaa... 62 pgs. Sanskrit... 314 pgs.. Linguistics. 142 pgs. -.. shriividyarand-aya... vedaantaparibhaashhaa dhameraajaadhvarendrakruti. Psychology.. svaamii vidhyaananda sarasvatii. Sanskrit. Literature. Sri Satyajnananda Tirtha. Sanskrit. 1887. 242 pgs. 1965.. shriimatsvaamidayaanandasarasvatii. Sanskrit. 1928. vedaanta dharshana brahmasuutra sarala hin'dii vyaakhyamu. Linguistics. 1943. Literature.. Sanskrit. 0.. Literature. 0. Literature.. Raja Sri Sri Rama Varma. Linguistics. 0. Sanskrit. Sanskrit. Psychology... 1949.. Language. shriimanmaharshhi vedavyaasa. 1969.. 176 pgs. 190 pgs. Literature. qs-emaraajashriikrxshhnd-adaasa... Psychology.org/…/SanskritIIIT. Linguistics. 524 pgs. vedaantapan'chadashi. Linguistics. Sanskrit. vedadhammevyaakhyaanamn.. vedaantaparibhaashhaa. vedaprakasa. Theology. Literature. Language.... 0. Linguistics. Literature. Philosophy. 463 pgs.. Sanskrit. vedhaantaraqs-aamand-ivimashe. Linguistics. Literature. vedantapanchadashi. 1965.. Sanskrit. vedaantaparibhaashhaasan'graha.. shrii bhagavad raamaanuja. vedaantapan'chadashi.. Dharmaradhwarindra.. pan' bhat't'ashriigauragoopaalashamaa. 1937. Language. Sanskrit. Not Available. shriibhagavatpaadaachaarya. 1959.… 163/167 . 236 pgs. Sanskrit. Not available. Sanskrit. Lingannasomayaji. Sanskrit. 614 pgs. shriimaddharmaraajaadhvariindra. Language. Linguistics.gopalacharya. 1942. Linguistics. Philosophy. Sanskrit... 480 pgs. vedaantavichaaramaalaa. Literature. 51 pgs. 145 pgs. 1833. Linguistics. 300 pgs. vasu charitram. Linguistics. 1985. Literature. Sanskrit. Literature. Language. 166 pgs. Linguistics. 580 pgs.. Philosophy. kalahasti kavi. kalahasti kavi. harikrxshhnd-adaasa goyandakaa. Psychology. Psychology. Literature. Language.. Sanskrit.. Language. Language. Philosophy. shrii baalaghanvi jaggu veng-kagaachaarya.. Sanskrit.. Sanskrit... Not available. sanskritdocuments. 0. vedanta desika. Sanskrit. Religion.2/14/2011 A list of scanned Sanskrit books at III… vasu charitram. 154 pgs. Literature. Language. Literature. vedaang-gaprakaasha navamobhaaga vyaakhyaaya. Literature. 1942. veidaanta darshana brahmasuutra. veimabhuupaalacharitamuu. 1927.. 490 pgs. 219 pgs. vedaantaparibhaashhaa. 0.. 416 pgs.... vedaantaraqs-aamand-ivimarsha chaturthabhaaga. Sanskrit. 1902. Sanskrit. A. vedaartha bhuumikaa. goopaalaachaarya. Linguistics. Linguistics. Language. 0. Linguistics.

208 pgs. Sanskrit. Language. Language. 1070 pgs. 0. 1913.2/14/2011 A list of scanned Sanskrit books at III… vekramorvasiyamu.org/…/SanskritIIIT. kalidasa. vidhyaamaadhava. 1925. Language.. Linguistics.. Sanskrit.. 1916. 50 pgs.. 234 pgs. 1897. viiramitrodaya puujaaprakaasha. vemana padyamulu. 501 pgs..x. Mahamahopadhyaya Pandita Mitra Misra. vishhnd-usharmaa. Religion. 614 pgs.. Language.. Religion.. 147 pgs. Linguistics. 577 pgs. Linguistics. shrii veera raja charan gupta. mitra mishra. viiramitroodaya Vol. 1939. jagadgurukrutayaa t'ippapyaa. Linguistics. vishatantram. Sanskrit.… vishhnd ubhaktikalpalataa mahidharakrutayaa t'ikayaa Language Linguistics Literature Sanskrit 164/167 . 1935.. 292 pgs. viind-aalaqs-and-amuu.. viduraniiti. Language. Sanskrit. Literature.. Sanskrit. Language. Linguistics. raamajii upaadhyaaya. Linguistics. 1991.. viiramitrodaya shraaddhaprakaasha.. Sanskrit. viiramitrodaya raajaniitiprakaasha bhaaga 6. Theology. 85 pgs. 1936. 382 pgs. Linguistics. Theology. Sanskrit. Sanskrit.k. Linguistics. Sanskrit. Social Sciences.. Literature.. Literature. sanskritdocuments. Literature. Language. Language.... 1917. Religion. 1955. 1962. 494 pgs. nyaayaacharya.. viiramitrotayasya shraaddhaprakaasha. 158 pgs..ii. 1925. mitra mishra. parameishvara. Sanskrit. vikramorvasiya.. 381 pgs. 1914. Mahamahopadhyaya Pandita Mitra Misra. viiramitroodayei bhakti prakaasha Vol. Linguistics. Sanskrit. viiramitrodaya paribhaashhaaprakaasha. Linguistics. 228 pgs. Literature. Language. vikramorvasiyam. Literature. 383 pgs. Social Sciences. Language. Language. kalidasa. 1916. Linguistics. viiramitroodaya Vol. Sanskrit.. 1906. Linguistics.. 394 pgs. Literature.. Mahamahopadhaya Pandita Mitra Misra. 1959. 1913. Sanskrit. Language.. vin'shashataabdikan' san'skrxta naat'akamu.. Sanskrit. Linguistics. Vishva Bandhu. Literature... Literature.. Literature. Literature. Linguistics. Mahamahopadhaya Pandita Mitra Misra. Sanskrit. Social Sciences. Sanskrit. srirama desikan siromani. Linguistics.... Sanskrit. mahaamahopaadhyaayashriimitramishra.. 0.. Social Sciences. 161 pgs. Sanskrit. Literature. 225 pgs.. Sanskrit. 266 pgs. kaalidaasa... viiramitrodaya Part Vii. dr sir c p raamaswamy aiyar... 1917. Sanskrit. Sanskrit. vidhyaamaadhaviiyamu prathamasan'put'amu 1 5 adhyaaya. Literature. viiramitrodaya tiir^thaprakaasha. 578 pgs. 166 pgs.. vish vekharaanandasan'sthaaniiya hastalekhasan'grahaparitaalikaa saacha khand-d'advayavatiisati..s. 1903.. Literature. Literature. shriikaalidaasa. Xxi. Theology. 0. Literature. Language. 610 pgs. Literature. Sanskrit.. vijaya vikrama vyayoga. mahaamahopaadhyaayashriimitramishra. Literature.. Sanskrit. vidyamaacdhaviiyamuu. 256 pgs. Social Sciences. Literature. Language.. 1932. Sanskrit... mahaamahopaadhyaayashriimitramishra.. bhatta narayana.. Language. 1923. Linguistics.. 158 pgs. Linguistics. 1913. Linguistics. Language. viiramitrodaya Part Ii. Language.. ramamurti.. Sanskrit. Sanskrit. Sanskrit. vikramoovrashiiyamuu. shriimahaamahopaadhyaayashriimitramishra. viiramitrodaya laqs-and-aprakaasha. vend-iisan'haaramu.. 194 pgs. 1959. Mahamahopadhaya Pandita Mitra Misra. 1972. 674 pgs.. Language. venisamhara.

. Literature. Sanskrit. 1942. 186 pgs. 146 pgs. Language. 1972. 1925. vrxddhasuuryaaruund-akarmavipaaka. Linguistics. Literature.. 1956. mahidharakrutayaa t ikayaa.. Literature. 286 pgs. Philosophy.. Language. Religion. 413 pgs. 1965. Kuberanath Shukla. Linguistics.. viveikachuud'aamand-i. Ganapathi Sastri. 1895. shriishn'karabhagavatpaada. Swetharnia Narayana. 244 pgs. 407 pgs. -. 376 pgs. Sanskrit. vushhabhaanujaa. K. vivarand-apajnikaa trutiyo bhaagan. Linguistics. Linguistics. Literature. Sanskrit. Psychology.. 1964.... Religion. Sanskrit. Literature. Linguistics.. paramaanandachakravarti. shriimadappayadiiqs-ita... 1957. Theology. Literature. Linguistics.. 516 pgs.. Language... Language. 0. 0. 327 pgs. Sanskrit.… 165/167 . visvasanskrit shatabdi granth yojnaaya. 237 pgs. 268 pgs.. 1909.. 1931. 264 pgs.. Sanskrit.. M. vivarand-aprameyasan'graha vidhaarand-ayamuniprand-ita Vol 5 Sanskrit Text. 1963. vyaakarand-a granthaa. vuttamautkika. Language. vrxttamuktaavalii...v.. Sanskrit.. Sanskrit. vivaakachuud'aamand-i kramaan'ka 93. Sanskrit. Theology. vrxttaalang-kaararatnaadlii.. Language. Linguistics. Sanskrit.. 676 pgs. 1965. Linguistics. Language... 0. 62 pgs. Sanskrit. vishhnd-udharmottaramahaapuuraand-a. shriikrxshhnd-aabhat't'a. b j sandesara. Linguistics. Language.. 440 pgs. 147 pgs.. Rangaswamy Aiyangar.. 354 pgs. vivarand-apajnikaa dashamo bhaagan. 1958. viveika chuud'aamand-i.. Sanskrit. vivarand-aprameyasan'graha. 1814. Sanskrit. Linguistics. vrxttaratnaakara.. Religion.. Bhrga Samhita. Sanskrit. M Rangacharya. vrajavilaasa. Language. Literature. Sanskrit. 382 pgs.. Religion. Sanskrit. Religion. Sanskrit. Language... 1982. vishhnd-usan'hitaa. Rangacharya. 725 pgs. 1964. Not available. M. Philosophy. Linguistics... 518 pgs. Sanskrit. 1893. bhaaratiitiirtha. vivarand-apajnikaa dvitiyo khand-d'an. Linguistics. Literature. not available.. vrxttivaartikamu. Language... Sanskrit.. Sri Kedara Bhatta. 1892. Linguistics.. vivarand-apajnikaa saptamo bhaagan. Not available. vishhnd-udharmoottara puraand-e trxtiiya khand-d'a. T. 1972. sanskritdocuments. Religion. Ramasastri Tailanga. Literature. Literature. M.. Theology. Sanskrit. nijagund-ashiva yoogi.. Religion.. 120 pgs. Literature. Literature. Language. vivarand-apajnikaa ekaadasho bhaagan. Linguistics. 0. 1879. Rangacharya. Linguistics... Theology. Sanskrit. 1962. Language. Language.. 118 pgs. Literature.. Religion... 1953. Sanskrit..2/14/2011 A list of scanned Sanskrit books at III… vishhnd-ubhaktikalpalataa. Literature.. Sanskrit. 440 pgs. gan'gaavishhnd-u shriikrxshhnd-adaasa. Literature. Language. Sanskrit. Language.. Linguistics. shriisachchidaanan'dein'drasarasvati. 2001. 298 pgs. vistaarikaavyaakhyaaya san'valita kaavyaprakaasha dvitiiyobhaaga. Sanskrit. 272 pgs. Psychology.. T P Upadhyaya. Sanskrit. 1926. Sanskrit. Language. viveikachin'taamand-i paart' I. M. 44 pgs. Sanskrit. 1940. Rangacharya. Not available. 988 pgs. vivarand-apajnikaa ashht'amo bhaagan. 1961. Religion. 511 pgs. Religion.. vishhvaksenasan'hitaa. Literature. Linguistics. shriimaduraadaasa. lakqs-mii narasin'ha bhat't'aa.org/…/SanskritIIIT.. Not available. vratakaand'amu chado bhaagan. 169 pgs. Sanskrit. Sanskrit. vivarand-apajnikaa dvadasho bhaagan. Literature. Rangacharya. 482 pgs..

Sanskrit.. Linguistics. Language. somaakarasudhaakara. vyaasasiddaantamaartaand-d'a. 430 pgs. shriimadagadaadharabhaat't'aachaarya.. 1908. shriiraajaanakamahimabhat't'a. Language. Sanskrit.. Linguistics. Language. Pandit Durgaprasad. vyaktiviveka of rajanaka sri mahimabhatta. Language. LANGUAGE. Literature. vyutpattivaada. Sanskrit.. vidvadbhi ke vi subrahmand-yashaastrii. 1942.. vyutpattivaada guud'haarthatattvaalokena samudbhaasita. LANGUAGE. 1977. Language. Language.2/14/2011 A list of scanned Sanskrit books at III… vyaakarand-a puurvapashnaavalii.. 1986. 0. hari naaraayand-a aapat'e.. Psychology.. Linguistics. shriivedaantachaarya. Language. Sanskrit. Theology. Language.. 0. Linguistics. sircar mk. Sanskrit. Literature. vyaasataatpayenind-eya. yaajnd-aavaalkyasmrithi. Literature.. yaajushha jyautishhan' bhaashhya aarcha jyautishhan. 1929. Literature.. rewaprasada dwivedi. 76 pgs. Linguistics. Linguistics. Sanskrit.. Language.. Literature. shriimitramishra. bapu shastri moghe. Sanskrit. 1929. LINGUISTICS. Linguistics. Sanskrit. 98 pgs. vyakaran pradip. Language. Sanskrit. Language.. yaagn-avalkyasmrxti trxtiiyaavrxtti. 1993. Linguistics.. shriimadagadaadharabhat't'aachaarya. 1892. Theology. 886 pgs. Literature. Sanskrit. 0. 306 pgs. yaadavaabhyudaya. Language. LINGUISTICS. 0. vyadhikarand-aprakarand-amuu.. Literature. Religion..... Not available. 0. Linguistics. 1931. 680 pgs. Linguistics.. 0. vyaakarand-abaalabodha prathamobhaaga. vyaatpipanj-chakarahasyamu sin'havyaadhralaqs-and-arahasyan. 166 pgs. 0. Literature. yogiishvarend-a maharshhind-aa yaagn-avalkyena. vyaasasan'grahamu nov 1933.. 484 pgs. Language. 1950. LITERATURE. -. vyaasashiddhaantamaataand-d'a.. vyutpattivaada guud'haarthatattvaaloka.. Literature. Literature. 1964. Psychology.. 90 pgs.. 310 pgs. 1927. Sanskrit..… 166/167 . 492 pgs. Language. Philosophy.. shriiniilakand-t'habhat't'a. Literature. 124 pgs.. Sanskrit. Sanskrit. Language. Religion. 1933... Social Sciences.. Language.. vyaasashiqs-aa. Balasubramanyam. Linguistics. Sri Maha Mahopadya Kapisthalamdesikacharya. Sanskrit.. vyavahaaranir^nd-aya.. Not available. 630 pgs. Literature. gopaalashaastrind-aa. 1230 pgs.. Linguistics. Sanskrit. 1892. Linguistics... yaagn-avalkyasmrxti viiramitrodaya mitaaqs-araa t'iikayaa. Linguistics. 190 pgs. sanskritdocuments. Not available. Language.. vyavahaaramayuukha miimaan'sa.. Literature. 122 pgs. Literature. Sanskrit. 270 pgs. Sanskrit.. Literature. vyakaran siddanta kaumadi. Linguistics. Sanskrit. 568 pgs.. vyaasaadhikaarand-amaalaa. Sanskrit.. 114 pgs. 283 pgs. mahaamahopaadyaya kapistalama desikaachaariyara. vyaaktiviveka vyaakhyaaya madhusuudaniivivrxtyaa... Linguistics. Literature.org/…/SanskritIIIT.. Literature. yajnj-avalkyasmuti Vol I.. Sanskrit. pand-d'ita veing-kat'araamashammrond-aa.k. vyaaptipanj-chakamu. 0. Language. Language... Sanskrit. Linguistics. shriimathuraanaathatarkavaagiisha. vedavidhaalaya. Sanskrit. Linguistics. Literature. Sanskrit. 556 pgs. 1942. Sri Varadaraja. 1937.. Sanskrit. 0.. Sanskrit.. 722 pgs. 116 pgs. 480 pgs. LITERATURE. Literature. Linguistics. J. 1150 pgs. Philosophy.

yoogasandhyaa.. Sanskrit. Sanskrit. 322 pgs. khemaraaja shriikrxshhnd-adaasane. ghatikasatam vatsya varadacharya. Sanskrit. yashasitalakamu. 1884. 802 pgs. yojavaar^tikama~.. khemaraaja shriikrxshhnd-adaasane. Literature. 0. Psychology. 1983. Language. Sanskrit. mahaakavi shriivaasudeva.. Linguistics. 1849. navare ityupaabhidhakrxshhnd-asharmand-a... Sanskrit. 202 pgs.. Sanskrit. Linguistics. 212 pgs. Sanskrit. yuktimallikaa.. Literature. Linguistics. Language.. Sri Vijnana Bhikshu. 1903. 1857. Language. Literature. Linguistics. yuktimallikaayaan'gund-asaurabhan. yajurveda san'hitaa. yathiraja vijaya natakam. Not available. Language. Linguistics. 616 pgs. 126 pgs. 1946. Sanskrit. Sanskrit. Literature.. Linguistics. 1897. Not available.. shriivaasudeva. Linguistics. Literature. Linguistics. Language. Sanskrit.. yatiindramata diipika... Sanskrit. Literature. Sanskrit. Religion. 597 pgs. Theology.. Language.. Language.org/…/SanskritIIIT. 1919.. 252 pgs... Language. 246 pgs. Linguistics. Literature. yogavaasishht'a bhaashhaa bhaaga 2 6 t'haa nirvaand-aprakarand-a puurvaarddhottaraarddha. yudhishht'hiravijayamu vyaakhyaaya. 484 pgs.. Sanskrit.. 1834.. 1949. Language. 1 0-9 A-D E-H I-L M-P Q-T U-Z sanskritdocuments. Language. Philosophy. 0. yoogavaasishht'he. Search matched 4853 books with 1743368 pgs. Theology. Not available. shriishrutasaagarasurikutayaa.. 218 pgs. vaajasaneyi madhyaandina shukla. Literature. yogaratnaakara vaidyakagran'tha dvitiiyaasrxti. 1903. Religion..2/14/2011 A list of scanned Sanskrit books at III… Sanskrit.. Linguistics.. 1909. Literature. Literature. 969 pgs. Literature. 0. hari naaraayand-a. Linguistics. 802 pgs. 226 pgs. 493 pgs. Sanskrit. yogaratnasamuchchaya dvitiyo bhaaga.… 167/167 ... Language. yudhishthiravijayamu. Not available..

Sign up to vote on this title
UsefulNot useful