Anda di halaman 1dari 8

TANDA&GEJALAKLINISPSIKIATRIK

Surjo&Vita
PENDAHULUAN Dalam praktik klinik seorang dokter akan berhadapan dengan pasien yang membutuhkan pertolongannya.Pasienadalahsosokmanusiayangsedangsakit,membawakeunikanpribadi, danmenampilkanperilakusakityangberbedabeda.Dokteryangbaikseyogyanyamampudan terampil mengenali tidak hanya fenomena kelainan fisik belaka melainkan juga fenomena kejiwaan,karenadengandemikiandoktermendapatkanpemahamanholistikdaripasiennya.Bab ini akan menguraikan fenomena kejiwaan, khususnya tanda dan gejala klinis psikiatrik yang banyakdijumpaidalampraktikseharihari. Lingkupbahasanpadababinimeliputi: Kesadarandankognisi Alamperasaan/emosi Perilakumotorik/konasi Alampikiran Persepsi/penginderaan Pembicaraandankemampuanberbahasa Tilikandandayanilaisosial KESADARAN&KOGNISI A.Kesadaran/Sensorium Kesadaranatausensoriumadalahsuatukondisikesigapanmentalindividudalammenanggapi rangsang dari luar maupun dari dalam. Gangguan kesadaran seringkali merupakan pertanda kerusakanorganikpadaotak.Terdapatberbagaitingkatankesadaran,yaitu: 1. Kompos mentis: adalah suatu derajat optimal dari kesigapan mental individu dalam menanggapirangsangdariluarmaupundaridalamdirinya.Individumampumemahamiapa yangterjadipadadiridanlingkungannyasertabereaksisecaramemadai. 2. Apatia: adalah suatu derajat penurunan kesadaran, yakni individu berespons lambat terhadap stimulus dari luar. Orang dengan kesadaran apatis tampak tak acuh terhadap situasidisekitarnya. 3. Somnolensi: adalah suatu keadaan kesadaran menurun yang cenderung tidur. Orang dengan kesadaran somnolen tampak selalu mengantuk dan bereaksi lambat terhadap stimulusdariluar. 4. Sopor: adalahderajatpenurunankesadaranberat.Orangdengankesadaransopornyaris tidak berespons terhadap stimulus dari luar, atau hanya memberikan respons minimal terhadapperangsangankuat. 5. Koma: adalah derajat kesadaran paling berat. Individu dalam keadaan koma tidak dapat bereaksi terhadap rangsang dari luar, meskipun sekuat apapun perangsangan diberikan padanya.

6. Kesadaran berkabut: suatu perubahan kualitas kesadaran yakni individu tidak mampu berpikir jernih dan berespons secara memadai terhadap situasi di sekitarnya. Seringkali individutampakbingung,sulitmemusatkanperhatiandanmengalmidisorientasi. 7. Delirium:suatuperubahankualitaskesadaranyangdisertaigangguanfungsikognitifyang luas.Perilakuorangyangdalamkeadaandeliriumdapatsangatberfluktuasi,yaitusuatusaat terlihatgaduhgelisahlainwaktunampakapatis.Keadaandeliriumseringdisertaigangguan persepsi berupa halusinasi atau ilusi. Biasanya orang dengan delirium akan sulit untuk memusatkan,mempertahankandanmengalihkanperhatian(3Pterganggu) 8. Kesadaran seperti mimpi (Dream like state): adalah gangguan kualitas kesadaran yang terjadipadaseranganepilepsipsikomotor. Individudalamkeadaaninitidakmenyadariapa yangdilakukannyameskipuntampaksepertimelakukanaktivitasnormal.Perludibedakan dengan tidur berjalan (sleep walking) yang akan tersadar bila diberikan perangsangan (dibangunkan), sementara pada dream like state penderita tidak bereaksi terhadap perangsangan. 9. Twilight state: keadaan perubahan kualitas kesadaran yang disertai halusinasi. Seringkali terjadi pada gangguan kesadaran oleh sebab gangguan otak organik. Penderita seperti beradadalamkeadaanseparuhsadar,responsterhadaplingkunganterbatas,perilakunya impulsif,emosinyalabildantakterduga. B.Kognisi: Adalah kemampuan untuk mengenal/mengetahui mengenai bendaatau keadaan atau situasi, yang dikaitkan dengan pengalaman pembelajaran dan kapasitas intelejensi seseorang. Termasuk dalam fungsi kognisi adalah; memori/daya ingat, konsentrasi/perhatian, orientasi, kemampuanberbahasa,berhitung,visuospatial,fungsieksekutif,abstraksidantarafintelejensi. C.Perhatian/konsentrasi: Adalah usaha untuk mengarahkan aktivitas mental pada pengalaman tertentu. Gangguan perhatianmeliputiketidakmampuanmemusatkanperhatian,mempertahankanperhatianataupun mengalihkan perhatian. Pada gangguan kesadaran khususnya pada delirium ketiga ranah perhatiantersebutterganggu.Terdapatbeberapajenihgangguanperhatian/konsentrasi,yaitu: 1. Distraktibilitas:adalahketidakmampuanindividuuntukmemusatkandanmempertahankan perhatian. Konsentrasinya sangat mudah teralih oleh berbagai stimulus yang terjadi disekitarnya.Lazimditemuipadagangguancemasakutdankeadaanmaniakal. 2. Inatensi selektif: adalah ketidakmampuan memusatkan perhatian pada obyek atau situasi tertentu,biasanyasituasiyangmembangkitkankecemasan.Misalnyaseorangdenganfobia simplektidakmampumemusatkanperhatianpadaobyekatausituasiyangmemicufobianya. 3. Kewaspadaan berlebih (hypervigilance): adalah pemusatan perhatian yang berlebihan terhadapstimuluseksternaldaninternalsehinggapenderitatampaksangattegang. D.Orientasi: Adalah kemampuan individu untuk mengenali obyek atau situasi sebagaimana adanya. Dibedakanatasorientasipersonal/orang,yaitukemampuanuntukmengenaliorangorangyang sudah dikenalnya. Orientasi ruang/spatial, yaitu kemampuan individu untuk mengenali tempat dimana ia berada. Orientasi waktu, yaitu kemampuan individu untuk mengenali secara tepat waktudimanaindividuberada.Sesuaidenganranahyangterganggumakadibedakangangguan

orientasiorang,tempatdanwaktu.Gangguanorientasiseringterjadipadakerusakanorganikdi otak. E.Memori/Dayaingat: Adalahprosespenngelolaaninformasi,meliputiperekamanpenyimpanandanpemanggilan kembali.Terdapatbeberapajenisgangguanmemori/dayaingat,yaitu: 1. Amnesia: adalah ketidakmampuan untuk mengingat sebagian atau seluruh pengalaman masa lalu. Amnesia dapat disebabkan oleh gangguan organik di otak, misalnya; pada kontusioserebri.Namundapatjugadisebabkanfaktorpsikologikmisalnyapadagangguan strespascatraumaindividudapatkehilanganmemoridariperistiwayangsangattraumatis. Berdasarkanwaktukejadian,amnesiadibedakanmenjadi: a. Amnesia anterograd, yaitu apabila hilangnya memori terhadap pengalaman/informasi setelah titik waktu kejadian. Misalnya; seorang pengendara motor yang mengalami kecelakaan,tidakmampumengingatperistiwaperistiwayangterjadisetelahkecelakaan. b. Amnesiaretrograd,yaituhilangnyamemoriterhadappengalaman/informasisebelumtitik waktukejadian.Misalnya,seoranggadisyangterjatuhdariatapdanmengalamitrauma kepala, tidak mampu mengingat berbagai peristiwa yang terjadi sebelum kecelakaan tersebut. 2. Paramnesia: Sering disebut sebagai ingatan palsu, yakni terjadinya distorsi ingatan dari informasi/pengalaman yang sesungguhnya. Dapat disebabkan oleh faktor organik di otak misalnya pada demensia. Namun dapat juga disebabkan oleh faktor psikologik misalnya padagangguandisosiasi.Beberapajenisparamnesia,antaralain: a. Konfabulasi:adalahingatanpalsuyangmunculuntukmengisikekosonganmemori.Biasa terjadipadaorangdengandemensia. b. DejaVu: adalahsuatuingatanpalsuterhadappengalamanbaru.Individumerasasangat mengenalisuatusituasibaruyangsesungguhnyabelumpernahdikenalnya. c. JamaisVu:adalahkebalikandariDejaVu,yaitumerasaasingterhadapsituasiyangjustru pernahdialaminya. d. Hiperamnesia:adalahingatanyangmendalamdanberlebihanterhadapsuatupengalaman e. Screen memory: adalah secara sadar menutupi ingatan akan pengalaman yang menyakitkanatautraumatisdenganingatanyanglebihdapatditoleransi f. Letologika:adalahketidakmampuanyangbersifatsementaradalammenemukankatakata yang tepat untuk mendeskripsikan pengalamannya. Lazim terjadi pada proses penuaan ataupadastadiumawaldaridemensi. Berdasarkanrentangwaktuindividukehilangandayaingatnya,dibedakanmenjadi: 1. Memorisegera(immidiatememory):adalahkemampuanmengingatperistiwayangbarusaja terjadi,yaknirentangwaktubeberapadetiksampaibeberapamenit 2. Memoribaru(recentmemory):adalahingatanterhadappengalaman/informasiyangterjadi dalambeberapahariterakhir 3. Memori jangka menengah (recent past memory): adalah ingatan terhadap peristiwa yang terjadiselamabeberapabulanyanglalu. 4. Memori jangka panjang: adalah ingatan terhadap peristiwa yang sudah lama terjadi (bertahuntahunyanglalu) EMOSI Emosi adalah suasana perasaan yang dihayati secara sadar , bersifat kompleks, melibatkan pikiran,persepsidanperilakuindividu.Secaradeskriptiffenomenologisemosidibedakanantara mooddanafek.

1. Mood:adalahsuasanaperasaanyangbersifatpervasifdanbertahanlama,yangmewarnai persepsiseseorangterhadapkehidupannya. a. Moodeutimia:adalahsuasanaperasaandalamrentangnormal,yakniindividumempunyai penghayatanperasaanyangluasdanserasidenganiramahidupnya. b. Mood hipotimia: adalah suasana perasaan yang secara pervasif diwarnai dengan kesedihan dan kemurungan. Individu secara subyektif mengeluhkan tentang kesedihan dankehilangansemangat.Secaraobyektiftampakdarisikapmurungdanperilakunyayang lamban. c. Mood disforia:menggambarkansuasanaperasaanyangtidakmenyenangkan.Seringkali diungkapkansebagaiperasaanjenuh,jengkel,ataubosan. d. Mood hipertimia:suasanaperasaanyangsecaraperfasifmemperlihatkansemangatdan kegairahanyangberlebihanterhadapberbagaiaktivitaskehidupan.Perilakunyamenjadi hiperaktifdantampakenerjiksecaraberlebihan. e. Moodeforia:suasanaperasaangembiradansejahterasecaraberlebihan. f. Mood ekstasia:suasanaperasaanyangdiwarnaidengankegairahanyangmeluapluap. Seringterjadipadaorangyangmenggunakanzatpsikostimulansia g. Aleksitimia: adalah suatu kondisi ketidakmampuan individu untuk menghayati suasana perasaannya.Seringkalidiungkapkansebagaikedangkalankehidupanemosi.Seseorang denganaleksitimiasangatsulituntukmengungkapkanperasaannya. h. Anhedonia:adalahsuatusuasanaperasaanyangdiwarnaidengankehilanganminatdan kesenanganterhadapberbagaiaktivitaskehidupan. i. Mood kosong: adalah kehidupan emosi yang sangat dangkal,tidak atau sangat sedikit memilikipenghayatansuasanaperasaan.Individudenganmoodkosongnyariskehilangan keterlibatanemosinyadengankehidupandisekitarnya.Keadaaninidapatdijumpaipada pasienskizofreniakronis. j. Mood labil: suasana perasaan yang berubah ubah dari waktu ke waktu. Pergantian perasaan dari sedih, cemas, marah, eforia, muncul bergantian dan tak terduga. Dapat ditemukanpadagangguanpsikosisakut. g. Mood iritabel: suasana perasaan yang sensitif, mudah tersinggung, mudah marah dan seringkalibereaksiberlebihanterhadapsituasiyangtidakdisenanginya. 2. Afek: adalah respons emosional saat sekarang, yang dapat dinilai lewat ekspresi wajah, pembicaraan,sikapdangerakgeriktubuhnya(bahasatubuh).Afekmencerminkansituasi emosisesaat. a. Afek luas: adalah afek pada rentang normal, yaitu ekspresi emosi yang luas dengan sejumlahvariasiyangberagamdalamekspresiwajah,iramasuaramaupungerakantubuh, serasidengansuasanayangdihayatinya. b. Afekmenyempit: menggambarkannuansaekspresiemosiyangterbatas.Intensitasdan keluasan dari ekspresiemosinyaberkurang, yangdapatdilihat dari ekspresiwajah dan bahasatubuhyangkurangbervariasi. c. Afek menumpul: merupakan penurunan serius dari kemampuan ekspresi emosi yang tampakdaritatapanmatakosong,iramasuaramonotondanbahasatubuhyangsangat kurang. d. Afekmendatar:adalahsuatuhendayaafektifberatlebihparahdariafekmenumpul.Pada keadaan ini dapat dikatakan individu kehilangan kemampuan ekspresi emosi. Ekspresi wajahdatar,pandanganmatakosong,sikaptubuhyangkaku,gerakangerakansangat minimal,daniramasuaradatarsepertirobot. e. Afek serasi: menggambarkan keadaan normal dari ekspresi emosi yang terlihat dari keserasianantaraekspresiemosidansuasanayangdihayatinya.

f.

Afek tidak serasi: kondisi sebaliknya yakni ekspresi emosi yang tidak cocok dengan suasana yang dihayati. Misalnya seseorang yang menceritakan suasana duka cita tapi denganwajahriangdantertawatawa. g. Afeklabil:Menggambarkanperubahaniramaperasaanyangcepatdantibatiba,yangtidak berhubungandenganstimuluseksternal. PERILAKUMOTORIK Perilaku adalah ragam perbuatan manusia yang dilandasi motif dan tujuan tertentu serta melibatkanseluruhaktivitasmentalindividu.Perilakumerupakanresponstotalindividuterhadap situasikehidupan.Perilakumotorikadalahekspresiperilakuindividuyangterwujuddalamragam aktivitas motorik. Berikut ini diuraikan berbagai ragam gangguan perilaku motorik yang lazim dijumpaidalampraktekpsikiatri,yaitu: 1. Stupor Katatonia: penurunan aktivitas motorik secara ekstrim, bermanifestasi sebagai gerakanyanglambat hinggakeadaantakbergerakdankakusepertipatung.Keadaanini dapatdijumpaipadaskizofreniakatatonik 2. Furor katatonia: suatu keadaan agitasi motorik yang ekstrim, kegaduhan motorik tak bertujuan, tanpa motif yang jelas dan tidak dipengaruhi oleh stimulus eksternal. Dapat ditemukanpadaskizofreniakatatonik,seringkalisilihbergantidengangejalastuporkatatonik. 3. Katalepsia:adalahkeadaanmempertahankansikaptubuhdalamposisitertentudalamwaktu lama. Individu dengan katalepsi dapat berdiri di atas satu kaki selama berjam jam tanpa bergerak.Merupakansalahsatugejalayangbisaditemukanpadaskizofreniakatatonik. 4. Flexibilitascerea:keadaansikaptubuhyangsedemikianrupadapatdiaturtanpaperlawanan sehinggadiistilahkanseluweslilin. 5. Akinesia: menggambarkan suatu kondisi aktivitas motorik yang sangat terbatas, pada keadaanberatmenyerupaistuporpadaskizofreniakatatonik. 6. Bradikinesia: perlambatan gerakan motorik yang biasa terjadi pada parkinsonisme atau penyakit parkinson. Individu memperlihatkan gerakan yang kaku dan kehilangan respons spontan. PROSESPIKIR 1. Prosespikirprimer: terminologiyangumumuntukpikiranyangdereistic,tidaklogis,magis; secaranormalditemukanpadamimpi,tidaknormalsepertipadapsikosis 2. Gangguanbentukpikir/aruspikir:asosiasilonggar:gangguanaruspikirdenganideideyang berpindah dari satu subyek ke subyek lain yang tidak berhubungan sama sekali; dalam bentukyanglebihparahdisebutinkoherensia 3. Inkoherensia: pikiranyangsecaraumumtidakdapatkitamengerti,pikiranataukatakeluar bersamasamatanpahubunganyanglogisatautatabahasatertentuhasildisorganisasipikir 4. Flight of Ideas/lompat gagasan: pikiran yang sangat cepat, verbalisasi berlanjut atau permainankatayangmengahsilkanperpindahanyangkonstandarisatuidekeidelainnya; idebiasanyaberhubungandandalambentukyangtidakparah,pendengarmungkindapat mengikutijalnpikirnya.

5. Sirkumstansial: pembicaraan yang tidak langsung sehingga lambat mencapai point yang diharapkan,tetapiseringkaliakhirnyamencapaipointatautujuanyangdiharapkan,sering diakibatkanketerpakuanyangberlebihanpadadetaildanpetunjukpetunjuk. 6. Tangensial: ketidakmampuanuntukmencapaitujuansecaralangsungdanseringkalipada akhirnyatidakmencapaipointatautujuanyangdiharapkan. ISIPIKIR Gangguanisipikir: Disiniyangtergangguadalahbuahpikirannya/keyakinannyadanbukancarapenyampaiannya. Dapatberupamiskinisipikir,waham,obsesi,fobia,danlainlain. 1. Kemiskinan isi pikir: pikiran yang hanya menghasilkan sedkit informasi dikarenakan ketidakjelasan,pengulanganyangkosong,ataufraseyangtidakdikenal. 2. Waham/delusi: satu perasaan keyakinan atau kepercayaan yang keliru, berdasarkan simpulanyangkelirutentangkenyataaneksternal,tidakkonsistendenganintelegensiadan latar belakang budaya pasien, dan tidak bisa diubah lewat penalaran atau dengan jalan penyajianfakta.Jenisjeniswaham: a. wahambizarre:keyakinanyangkeliru,mustahildananeh(contoh:makhlukangkasaluar menanamkanelektrodadiotakmanusia) b. wahamsistematik:keyakinanyangkeliruataukeyakinanayangtergabungdengansatu tema/kejadian(contoh:orangyangdikejarkejarpolisiataumafia) c. wahamnihilistik:perasaanyangkelirubahwadiridanlingkungannyaatauduniatidakada ataumenujukiamat d. waham somatik: keyakinan yang keliru melibatkan fungsi tubuh (contoh: yakin otaknya meleleh) e. wahamparanoid:termasukdidalamnyawahamkebesaran,wahamkejaran/persekutorik, wahamrujukan(reference),danwahamdikendalikan. waham kebesaran: keyakinan atau kepercayaan, biasanya psikotik sifatnya, bahwa dirinyaadalahorangyangsangatkuat,sangatberkuasaatausangatbesar. waham kejaran (persekutorik): satu delusi yang menandai seorang paranoid, yang mengira bahwa dirinya adalah korban dari usaha untuk melukainya, atau yang mendorongagardiagagaldalamtindakannya.Kepercayaaniniseringdirupakandalam bentuk komplotan yang khayali, dokter dan keluarga pasien dicurigasi bersamasama berkomplotuntukmerugikan,merusak,mencederai,ataumenghancurkandirinya. wahamrujukan(delusionofreference):satukepercayaankeliruyangmeyakinibahwa tingkahlakuoranglainitupastiakanmemfitnah,membahayakan,atauakanmenjahati dirinya. wahamdikendalikan:keyakinanyangkelirubahwakeinginan,pikiran,atauperasaannya dikendalikanolehkekuatandariluar.Termasukdidalamnya: thoughtwithdrawal:wahambahwapikirannyaditarikolehoranglainataukekuatanlain thoughtinsertion:wahambahwapikirannyadisisipiolehoranglainataukekuatanlain thoughtbroadcasting:wahambahwapikirannyadapatdiketahuiolehoranglain,tersiar diudara thoughtcontrol:wahambahwapikirannyadikendalikanolehoranglainataukekuatan lain f. waham cemburu: keyakinan yang keliru yang berasal dari cemburu patologis tentang pasanganyangtidaksetia

g. erotomania:keyakinanyangkeliru,biasanyapadawanita,merasayakinbahwaseseorang sangatmencintainya 3. Obsesi:satuideyangtegarmenetapdanseringkalitidakrasional,yangbiasanyadibarengi satukompulsiuntukmelakukansuatuperbuatan,tidakdapatdihilangkandenganusahayang logis,berhubungandengankecemasan. 4. Kompulsi:kebutuhandantindakanpatologisuntukmelaksanakansuatuimpuls,jikaditahan akanmenimbulkankecemasan,perilakuberulangsebagairesponsdariobsesiatautimbul untukmemenuhisatuaturantertentu. 5. Fobia: ketakutan patologis yang persisten, irasional, berlebihan, dan selalu terjadi berhubungan dengan stimulus atau situasi spesifik yang mengakibatkan keinginan yang memaksauntukmenghindaristimulustersebut.Beberapacontohdiantaranya: a. Fobiaspesifik:ketakutanyangterbataspadaobyekatausituasikhusus(contohtakutpada labalabaatauular b. Fobiasosial:ketakutandipermalukandidepanpubliksepertirasatakutuntukberbicara, tampil,ataumakandidepanumum c. Akrofobia:ketakutanberadaditempatyangtinggi d. Agorafobia:ketakutanberadaditempatyangterbuka e. Klaustrofobia:ketakutanberadaditempatyangsempit f. Ailurofobia:ketakutanpadakucing g. Zoofobia:ketakutanpadabinatang h. Xenofobia:ketakutanpadaorangasing i. Fobiajarum:ketakutanyangberlebihanmenerimasuntikan PERSEPSI: Sebuahmentalprosesyangmerupakanpengirimanstimulusfisikmenjadiinformasipsikologis sehinggastimulussensorikdapatditerimasecarasadar.Beberapacontohgangguanpersepsi: 1. Depersonalisasi:satukondisipatologisyangmunculsebagaiakibatdariperasaansubyektif dengan gambaran seseorang mengalami atau merasakan diri sendiri (atau tubuhnya) sebagaitidaknyataataukhayali(asing,tidakdikenali) 2. Derealisasi:perasaansubyektifbahwalingkungannyamenjadiasing,tidaknyata 3. Ilusi:satupersepsiyangkeliruataumenyimpangdaristimuluseksternalyangnyata 4. Halusinasi: persepsi atau tanggapan palsu, tidak berhubungan dengan stimulus eksternal yangnyata;menghayatigejalagejalayangdikhayalkansebagaihalyangnyata. Jenisjenis halusinasi: a. halusinasi hipnagogik: persepsi sensorik keliru yang terjadi ketika mulai jatuh tertidur, secaraumumbukantergolongfenomenapatologis b. halusinasi hipnapompik: persepsi sensorik keliru yang terjadi ketika seseorang mulai terbangun,secaraumumbukantergolongfenomenapatologis c. halusinasiauditorik:persepsisuarayangkeliru,biasanyaberupasuaraorangmeskidapat saja berupa suara lain seperti musik, merupakan jenis halusinasi yang paling sering ditemukanpadagangguanpsikiatri d. halusinasivisual:persepsipenglihatankeliruyangdapatberupabentukjelas(orang)atau punbentuktidakjelas(kilatancahaya),seringkaliterjadipadagangguanmedisumum e. halusinasi penciuman: persepsi penghidu keliru yang seringkali terjadi pada gangguan medisumum f. halusinasipengecapan:persepsipengecapankelirusepertirasatidakenaksebagaigejala awalkejang,seringkaliterjadipadagangguanmedisumum

g. halusinasi taktil: persepsi perabaan keliru seperti phantom libs (sensasi anggota tubuh teramputasi),atauformikasi(sensasimerayapdibawahkulit) h. halusinasisomatik:sensasikeliruyangterjadipadaataudidalamtubuhnya,lebihsering menyangkutorgandalam(jugadikenalsebagaicenesthesichallucination) i. halusinasililiput:persepsikeliruyangmengakibatkanobyekterlihatlebihkecil(micropsia) REALITYTESTINGABILITY(RTA) Kemampuan seseorang untuk menilai realitas. Kemampuan ini akan menentukan persepsi, respons emosi dan perilaku dalam berelasi dengan realitas kehidupan. Kekacauan perilaku, waham, dan halusinasi adalah salah satu contoh penggambaran gangguan berat dalam kemampuanmenilairealitas(RTA). DAYANILAI Kemampuan untuk menilai situasi secara benar dan bertindak yang sesuai dengan situasi tersebut. 1. DayaNilaiSosial: kemampuanseseoranguntukmenilaisituasisecarabenar(situasinyata dalam kehidupan seharihari) dan bertindak yang sesuai dalam situasi tersebut dengan memperhatikan kaidah sosial yang berlaku di dalam kehidupan sosial budayanya. Pada gangguanjiwaberatataukepribadianantisosialmakadayanilaisosialnyaseringterganggu. 2. UjiDayaNilai: kemampuanuntukmenilaisituasisecarabenardanbertindakyangsesuai dalamsituasiimajineryangdiberikan. TILIKAN Kemampuan seseorang untuk memahami sebab sesungguhnya dan arti dari suatu situasi (termasuk di dalamnya dari gejala itu sendiri). Dalam arti luas, tilikan sering disebut sebagai wawasandiri,yaitupemahamanseseorangterhadapkondisidansituasidirinyadalamkonteks realitas sekitarnya. Dalam arti sempit merupakan pemahaman pasien terhadap penyakitnya. Tilikan terganggu artinya kehilangan kemampuan untuk memahami kenyataan obyektif akan kondisidansituasidirinya.Jenisjenistilikan: 1. Tilikanderajat1:penyangkalantotalterhadappenyakitnya 2. Tilikanderajat2:ambivalensiterhadappenyakitnya 3. Tilikanderajat3:menyalahkanfaktorlainsebagaipenyebabpenyakitnya 4. Tilikan derajat 4: menyadari dirinya sakit dan butuh bantuan namum tidak memahami penyebabsakitnya 5. Tilikan derajat 5: menyadari penyakitnya dan faktorfaktor yang berhubungan dengan penyakitnyanamuntidakmenerapkandalamperilakupraktisnya 6. Tilikan derajat 6 (sehat): menyadari sepenuhnya tentang situasi dirinya disertai motivasi untukmencapaiperbaikan BaftarBacaan: 1. Kaplan,Sadock,SynopsisofPsychiatry,ed