Anda di halaman 1dari 62

LAPORAN PERTANGGUNG JAWABAN

STUDY EXCURSION 2011

STUDYEXCURSION2011 25AGUSTUS5JULI2011 BATURAJATANJUNGENIMPALEMBANG CILEGONBANDUNG

JURUSANTEKNIKKIMIA FAKULTASTEKNOLOGIINDUSTRI INSTITUTTEKNOLOGISEPULUHNOPEMBER 2011

LaporanStudyExcursion2011

BABI URAIANSINGKATPT.SEMENBATURAJA(Persero)
I.1. ProfilPerusahaan PTSemenBaturaja(Persero)adalahBadanUsahaMilikNegara(BUMN)yang bergerak pada bidang industri semen portland di wilayah Sumatera Selatan, tepatnya Tanjung Enim. PT Semen Baturaja (Persero) didirikan pada 14 November 1974 dengan saham gabungan dari PT. Semen Gresik sebesar 45 % dan PT. Semen Padang sebesar 55 %. Pemilihan letak pusat produksi di daerah Tanjung Enim ini dilakukan dengan pertimbangan jumlah ketersediaan bahan baku dan lokasi yang tepatuntukdijadikanlokasipertambangan. Padatanggal9November1979,statusperusahaanberubahdariPenanaman Modal Dalam Negeri (PMDN) menjadi Persero dengan komposisi saham milik PemerintahanRepublikIndonesia88%,PT.SemenPadang7%,PT.SemenGresik5 %.Kemudianpadatahun1991,PT.SemenBaturajadiambilalihsecarakeseluruhan olehPemerintahRepublikIndonesia. PT. Semen Baturaja memiliki tiga lokasi utama, dengan pembagian sebagai berikut: Lokasi Palembang Kantorpusat Pengilingandanpengepakan Baturaja Penambangan Pusatproduksidanpengepakan Panjang Seiring dengan meningkatnya pertumbuhan masyarakat, pembangunan Penggilingandanpengepakan

infrastruktur baru pun semakin ditingkatkan sehingga kebutuhan semen juga ikut meningkat.Olehkarenaitu,PT.SemenBaturajasebagaiprodusentunggalsemendi Sumatera Selatan mulai mengadakan beberapa tahapan optimasi untuk meningkatkankapasitasproduksinya. ProyekOptimasiI(OPTI)dimulaipadatahun1992danselesaipada1994, dengan pemasangan unit cooler ( grate cooler ), sehingga kapasitas produksi meningkat menjadi 550.000 ton semen per tahun. Kapasitas ini terus ditingkatkan

LaporanStudyExcursion2011
sehingga pada tahun 1996, kapasitas produksi PT. Semen Baturaja mencapai 593.664ton. ProyekOptimasiII,sebagaitindaklanjutdariOPTI,dilakukanpada1996dan selesai pada 2001. Optimasi inin dilakukan untuk meningkatkan kapasitas produksi hingga dua kali lipat, yaitu sebesar 1.250.000 ton semen per tahun. Kapasitas produksi masih terus ditingkatkan, sehingga saat ini kapasitas produksi sekitar 1,2 jutatonpertahunnya. Kapasitas terpasang produksi Perseroan sebesar 1.250.000 ton semen per tahun, masingmasing Pabrik Baturaja 550.000 ton, Pabrik Palembang 350.000 ton danPanjang350.000tonatausebesar2,6%dibandingkapasitasterpasangnasional. Dalam tahun 2009 realisasi produksi terak telah mencapai 1.039.427 ton atau meningkat 1% diatas produksi tahun 2008, sedangkan produksi semen secara keseluruhansebesar1.047.300tonatau98%dibandingtahun2008. Untuk menjamin kualitas produk, pemantauan kualitas dilakukan di setiap tahapan proses produksi secaraterusmenerusuntuktetapmemenuhipersyaratan StandardNasionalIndonesia(SNI1520492004).Untukmenjagakonsistensidalam memenuhi Standard Nasional Indonesia dan operasional Perseroan secara periodik diaudit oleh Badan Sertifikasi Independen. Disamping itu perseroan telah menerapkan Sistem Manajemen ISO 9001 : 2000, Sistem Manajemen Lingkungan danSistemManajemenKeselamatandanKesehatanKerja(K3). Semen Portland type I diproduksi menurut Standard Nasional SNI No 15 2049 1994. Agar mutu semen selalu memenuhi standar hasilnya, maka secara berkesinambungansemenditelitidandimonitorsecarakonsistendilaboratoriumPT Semen Baturaja (Persero) dengan menggunakan X Ray Analyzer dan komputer (QCX System) juga di laboratorium Balai Besar Penelitian dan Pengembangan IndustriBarangTeknikBandung. Dalam menyalurkan produknya Semen Baturaja menggunakan distributor denganjaringanyangtersebardiseluruhwilayahSumateraSelatan,Lampung,Jambi, Bengkulu, Bangka Belitung, Riau, Banten, dan sekitarnya. Hal ini memberikan peluang bagi Semen Baturaja untuk meningkatkan penjualan dan mencapai kapasitas terpasang karena Sumatera Selatan dan Lampung merupakan wilayah di Indonesiayangmenikmatipertumbuhanekonomiyangcukupbaikdanstabil.

LaporanStudyExcursion2011

BABII PROSESPRODUKSI
II.1. PengenalanSingkatProduk Semen merupakan hasil pencampuran clinker dan gypsum, terkadang ditambahjugabahanlainsepertitrass,abuvulkanis,kapur,atauflyash.Berdasarkan komposisi dan bahan tambahan tersebut, semen dibagi menjadi 3 macam, antara lainadalah: Portland:PortlandIV Blended:PPC,PCC,danslug Special:colourdanoilwell Clinker,biasanya sekitar 9497% dari komposisi semen, tersusun dari CS3 ( alite ), CS2 ( belite ), C3A ( celite ), dan C4A ( ferite). Untuk PT. Semen Baturaja, komposisinyaadalah: Alite 5070%

Belite 1550% Celite 510% Felite 515%

dengankomposisiclinkersekitar8096%darisemen. Sampai saat ini, Baturaja hanya mempunyai 1 clinker. Hal ini dikarenakan sistem pembersihan dan perawatan clinker menggunakan sistem operasi gas, sehinggakurangekonomisjikajumlahclinkeryangdigunakanterlalubanyak. II.2. ProsesProduksi II.2.1.ProsesPenambangan BahanbakulimestonedanclayuntukpembuatansemenBaturajadiperoleh dari penambangan terbuka. Tambang seluas 600 ha tersebut baru dipergunakan sekitar20hasajadandiperkirakanbaruakanhabis30tahunmendatang. Tahapanprosespenambangansecaragarisbesaradalah: Cutting/Pemotongan Drilling atau Blasting Digging Hauling Crushing ReklamasiEksplorasiulang Blastingatauprosespeledakandijadwalkansetiapjam12.00waktusetempat


II.2.2.BahanBakuProduksi

LaporanStudyExcursion2011

Semenmemilikiduajenisbahanbaku,yaitu: Contoh:limestone,chalk,marble,danshelldeposit

Calcareous,yangmemilikikandunganCaCO3lebihbesardari75% Argillaceous,bahanyangmemilikikandunganSiO2,Al2O3,Fe2O3 Contoh:clay,marl Dalam bahan baku tersebut, terkandung beberapa oksida utama yang diperlukan dalam proses produksi, yaitu CaO dari limestone dan SiO2, Al2O3, Fe2O3 dariclayatauglass. Selain bahan baku, diperlukan juga bahan koreksi, untuk memperbaiki karateristikprodukyangdihasilkan.Dalamhalini,digunakanpasirbesidansilika. Bahanbaku Kapur Clay Rawmix Pasirbesi Pasirsilika Batubara Gypsum Sumber Tambang Tambang Pantai Cilacap, Lampung, tambangrakyat Tambangrakyat PT. Bukit Asam, tambang rakyat Thailand Komposisi(%) 7590 720 13 16 180200kg/tonsemen 36

Clinker

Semen

pembuatan clinker , yaitu wet process dan dry process. Namun, saat ini hanya digunakan dry process yang lebih efisien dengan burner FLS Swirlfax berkapasitas 4300ton/hari. Wetprocess Kapasitaspanasyangdiperlukan1200kcal/kg Kapasitasproduksikecilkarenaterlalubanyakair Memerlukanruangbakaryangpanjang Homogenisasitinggi

Burner

Ada 2 macam proses yang pernah digunakan oleh Baturaja dalam proses


Dryprocess

LaporanStudyExcursion2011

Kapasitaspanasyangdiperlukan900kcal/kg Homogenisasirendah,sehinggagrindinglebihsusah Konsumsipanasrendah Kapasitasproduksitinggi Secara garis besar, proses pembuatan semen dimulai dari penambangan bahan mentah yang menjadi bahan baku pembuat semen, yaitu batu kapur dan tanah liat di Baturaja. Setelah itu, dilakukan proses pemecahan dan penghancuran (crusher).Bahanbakuyangtelahhalusdiangkutketempatpenyimpanan(limestone storagedanclaystorage)dandicampurkandenganpasirsilikadanpasirbesiuntuk dijadikan raw meal. Raw meal ini yang akan di giling di dalam raw mill setelah mengalami proses pengeringan dan hasilnya disimpan ke dalam raw material storagesilo. Proses berikutnya adalah proses pembakaran, dimana sebelumnya sudah dilakukanpemanasanawaldipreheater,yangbertujuanmenghilangkanCO2dengan proses kalsinasi. Proses ini dilanjutkan dengan pembakaran di kiln dengan menggunakanbahanbakarbatubarauntukmendapatkanclinker.Clinkerkemudian didinginkan dengan mechanical fan dan ditransfer ke storage dengan bantuan elektrostatis. Udara panas yang berasal dari clinker akan dipergunakan untuk pemanasan raw mill dan calciner. Clinker hasil produksi Pabrik Baturaja sebagian digilingdiPabrikBaturajadansebagianlagidibawakePabrikPalembangdanPabrik Panjanguntukdiproseslebihlanjutdikeduapabriktersebut. Prosesselanjutnyaadalahpenggilinganclinker.Penambahanbahanbahan baku penolong seperti gypsum dilakukan sebelum memasukkan clinker ke cement mill.Hasildaripenggilinganclinkerdengangypsuminilahyangdisebutsemenjenis PortlandTypeIyangkemudiandilakukanpengantongandansiapdijualdipasar. Produk Semen Baturaja dipasarkan dalam beberapa macam kemasan yaitu curah,sakdengankapasitas50kg,danbeddalamsatuanton. Beberapareaksiyangterjadidalamprosespembuatansemeniniadalah: Mineraldecomposition Calcination :Al2SiO3+2H2OAl2O3+2SiO2+2H2O :CaCO3CaO+CO2 :sinteringdanpembentukanCaS2

Solidphasereaction

LaporanStudyExcursion2011
Untuk menjaga kualitas produk yang dihasilkan, maka dilakukan beberapa hal,antaralainkontrolvariabel,installperalatan,menjagaketersediaansuplaipanas dan energi ( sekitar 112 kWh/ kg hasil ), dan menjaga jumlah dan kualitas bahan baku.

II.2.3.SistemFiring PT. Semen Baturaja menggunakan sistem direct firing dan indirect firing. Untuksistemdirectfiringsendiriataupembakaranlangsungdipergunakanfinecoal padaAtoxmill,berkapasitas30ton/hari.Abuhasilpembakaranataucoalashakan digunakan sebagai bahan pembuatan clinker. Komposisi coal ash yang dihasilkan akanmempengaruhikomposisirawmixyangdipergunakandalamprosesproduksi.

LaporanStudyExcursion2011

BABI URAIANSINGKATPT.BUKITASAMPERSEROTbk.
II.1. ProfilPerusahaan Sejarah pertambangan batubara di

TanjungEnimdimulaisejakzamankolonial Belanda tahun 1919 dengan menggunakan metode penambangan terbuka (open pit mining)diwilayahoperasipertama,yaitudi Tambang Air Laya. Selanjutnya mulai 1923 beroperasi dengan metode penambangan bawah tanah (underground mining) hingga 1940, sedangkan untuk produksi komersial dimulaipada1938. Seiring dengan berakhirnya kekuasaan kolonial Belanda di tanah air, para karyawan Indonesia kemudian berjuang menuntut perubahan status tambang menjadipertambangannasional.Pada1950,PemerintahRIkemudianmengesahkan pembentukanPerusahaanNegaraTambangArangBukitAsam(PNTABA). Pada1981,PNTABAkemudianberubahstatusmenjadiPerseroanTerbatas

dengan nama PT Tambang Batubara Bukit Asam (Persero) Tbk, yang selanjutnya disebutPerseroan.Dalamrangkameningkatkanpengembanganindustribatubaradi Indonesia, pada 1990 Pemerintah menetapkan penggabungan Perum Tambang BatubaradenganPerseroan. Sesuai dengan program pengembangan ketahanan energi nasional, pada 1993 PemerintahmenugaskanPerseroanuntukmengembangkanusahabriketbatubara. Pada 23 Desember 2002, Perseroan mencatatkan diri sebagai perusahaan

publikdiBursaEfekIndonesiadengankodePTBA. PT. Bukit Asam sendiri memiliki pertambangan dan demarga di berbagai

wilayahdiIndonesia.Untuklebihjelasnya,dapatdilihatpadagambardibawahini:

LaporanStudyExcursion2011

10

II.2. ProsesProduksi II.2.1.BahanBakuProduksi Batubara merupakan senyawa hidrokarbon padat yang terdapat di alam dengan komposisi yang cukup kompleks. Bahan organik utamanya yaitu tumbuhan yang dapat ditengarai berupa jejak kulit pohon, daun, akar, struktur kayu, spora, pollen, damar, dan lainlain. Selanjutnya bahan organik tersebut mengalami berbagai tingkat pembusukan (dekomposisi) sehingga menyebabkan perubahan sifatsifatfisikmaupunkimiabaiksebelumataupunsesudahtertutupolehendapan lainnya. Proses perubahan sisasisa tanaman menjadi gambut hingga batu bara

disebut dengan istilah pembatu baraan (coalification). Secara ringkas ada 2 tahap prosesyangterjadi,yakni:

Tahap Diagenetik atau Biokimia, dimulai pada saat material tanaman terdeposisi hingga lignit terbentuk. Agen utama yang berperan dalam proses perubahan ini adalah kadar air, tingkat oksidasi dan gangguan biologis yang dapat menyebabkan prosespembusukan(dekomposisi)dankompaksimaterialorganiksertamembentuk gambut.

LaporanStudyExcursion2011
Tahap Malihan atau Geokimia, meliputi proses perubahan dari lignit menjadi bituminusdanakhirnyaantrasit. Mutu endapan batubara juga ditentukan oleh suhu, tekanan serta lama waktu pembentukan, yang disebut sebagai 'maturitas organik. Pembentukan batubaradimulaisejakperiodepembentukanKarbon(CarboniferousPeriod)dikenal sebagaizamanbatubarapertamayangberlangsungantara360jutasampai290juta tahunyanglalu.Berikutiniditunjukkantahapanpembatubaraan.

11

Proses awalnya, endapan tumbuhan berubah menjadi gambut/peat (C60H6O34)yangselanjutnyaberubahmenjadibatubaramuda(lignite)ataudisebut pula batubara coklat (brown coal). Batubara muda adalah batubara dengan jenis maturitasorganikrendah. Setelahmendapatpengaruhsuhudantekananyangterusmenerusselama jutaan tahun, maka batubara muda akan mengalami perubahan yang secara bertahap menambah maturitas organiknya dan mengubah batubara muda menjadi batubara subbituminus (subbituminous). Perubahan kimiawi dan fisika terus berlangsung hingga batubara menjadi lebih keras dan warnanya lebih hitam sehingga membentuk bituminus (bituminous) atau antrasit (anthracite). Dalam kondisi yang tepat, peningkatan maturitas organik yang semakin tinggi terus berlangsung hingga membentuk antrasit. Dalam proses pembatubaraan, maturitas

LaporanStudyExcursion2011
organiksebenarnyamenggambarkanperubahankonsentrasidarisetiapunsurutama pembentukbatubara. Semakin tinggi peringkat batubara, maka kadar karbon akan meningkat, sedangkan hidrogen dan oksigen akan berkurang. Karena tingkat pembatubaraan secaraumumdapatdiasosiasikandenganmutuataumutubatubara,makabatubara dengan tingkat pembatubaraan rendah disebut pula batubara bermutu rendah seperti lignite dan subbituminus biasanya lebih lembut dengan materi yang rapuh dan berwarna suram seperti tanah, memiliki tingkat kelembaban (moisture) yang tinggi dan kadar karbon yang rendah, sehingga kandungan energinya juga rendah. Semakin tinggi mutu batubara, umumnya akan semakin keras dan kompak, serta warnanya akan semakin hitam mengkilat. Selain itu, kelembabannya pun akan berkurang sedangkan kadar karbonnya akan meningkat, sehingga kandungan energinyajugasemakinbesar Berdasarkan tinjauan beberapa senyawa dan unsur yang terbentuk pada saat proses coalification, maka secara umum dikenal beberapa tingkatan batubara yaitu:

12

1.Peat/gambut,(C60H6O34)dengansifat:

Warnacoklat Materialbelumterkompaksi Mernpunyaikandunganairyangsangattinggi Mempunvaikandungankarbonpadatsangatrendah Mempunyalkandungankarbonterbangsangattinggi Sangatmudahteroksidasi Nilaipanasyangdihasilkanamatrendah.

2.Lignit/browncoal,(C70OH5O25)denganciri:

Warnakecoklatan Materialterkompaksinamunsangatrapuh Mempunyaikandunganairyangtinggi Mempunyaikandungankarbonpadatrendah Mempunyaikandungankarbonterbangtinggi Mudahteroksidasi Nilaipanasyangdihasilkanrendah.

LaporanStudyExcursion2011

13

3.Subbituminous(C75OH5O20)Bituminous(C80OH5O15)denganciri:

Warnahitam Materialsudahterkompaksi Mempunyaikandunganairsedang Mempunyaikandungankarbonpadatsedang Mempunyaikandungankarbonterbangsedang Sifatoksidasirnenengah Nilaipanasyangdihasilkansedang.

4.Antrasit(C94OH3O3)denganciri:

Warnahitammengkilat Materialterkompaksidengankuat Mempunyaikandunganairrendah Mempunyaikandungankarbonpadattinggi Mempunyaikandungankarbonterbangrendah Relatifsulitteroksidasi Nilaipanasyangdihasilkantinggi. Untukmenjagakualitasbatubarayangdihasilkan,lapisanpenutupbatubara dibuangsetebal510cm.Inilahyangdisebutbatubarabersih

II.2.2.PengenalanProduk

PT Bukit Asam (Persero) Tbk. (PTBA) memasarkan 6 (enam) jenis batubara yangberbedaIPC53,BA55,BA59,BA63,BA67,BA70denganspesifikasisebagai berikut:

DenganrataratapermintaanyangcukuptinggiuntukBA67


II.2.3.AnalisaProduk

LaporanStudyExcursion2011

14

Padadasarnyaterdapatduajenismaterialyangmembentukbatubara,yaitu:

CombustibleMaterial,yaitubahanataumaterialyangdapatdibakar/dioksidasioleh oksigen. Material tersebut umumnya terdiri dari karbon padat (Fixed Carbon), senyawa hidrokarbon, total Sulfur, senyawa Hidrogen, dan beberapa senyawa lainnyadalamjumlahkecil.

Non Combustible Material, yaitu hahan atau material yang tidak dapat dibakar/dioksidasi oleh oksigen. Material tersebut umurnnya terdiri dan senyawa anorganik (Si02, A1203, Fe203, Ti02, Mn304, CaO, MgO, Na20, K20 dan senyawa logam lainnya dalam jumlah kecil) yang akan membentuk abu dalam batubara. Kandungan non combustible material ini umumnya tidak diingini karena akan menguranginilaibakarnya. Komposisi material dalam batubara inilah yang nantinya akan dijadikan parameterkualitasbatubarayangseringdigunakanantaralainadalahkalori,kadar kelembaban (Kandungan Air), kandungan zat terbang, kadar abu, kadar karbon, kadar sulfur, ukuran, dan tingkat ketergerusan (HGI), di samping parameter lain sepertianalisisunsuryangterdapatdalamabu(SiO2,Al2O3,P2O5,Fe2O3,dll),analisis komposisisulfur(pyriticsulfur,sulfatesulfur,organicsulfur),dantitiklelehabu(ash fusion temperature) serta analisa analisa unsur terkecil (trace element) seperti Hg,As,Se,B,dll. Pengaruh parameter di atas terhadap peralatan pembangkitan listrik adalah: 1.Kalori(CalorificValueatauCV,satuancal/grataukcal/kg) CV sangat berpengaruh terhadap pengoperasian pulveriser/mill, pipa batubara,danwindbox,sertaburner.SemakintinggiCVmakaaliranbatubarasetiap jamnyasemakinrendahsehinggakecepatancoalfeederharusdisesuaikan. Untuk batubara dengan kadar kelembaban dan tingkat ketergerusan yang sama, maka dengan CV yang tinggi menyebabkan pulveriser akan beroperasi di bawahkapasitasnormalnya(menurutdesain),ataudengankatalainoperatingratio nyamenjadilebihrendah. 2.Kadarkelembaban(Moisture,satuanpersen) Hasil analisis untuk kelembaban terbagi menjadi free moisture (FM) dan inherentmoisture(IM).Adapunjumlahdarikeduanyadisebutdengantotalmoisture

LaporanStudyExcursion2011
(TM). Kadar kelembaban mempengaruhi jumlah pemakaian udara primernya. Batubara berkadar kelembaban tinggi akan membutuhkan udara primer lebih banyak untuk mengeringkan batubara tersebut pada suhu yang ditetapkan oleh outputpulveriser. 3.Zatterbang(VolatileMatteratauVM,satuanpersen) Kandungan VM mempengaruhi kesempurnaan pembakaran dan intensitas api.Penilaiantersebutdidasarkanpadarasioatauperbandinganantarakandungan karbon (fixed carbon) dengan zat terbang, yang disebut dengan rasio bahan bakar (fuelratio). Semakin tinggi nilai fuel ratio maka jumlah karbon di dalam batubara yang tidak terbakar juga semakin banyak. Jika perbandingan tersebut nilainya lebih dari 1.2, maka pengapian akan kurang bagus sehingga mengakibatkan kecepatan pembakaranmenurun. 4.Kadarabu(Ashcontent,satuanpersen) Kandunganabuakanterbawabersamagaspembakaranmelaluiruangbakar dandaerahkonversidalambentukabuterbang(flyash)yangjumlahnyamencapai 80 persen dan abu dasar sebanyak 20 persen. Semakin tinggi kadar abu, secara umum akan mempengaruhi tingkat pengotoran (fouling), keausan, dan korosi peralatanyangdilalui. 5.Kadarkarbon(FixedCarbonatauFC,satuanpersen) Nilaikadarkarbondiperolehmelaluipenguranganangka100denganjumlah kadar air (kelembaban), kadar abu, dan jumlah zat terbang. Nilai ini semakin bertambah seiring dengan tingkat pembatubaraan. Kadar karbon dan jumlah zat terbang digunakan sebagai perhitungan untuk menilai kualitas bahan bakar, yaitu berupanilaifuelratiosebagaimanadijelaskandiatas. 6.Kadarsulfur(Sulfurcontent,satuanpersen) Kandungansulfurdalambatubaraterbagidalampyriticsulfur,sulfatesulfur, dan organic sulfur. Namun secara umum, penilaian kandungan sulfur dalam batubara dinyatakan dalam Total Sulfur (TS). Kandungan sulfur berpengaruh terhadap tingkat korosi sisi dingin yang terjadi pada elemen pemanas udara,

15

LaporanStudyExcursion2011
terutama apabila suhu kerja lebih rendah dari pada titik embun sulfur, di samping berpengaruh terhadap efektivitas penangkapan abu pada peralatan electrostatic precipitator. 7.Ukuran(Coalsize) Ukuran butir batubara dibatasi pada rentang butir halus (pulverized coal atau dust coal) dan butir kasar (lump coal). Butir paling halus untuk ukuran maksimum 3 milimeter, sedangkan butir paling kasar sampai dengan ukuran 50 milimeter. 8.Tingkatketergerusan(HardgroveGrindabilityIndexatauHGI) Kinerja pulveriser atau mill dirancang pada nilai HGI tertentu. Untuk HGI lebih rendah,kapasitasnyaharusberoperasilebihrendahdarinilaistandarnyapulauntuk menghasilkantingkatkehalusan(fineness)yangsama.

16

II.3. PerlindunganLingkunganHidup Untuk menjaga kelestarian lingkungan hidup, ada beberapa program yang dijalankanPT.BukitAsam,antaralainadalah: Kolampengendapanlumpur Penyiramanairdijalananuntukmengurangidebuyangbeterbangan Reklamasidengantanamanyangekonomis Pembuatankolampengolahanlimbah Pemberiankapuraktifdalamlimbahuntukmengurangikeasamanairtambang Reuselimbahbeltconveyor Rencana Pasca Tambang (TAHURA ENIM), yaitu perubahan wilayah bekas pertambanganmenjadiwilayahpertanian,perumahan,maupundaerahwisata. II.4. IstilahyangDigunakan Abuatauash Sisa pembakaran dari mineralmineral yang tidak hangus dalam batubara seperti lempung,kuarsa,pasir,lanau dan belerang bila batubara dibakar.Mineralmineral tersebut secra kimia dan fisika sama dengan lempung, kuarsa,pasir,lanau, dan belerangyangterdapatdialam


Adb

LaporanStudyExcursion2011

17

Singkatan dari air dried basis. Air asam penirisan. Air bersifat asam yang ditiriskan daritambangbatubaradalamatautambangbatubaraterbukayangdihasilkanoleh reaksi organik atau inorganik bahanbahan mengandung pirit (besi sulfida) dengan air dan oksigen sehingga air ini mengandung asam belerang dan besi. Airdriedbasis Disingkat ADB atau adb, berarti analisis conto batubara dalam keadaan kadar kelembaban yang hampir sama dengan kelembaban udara sekitarnya. Airdried Disingkat AD atau ad, berarti conto batubara dikeringkan secara alami atau dalam alatpengeringpadasuhuruangsebelumdianalisis. Analisisproksimat Penentuan pesentase dari kadar kelembaban, zat terbang , karbon tertambat (karbon tetap) dan abu dengan cara tertentu di laboratorium umumnya untuk batubara dan kokas. Walaupun tidak tepat analisa proksimat lebih sering mencantumkan nilai kalor batubara, analisa dilakukan pada basis contoh sebagai diterima(asreveived),bebaskelembaban(moisturefree)danbebasabu(ashfree). Analisisultimat Analisalaboratoriumuntukmenentukankandunganabu,karbon,hidrogen,ogsigen dan belerangdalam batubara dengan metoda tertentu. Kandungan itu dinyatakan dalampersenpadabasiscontohdikeringkanpadasuhu105Cdalamkeadanbebas kelembabandanabu. ARB Singkatan dari as received basis. Asreceived basis : disingkat ARB atau arb, yang berarticontohyangdianalisasesuaikeadaanpadawaktuditerimadilaboratorium. Ashfusibility:Ukurandalamderajatsuhudariabubatubaramelunakdengancarauji karbon contoh batubara (di laboratorium dengan cara dan keadaan baku).

LaporanStudyExcursion2011
Ash fusion temperature : suhu pelunakan abu, yakni suhu ketika conto batubara (biasanya dibentuk seperti kerucut kecil) mulai berubah dan, melunak mendekati pelelehandalamujibakarlaboratorium.

18

LaporanStudyExcursion2011

19

BABI URAIANSINGKATPT.PUPUKSRIWIDJAJAPALEMBANG
I.1. ProfilPerusahaan PT Pupuk Sriwidjaja Palembang merupakan anak perusahaan dari PT Pupuk Sriwidjaja (Persero) yang merupakan Badan Usaha Milik Negara (BUMN) . PT Pupuk Sriwidjaja Palembangmenjalankanusahadibidangproduksidanpemasaranpupuk.Perusahaanyang juga dikenal dengan sebutan PT Pusri ini, diawali dengan didirikannya Perusahaan Pupuk pada tanggal 24 Desember 1959, merupakan produsen pupuk urea pertama di Indonesia. Perusahaaninitelahmengalamibeberapakalipengembangan,sehinggaPTPupukSriwidjaja yangsemulahanyamemilikisatupabrikdengankapasitasterpasang100.000tonpertahun, dalamperiode19722004telahmenjadi2.280.000tonurea

Secarasekilas,tahapanpembangunanPUSRIadalahsebagaiberikut:

Pusri didirikan pada tanggal 24 Desember 1959 di Palembang, dengan kegiatan usahamemproduksipupukurea. Padatahun1963beroperasipabrikpupukureapertamayaitu:PUSRIIdengan kapasitasterpasangsebesar100.000tonpertahun.

Tahun1974dibangunpabrikpupukUreakeduayaituPUSRIIIdengankapasitas terpasang sebesar 380.000 ton pertahun ( sejak tahun 1992 kapasitasnya ditingkatkan/optimasimenjadi570.000ton/tahun).

Tahun1976dibangunpabrikpupukUreaketiga,yaituPUSRIIIIdengankapasitas terpasangsebesar570.000tonpertahun.

Tahun 1977 dibangun pabrik pupuk Urea keempat, yaitu PUSRI IV dengan kapasitasterpasangsebesar570.000tonpertahun.

LaporanStudyExcursion2011
Tahun 1990 dibangun pabrik pupuk Urea, yaitu PUSRI I B dengan kapasitas terpasang sebesar 570.000 ton pertahun sebagai pengganti pabrik Pusri I yang dihentikan operasinya karena usia teknis dan sudah tidak efisien lagi. Pabrik ini mulai berproduksi pada tahun 1994, merupakan pabrik pertama yang dikerjakan sebagian besar oleh ahliahli bangsa Indonesia, yang dibangun dengan konsep hemat energi dan menggunakan sistem kendali komputer Distributed ControlSystem

20

Tahun 1979, pemerintah menetapkan PT.Pusri sebagai perusahaan yang bertanggung jawab dalam pengadaan dan penyaluran seluruh jenis pupuk bersubsidi, baik yang berskala dari produksi dalam negeri maupun import untuk memenuhikebutuhanprogramintensifikasipertanian(BimasdanInmas).

Tahun1997dibentukHoldingBUMNPupukdiIndonesiadanPT.Pusriditunjukoleh pemerintahsebagaiindukperusahaan.

Tanggal 1 Desember 1998, pemerintah menghapus subsidi dan tata niaga seluruh jenispupuk,baikpupukyangdiproduksidalamnegerimaupunpupukimport

Padatahun2001tataniagapupukkembalidiaturolehPemerintahmelaluiKepmen Perindag RI No.93/MPP/Kep/3/2001, tanggal 14 Maret 2001, dimana unit niaga Pusri dan atau produsen melaksanakan penjualan pupuk di lini III (kabupaten) sedangkan dari kabupaten sampai ke tangan petani dilaksanakan oleh distributor (BUMN,Swasta,Koperasi)

Pada tahun 2003 keluar Kepmen Perindag No.70/MPP/2003 tanggal 11 Februari 2003tentangtataniagapupukyangbersifatrayonisasidanberartiPTPusritidaklagi bertanggungjawabuntukpengadaandanpenyediaanpupuksecaranasionaltetapi dibagidalambeberaparayon.

Pada tahun 2010 dilakukan Pemisahan (Spin Off) dari Perusahaan Perseroan (Persero) PT. Pupuk Sriwidjaja disingkat PT. Pusri (Persero) kepada PT. Pupuk SriwidjajaPalembangsertatelahterjadinyapengalihanhakdankewajibanPT.Pusri (Persero)kepadaPT.PusriPalembang

LaporanStudyExcursion2011

21

BABII PROSESPRODUKSI
II.1. PengenalanSingkatProduk II.1.1.PengenalanProduk Produksi Pabrik PT Pupuk Sriwidjaja terdiri dari produk utama dan produk sampingyangdihasilkanolehPabrikUtamaPusriII,III,IV,IB.Produkutamaterdiri dari Amoniak dan Urea, sedangkan produk samping terdiri dari Amoniak Ekses, Oksigen,Nitrogen,Dryice,danCO2 PT. Pusri mempunyai 4 (empat) unit pabrik dengan masingmasing pabrik terdiriatas3(tiga)bagiansebagaiberikut:

PabrikOffsite/Utilitas Pabrik utilitas adalah pabrik yang menghasilkan bahanbahan pembantu

maupun energi yang dibutuhkan oleh pabrik amoniak dan urea. Produk yang dihasilkandandiolahdaripabrikutilitasiniantaralainsebagaiberikut:

LaporanStudyExcursion2011
AIRBERSIH AIRPENDINGIN AIRDEMIN UDARAPABRIK UDARAINSTRUMENT TENAGA LISTRIK, disuplai 4 pembangkit listrik dengan kapasitas 21 25MW

22

UAPAIRdengantekanan42kgataumediumsteam

PabrikAmoniak

PabrikAmoniakialahpabrikyangmenghasilkanamoniaksebagaihasilutama dan carbon dioxide sebagai hasil samping yang keduanya merupakan bahan baku pabrikurea. Bahan baku pembuatan amoniak adalah gas bumi yang diperoleh dari Pertaminadengankomposisiutamamethane(CH4)sekitar70%danCarbonDioxide (CO2) sekitar 10%. Steam atau uap air diperoleh dari air Sungai Musi setelah mengalami suatu proses pengolahan tertentu di Pabrik Utilitas. Sedangkan udara diperoleh dari lingkungan, dan sebelum udara ini digunakan sebagai udara proses, ditekanterlebihdahuluolehkompresorudara. Secara garis besar proses dibagi menjadi 4 unit, dengan urutan sebagai berikut:


1. 2. 3. 4. FeedTreatingUnit ReformingUnit Purification&Methanasi

LaporanStudyExcursion2011

23

CompressionSynloop&RefrigerationUnit

(1)FeedTreatingUnit GasAlamyangmasihmengandungkotoran(impurities),terutamasenyawa belerangsebelummasukkeReformingUnitharusdibersihkandahuludiunitini,agar tidak menimbulkan keracunan pada Katalisator di Reforming Unit. Untuk menghilangkansenyawabelerangyangterkandungdalamgasalam,makagasalam tersebut dilewatkan dalam suatu bejana yang disebut Desulfurizer. Gas alam yang bebassulfuriniselanjutnyadikirimkeReformingUnit. (2)ReformingUnit Di reforming unit gas alam yang sudah bersih dicampur dengan uap air, dipanaskan, kemudian direaksikan di Primary Reformer, hasil rekasi yang berupa gasgashydrogendancarbondioxidedikirmkeSecondaryReformerdandireaksikan denganudarasehinggadihasilkangasgassebagaiberikut:

Hidrogen Nitrogen KarbonDioksida

GasgashasilreaksiinidikirimkeUnitpurifikasidanMethanasiuntukdipisahkangas karbondioksidanya. (3)Purification&Methanasi KarbondioksidayangadadalamgashasilreaksiReformingUnitdipisahkandahuludi UnitPurification,KarbonDioksidayangtelahdipisahkandikirimsebagaibahanbakuPabrik Urea.Sisakarbondioksidayangterbawadalamgasproses,akanmenimbulkanracunpada katalisator ammonia converter, oleh karena itu sebelum gas proses ini dikirim ke Unit Synloop&RefrigerationterlebihdahulumasukkeMethanator (4)CompressionSynloop&RefrigerationUnit Gas Proses yang keluar dari Methanator dengan perbandingan gas hidrogen : nitrogen = 3 : 1, ditekan atau dimampatkan untuk mencapai tekanan yang diinginkan oleh Ammonia Converter agar terjadi reaksi pembentukan, uap ini kemudian masuk ke Unit Refrigerasi sehingga didapatkan amoniak dalam fasa cair yang selanjutnya digunakan sebagaibahanbakupembuatanUrea.

LaporanStudyExcursion2011
Hasil / produk pada proses di atas adalah gas ammonia cair serta karbon dioksida

24

yangdigunakansebagaibahanbakupembuatanUrea.

PabrikUrea

ProsespembuatanUreadibuatdenganbahanbakugasCO2danliquidNH3 yangdisuplaidariPabrikAmoniak.

LaporanStudyExcursion2011
ProsespembuatanUreatersebutdibagimenjadi6unit,yaitu: 1. 2. 3. 4. 5. 6. SintesaUnit PurifikasiUnit KristaliserUnit PrillingUnit RecoveryUnit ProsesKondensatTreatmentUnit

25

(1)SintesaUnit Unit ini merupakan bagian terpenting dari pabrik Urea, untuk mensintesa Urea dengan mereaksikan Liquid NH3 dan gas CO2 di dalam Urea Reaktor dan ke dalamreaktorinidimasukkanjugalarutanrecyclekarbamatyangberasaldaribagian Recovery. Tekanan operasi di Sintesa adalah 175 Kg/cm2 G. Hasil Sintesa Urea dikirim ke bagian Purifikasi untuk dipisahkan ammonium karbamat dan kelebihan ammonianyasetelahdilakukanstrippingolehCO2 (2)PurifikasiUnit Ammoniumkarbamatyangtidakterkonversidankelebihanammoniadiunit Sintesadiuraikandandipisahkandengancaratekanandanpemanasandengandua steppenurunantekanan,yaitupada17kg/cm2Gdan22,2kg/cm2G.Hasilperuraian berupa gas CO2 dan NH3 dikirim ke bagian Recovery, sedangkan larutan ureanya dikirimkebagiankristaliser. (3)KristaliserUnit Larutan urea dari unit Purifikasi dikristalkan dibagian ini secara vacuum. Kemudian kristal ureanya dipisahkan di Centrifuge. Panas yang diperlukan untuk menguapkanairdiambildaripanasSensibellarutanurea,maupunpanaskristalisasi ureadanpanasyangdiambildarisirkulasiUreaSlurrykeHPAbsorberdariRecovery. (4)PrillingUnit Kristal urea keluaran Centrifuge dikeringkan sampai menjadi 99,8% berat dengan udara panas, kemudian dikirimkan ke bagian atas Prillign Tower untuk dilelehkan dan didistribusikan merata ke seluruh distributor, dan dari distributor dijatuhkan ke bawah sambil didinginkan oleh udara dari bawah dan menghasilkan produk urea butiran (prill). Produk urea dikirim ke bulk storage dengan belt conveyor.


(5)RecoveryUnit

LaporanStudyExcursion2011

26

Gas ammonia dan gas CO2 yang dipisahkan dibagian purifikasi diambil kembali dengan 2 step absorbsi dengan menggunakan mother liquor sebagian absorbentkemudiandirecyclekembalikebagiansintesa. (6)ProsesKondensatTreatmentUnit Uap air yang menguap dan terpisahkan dibagian kristaliser didinginkan dan dikondensasikan. Sejumlah kecil urea, NH3, dan CO2 ikut kondensat kemudian diolah dan dipisahkan di stripper dan hydrolizer. Gas CO2 dan gas NH3nya dikirim kembali ke bagian purifikasi untuk direcover. Sedang air kondensatnya dikirim ke utilitas.

II.2. ProsesProduksi II.2.1.Prosesproduksipupukurea Kedengaran amat sederhana bahwa pupuk Urea terbuat dari gas alam, air dan udara. Udara tersedia tidak terbatas sedang gas alam terdapat banyak di Indonesia.DengansendirinyabagiIndonesiabukanlahmenjadimasalahyangberat untuk dapat memproduksi sendiri pupuk buatan bagi kepentingan pertaniannya. Namun tidaklah sesederhana itu proses pembuatan pupuk Urea yang dibuat di PabrikPusriyangdikenalsebagaijenispupuktunggalberkadarNitrogen46%. Dimulai dari ladangladang gas yang banyak terdapat di sekitar Prabumulih yang diusahakanolehPertamina,gasalamyangbertekananrendahdikirimmelaluipipa

LaporanStudyExcursion2011
pipa berukuran 14 inchi ke pabrik pupuk PT Pupuk Sriwidjaja, di Palembang. Gas alaminidimasamasayanglalutidakdiusahakanorangdandibiarkanhabisterbakar. Menjelajah hutanhutan, rawarawa, sungai, bukitbukit dan daerahdaerah yang sulit dilalui, gas alam bertekanan rendah ini dikirim melalui pipapipa sepanjang ratusan kilometer jauhnya menuju pemusatan gas alam di pabrik pupuk di Palembang. Gas bertekanan rendah, melalui proses khusus pada kompresor, gas diubahmenjadigasyangbertekanantinggi.Kemudiangasinidibersihkanpadaunit SintesaGasuntukmenghilangkandebu,lilindanbelerang. Pertemuan antara gas yg sudah diproses dengan air dan udara pada unit sintesa ini menghasilkan tiga unsur kimia penting, yaitu unsur gas N2 (zat lemas), unsur zat air (H2), dan unsur gas asam arang (CO2), Ketiga unsur kimia penting ini kemudian dilanjutkan prosesnya. Zat lemas (N2) dan zat air (H2) bersamasama mengalirmenujuUnitSintesaUrea.Padasintesaamoniak,zatlemas(N2)danzatair (H2)diprosesmenghasilkanamoniak(NH3).Gasasamarang(CO2),yangdihasilkan padaunitSintesaGas,kemudianbereaksidenganamoniakpadaunitSintesaUrea. Hasilreaksiiniadalahbutirbutirureayangberbentukjarumdansangatmenyerap air. Oleh karena itu proses pembuatan dilanjutkan lagi pada Menara Pembutir, dimana bentuk butirbutir tajam itu diubah dengan suatu tekanan yang tinggi menjadi butirbutir Urea bulat yang berukuran 1 sampai 2 milimeter sehingga mempermudah petani menabur dan menebarkannya pada sawahsawah mereka. Padaumumnya,butirbutirUreaitudibungkusdengankarungplastikdenganberat 50Kilogram.

27

LaporanStudyExcursion2011

28

II.2.2.ProseskimiapembuatanAmoniakdanUrea PupukUreayangdikenaldengannamarumuskimianyaNH2CONH2pertama kali dibuat secara sintetis oleh Frederich Wohler tahun 1928 dengan mereaksikan garamcyanatdenganammoniumhydroxide. Pupuk urea yang dibuat PT Pusri merupakan reaksi antara karbon dioksida (CO2)danammonia(NH3).Keduasenyawainiberasaldaribahangasbumi,airdan udara. Ketiga bahan baku tersebut meruapakan kekayaan alam yang terdapat di SumateraSelatan. Pada proses pembuatan amoniak dengan tekanan rendah dalam reaktor (150 atmosfir) yaitu dengan reaksi reforming merubah CO menjadi CO2, penyerapan CO2 dan metanasi. Reaksi reforming ini dilakukan dalam 2 tingkatan yaitu:


TingkatPertama:

LaporanStudyExcursion2011

29

Gas bumi dan uap air direaksikan dengan katalis melalui piappipa vertikal dalam dapurreformingpertamadansecaraumumreaksiyangterjadisebagaiberikut: CnH2n+nH2O>NCO+(2n+1)H2panas CH4+H2O>CO+3H2panas TingkatKedua: Udara dialirkan dan bercampur dengan arus gas dari reformer pertama di dalam reformerkedua,halinidimaksudkanuntukmenyempurnakanreaksireformingdan untukmemperolehcampurangasyangmengandungnitrogen(N) 2CH4+3O2>12N2 2CO+4H2O>12N2 lalu campuran gas sesudah reforming direaksikan dengan H2O di dalam converter COuntukmengubahCOmenjadiCO2 CO+H2O>CO2+H2 CO2yangterjadidalamcampurangasdiserapdenganK2CO3 K2CO3+CO2+H2O>KHCO3 larutanKHCO3dipanaskangunamendapatkanCO2sebagaibahanbakupembuatan urea. Setelah CO2 dipisahkan, maka sisasisa CO, CO2 dalam campuran gas harus dihilangkanyaitudengancaramengubahzatzatitumenjadiCH4kembali CO+3H2>CH4+H2O CO2+4H2>CH4+2H2O Lalu kita mensintesa nitrogen dengan hidrogen dalam suatu campuran ganda pada tekanan150atmosfirdankemudiandialirkankedalamconverteramoniak. N2+3H2>2NH3 Setelah didapatkan CO2 (gas) dan NH3 (cair), kedua senyawa ini direaksikan dalam reaktorureadengantekanan200250atmosfer. 2NH3+ CO2> NH2COONH4+Q amoniakkarbondioksidaammoniumkarbamat NH2COONH4>NH2CONH2+H2OQ Reaksi ini berlangsung tanpa katalisator dalam waktu 25 menit. Proses selanjutnya adalah memisahkan urea dari produk lain dengan memanaskan hasil reaksi (urea, biuret, ammonium karbamat, air dan amoniak kelebihan) dengan penurunan tekanan, dan temperatur 120165 derajat Celsius, sehingga ammonium

LaporanStudyExcursion2011
karbamat akan terurai menjadi NH3 dan CO2, dan kita akan mendapatkan urea berkonsentrasi7075%. Untuk mendapatkan konsentrasi urea yang lebih tinggi maka dilakukan pemekatandengancara: 1. Penguapan larutan urea di bawah vacuum (ruang hampa udara, tekanan 0,1 atmosfirmutlak),sehinggalarutanmenjadijenuhdanmengkristal. 2. Memisahkankristaldaricairaninduknyadengancentrifuge 3. Penyaringankristaldenganudarapanas Untuk mendapatkan urea dalam bentuk butiran kecil, keras, padat maka kristal urea dipanaskan kembali sampai meleleh dan urea cair lalu disemprotkan melaluinozzlenozzlekecildaribagianatasmenarapembutir(prillingtower). Sementara tetesan urea yang jatuh melalui nozzle tersebut, dihembuskan udara dingin ke atas sehingga tetesan urea akan membeku dan menjadi butir urea yangkerasdanpadat Pengolahan air limbah di pabrik PT Pusri Palembang kini kian

30

disempurnakan dengan telah dioperasikannya pemakaian Instalasi Pengolahan Air Limbah (IPAL) dan Minimasi Pemisah Air Limbah (MPAL) yang memanfaatkan media tanaman Eceng Gondok. Sebelumnya Pusri telah memiliki sistem IPAL yang menggunakan bantuan mikrobiologi, namun seiring dengan perkembangan teknologi makadipandangperluuntukdisempurnakanlagi. LebihlanjutIndramenjelaskanProyekIPALdanMPALiniterdiridaribeberapa unitprosesantaralain: 1.KolamEmergency 2.KolamEkualisasi 3.Kolam/TangkiNetralisasi 4.Scrubber 5.KolamWetland 6.KolamMikrobiologis 7.BakPenampungdimasingmasingpabrikatauMPAL 8.Sertaunitunitpendukungnya.

LaporanStudyExcursion2011

31

II.Prosesproduksiproduksamping a.AmoniakEkses b.NitrogendanOksigenCair Pabrik oksigen mulai berproduksi pada tahun 1980 dan nitrogen pada tahun 1983. Dalam pabrik pemisah udara (Air Separation Unit) prinsipnya adalah melakukan fraksinasi terhadap kandungan nitrogen dan oksigen yang terdapat dalam udara bebas Dengan melalui kompresor, udara bebas tersebut dikompresi dan kemudian didinginkan hinggasuhuminus184derajatCelcius.KandunganH2Oyangterdapatdalamudaratersebut diuapkanuntukdihilangkan.Dengantitikdidihyangberbeda,padasuhuminus183derajat Celcius, Oksigen (O2) mencair dan memisahkan diri dari Nitrogen (N2). Gas Nitrogen akan mencairpadasuhuminus196,8derajatCelcius.ProsesyangdigunakandalamAirSeparation UnitadalahdariperusahaanProcessSystemIncorporated,NewYork,AmerikaSerikat. Kapasitas terpasang pabrik ini adalah 60 N/M3 Oksigen per Jam dan 50 N/M3 Nitogen per Jam.Produk nitrogen dan oksigen cair ini terutama untuk keperluan sendiri,disampingkelebihannyadapatdijual. c.CO2daneskering(dryice) Dry ice mulai diproduksi tahun 1983 dan produksi CO2 pertama kali dalam bentuk botolpadatahun1980dansejak1983adayangdalambentukbotoldanadajugayangcair.

LaporanStudyExcursion2011

32

PabrikinimenggunakanprosesdariperusahaanGasesIndustrialesBuenosAires,Argentina dengankemampuanproduksi55tonCO2cairperhari.CO2cairberasaldarigasCO2yang berlebihdaripabrikamoniakyangdikirimkepabrikCO2cair.SetelahgasCO2domurnikan, lalau didinginkan pada suhu minus 30 derajat Celcius. Pada tekanan 15kg/cm2 gas CO2 berubahmenjadicair.CO2cairumumnyadigunakandalamindustriminumandanblanket. Untuk memproduksi es kering(dryice),CO2cairyangtelahdihasilkansebelumnya diubah menjadi salju CO2 padat yang ditekan dengan alat press sehingga membentuk silinder berukuran panjang 34 cm dengan penampang garis tengah 15cm dan temperatur minus78,8derajatCelcius.Kapasitaspembuataneskeringiniadalah4,8tonperhari. Es kering ini umumnya digunakan untuk pengawetan hasil pertanian dan perikanan. Penggunaan es kering dapat mengurangi persentase kerusakan, lebih tahan lama penyimpanannya dan dapat mengurangi bahanbahan terbuang. Pendinginan/pengawetan bahan makanan dengan es kering tidak boleh tersentuh langsung, sebab akan mengakibatkanbahanmakanantersebutrusak.Untukbeberapaindustritertentu,eskering bergunadalampekerjaanlineryangsangatpenting. .

LaporanStudyExcursion2011

33

LaporanStudyExcursion2011

34

BABI URAIANSINGKATPT.PERTAMINA(Persero)UPIIIPLAJU
I.1. ProfilPerusahaan Perjalanan kilang PERTAMINA

Musi dimulai sekitar 19571961, dimana terjadi kegiatan nasionalisasi perusahaan minyak Belanda dan Amerika baik di Sumatera Utara maupun di Sumatera Selatan. Sejalan dengan pengakuan

kedaulatan Indonesia, saham milik pemerintah Belanda beralih ke tangan pemerintah Republik Indonesia dan pada tanggal 31 Desember 1959, berubah menjadi PT. PERMINDO. Setelah mengalami beberapa kali perubahan pemilik dan nama,akhirnyapada1969,KilangSungaiGerongdiserahkankePNPERTAMINA. Pengembangan kilang Musi sendiri dilakukan melalui beberapa tahapan

berikut: 1904 1926 1965 1970 1971 1972 PendiriankilangminyakPlajuberkapasitas110MBSD PendiriankilangminyakSungaiGerongberkapasitas70MBSD NasionalisasikilangPlaju NasionalisasiSungaiGerong PembangunanpolypropyleneplantPlajuberkapasitas20.000ton/tahun IntegrasikilangPlajudanSungaiGerong UpgradingkilangtahapI 1982 PembangunanHVUII UpgradingFCCU 1983 1987 1990 1994 PembangunanTA/PTAplantberkapasitas180.000/th ProyekEnergyConservationImprovement DebottleneckingTA/PTAplantmenjadi225.000ton/th UpgradingkilangtahapI RevampingRFFCU


PembangunanPPplant

LaporanStudyExcursion2011

35

StandarisasifrekuensilistrikSungaiGerong 2002 2003 Pembangunanjembatanintegrasi PERTAMINAberubahstatusmenjadiPT.PERTAMINA(PERSERO)

LaporanStudyExcursion2011

36

BABII PROSESPRODUKSI
II.1. PengenalanProduk


II.1.1.ProdukkilangMusi PERTAMINA melaksanakan tugas dari pemerintah sebagai Public Service Obligation (PSO), yaitu untuk memenuhi kebutuhan masyarakat akan produk BBM dalamnegeri.BeberapaprodukyangdihasilkanUPIIIplajuadalah: PRODUKBAHANBAKARMINYAK Premium MinyakTanah Solar IndustrialDieselOil IndustrialFuelOil KEGUNAANUTAMA Bahanbakarmesin Bahanbakarrumahtangga Bahanbakardiesel Bahanbakarmesinindustri Minyakbakarindustri


PRODUKBAHANBAKARKHUSUS Avgas Avtur Pertamax PRODUKNBBMDANGAS LPG Solvent Musicoolrefrigerant PRODUKPETROKIMIA Polytampolypropylene Pertamina PTA II.1.3.POLYTAM

LaporanStudyExcursion2011
KEGUNAANUTAMA Bahanbakarpesawatbalingbaling Bahanbakarpesawatjet Bahanbakarmesinkompresitinggi

37

KEGUNAANUTAMA Bahanbakarrumahtangga Bahanpelarut Mediapendinginramahlingkungan

KEGUNAANUTAMA Bahanbakuindustriplastik Bahanbakupolyestertekstil

Selain itu, kilang Musi juga menghasilkan produk lain, seperti naphta,

vaccumresidue,paraphinicoildistillate,dannitrogen.

DiproduksidiPERTAMINAUPIII,Plajudengankapasitas45.000ton/tahundandikemas dalamtas25kg,yangdiprosesmelaluipolimerisasigaspropyleneyangdimodifikasi denganagenaditifsepertiantioksidan,antiblokdanslipagent. BerbagaijenisPolytam: PolytamFilm(PF1000) BenangPolytam(PY240) PolytamInjeksi FiturKhusus: KantongplastikyangdihasilkandariPERTAMINAPolytammemilikikarakteristikyang lebihbaikdalamhal:visuallebihjelas,mengkilap,openabilityantistatikdanbaikrendah. Untukaplikasikarungplastik,menyengatmasingmasingmemilikiyanglebihbaiktarik, wiruberseratdanmudahbukan.


AplikasiManfaat: PolytamFilm(PF1000)

LaporanStudyExcursion2011

38

oBahanbakuyangdigunakanuntukmemproduksikemasanumumuntukyangbaik,hal sayuran,buahbuahandanroti. oTubularFilm oPemainFilm Benang(PY240) oBahanbakukarungplastikdigunakanuntukberbagai,tasanyamanplastik,tegapband, minumjeramidantaliplastik PolytamInjeksi oBahanbakuyangdigunakanuntukmemproduksiprodukplastikrumahtanggaumum oOtomotifbagian oBateraikasus oMakanandanperalatanobat oMainanPlastik II.1.4.RefrigerantHydrocarbonMusicool MusicooladalahrefrigeranthematenergidanramahlingkunganproduksiPT PERTAMINA(PERSERO)UPIII.Refrigerantinimemilikibeberapakeunggulan,yaitu: Ramahlingkungan,karenatidakmembentukracunmaupungum,sertatidak merusaklapisanozon,meskipundilepaskeudarabebas. Hematenergi Irit, karena ,Musicool memiliki kerapatan yang rendah. Oleh karena itu, hanyaperlusekitar30%penggunaannyadibandingkanrefrigerantCFCpada kapasitaspendinginyangsama. II.2. ProsesProduksi Kilang Musi dirancang untuk mengolah minyak mentah dalam negeri, terutamadaridaerahSumateraSelatandansekitarnya,dengankapasitasterpasang 126.2 ribu barel per hari (MBSD). Konfigurasi proses pengolahan Kilang Musi merupakankilangterintegrasiantarakilangBBMdankilangprodukpetrokimia,yang dihasilkandaripengolahanhasilcrackingminyakbumi.ProsesproduksiPERTAMINA secaragarisbesardapatdilihatpadadiagramprosesdibawahini.

LaporanStudyExcursion2011

39


KilangMusimemproduksiBBMmelalui3tahapanunitproses,yangterdiridari: PRIMARYPROCESSUNIT Primary process merupakan tahapan proses pemisahan distilasai pada tekananatmosferikuntukpemisahanminyakmentahataucrudeoilataupundistilasi tekananhampauntukpemisahanLongResidueyangmenghasilkanfraksinasiproduk BBM. UNITPROSES CDUII CDUIII CDUIV CDUV CDUVI HVUII StabilizerCAB BBDistilling LOKASI Plaju Plaju Plaju Plaju SungaiGerong SungaiGerong Plaju Plaju KAPASITAS (MBSD) 16.20 30.00 30.00 35.00 15.00 53.50 4.90 2.89


SECONDARYPROCESSUNIT

LaporanStudyExcursion2011

40

Secondary process merupakan tahapan lanjutan Primary Process dengan teknologi reaksi kimia, seperti catalytic cracking, polimerisasi, atau alkilasi, yang bertujuanmengkonversifeedstockmenjadiprodukyangbernilaitambah.Prosesini dilanjutkandenganstabilisasiuntukmendapatkanfraksiBBMsesuaispesifikasi. UNITPROSES Alkylasi C4Polymerisasi RFCCU TREATINGSYSTEMANDBLENDINGPROCESS Sebelum masuk ke tangi final product, komponen produk BBM ditreating terlebih dahulu melalui process treating technology. Sedangkan untuk optimalisasi produkBBM,fraksiprodukyangsejenisakanmelaluiblendingprocess. Selain kilang BBM, UP III Plaju juga memiliki kilang petrokimia, yang terdiri darikilangPolypropyleneatauPPdankilangTA/PTA. Kilang PP dibanggun pada 1971 dengan kapasitas produksi 20.000 ton/ tahun dan ditingkatkan menjadi 45.200 ton/ tahun pada 1994. Bahan baku yang digunakan adalah raw propane polypropylene yang dipasok dari unit RFCC Sungai Gerong. Salah satu produk dari kilang ini adalah POLYTAM, biji plastik PP yang digunakansebagaibahanbakuindustriplastik. II.3. FasilitasPendukungProduksidanPengolahanLimbah Dalam proses produksinya, PERTAMINA memiliki beberapa fasilitas yang mendukungjalannyaprosesproduksi Utilitas Fasilitasutilitasberfungsimenyediakanpasokanlistrikuntukkebutuhanoperasional kilang,menghasilkandanmendistribusikanfluidaproses,sertasuplaidandistribusi kebutuhanairbersih Laboratorium LOKASI Plaju Plaju SungaiGerong KAPASITAS(MBSD) 1.80 2.30 20.50

LaporanStudyExcursion2011
Laboratoriumbertanggungjawabmengontrolkualitasbahanbakudanprodukyang dihasilkankilangagarsesuaispesifikasistandarmutuujikualitas. Tangkitimbun Tangki penimbun berfungsi menampung bahan baku dan produk yang dihasilkan dariprosespengolahan Dermaga Kilang Musi memiliki 12 unit dermaga untuk memperlancar distribusi produk dan transportasi

41

Untuk mengendalikan limbah hasil produksi, maka kilang Musi memiliki beberapafasilitaspengolahanlimbah,yaitu: Incinerator Oilcatcher :unitpembakaranlimbahpadatkilangpetrokimia :saranamengurangikadarminyakyanngterbawaairbuangankilang : sarana mereduksi BOD dan COD

Primarydansecondaryeffluenttreatment limbahkilangpetrokimia

Flaringsystem :untukmembakargasbuangsebelumdilepaskeudara

LaporanStudyExcursion2011

42

BABI URAIANSINGKATPT.CABOTINDONESIA
I.1. ProfilPerusahaan PT.CabotIndonesia,yangmembukasebuahpabrikdengankapasitas30.000 ton karbon hitam di Cilegon Mei 1992, kini berencana untuk melipatgandakan ukuranoperasiuntuk60.000ton.Peningkatankapastasproduksiinibertujuanuntuk memenuhikebutuhanpasarkarbonhitamdalamnegeriIndonesia,yangdikatakan berkembang dengan cepat dalam menanggapi pertumbuhan produksi ban dan industri terkait. Ekspansi PT. Cabot Indonesia, awal tahun ini disetujui oleh Indonesia,BadanKoordinasiPenanamanModal,merupakansuatuinvestasisebesar $24,5juta.Kapasitastambahanakandiarahkanterutamauntukpasarlokal,tetapi juga akan mendukung ekspor ke pasar regional. Produksi komersial dimulai pada tahun1995. I.2. ProsesProduksi

Carbon black adalah bentuk lain elemen karbon yang berasal dari cokes, charcoaldangraphitedanterbentukakibatpembakaranhidrokarbonaromatikberat secaratidaksempurnaolehudarapanasdangasaalamsesuaireaksiberikut: CxHy+O2>C+CH4+CO+H2+CO2+H2O Setiappartikelprimersalingberhubunganmembentukformasitigadimensi yangdisebutaggregates.Susunangeometrisiniberpengaruhpadastrukturformasi

LaporanStudyExcursion2011
tersebut.Reaksikimiadalamprosesdiakhiridenganpenyemprotanairpadabagian bawahreaktor. Sebagianagregatdapatbergabungmenjadpartikelyanglebihbesardisebut agglomerates. Partikel ini akan terpisah saat proses pencampuran menjadi karet olahan

43

Mata rantai utama dalam pross pembuatan carbon black adalah reaktor yangdilapisibatatahanapi.Carbonblackdihasilkandariprosesreaksikimiadimana terjadi proses pembakaran tidak sempurna.Bahan baku yang digunakan dalam proses ini adalah hidrokarbon berat, yang diperoleh dari proses distilasi minyak, produksietilen,dandistilasicoaltar. Minyak panas diinjeksikan untuk memanaskan reaktor tertutup. Proses pembakaran diatur dan dihentikan sebelum proses sempurna, sehingga hanya sebagiankecilminyakyangterbakaruntukmenjagatemperaturreaksisekitar1350 1800 C. Sisa minyak akan tersebar selama pembentukan carbon black. Proses inindisebutOilFurnaceprocess

Untuk memproduksi berbagai macam carbon black dengan karateristik berbeda, dilakukan manipulasi terhadap kondisi reaktor. Reaksi pembentukan carbonblackdikontroldengansteamataupenyemprotanair. Partikelyangterbentukakandibawadenganalirangaspanasmenujuproses coolingdanpemisahangasdalamsleevefilters.Partikelyangdisebutnonreinforced

LaporanStudyExcursion2011
carbon black ini akan ditransfer ke dalam proses pelletizing, untuk memudahkan transferkedalamsilo. Skema sederhana dari keseluruhan proses produksi carbon black adalah sebagaiberikut:

44

I.3. AplikasiProduk Macam carbon blackdapat diklasifikasikan sesuai ukuran, spesifikasi permukaan partikel, dan struktur agregat. Proses pembakaran carbon black menghasilkan beberapa macam produk dengan karateristik yang beragam dan meningkatkan karateristik mekanika fisik produk dengan penambahan zat aditif tertentu ( proteksi terhadap radiasi UV,pigmentasi, dan konduktasi serta mengatur kekerasanproduk,terutamapadaindustrikaret). Pasarutamacarbonblackadalahsektorindustriban,diikutisektorproduksi barangkaret.

LaporanStudyExcursion2011

45

BABI URAIANSINGKATPT.TITANPETROKIMIANUSANTARA
I.4. ProfilPerusahaan Pabrik ini terletak di situs 36hektar di Merak, Provinsi Banten, sekitar 120 kmdiluarJakarta,dimulaidenganduakeretaapi,duagudangpenyimpananuntuk PEdengankapasitasgabungansebesarhampir14.000metrikton,sebuahdermaga swastayangdapatmelayanikapalmasukhingga10.000DWTdanfasilitasproduksi HidrogendanNitrogen. PT. TITAN Petrokimia Nusantara Tbk. didirikan pada 9 Desember 1987 dengannamaPTIndofatraPlastikIndustridanbergantinamamenjadiPTFatrapindo Nusa Industri pada tahun 1988. Kemudian nama tersebut berubah menjadi PT Fatrapolindo Nusa Industri Tbk. pada tahun 2001, terkait dengan proses penggabunganperusahaanpadaIndonesiaStockExchange. Perusahaan tersebut merupakan salah satu produsen Biaxially Oriented Polypropylene (BOPP film) di Indonesia, dengan nama Falene. Falene BOPP film diproduksidenganmenggunakanteknologipadaindustriplasticfilmdanmerupakan salahsatufilmterbaikdiIndonesia. MenggunakanteknologidariMitsubishiHeavyIndustries,JepangdanDMT, SAPerancis,perusahaanmemproduksibermacammacamjenisfilm,dikelompokkan kedalam4kategori,yaituFalenePlain,FaleneHeatSealable,FaleneCigarette danFaleneMetalizable. Semuaprodukperusahaandipasarkansecaralangsungdandigunakanuntuk kemasan produkproduk makanan, bungkus luar kemasan rokok, sabun dan detergen, alatalat tulis, kosmetik, bahan kemasan untuk penggantian aluminium (metalized film) dan produkproduk lain dari berbagai macam industry yang menggunakanplastiksebagaibahanutamauntukkemasan. Setelah dua tahun konstruksi, pada tahun 1993 perusahaan mulai produksi PEdenganduakeretaapi;totalkapasitas200.000tonpertahun.Setahunkemudian padatahun1994,programekspansipertamaperusahaanmenyebabkanpeningkatan dalam kapasitas produksi 50.000 ton per tahun. Perusahaan ini memulai program ekspansi kedua pada tahun 1998 dengan menambahkan kereta ketiga dengan kapasitas200.000tonpertahun.Halinimembawatotalkapasitasperusahaanuntuk

LaporanStudyExcursion2011
450.000 ton per tahun, sehingga terbesar ketiga High Density Polyethylene (HDPE) danLinearLowDensityPolyethylene(LLDPE)produsendiAsiaTenggara.Padatahun 2003,PT.PemegangsahamPeniyangdijualperusahaanuntukGrupIndika,sebuah kelompok dengan kepentingan Indonesia di petrokimia, energi dan pertambangan. Tiga tahun kemudian, pada 21 Maret 2006 Indika menjual perusahaan ke Titan Petchem (M) Sdn. Bhd, anak perusahaan dari Titan Kimia Corp Sdn. Bhd dan kemudianbergantinamamenjadiPT.TITANPetrokimiaNusantara(PT.TITAN).

46

LaporanStudyExcursion2011

47

BABII PROSESPRODUKSI
II.1. PengenalanSingkatProduk Polyethylene atau lebih sering disebut PE adalah poliolefin yang paling banyak digunakan di dunia. PT. TITAN memproduksi berbagai macam High Density Polyethylene (HDPE) dan Linear Density Polyethylene resin dengan merek dagang TITANVENE. Produksi menggunakan proses fluidized bed Innovene menghasilkan produkberkualitastinggidanmemberikanperlindunganlingkunganoptimal. Berdasarkandensitasnya,polyethylenedapatdikelompokkanmenjadi: a. LowDensityPolyethylene(LDPE) LDPE memiliki banyak cabang, rantai polimer lurus dan struktur tidak serapatHDPE(HighDensityPolyethylene).ReaksipolimerisasiLDPEmerupakan reaksieksotermikdengankondisioperasipadatekanandantemperaturtinggi. Sifat fisik LDPE antara lain adalah memiliki densitas 0,910,94 g/cm3, titik leleh 98115oC. Kegunaannya adalah sebagai tempat penyimpanan asam, lapisan film transparan dalam pengemasan, dan injection molding untuk pembuatanbarangbarangrumahtangga,mainananakanak,insulasikawatdan kabel,pelapiskoilataukertas. b. VeryLowDensityPolyethylene(VLDPE) VLDPE dikenal juga sebagai Ultra Low Density Polyethylene (ULDPE), memiliki rantai polimer pendek, cabang banyak dan merupakan bentuk khusus LLDPE. Sifat fisik VLDPE antara lain adalah memiliki densitas 0,860,9 g/cm3, titikleleh60100oC,teksturhalus,fleksibel,mudahdibentuk,tidakmemilikirasa danbau,lapisannyacukupbening. c. HighDensityPolyethylene(HDPE) HDPE dihasilkan dengan menggunakan katalis ZieglerNatta dengan bantuankatalismetaloxidesepertikromiumoksida.SifatfisikHDPEantaralain adalahmemilikidensitas0,940,97g/cm3,titikleleh125132oC. ProdukHDPEdapatdibagimenjadi2kelas,yaitu:


i.

LaporanStudyExcursion2011
HDPE dengan berat molekul tinggi, digunakan untuk blow molding (misal: botol)danpipa.Tipeinimempunyaidayatahanterhadaptekananyangbaik, keras,dankaku. ii. HPDE dengan berat molekul rendah, digunakan untuk injection molding (misal: peralatan rumah tangga, mainan anakanak yang membutuhkan kekerasan tinggi dan tahan terhadap panas, lapisan film dan sheet, insulasi kawat dan kabel, dan pipa) dan rotational molding. Tipe ini lebih mudah diprosesdaripadaHDPEdenganberatmolekultinggi. d. LinearLowDensityPolyethylene(LLDPE) LLDPE mempunyai keuntungan bila dibanding LDPE, yaitu proses lebih murah, tidak mudah robek,tahanterhadappanasdanmemilikikekakuanyang sesuaiuntukinjectionmoldedparts.SifatfisikLLDPEantaralainadalahmemiliki densitas0,90,94g/cm3dantitikleleh100125oC. Proses produksi yang dilakukan oleh PT. TITAN Petrokimia Nusantara menghasilkan polyethylene (HDPE dan LLDPE) yang dapat digunakan untuk berbagaimacamproduk.

48

ProdukLLDPEdenganberbagaivariasinyamemilikikegunaansebagaiberikut: LLDPEtipeLL0209AA Sebagaisackfilm,kemasanmakanansertakemasanpadaindustrilainnya. LLDPELL0209SR Sebagaikemasanmakanan,tasbelanjaan,kemasanuntukindustri. LLDPELL0220AA Sebagaiblendedfilm,castfilmdanlapisanluarrotomoulding LLDPELL0220SR Sebagaikemasanmakanan,tasbelanjaan,kemasanuntukindustri. KawatdanKabel Sebagaiisolasikawatdankabellistrikberteganganrendah. ProdukHDPEdenganberbagaivariasinyamemilikikegunaansebagaiberikut: BlowMoldingtipeHD5220GM Untukblowmouldedcontainersususertakemasansusudanjusbuahbuahan. BlowMouldingtipeHD5707GM Untukblowmouldedcontainersususertakemasansusudanjusbuahbuahan. BlowMouldingtipeHD5502GA

LaporanStudyExcursion2011
Untuk blow moulded container (5L atau kurang) makanan, bahan kimia, rotan sintetisdanpipapipasaluran. BlowMouldingtipeHD5401GA Untuk blow moulded container berukuran besar (lebih dari 5L) untuk makanan, bahankimia,rotansintetisdanpipapipasaluran. BlowMouldingtipeHD5420GA Untukblowmouldedcontaineryangberukuransangatbesarlebihdari150Luntuk bahanbahankimiayangdigunakanpadaindustri. Tape/FilamenHD5609AA Untukplester,tali,netdananyamankarung. RotoMouldingHD3840UA Digunakanuntuktangkirotationalmouldeduntukairdanbahanbahankimia,drum dangerobak. HDPEFilmHD5301AA Untuktas,kemasanmakanan,kemasanindustry. OrganolepticInjectionMoldingtipeHD5120EAB Untuktutupbotolbahankimiadanmakanan, OrganolepticInjectionMoldingtipeHD5120GBB Untuktutupbotolbahankimiadanmakanan, OrganolepticInjectionMoldingtipeHD5211EAB Untuktutupbotolairmineraldanmakanannonkarbohidrat. GeneralInjectionMoldingtipeHD5740UA Untukpetikemas,tutupbotol. GeneralInjectionMoldingtipeHD6070EA Untukpetikemas,tutupbotol,kotakmakanandantutupnya. GeneralInjectionMoldingtipeHD6070UA Untukpetikemas,tutupbotol,kotakmakanandantutupnya. GeneralInjectionMoldingtipeHD5218EA Untukperalatanrumahtangga,container,danmainananakanak. II.2. UnitProduksi PT. TITAN Petrokimia Nusantara memproduksi polyethylene (PE) dengan bahan baku utama adalah ethylene dan butene. Kedua bahan baku

49

LaporanStudyExcursion2011
tersebut direaksikan dengan menggunakan katalis sehingga menjadi produk produkyangdiinginkan,baikHDPEmaupunLLDPE. Bahan baku utama akan direaksikan di dalam reaktor. Reaksi tersebut adalah reaksi polimerisasi eksothermis. Dalam reaksi tersebut digunakanberbagaikatalisyangdapatmenunjangprosesreaksi. Departemen produksi PT. TITAN Petrokimia Nusantara terdiri dari

50

jettyyangberfungsiuntukbongkarmuatankapalyangmemasokethylenedan butene.Grademaksimumethyleneadalahsebesar350tonperjam,sedangkan gradebutaneadalahsebesar100tonperjam. Selain jetty, departemen produksi juga memiliki tangki ethylene dan tangki butene. Tangki ethylene berfungsi untuk menyimpan ethylene dengan temperatur 103C dan temperatur maksimum tangki adalah 190C. bila tekanan di dalam tangki naik, maka ethylene akan ditransfer ke kompresor. Tangki ini dilengkapi dengan safety rely valve. Tangki butane berfungsi menampungbutane.Tekananoperasitangkiadalah2bar,temperaturoperasi 29Cdengantemperaturmaksimum60C.tangkiinidilengkapidenganpressure safetyvalve. Selanjutnya terdapat Feed Purification Unit. Unit ini berfungsi untuk memurnikan feed yang akan dimasukkan ke dalam reactor dengan menggunakanfluidizedbedgas.Zatzatpengotoryangakandihilangkanadalah CO2,CO,O2,danair.Zatzattersebutdapatmerusakkatalis.Selainitusulfurdan asethylenejugamerupakanzatyangakandihilangkandarifeed. Terdapat Catalist Preparation Unit yang berfungsi untuk proses pembuatan katalis. Terdapat pula Solvent Recovery Unit yang berfungsi untuk menghilangkanairsertafraksiberat(oktan)darisolvent.CromiumAktivasiUnit berfungsiuntukpembuatankataliskromium. Unit boiler berfungsi sebagai penyedia steam yang dugunakan pada proses. PT. TITAN Petrokimia Nusantara memiliki 3 unit boiler. Unit boiler tersebut memproduksi dua macam steam yaitu steam medium yang bertekanan7barsertasteamlowyangbertekanan3,5bar. Unit Prepolimerisasi berfungsi untuk membuat katalis prepolimer.unit ini terdapat pada train 1 dan 2. Train 1 dan train 2 digunakan untuk memproduksi HDPE. Sedangkan train 3 yang memproduksi LLDPE tidak

LaporanStudyExcursion2011
menggunakan unit prepolimerisasi. Unit polimerisasi adalah unit dimana pembuatanpowderpolimerterjadi. Sebagai unit akhir produksi terdapat Additive Extrusion Unit untuk pembuatanbijipolyethylenesertaBaggingUnituntukpengepakanprodukyang telahdihasilkandansiapuntukdipasarkan. II.3. ProsesProduksi Kunci utama dari proses dengan Fluidized Bed Innovene adalah sistem katalis yang yang dirancang khusus untuk proses polimerisasi. Melalui perjanjian lisensi dengan BP, PT. TITAN memiliki akses ke berbagai teknologi BP, dari jenis Ziegler Natta Catalyst sampai teknologi Innovene terbaru, yaitu injeksi katalis BP langsung.Teknologiinimemastikanoperasipabrikyangefisiendanprodukdengan kualitastinggi.Outputdarikualitasprodukyangkonsistenterjamin. Katalisataukatalisyangtelahdiprepolimerasidiumpankankedalamreaktor tempat terjadinya proses polimerisasi dalam konsentrasi rendah. Partikel polimer kering yang sedang berkembang dijaga tetap dalam kondisi terfluidisasi dengan aliran naik gas reaktan, yang sebagian besar mengandung monomer ethylene dan komonomerbutane.Gasiniakankeluarmelaluibagianatasreaktordandidinginkan sebelum direcycling kembali ke dasar reaktor. Komposisi gas tersebut terus menerusdiatursecaraotomatisuntukmemastikanprodukmemilikispesifikasiyang diinginkan. Polyethylene powder dikeluarkan dari fluidizede bed melalui sebuah valve, kemudiandidegassingdandiolahuntukmenghentikanaktivitaskatalisyangmasih tersisa. Pneumatic conveying mendorong powder menuju pelletizing extruder, di mana terjadi pencampuran powder dengan aditif tertentu sesuai aplikasi produk. Produkakhirdariprosesiniberupapelletyangsiapuntukdikirim.

51

LaporanStudyExcursion2011

52

LaporanStudyExcursion2011

53

BABI URAIANSINGKATPLTUSURALAYA
I.1. ProfilPerusahaan Pada waktu terjadinya krisis energi yang melanda dunia tahun 1973 dan pada saat itu terjadi embargo minyak oleh negaranegara Arab terhadapa Amerika Serikat dan negaranegara Industri lainnya dan disusul keputusan OPEC (organisasi negaranegarapengeksporminyak)untukmenaikanBBMlimakalilipat.Belajardari pengalaman maka Pemerintah mencari sumber energi pengganti BBM Pemerintah menyadari akan ketergantungan pada BBM serta gas alam dan uranium yang akan habis 4080 tahun lagi salah satu jalan yang ditempuh adalah pengalihan kepada batubara. Dalam rangka memenuhi peningkatan kebutuhan akan tenaga listrik khususnya di pulau Jawa sesuai dengan kebijaksanaan pemerintah serta untuk meningkatkan pemanfaatan sumber eneri primer dan diversifikasi sumber energi primer untuk pembangkit tenaga listrik, maka PLTU Suralaya dibangun dengan menggunakan batubarasebagaibahanbakarutamayangmerupakansumberenergiprimerkelima disampingenergiair,minyakbumidanpanasbumi. PLTU Suralaya pembangunannya dilakukan dalam 3 (tiga) tahap yang seluruhnyaberjumlah7unit: SumberDayayangDikelola(Kapasitas) Unit14,@400MW Unit57,@600MW Totalunit17=3.400MW Dalam pembangunannya secara keseluruhan, dibangun oleh PLN Proyek Induk Pembangkit Therma Jawa Barat dan Jakarta Raya dengan Konsultan asing dari Montreal Engeneering Company (Monenco) Canada untuk unit 1s/d 4 sedangkan 1.600MW 1.800MW Tahap Tahap Tahap I II III = = = 2x400 2x400 3x600 MW MW MW beroperasi beroperasi beroperasi tahun tahun tahun 1984 1989 1997

LaporanStudyExcursion2011
untuk unit 5 s/d7 dari Black & Veatch International ( BVI ) Amerika Serikat. Dalam melaksanakan pembangunan Proyek PLTU Suralaya dibantu oleh beberapa kontraktorlokaldankontraktorasing. PLTU Suralaya terletak di desa Suralaya Merak Kotamadya Cilegon, Jawa Barat7KmkearahutaradariPelabuhanPenyeberanganMerak.Luaslahanyang digunakan untuk membangun PLTU Suralaya berikut sarana dan fasilitas penunjang lainnya adalah 240,65 hektar. Lahan yang dipergunakan untuk PLTU Suralayamerupakanlembahyangdikelilingiolehbukit/hutanlindung. Sebelumnya ada 4 (empat) lokasi alternatip yang dipilih untuk lokasi PLTU.Namundarihasilstudikelayakan,Suralayatelahdipilihsebagailokasiyang palingbaik,karenaadanyabeberapafaktorsebagaiberikut: 1. Tersedianyatanahdataranyangcukupluasdimanatanahtersebutdipandang tidakproduktifuntukpertanian. 2. Tersedianyapantaidanlautyangcukupdalam,tenangdanbersih,halinibaik untukpelabuhandanairpendingin. 3. Adanya faktor item 2 tersebut diatas, maka akan membantu/memperlancar pengangkutanperalatanberatdanbahanbakar. 4. Jalanmasuklokasitidakterlalujauhdansebelumnyasudahadajalannamum belumbegitubaik. 5. Jumlah penduduk disekitar lokasi masih relatip sedikit sehingga tidak perlu pembebasanpendudukgunapemasangansalurantransmisi. 6. Tanah yang memungkinkan untuk didirikan bangunan yang besar dan bertingkat. 7. Tersedianya tempat yang cukup untuk penimbunan limbah abu dari sisa pembakaranbatubara. 8. Tersedianya tenaga kerja yang cukup memperlancar pelaksanaan pembangunan. 9. Dampaklingkunganyabaikkarenaterletakdiantaraperbukitandanlaut. MenimbangdatamonitoringbebanlistrikseIndonesia,bahwakebutuhan akan tenaga listrik di pulau Jawa merupakan yang terbesar, maka tepat apabila dibangunpembangkityangbesardiPulauJawa.

54

LaporanStudyExcursion2011

55

BABII PROSESPRODUKSI
II.1. ProsesProduksiTenagaListrik

BATUBARA,sebagaibahanbakarutamaPembangkitSuralayaberasaldari Tambang batubara Bukit Asam,Sumatera Selatan. Batubara yang digunakanmemilikiheatingvaluesekitar4,2255,242kcal/kgberdasarkan analisisproksimat. Batubaradarikapalakandikirimkedalamjunctionhousedengan belt conveyor, dilanjutkan menuju scrapper dan pulverizer. Pulverizer ini berfungsimenghancurkanbatubarahinggaukuran200mesh. Batubara yang telah hancur akan disembur udara panas dengan temperatur 300 C dan ditransfer menuju burner. Panas yang dihasilkan akandigunakanmendidihkanairdalamboilerhinggauapnyakeringatau menghasilkan steam. Steam tersebut akan menggerakkan turbin pada generator dan menghasilkan arus sebesar 23 kV. Arus ini akan melewati travostepupuntukmenaikkanarushingga500kV. Batubara yang digunakan sebagai bahan bakar boiler akan menghasilkan abu. Abu ini akan ditiup dengan fan menuju electric precipitators. Dalam ESP, abu akan diinduksi hingga bermuatan negatif

LaporanStudyExcursion2011
dan dibawa menuju collecting plate. Sisa gas yang telah bersih akan dikeluarkankeatmosfer. BOILER, masingmasing boiler membutuhkan 1,500 ton air.Uap yang keluardariboilerpadatekanan174kg/cm2dan540derajatCelcius. TURBIN & GENERATOR, uap dialirkan ke turbin.Masingmasing turbin untuk unit 1,2,3 & 4 berkapitas 400 MW dan 600 MW untuk unit 5,6 & 7.Masingmasing turbin dihubungkan langsung dengan generator. Teganganyangdihasilkandinaikkandari23,000voltmenjadi500,000volt denganmenggunakantrafosebelumdisalurkankesistemjaringan. PENDINGIN, uap yang melewati turbin akan didinginkan dan dikondensasikan menjadi air di dalam kondensor sebelum dikembalikan keboiler.Kondensorsendirididinginkanolehairyangdipompakandariair laut. Sistem yang dipergunakan pada unit ini adalah sistem interkoneksi, maksudnya saat salah satu sistem overhaul, maka suplai listrik akan dilakukan oleh unit lain. Namun, bila semua unit mengalami masalah, maka putara turbin akan mengalami penurunan hingga mati. Suplai listrik untuk turbin diperoleh dari EDG (diesel genset), yang berjumalah 2. Masingmasing untuk unit 14 dan unit 57. EDG ini diuji setiaphariJumatuntukmencegahkemungkinantertentu . DampakLingkunganakibatberoperasinyaPLTUSuralaya >AbuTerbang(FlyAsh) >EmisiGasHasilPembakaran(Sox,Nox,CO2) >LimbahCair(WaterPollution) >LimbahLainnya(OtherPollutants) Limbah klorin akan diolah dalam chlorine plant, dan dicek berapa ppm konsentrasipadakeluarandikondensor SemuadampakterhadaplingkunganmasihdibawahambangbatasBME

56

II.2.ProdukSamping ABUDANDEBU,beberapabatubarayangterbakarjatuhkebagianbawahboiler di mana nantinya dikumpulkan dan dijual untuk pembuatan bahan bangunan. Lebih dari 99,5% debu ditangkap oleh electrostatic precipitators (ESP).Pada

LaporanStudyExcursion2011
elektrondilepaskankebatanganberbentuksaringansehinggapartikelyanghalus yanglewatditarikkesaringantersebutdankemudiandapatdikumpulkansecara prosesmekanik.Serbukabubatubaramemilikibeberapamacampenggunaan,dari proyekpembuatanjalansampaidenganbahansemenuntukpembuatanbeton. Abu batubara adalah bagian dari sisa pembakaran batubara pada Boiler pembangkit listrik tenaga uap yang berbentuk partikel halus amorf dan bersifat Pozzolan, berarti abu tersebut dapat bereaksi dengan kapur pada suhu kamar denganmediaairmembentuksenyawayangbersifatmengikat.Denganadanyasifat pozzolan tersebut abu terbang mempunyai prospek untuk digunakan berbagai keperluanbangunan.

57

LaporanStudyExcursion2011

58

BABI URAIANSINGKATPT.MITSUBISHICHEMICALINDONESIA
I.1. ProfilPerusahaan Industri poliester memiliki

peranan yang sangat penting dalam perkembangan kondisi perekonomian di Indonesia. Salah satunya adalah PT. Mitsubishi Chemical Indonesia, dahulu PT. Bakrie Kasei Corporation (BKC), yang didirikan pada tanggal 4 Maret 1991 untuk memproduksi Purified Terephtalic Acid (PTA). Operasi komersial dimulai pada bulan Januari 1994, dengan kapasitasproduksiplantpertamasebesar250.000metrikton. Untuk memenuhi meningkatnya permintaa produk, maka MCCI memulai pembangunan plant kedua pada tahun 1996 dan melakukan integrasi dengan PET Resinplantdengankapasitas52.000metrikton,yangberoperasipadatahun1995. Peningkatan kapasitas produksi ini terus dilakukan hingga pada akhir tahun 2000, kapasitasproduksitotalmencapai640.000tonPTApertahun.

LaporanStudyExcursion2011

59

BABII PROSESPRODUKSI
II.1. BahanBakuProduksi Raw material (bahan baku) dari PT. Mitsubishi Chemical Indonesia (MCCI) adalah paraxylene (PX) yang dibeli dari PT. Pertamina. Hal ini karena biaya operasi untukdikeluarkanuntukmengelolahCrudeOilmenjadiparaxylene(PX)sangattinggi dibandingjikalangsungmembelidariPT.Pertamina. Paraxylene (PX) merupakan turunan dari Naphtha yang juga merupakan

turunandaricrudeoil. II.2. PengenalanProduk II.2.1.ProdukMCCI MCCI memiliki dua macam produk, yaitu PTA dan PETresin.PTAadalahbahanyangtidakberacun,diproduksi dengan mengoksidasi salah satu komponen minyak bumi, yaituparaxylene(PX).Materialinindigunakandalamindustri poliester dan industri tekstil. Sedangkan, PET resin digunakandalampembuatanfilmataubotolminuman.Produkinitidakberbahaya, dapatdidaurulang,danmemilikiketahananyangtinggi. a. PurifiedTerephthalicAcid(PTA) Purified Terephthalic Acid (PTA) adalah senyawa organik dengan rumus C6H4(COOH)2.Produkiniberupapadatantakberwarnamerupakankomoditaskimia yangdigunakanterutamasebagaipendahulukepadapoliesterPET,digunakanuntuk membuatpakaian,botolplastik,danfiber. b. PolyethyleneTerephtalate(PETResin) Polyethylene terephthalate (kadangkadang ditulis poli (etilena tereftalat)), biasadisingkatPET,PETE,atauPETPusangatauPETP,adalahtermoplastikpolimer darikeluargaresinpoliesterdandigunakandalamseratsintetis,kemasanminuman serta makanan, aplikasi thermoforming, dan rekayasa resin sering dikombinasikan denganseratkaca. Tergantungpadapengolahandansejarahtermaldalamprosesproduksinya, polyethylene terephthalate ada yang sebagai amorf (transparan) dan sebagai

LaporanStudyExcursion2011
semicrystallinematerial.Bahansemicrystallinemungkinmuncultransparan(partikel ukuran <500 nm) atau buram dan putih (ukuran partikel sampai beberapa mikron) tergantungpadastrukturkristaldanukuranpartikel. MayoritasproduksiPETdiduniauntukseratsintetisbesarnyalebihdari60% denganjumlahproduksikemasanbotolsekitar30%daripermintaanglobal.Selain itu PET juga dapat digunakan sebagai bahan pembuat pita kaset, kosmetik, disket komputer,danjugasebagaicoating. Secara garis besar, produk industri poliester dan PET Resin yang dihasilkan PT.MitsubishiChemicalIndonesiaadalahsebagaiberikut:

60

II.2.2.Pemasaranproduk Untuk pemasaran produknya, PT. Mitsubishi Chemical Indonesia (MCCI) telah mengekspor ke berbagai Negara di dunia terutama di AsiaPasifik. Sebagian besar produk MCCI yang diekspor, sedangkan sisanya digunakan untuk memenuhi kebutuhan dalam negeri. Dengan ratarata produksi 640.000 ton/tahun untuk PTA dan 52.000 Ton/tahun untuk PET Resin, PT. Mitsubishi Chemical Indonesia (MCCI) mampumenjadisalahsatupenghasilpoliesterterbesardiIndonesia.


II.3. ProsesProduksi II.3.1.PengolahanparaxylenemenjadiPTA

LaporanStudyExcursion2011

61

Udara PX Katalis Separasi Mixing Oksidasi Kristalisasi

Drying CrudeTPA(CTA)

PurificationTPA
Separasi Kristalisasi

CTAPlant
Hidrogenasi Pelarutan denganair

Drying TPA

II.3.2.PengolahanPTAMenjadiPolyethyleneTerephtalate(PET)Resin Polyethylene Terephtalate (PET) Resin merupakan turunan dari PTA. PET Resin sendiri didapat dari esterifikasi dari PTA. Pembuatan Polyethylene Terephtalate(PET)ResindariPTAdilakukanpadaPETResinPlant.

LaporanStudyExcursion2011
BerikutadalahgambarmekanismereaksiprosespembuatanPETdariPTA

62

II.4PengendalianMutuProduksi MutudariprodukyangdihasilkanolehPT.MitsubishiChemicalIndonesiaini dikontrol secara online. Kemajuanteknologisangatdigunakanolehperusahaanini. Sehinggakualitasdariproduksangatterjaga. Mutu dari product dari purified terephthalic acid (PTA) dipengaruhi oleh ukurankristalnya.Ukuranmediumyangsangatdiharapkandalamprosespembuatan purified terephthalic acid (PTA) sendiri, karena itu harga dari ukuran medium lebih mahal dibanding dengan ukuran kristal sebesar 100 m yang hanya sebagai harga premiumnya. Untuk itu penting sekali untuk memperhatikan dari crystal size distribution(CSD)padaprosescontinuedaripembuatanPTAinisendiri. Kualitas hasil produksi merupakan salah satu syarat utama dalam industry untukmeraihkepuasandaricustomer/pelanggan.PT.MitsubishiChemicalIndonesia (MCCI)telahmemperolehsertifikasiISO9002padatahun1996sebagaibuktibahwa kualitas produk keluar (release product) telah sesuai dengan standar internasional. II.5.LimbahdanPelestarianLingkungan Secara umum industry polyester khususnya PT. Mitsubishi Chemical Indonesia (MCCI) menghasilkan 3 jenis limbah, yaitu padat, cair, dan gas. Untuk

LaporanStudyExcursion2011
limbah padat, PT. Mitsubishi Chemical Indonesia (MCCI) melakukan treatment terlebihdahulu.SetelahitulimbahpadatdikirimkePPLIuntukdidikelolahmenjadi limbah yang ramah lingkungan. Sedangkan limbah yang berbentuk cair dilakukan wastewater treatment terlebih dahulu, dengan standart internasional maka jika telahmemenuistandartlimbahyangtelahditreatmentdialirkankelaut.Limbahgas ditreatmentdengancararegularsmplingdengancarainlinemonitoring. Secara keseluruan, limbah yang dihasilkan oleh PT. Mitsubishi Chemical Indonesia(MCCI)initelahmemenuhistandartpemerintah.IniterbuktidariRELEASE PROPER2005yangdikeluarkanpemerintah,MCCItergolongindustriyantelahlulus propertestdenganperingkatberwarnabiru.

63