P. 1
Bacillus

Bacillus

|Views: 5,373|Likes:
Dipublikasikan oleh Vivin Rosidah A

More info:

Published by: Vivin Rosidah A on Apr 29, 2012
Hak Cipta:Attribution Non-commercial

Availability:

Read on Scribd mobile: iPhone, iPad and Android.
download as DOCX, PDF, TXT or read online from Scribd
See more
See less

10/01/2013

pdf

text

original

BAB I PENDAHULUAN

1.1 Ciri Umum Kelompok Bacillus Secara umum, Kelompok Bacillus merupakan bakteri berbentuk batang (basil), dan tergolong dalam bakteri gram positif yang umumnya tumbuh pada medium yang mengandung oksigen (bersifat aerobik) sehingga dikenal pula dengan istilah aerobic sporeformers. Kebanyakan anggota genus Bacillus dapat membentuk endospora yang dibentuk secara intraseluler sebagai respon terhadap kondisi lingkungan yang kurang menguntungkan, oleh karena itu anggota genus Bacillus memiliki toleransi yang tinggi terhadap kondisi lingkungan yang berubah-ubah. Beberapa anggota Bacillus memiliki S-layer yang merupakan lapisan crystalline dipermukaan subunit protein atau glikoprotein. Bagian kapsul kebanyakan anggota Bacillus mengandung D atau L-glutamic acid, sedangkan beberapa lainnya memiliki kapsul yang mengandung karbohidrat. Variasi struktur dinding sel seperti pada kebanyakan bakteri gram negatif tidak ditemukan pada genus Bacillus. Dinding sel vegetatif kebanyakan anggota Bacillus terbuat dari peptidoglikan yang mengandung Meso-Diaminopimelic acid (DAP) dengan tipe Glyserol Teichoic Acid sangat bervariasi diantara spesies. Kebanyakan anggota genus Bacillus merupakan bakteri yang bersifat motil dan memiliki flagela tipe peritrik. Bakteri Bacillus sp. biasanya banyak ditemukan di tanah. Cara untuk mendapatkan bakteri Bacillus sp. yaitu dengan mengambil sampel tanah menggunakan sendok yang telah disterilisasikan terlebih dahulu kemudian ambil tanah sekitar kedalaman 3 cm dari permukaan tanah. Bacillus sp. merupakan bakteri gram positif dengan sel batang berukuran 0,3-22x1,27-7 πm, sebagian bersifat motil (mampu bergerak) mobilitasnya ini disebabkan oleh flagel, jika dipanaskan akan membentuk endospora, yaitu bentuk dorman sel vegetatif sebagai bentuk pertahanan diri yang muncul saat kondisi ekstrim yang tidak menguntungkan bagi bakteri. Kandungan air endospora sangat rendah bila dibandingkan dengan sel vegetatifnya, maka endospora berbentuk sangat padat dan sangat refraktil bila dilihat di bawah mikroskop. Endospora dibentuk dalam sporangium di dalam sel dan dibentuk saat sel masak. Endospora memiliki dinding tebal, reaktif, dan sangat resisten. Letak endospora dalam sel ukuran selama pembentukannya tidak sama antara spesies satu

1

dengan lainnya. Beberapa spesies memiliki spora sentral, terminal, atau letal. Endospora dapat berbentuk oval, silindris, bulat, atau lainnya. Bacillus sp. bersifat aerob sampai anaerob fakultatif, metabolisme dengan fermentasi dan respirasi. Isolat-isolat murni tersebut dipelihara dalam medium agar miring. Untuk memastikan bahwa koloni-koloni tersebut adalah Bacillus, maka dilakukan serangkaian pengujian yang bersifat spesifik yaitu pengecetan gram, pengecetan negatif dan motilitasnya. Bacillus dibedakan dari anggota familia Bacillaceae lainnya berdasarkan sifat-sifatnya yaitu: keseluruhannya merupakan pembentuk spora, hidup pada kondisi aerob baik sebagai jasad yang sepenuhnya aerob maupun aerob fakultatif, selnya berbentuk batang, dan memproduksi katalase.

1.2 Jenis-jenis Bacillus Kebanyakan anggota genus Bacillus adalah organisme saprofit yang lazim terdapat dalam tanah, air, udara, dan tumbuh-tumbuhan, seperti Bacillus cereus dan Bacillus subtilis. Beberapa di antaranya patogen bagi insekta Bacillus cereus dapat tumbuh pada makanan dan menghasilkan enterotoksin yang menyebabkan keracunan makanan. Organisme ini kadang-kadang dapat menimbulkan penyakit pada orang fungsi imun yang terganggu (misalnya meningitis, endokarditis, endoftalmitis, konjungtivitis, atau gastro enteritis akut). Bacillus anthracis, penyebab antraks adalah bakteri patogen utama genus ini.

1.

Bacillus anthracis Kuman antraks banyak ditemukan pada penyakit zoonosis, infeksi pada ternak lembu, kambing, domba dan babi. Kuman dikelurakan melalui feses, urin dan saliva binatang yang terinfeksi dan bertahan hidup di ladang dalam bentuk spora untuk waktu yang lama sekali.

Morfologi Batang dengan ukuran 1 x 3-4 µm, dapat tersusun dengan seperti bamboo, bentuk batangnya persegi atau cekung ujungnya, sendiri-sendiri, berpasangan atau membentuk rantai pendek, tidak bergerak, berspora oval yang letaknya sental, kadang-kadang berkapsul.

2

Struktur Antigen Bahan simpai B anthracis, yang terdiri atas polipeptida berbobot molekul tinggi yang mengandung asam D-glutamat, adalah suatu hapten. Badan bakteri mengandung protein dan suatu polisakarida somatic, keduanya bersifat antigenik.

Patogenesis Antraks terutama merupakan penyakit pada biri-biri, sapi, kuda, dan hewan lainnya; manusia jarang terserang. Infeksi biasanya didapat dengan masuknya spora melalui luka pada kulit atau selaput lendir, jarang dengan inhalasi spora ke dalam paru-paru. Pada hewan, pintu masuknya adalah mulut dan saluran pencernaan. Spora dari tanah yang tercemar mudah masuk bila termakan bersama tumbuhan berduri atau yang merangsang. Pada manusia, goresan pada kulit atau inhalasi menyebabkan timbulnya infeksi. Spora tumbuh pada jaringan di tempat masuk, dan pertumbuhan organisme vegetative mengakibatkan pembentukkan edema gelatinosa dan kongesti. Basil menyebar melalui getah bening ke dalam aliran darah, bakteri berkembang biak dengan bebas dalam darah dan jaringan segera sebelum dan setelah kematian hewan. Dalam plasma hewan yang mati karena antraks, telah ditemukan suatu faktor toksik. Bila diinokulasikan, zat ini mematikan mencit atau marmot dan secara spesifik dinetralisasi oleh antiserum antraks. Eksudat antraks mengandung polipeptida yang identik dengan polipeptida pada

simpai Bacillus, dan dapat menimbulkan reaksi histologik yang sama seperti reaksi akibat infeksi antraks. Protein lain yang diisolasi dari eksudat merangsang kekebalan yang kuat terhadap antraks bila disutikkan pada hewan. Dari filtrat (“toksin antraks”), telah dipisahkan tiga zat dengan filtrasi gelas dan kromatrografi: (1) antigen proktektif, (2) faktor edema, dan (3) faktor letal. Campuran dari (1), (2), dan (3) lebih toksik pada hewan, dan campuran seperti ini lebih imunogenik daripada masing-masing zat sendirisendiri. Pembentukan toksik berada di bawah pengaruh suatu plasmid; bila plasmid ini hilang, toksik tidak diproduksi. Tipe antraks yang lain adalah antraks pernapasan (“penyakit tukang sortir wool”). Spora atraks yang terhirup dari debu wool, bulu atau kulit mengakibatkan berkembangnya spora dalam paru-paru atau dalam kelenjar getah bening trakebronkial dan menimbulkan mediastinitis hemoragik, pneumonia, meningitis, dan sepsis yang biasa cepat menimbulkan kematian jumlah organisme dalam darah melebihi 10⁷/ mL.

3

B. muntah dan diare berdarah jarang merupakan tanda-tanda klinik. C. lalu infeksi dapat menyebar. Simpai tetap utuh. Hewan sering terkena antraks dengan memakan sporanya dan organisme menyebar lewat saluran usus. Bahan: Cairan atau nanah dari lesi lokal. 4 . kemudian pustula. organisme berkembang biak di tempat masuk. Pneumonia hemoragik dengan syok merupakan gejala yang terakhir. meningitis atau edema paru-paru hemoragik.Patologi Pada hewan yang peka. organisme kemudian dengan cepat menyebar dan mencapai aliran darah. Pewarnaan Sediaan: Dari lesi lokal atau darah hewan yang mati. antraks menimbulkan infeksi kulit (pustula ganas). Organisme tetap terlokalisasi. Karena itu. Simpai lambat laun mengalami disintegrasi dan menghilang. dan akhirnya menjadi ulkus nekrotik. menimbulkan septikemia. Biakan antraks virulen mematikan mencit atau marmot bila disutikkan secara intraperitoneal. Biakan: Bila dibiakkan pada lempeng agar darah. sedangkan organisme tidak patogen yang sejenis (misal B cereus) menunjukkan pergerakkan dengan “menyebar”. Papula ini dengan cepat berubah menjadi visikel. Pada perbenihan setengah padat. Tes Diagnostik Laboratorium A. gejala dini dapat berupa mediastinitis. Mula-mula timbul popula dalam 12-36 jam setelah masuknya organisme atau spora melalui goresan. Pada antraks pernapasan. dan organisme dikelilingi oleh sejumlah besar cairan seperti protein yang mengandung sedikit leukosit. sepsis. Peragian karbohidrat tidak bermanfaat. sakit perut. darah. organisme ini membentuk koloni kelabu nonhemolitik dengan morfologi mikroskopis yang khas. Antraks dapat diidentifikasi pada sediaan kering dengan teknik pewarnaan imunofluoresensi. basil antraks selalu tidak bergerak. tetapi pada manusia hal ini jarang terjadi. Gambaran Klinik Pada manusia. Pada hewan yang resisten. organisme berkembang biak selama beberapa jam. rantai bakteri terbentuk batang besar Gram-positif sering terlihat. setelah itu terkumpul sejumlah besar leukosit. dahak.

atau dengan antigen proktektif dan filtrate biakan. Spora-spora ini dapat tetap hidup selama puluhan tahun. Polilisin sintetik mempunyai daya kerja yang mirip. Tes Serologi: Antibodi penyebab presipitasi atau hemaglutinasi dapat diperlihatkan dalam serum orang atau hewan yang telah divaksinasi atau terinfeksi. sedangkan yang lain (tikus) sangat resisten terhadap infeksi antraks. tetapi pengobatan harus dimulai sedini mungkin. Kekebalan aktif terhadap antraks dapat diinduksi pada hewan yang peka oleh vaksinasi dengan basil hidup yang telah dilemahkan. Imunisasi antraks didasarkan pada percobaan klasik Louis Pasteur. Polipeptida tertentu yang mematikan hasil antraks telah diisolasi dari jaringan hewan. selanjutnya hewan-hewan ini terbukti kebal. suhu badan.5 pada suhu yang cocok. Tindakan pengendalian meliputi (1) pembuangan bangkai hewan dengan membakar atau 5 . yang pada tahun 1881 membuktikkan bahwa biakan yang telah tumbuh dalam kaldu pada 42-52°C selama beberapa bulan akan kehilangan sebagian besar virulensinya dan dapat disuntikkan hidup-hidup pada biri-biri dan sapi tanpa menyebabkan penyakit. eritromisin. kecuali pada pengobatan antraks pernapasan. Hewan merumput yang terinfeksi melalui luka pada selaput lendir menjadi penyambung rantai infeksi terus-menerus. Kotak dengan hewan yang terinfeksi atau dengan kulit. dengan suspensi spora. Resistensi dan Kekebalan Beberapa hewan (marmot) sangat peka. dimana mortilitas tetap tinggi. Tetrasiklin. Kenyataan ini diperkirakan akibat sejumlah mekanisme pertahanan: aktivitas leukosit. dan daya bakterisidal darah. rambut dan bulunya merupakan sumber infeksi pada manusia. Beberapa basil Gram-positif lainnya mungkin resisten terhadap penisilin karena membentuk-β-laktamase. Penisilin cukup memuaskan. Mungkin spora dapat tumbuh dalam tanah pada pH 6. Terdapat banyak variasi mengenai kemanjuran berbagai vaksin. Pengobatan Banyak antibiotika efektif terhadap antraks pada manusia.D. Epidemiologi. Pencegahan dan Pengendalian Tanah tercemar oleh spora antraks dari bangkai hewan. Serum imun kadang-kadang disuntikkan bersama dengan basil hidup pada hewan. atau klidamisin mungkin efektif.

endoftalmitis dan panoftalmitis (khasnya bakteri masuk ke dalam mata melalui benda asing yang berkaitan dengan trauma). Dalam pertumbuhan Bacillus cereus menghasilkan toksin selama pertumbuhan atau selama sporulasi. (2) dekontaminasi produk-produk hewan (biasanya dengan autoklaf). sedangkan B. Tidak membentuk kapsul. Morfologi Bacillus cereus merupakan salah satu anggota genus Bacillus yang pertama kali diisolasi pada tahun 1969 dari darah dan cairan pleura pasien pneumonia. aktivitas hemolisis (B cereus memiliki sifat ini. sentral atau parasentral. (3) baju dan sarung tangan pelindung waktu mengenai bahan-bahan yang mungkin tercemar dan (4) imunisasi aktif hewan peliharaan dengan vaksin hidup yang dilemahkan. GA 30333. Bacillus cereus memiliki beberapa karakter morfologi diantaranya: Gram positif dengan lebar sel 0. motilitas positif. anthracis bersifat non-hemolitik). Bentuk koloni irregular. spora elipsoidal. Bacillus cereus Dapat menyebabkan keracuann makanan dan juga menyebabkan pneumonia. namun tetap dapat dibedakan berdasarkan determinasi motilitas (kebanyakan Bacillus cereus bersifat motil) dan adanya kristal toxin (hanya dihasilkan oleh B. kejang otot perut. 2. thuringiensis). opague terkadang waxy. Enterotoksin Bacillus cereus memiliki karakter yang mirip dengan Bacillus thuringiensis dan Bacillus anthracis. spora jarang keluar dari sporangia.2 µm dan panjang 3 – 5 µm. Orang yang mempunyai resiko besar karena pekerjaanya harus diimunisasi dengan vaksin bebas-sel yang dapat diperoleh dari Centers for Disease Control.9 – 1. biasanya muncul dalam bentuk rantai panjang tipe R. Atlanta. Bacillus cereus menghasilkan beberapa enterotoksin dapat dalam makanan atau dibentuk dalam usus penyebab penting dari infeksi mata. 6 . Pada medium cair membentuk turbiditas moderate .mengubur pada sumur yang dalam disertai kapur. Enterotoksin penyebab muntah berkaitan pada nasi panas tercemar (emetic type) dengan gejala mual. bronkopneumonia dan luka. keratitis berat. Enterotoksin penyebab diare bersifat keracunan lewat makan (diarrheal type).

Spesies ini diketahui bersifat antagonistik terhadap Fusarium roseum var sambucinum yang merupakan agen penyebab Potato Dry Root dengan menggunakan medium uji potato dextrose agar. Bacillus cereus memproduksi Mycocercin yang merupakan antibiotik peptida yang efektif terhadap beberapa jenis yeast maupun mold dengan rentang minimal inhibitory concentration antara 19. 7 . Bacillus pumilus (contoh: Pumilin) dan Bacillus subtilis (Difficidin. Bacillus cereus merupakan salah satu anggota genus Bacillus yang memiliki potensi antibiotik. Karena kebanyakan strain Bacillus cereus hidup dalam gastro-intestinal dan menyebabkan infeksi diarrhoeal. Bacillus cereus memproduksi Biocercin yang efektif menghambat Staphylococcus aureus dan Staphylococcus albus dengan menggunakan protease pepton agar sebagai medium uji. namun beberapa diantaranya yang bersifat saprofitik dapat bermanfaat sebagai probiotik dan juga penghasil antibiotik yang potensial. Bacillus polymyxa (Polymixin. Bacillus cereus BMG 366-UF5 melalui fermentasi dengan menggunakan spora sebagai inokulum awal. maka temperatur 37oC merupakan temperatur pertumbuhan yang optimal. Bacillus laterosporus (contoh: Laterosporin). Bacillus cereus merupakan mikroorganisme yang dapat tumbuh pada kisaran temperatur yang luas dan terdapat strain yang tergolong psychrophilic hingga thermophilic. Bacillus cereus kebanyakan ditemukan terkandung dalam bahan pangan dan menyebabkan 2 tipe keracunan makanan: 1) emetic yang merupakan keracunan yang dimediasi oleh toksin yang sangat stabil yang dapat bertahan pada temperatur tinggi.Beberapa strain dari Bacillus cereus bersifat patogen dan berbahaya bagi manusia karena dapat menyebabkan foodborne illness. Subtilin. Bacillus circulans (contoh: Circulin) .5 – 78 mikrogram/mL. Antibiotika Beberapa species utama genus Bacillus yang dapat memproduksi peptida antibiotik diantaranya: Bacillus brevis (contoh: Gramicidin. Bacillus licheniformis (contoh: Bacitracin). dapat memproduksi Prumycin yang merupakan antibiotik yang juga diproduksi oleh Streptomyces kagawaensis dengan aktivitas yang tidak jauh berbeda. pH ekstrim serta tahan terhadap enzim pencernaan seperti: trypsin. Cerexin B merupakan antibiotik yang efektif terhadap bakteri gram positif yang diproduksi oleh Bacillus cereus Gp-3 dan merupakan antibiotik amphoteric acylpeptide. Tyrothricin). Mycobacillin). Zwitermicin). 2) diarrhoeal yang dimediasi oleh enterotoksin yang labil terhadap panas dan asam. Bacillus cereus (Cerexin. Colistin). pepsin.

Keberadaan B. 8 . cereus dalam jumlah besar (lebih dari 10 6 organisme/g) dalam makanan merupakan indikasi adanya pertumbuhan dan pembelahan sel bakteri secara aktif. Gejala-gejala keracunan makanan tipe diare karena B. dan berpotensi membahayakan kesehatan. kram perut. cereus . Gejala-gejala Penyakit Keracunan makanan karena B. cereus merupakan penamaan secara umum.UW 119 dan UW 120. Gejala-gejala keracunan makanan tipe ini mirip dengan gejala keracunan makanan yang disebabkan oleh Staphylococcus aureus . beberapa fungi (seperti: oomycetes) dan protista (contohnya: alga). Organisme-organisme ini menghasilkan racun yang sangat tahan panas yang mungkin mirip dengan racun penyebab muntah yang diproduksi oleh B. Beberapa strain B. UW 89. UW 32.Zwittermicin A merupakan salah satu antibiotik golongan aminopolylol yang diketahui efektif dalam menghambat beberapa patogen yang menyerang tanaman dengan spektrum luas meliputi bakteri (baik gram positif maupun gram negatif). gejala-gejala ini tetap berlangsung selama 24 jam. juga memproduksi Kanosamin yang merupakan antibiotik dengan spektrum luas. walaupun ada dua tipe penyakit yang disebabkan oleh dua metabolit yang berbeda. Rasa mual mungkin menyertai diare. UW 56. Pada sebagian besar kasus. UW 78. Keracunan makanan tipe emetik ditandai dengan mual dan muntah dalam waktu 0. sementara penyakit dengan gejala muntah (tipe emetik) diyakini disebabkan oleh peptida tahan panas dengan berat molekul rendah. Diare berair. UW 52. Zwittermicin A diketahui diproduksi oleh beberapa strain Bacillus cereus diantaranya: Bacillus cereus UW 11. UW 64. Umumnya gejala terjadi selama kurang dari 24 jam.5 sampai 6 jam setelah mengkonsumsi makanan yang terkontaminasi. Beberapa strain tersebut selain memproduksi Zwittermycin A. UW 96. cereus mirip dengan gejala keracunan makanan yang disebabkan oleh Clostridium perfringens . Penyakit dengan gejala diare (tipe diare) disebabkan oleh protein dengan berat molekul besar. tetapi jarang terjadi muntah (emesis). dan rasa sakit mulai terjadi 6-15 jam setelah konsumsi makanan yang terkontaminasi. licheniformis telah diisolasi dari kambing dan ayam yang dicurigai menjadi penyebab kasus keracunan makanan. subtilis dan B. Kadang-kadang kram perut dan/atau diare dapat juga terjadi.

3. Dapat tumbuh pada anaerobic agar dan nutrien broth dan penambahan NaCl 7%. Memasak suhu kurang dari atau sama dengan 100 ° C (212 ° F) memungkinkan beberapa spora Bacillus cereus untuk bertahan hidup.5–9. antara 20 – 30 menit.Diagnosis Bacillus cereus dipastikan sebagai penyebab suatu kasus keracunan makanan. Terjadi karena kelangsungan hidup endospora bakteri ketika makanan tidak benar matang. Patogenesis Bacillus cereus bertanggung jawab untuk sebagian kecil penyakit bawaan makanan (2-5%). nutritive agar serta nutritive agar dengan 7 – 10 % darah domba. menyebabkan mual muntah. waktu yang cepat munculnya gejala segera setelah infeksi. yang memungkinkan endospores untuk berkecambah. apabila (1) hasil isolasi Bacillus cereus menunjukkan bahwa strain-strain dari serotip yang sama ditemukan pada makanan yang dicurigai dan dari kotoran atau muntahan pasien. kotoran. resisten terhadap pH 4. Dalam medium GA. meskipun beberapa strain psychrotrophic hasil pertumbuhan bakteri dalam produksi 9 . Perkecambahan dan pertumbuhan umumnya terjadi antara 10-50 ° C (50-122 ° F). parah dan diare penyakit bawaan makanan Bacillus. Bacillus cereus telah mencapai fase eksponensial pada 6 jam inkubasi dan mencapai fase stasioner 20 jam setelah inkubasi. atau muntahan pasien menunjukkan adanya sejumlah besar Bacillus cereus dari serotip yang dikenal sebagai penyebab keracunan makanan. atau (2) hasil isolasi bakteri dari makanan yang dicurigai. Makanan dimasak tidak dimaksudkan untuk dipakai sendiri atau pendinginan yang cepat dan pendinginan harus disimpan pada suhu di atas 60 ° C (140 ° F). Waktu generasi relatif singkat. atau (3) dengan cara mengisolasi Bacillus cereus dari makanan yang dicurigai dan menentukan kemampuannya dalam menghasilkan enterotoxin ( enterotoxigenicity ) dengan uji serologis (untuk toxin penyebab diare) atau uji biologis (untuk tipe diare dan emetik). didukung dengan beberapa bukti pada makanan. seringkali sudah cukup untuk mendiagnosis keracunan makanan tipe ini.40 oC. Tes Diagnostik Laboratorium Bacillus cereus non pathogen menunjukkan pergerakan dengan penyebaran (swarming) pada media kultur seengah padat. Sel vegetatif dari Bacillus cereus dapat tumbuh pada rentang temperatur 5– 50 oC dengan temperatur optimal antara 35 . Pada tipe emetik. Masalah ini diperparah ketika makanan itu tidak benar didinginkan.

pastry (sejenis kue). 1982). Spora dari jenis bakteri ini tahan terhadap panas dan kondisi lingkungan yang tidak menguntungkan dan mampu membentuk kecambah dalam larutan yang mengandung NaOH dan HCL. pasta. sayuran. bersifat aerobik. dan ikan. dan salad sering dicurigai sebagai penyebab dalam kasus-kasus keracunan makanan. dan disimpan dengan benar umumnya aman dari racun yang menyebabkan muntah. Penyimpanan dengan benar (di bawah 7°C dan hanya untuk beberapa hari) akan mencegah pertumbuhan mikroorganisme dan produksi racun. sup. makanan yang dimasak. salah satunya sangat tahan terhadap panas dan pH antara 2 dan 11. makanan bertepung lainnya seperti kentang. dan keju juga dapat menjadi penyebabnya. termasuk daging. Kasus-kasus tipe emetik umumnya berkaitan dengan makanan dari beras. Namun demikian. et al. pudding. yakni apabila makanan yang sudah dimasak bersentuhan dengan bahan mentah atau peralatan yang terkontaminasi (misalnya alas pemotong). dan mampu membentuk spora yang dapat ditemukan di tanah. Untuk bakteri Bacillus cereus sendiri merupakan bakteri gram positif. diare dan muntah (muntah) sindrom . Epidemiologi Bacillus sp termasuk kedalam family Bacillaceae.. pada sayuran maupun produk pangan (Tay. yang disimpan dengan cara yang tidak benar (misalnya nasi. pasta). berkaitan dengan penyebab keracunan makanan tipe diare. 10 . Campuran makanan seperti saus. Tipe emetik umumnya berkaitan dengan makanan yang mengandung tepung. dipanaskan. Resiko paling besar yaitu kontaminasi silang. konsumsi menyebabkan dua jenis penyakit. casserole (sejenis makanan yang dimasak dalam wadah tertutup di atas api kecil). Makanan yang Terkait Berbagai jenis makanan.. susu. Walaupun demikian. Pencegahan Pencegahan secara total mungkin tidak dapat dilakukan. Populasi Rentan Semua orang diyakini rentan terhadap keracunan makanan oleh Bacillus cereus.enterotoksin.

Biasanya bentuk rantai atau terpisah.dan Iga keluarnya. Kemudian nama Bacillus subtilis dikenalkan oleh Ferdinand Cohn pada 1872. Morfologi Bacillus subtilis termasuk jenis Bacillus. infeksi mata dan lain-lainnya. Sporanya dapat tahan terhadap panas tinggi yang sering digunakan pada makanan dan bertanggung jawab terhadap kerusakan pada roti. Bacillus subtilis diklasifikasikan sebagai obligat anaerob walau penelitian sekarang tidak benar. Bacillus subtilis menghasilkan enzim proteolytic yang subtilisin. Tidak seperti species lain seperti sejarah. Bacillus subtilis spores dapat hidup yang ekstrim pemanasan yang sering digunakan 11 . Toksik Bacillus subtilis tidak dianggap sebagai manusia pathogen. endokarditis. IgG . Sebagian motil dan adapula yang non motil. dapat mencemari makanan tetapi jarang menyebabkan keracunan makanan. tetapi ditolak popularitasnya setelah pengenalan konsumen antibiotik murah walaupun kurang menyebabkan reaksi alergi kesempatan yang cukup rendah dan racun normal flora usus. Semua membentuk endospora yang berbentuk bulat dan oval. katalase positif yang umum ditemukan di tanah. Bakteri ini dipasarkan di seluruh Amerika dan Eropa dari 1946 sebagai immunostimulatory bantuan dalam usus dan perawatan dari penyakit urinary tract seperti Rotavirus dan Shigella. Bacillus subtilis merupakan jenis kelompok bakteri termofilik yang dapat tumbuh pada kisaran suhu 45 °C – 55 °C dan mempunyai pertumbuhan suhu optimum pada suhu 60 °C – 80 °. Bacillus subtilis tidak dianggap sebagai patogen walaupun kontaminasi makanan tetapi jarang menyebabkan keracunan makanan. Bakteri ini termasuk bakteri gram positif. Bacillus subtilis telah digunakan sepanjang 1950 sebagai alternatif dari obat karena efek immunostimulatory sel dari masalah. Bacillus subtilis selnya berbentuk basil. Bacillus subtilis Dapat menyebabkan meningitis. yang pada pencernaan telah ditemukan secara signifikan untuk kekebalan aktivasi antibodi spesifik GM. Bacillus subtilis mempunyai kemampuan untuk membentuk endospora yang protektif yang memberi kemampuan bakteri tersebut mentolerir keadaan yang ekstrim. Bacilus Subtilis ini awalnya bernama Vibro subtilis oleh Christian Gottfried Ehrenberg pada tahun 1835. Bacillus subtilis produces the proteolytic enzyme subtilisin . ada yang tebal dan yang tipis.3.

pBE2C1AB digunakan dalam produksi polyhydroxyalkanoates (PHA) dan agar mereka dapat menggunakan gandum terendam air limbah sebagai sumber karbon untuk menurunkan biaya produksi PHA. asam. Bacillus subtilis terbukti untuk manipulasi genetik. yang memberikan B. memproduksi sebuah endospore yang tahan terhadap faktor lingkungan seperti panas. dan bertanggung jawab untuk menyebabkan kekentalan yang lengket. Keguanaan lain bakteri ini cukup banyak sekarang dangan berkembangnya teknologi. Sebelum proses untuk menghasilkan spora bakteri melalui proses produksi flagella dan mengambil DNA dari lingkungan. recombinants Bacillus subtilis str. dan garam. yang merupakan contoh sederhana dari diferensiasi selular.untuk memasak makanan. populer di seluruh dunia sebelum pengenalan konsumen antibiotik immunostimulatory sebagai agen untuk membantu perawatan gastrointestinal dan penyakit urinary tract. Hal ini masih banyak digunakan di Eropa Barat dan Timur Tengah sebagai alternatif obat. dan bekerja sebagai agen kontrol biologi. pBE2C1 dan Bacillus subtilis str. memungkinkan organisme untuk terus berada di dalam lingkungan sampai kondisi menjadi baik. subtilis kemampuan untuk bergerak sangat cepat. karena itu telah menjadi banyak diadopsi sebagai model organisme untuk penelitian laboratorium. yang dapat berada di dalam lingkungan dalam jangka waktu yang lama. dapat dikonversi menjadi peledak berbahaya compounds dari nitrogen. membenang konsistensi yang disebabkan oleh bakteri produksi panjang rantai polysaccharides dan manja dalam adonan roti. karbon dioksida. dan air. Bacillus subtilis dapat membagi asymmetrically. Endospore adalah yang dibentuk pada saat gizi stres. Bacillus subtilis strain QST 713 (dipasarkan sebagai QST 713 atau serenade) memiliki alam berhubung dgn fungisida aktivitas. 12 . terutama dari sporulation. Hal ini juga sangat flagellated.

Ose dibakar sampai steril. dipulaskan di salah sisi/ tepi media jangan menyentuh dinding petridish c. dengan salah satu sisinya d. Untuk melakukan penanaman bakteri (inokulasi) terlebih dahulu diusahakan agar semua alat yang ada dalam hubungannya dengan medium agar tetap steril. Dengan ose yang sudah steril diambil sampel atau bakteri culture. Ose dibalik dengan melanjutkan goresan-goresan sejajar pertama. Goresan sejajar : (isolasi) a. yaitu: A.BAB II IDENTIFIKASI 2. hal ini agar menghindari terjadi kontaminasi. dimana dikenal beberpa cara penanaman bakteri. Ose dibakar sampai steril.1 Metode Penanaman Bakteri Penanaman bakteri atau biasa disebut juga inokulasi adalah pekerjaan memindahkan bakteri dari medium yang lama ke medium yang baru dengan tingkat ketelitian yang sangat tinggi. setelah medianya diputar 90°C 13 . pulasan itu digores-goreskan sejajar sampai memenuhi permukaan media. dinginkan b. Berdasarkan wujud atau bentuk media dan sifat media. Dengan ose steril yang lain. suspensi sampel) Cara penanaman: 1. Penanaman pada media padat bentuk plate Tujuan: Untuk mengisolasi/ memisahkan pertumbuhan bakteri satu dengan lainnya (yang ditanam specimen) Untuk memperbanyak bakteri (yang ditanam culture bakteri atau koloni bakteri) Untuk menghitung jumlah kuman (yang ditanam. dinginkan b. 2. pulasan itu digores-goreskan sejajar pada salah satu tepi media. dipulaskan di salah sisi/ tepi media jangan menyentuh dinding petridish c. Dengan ose yang sudah steril diambil sampel atau bakteri cultur. Goresan sejajar melingkar : (isolasi) a. Dengan ose steril yang lain.

kasar (rough). Media diputar 90°C. masuk incubator 37°C 48 jam Catatan: Media yang digunakan tergantung dari jenis bakteri yang dihitung. anhaemolytis dan sebagainya. digoreskan sejajar lagi setelah medianya diputar 90°C f. menjalar. Dengan menggunakan spatel yang terbuat dari kaca/kawat. kuning. sebanyak sampai menutupi semua permukaan dasar petridish c. cekung. Ukuran 2. bergelombang. haemolytis. hijau. Suspensi sampel. tetesan itu diratakan pada seluh permukaan media plate. dengan tujuan “memperbanyak”. sampel cair atau cultur bakteri di dalam media cair diambil dengan pipet steril sebanyak 0. Warna 3. Cara taburan : (isolasi dan memperbanyak) a. Bentuk 4. melekat pada perbenihan. Cara penuangan : (penghitungan) a. Campur baik-baik. rhizoid dan sebagainya : datar. Permukaan 5. Suspensi sampel/ sampel cair diteteskan ke dalam petridish steril ssebanyak 0. Dituangi media padat steril yang dicairkan. cembung. serabut. kering.1 atau 1 ml secara steril b. sampai memenuhi permukaan media plate. Dibalik. merah dan sebagainya : bulat. Dengan ose yang dimiringkan goresan-goresan sejajar kedua. berlendir. tunggu sampai agar-agarnya membeku d. 3. goresan-goresan sejajar yang ketiga digoreskan sejajar lagi dengan ose yang sudah dibalik.e. hitam. yang sudah steril dan dingin.1 ml diteteskan di permukaan media plate tepat ditengah-tengahnya b. Koloni bakteri yang tumbuh pada media padat bentuk plate. jernih. Sifatnya : diukur berapa diameternya dengan satuan mm : putih. Pembacaan: Pertumbuhan bakteri pada media padat disebut “koloni” yaitu kelompokankelompokan bakteri yang tumbuh pada media tersebut Koloni bakteri pada media padat dengan tujuan isolasi dapat dibedakan berdasarkan criteria sebagai berikut: 1. halus (smooth) : keruh. yang penting diperhatikan selain adanya pertumbuhan koloni juga kemurniaan koloni itu 14 . 4.

mulut tabung dibakar dengan nyala api tidak berjelaga c.- Koloni bakteri yang tumbuh pada media padat bentuk plate. Ose dibakar lagi sampai steril Contoh: Media nutrient agar 2. criteria koloni tidak perlu diperhatikan. dengan tujuan “penghitungan”. Ose yang sudah berisi koloni bakteri digoreskan zig-zag pada permukaan media. Tutup tabung media dibuka dengan menjepit menggunakan jari kelingking kanan. diambil koloni bakteri b. kemudian dibaca perubahanperubahan yang terjadi pada media dengan atau tanpa penambahan reagensia. Penanaman pada media semisolid di dalam tabung Tujuan: Untuk identifikasi bakteri Untuk menyimpan bakteri 15 . B. C. Penanaman pada media padat di dalam tabung bentuk miring Tujuan: Untuk memperbanyak bakteri Untuk identifikasi Untuk menyimpan bakteri Cara penanaman: 1. tetapi tinggal dihitung saja. Dengan ose yang sudah steril dan dingin. Goresan zig-zag dan ditusuk: Pelaksanaan penanamannya seperti nomor 1 dengan perbedaan sebagai berikut: Urutan c setelah digoreskan zig-zag kemudian ditusukkan ditengah-tengahnya 1 sampai 2 kali. Goresan zig-zag: a. Mulut tabung dibakar lagi. betul-betul ditengah media tidak terlalu kebawah/ keatas dan juga tidak terlalu kekiri/ kekanan d. Contoh: Media TSIA Pembacaan: Koloni yang tumbuh diperhatikan kemurniannya. segera ditutup dengan tutupnya e.

Setelah tabung diletakkan pada raknya (ditegakkan). dinginkan b. Ose bekas pakai juga dibakar sampai steril f. Mulut tabung dibakar sebentar. Tutup tabung dibuka dengan menggunakan jari kelingking kanan d. kemudian dibaca perubahanperubahan yang terjadi pada media itu (warna. Ose dibakar sampai steril. tutup kembali. disamping kekeruhan dapat juga diikuti perubahan warna indikatornya yang merupakan pertanda adanya perubahan/ pemecahan gula/bahan kimia yang terkandung dalam itu. dan sebagainya) dengan atau tanpa penambahan reagensia. Begitu pula osenya dibakar/ disteril kembali. ose yang sudah ada koloni bakterinya ditusukkan tegak lurus di permukaan bagian tengah sampai dasar tabung e. Ose jarum penanam steril. Ose yang sudah berisi koloni bakteri digores-goreskan pada dinding tabung bagian dalam sebelah atas yang tadinya tertutup oleh cairan media e. Penanaman pada media cair Tujuan: Untuk memperbanyak cultur bakteri Untuk melihat gerak bakteri Untuk identifikasi Cara penanaman: a. 16 . Mulut tabung dibakar lagi dan ditutup kembali. diambil koloni bakteri c. medianya menjadi keruh. goresan bakteri akan terendam cairan media. mulutnya dibakar d. dinginkan b. Apabila bakterinya ditanam didalam media yang untuk identifikasi. D. Dengan ose itu diambil koloni bakteri c. gerak. Pembacaan: Koloni yang tumbuh diperhatikan kemurniannya dahulu. Tutup tabung media dibuka.Cara penanaman: a. Kalau tidak tumbuh medianya tetap jernih. Mulut tabung dibakar. Pembacaan: Kalau bakteri yang ditanam dapat tumbuh didalam media cair itu. Dengan ose yang sudah steril dan dingin.

yaitu: 1. Menentukan apakah jenis mikroorganisme berbahaya berpengaruh pada kesehatan Adapun prinsip identifikasi.3 Isolasi dan Identifikasi Bacillus A.2. Menentukan uji kepekaan terhadap antibiotika 4.2 Identifikasi Bakteri Tujuan identifikasi bakteri. Menentukan arti penting pengobatan 2. Alat Jarum ose Object glass Mikroskop Mikrometer Kertas merang Tabung reaksi Pipet tetes Beaker glass Cawan petri Oven Pembakar spirtus Inkubator Wrapper B. Identifikasi mikroorganisme menggunakan kriteria Genotip: Identifikasi karakteristik bakteri menggunkan teknik molekuler untuk analisis DNA dan RNA 2. Pedoman perawatan klinis 3. Identifikasi mikroorganisme menggunakan kriteria Fenotif: Mikroskopis dengan pewarnaan Gram Isolasi : morfologi koloni dengan identifikasi Kebutuhan lingkungan untuk pertumbuhan Kepekaan terhadap antibiotika Kebutuhan nutrisi dan kemampuan metabolik 2. yaitu: 1. Bahan Aquades Alkohol 70% Alumunium foil Medium Nutrient Agar (NA) Nitrat Broth (NB) Malachite Green Sterch Agar (SA) SIMA Semisolid Skim Milk Agar (SMA) Simon Citrat 17 .

Tanah diambil secara aseptis 2. (hasil pada Hari II) Hari II : Koloni yang tersangka dari Blood agar plate dicat Gram.5%. Pengambilan Sampel 1. Sampel tanah dimasukkan ke dalam tabung pengenceran pertama 3. b. (hasil pada Hari III) Hari III : Dibaca dan dicatat pertumbuhan pada media gula dan media lainnya.- MR-VP Broth KOH-Alfanafto Reagen A dan B. Cara Kerja a. Kalau ditemukan Gram (+) batang kemudian ditanam pada media gula dan media lainnya. Metode Hari I : Spesimen ditanam pada Blood agar plate dan Mac Conkey. Alumunium foil disiapkan yang sebelumnya disterilkan terlebih dahulu dengan alkohol 70% 3. Sampel diambil dengan cepat dan dengan hati-hati dimasukkan ke dalam alumunium foil steril kemudian ditutup rapat. Tahap Isolasi Bacillus 1. Preparasi suspensi dilakukan 2. dan 10 %) Kristal Violet Lugol’s Iodine - Safranin Etanol 96% Reagen H₂O₂ Media Rafinosa Laktosa Reagen Oksidase C. NB 0% NB +NaCl (6. Sampel tanah direbus pada suhu 80oC selama 10 menit 18 . dilakukan test kimia. D. Masuk inkubator 37°C 24 jam. Masuk inkubator 37°C 24 jam.

Jarum ose dibakar. Streak ini dianggap sebagai sterak primer pada permukaan NA 4. elevasi. Diamati dibawah mikroskop 19 . diangkat lalu didinginkan melewati streak sekunder dan kemudian dilanjutkan kestreak tersier tanpa kembali kestreak primer dan sekunder diinkubasi pada suhu 30oC selama 2 x 24 jam d. Ditetesi dengan gram D (safranin). Dicuci dengan air mengalir. Ditetesi dengan gram B (lugol’s iodine). Dibuat ulasan bakteri pada object glass. Pengamatan Morfologi Koloni 1. dibiarkan selama 60 detik 5. e. dibiarkan selama 45 detik. Uji Pewarnaan Gram 1. lalu dikeringanginkan 4. dicuci dan dikeringanginkan 8. Dibuat preparat ulas bakteri uji dengan metode pewarnaan sederhana mengggunakan pewarna Methylen Blue 3. Diinkubasi 2 x 24 jam pada suhu 30oC 3. Diukur panjang dan lebar sel. Dicuci dengan air mengalir. Diamati perbedaan bentuk koloni. ukuran. margin. setelah dingin disentuhkan ke permukaan koloni bakteri yang akan disteak pada plating NA 3. Dibuat biakan pada media Nutrient Agar (NA) cawan 2. Ditetesi dengan gram A (Kristal violet).c. Dipilih satu koloni yang nampak terdiri dari satu tipe sel 2. Jarum ose dibakar. Disiapkan mikroskop yang telah dipasang mikrometer okuler yang sudah terkalibrasi 2. Jarum ose dibakar. dan permukaan. kemudian dihitung panjang dan lebar sel sebenarnya f. dibiarkan selama 60 detik 3. Dicuci dengan gram C(ethanol 96%) setetes demi settee sampai etanol yang jatuh berwarna bening 7. kemudian difiksasi 2. Tahap Pemurnian Dengan Metode Streak Kuadran 1. lalu dikeringanginkan 6. Pengukuran Panjang Dan Lebar Sel 1. diangkat lalu didinginkan dan disteakan melewati streak primer kesatu atau kedua dan kemudian dilanjutkan kestreak sekunder tanpa kembali kestreak primer 5.

Diamati perubahan yang terjadi. dan jika tidak terbentuk warna tersebut maka menandakan hasil uji negatif 20 . 2. jika pinggir mulai mongering. ditambahkan lagi Malachite Green h. Diinkubasi selama 2 x 24 jam pada temperatur 30oC 3. Diinokulasikan bakteri uji pada medium padat Starch Agar sebanyak 1 ose. dan jika tidak terbentuk zona jernih (warna biru reagen) menandakan hasil uji negatif j. 2. Uji Motilitas 1. Bakteri ditetesi dengan alfanaftol 3 tetes dan KOH 40 % 2 tetes 4. Diinokulasikan bakteri uji pada medium cair MR-VP sebanyak 1 ose 2. Dibiarkan selama lim menit. 4. jika media berubah menjadi merah muda s. Uji VP (Voges Proskauer) 1.d merah setelah penambahan alfanaftol dan KOH 40% menandakan hasil uji positif. Ditetesi dengan Malachite Green diatas kertas merang dan diletakkan di atas air mendidih 3. jika terbentuk zona jernih di sekitar koloni menandakan hasil uji positif. dan jika warna media tetap menandakan hasil uji negatif k.g. Dilihat pertumbuhan koloni bakterinya yang ada pada amedium SIMA semisolid i. Diinokulasikan bakteri uji pada medium SIMA semisolid sebanyak 1 ose 2. Uji Pewarnaan Endospora 1. Diinkubasi selama 2 x 24 jam pada temperature 30oC 3. Diamati perubahan yang terjadi. Dibuat ulasan bakteri pada object glass lalu ditutupi dengan kertas merang 2. Permukaan media ditetesi dengan larutan Lugol’s Iodine. Diinkubasi selama 2 x 24 jam pada temperatur 30oC 3. Diamati perubahan yang terjadi. Uji Hidolisis kasein 1. jika terbentuk zona jernih di sekitar koloni menandakan hasil uji positif. Uji Hidrolisis Starch 1. Diinokulasikan bakteri uji pada medium padat SMA sebanyak 1 ose. Diinkubasi selama 2 x 24 jam pada temperatur 30oC 3.

Diinkubasi selama 2 x 24 jam pada temperatur 30oC 3. hasil positif jika media berubah warna dari ungu menjadi kuning dan hasil negatif jika media tetap berwarna ungu. jika hasil positif media berwarna biru sedangkan hasil negatif tetap berwarna hijau. Uji Penggunaan Sitrat 1. Bakteri uji ditumbuhkan pada medium Rafinosa dan Laktosa 2. Uji Oksidase 1. Diinkubasi selama 2 x 24 jam pada temperatur 30oC 3. Diinokulasikan bakteri uji pada medium agar miring Simon’s Citrate sebanyak 1 ose 2. Uji Reduksi Nitrat 1. tutup dengan potongan tissue 2. Diamati perubhan yang tejadi. Ditetesi dengan reagen oksidase 3. Jika terbentuk gelembung gas menunjukka bahwa hasil uji positif dan sebaliknya m. hasil uji negatif yaitu tidak terbentuk warna biru marun n. Hasil positif jika berwarna biru marun. Dibuat preparat ulas bakteri pada objek glass. Diteteskan 1 ml nitrat reagen A dan dilanjutkan dengan nitrate reagen B 4. Hasil positif jika terbentuk warna merah tua/ merah gelap.l. Diamati perubahannya. Uji Katalase 1. Dibuat preparat ulas bakteri pada objek glass 2. Diinkubasi selama 2 x 24 jam pada temperatur 30oC 3. ditambahkan bubuk seng (sampai dengan 5 mg/ml media) dan diamati jika terbentuk warna merah maka hasi pengujian positif 21 . Uji Gula 1. o. p. Diamati perubahan yang terjadi 4. jika belum terbentuk warna merah. Ditetesi dengan larutan H2O2 3. Diinokulasikan bakteri uji pada medium cair Nitrate Broth sebanyak 1 ose 2. Diamati perubahan yang terjadi 4.

Ditentukan persen homologinya dengan rumus % Homologi = Jumlah karakter yang sama x 100% Jumlah karakter yang diujikan E. 6. 3. 4. 7. Pengamatan Morfologi Sel No 1. Pengamatan Bentuk koloni Ukuran Elevasi Margin Permukaan Circular Moderate Convex Entire Halus mengkilap Hasil Tabel 2. Isolat diinokulasikan dengan streak kontinyu 2. Data-data yang diperoleh dibandingkan dengan data karakter bakteri dari sumber 2. dan 10 % 1. Uji Toleransi NaCl Dibuat tiga buah tabung Nutrient Broth yang mengandung Nacl 0%. Penentuan Spesies Melalui Pendekatan Homologi 1. 5. Diamati hasilnya dengan melihat tingkat kekeruhan pada media r.5 %. Hasil Pengamatan dan Pembahasan a. Jenis Uji Gram Endospora Katalase Starch Casein Rafinossa NaCl 10% Isolat + + + + + + + + + + d + + d + + d + + + d 22 A + + B + + C + + D + + E + + . 2.q. 6. Hasil Tabel 1. 4. 3. 2. Perbandingan Isolat dan Spesies-spesies Bacillus No 1. Diinkubasi selama 2 x 24 jam pada temperatur 30oC 3. 5.

8. 7. 3. Spesies B. Pengukuran Homologi No 1. 5. 2. 2.8. Oksidase Tabel3. Pada Media Gula-gula No 1. Jenis Uji Gram Endospora Starch Casein Rafinossa NaCl 10% Sitrat Motilitas VP IA 1 1 1 1 1 0 0 1 1 IB 1 1 1 1 1 0 0 0 1 IC 1 1 1 1 1 0 0 0 1 ID 1 1 1 1 0 1 0 0 0 0 5 IE 1 1 1 1 0 0 0 0 1 0 5 10. 4. subtilis Glukosa Laktosa Mannitol Maltosa + + + Sukrosa + +/+ - + + + ± Tabel 4. 9. 9. 3. cereus B. VP 11. Oksidase 1 1 1 Jumlah karakter 8 7 7 yang sama % Homologi = Jumlah karakter yang sama x 100% Jumlah karakter yang diujikan = 8 x 100 % 10 Keterangan : d = 16-84% strain positif A = Bacillus anthracis B = Bacillus cereus = 80 % C = Bacillus thuringiensis D = Bacillus megaterium E = Bacillus subtilis 23 . anthracis B. 6. Sitrat Motilitas + + + d d + + d + + + d + + - + + + - 10.

24 .

amati bakteri Bacillus sp. Kemudian sampel yang mengandung bakteri tersebut dijaga agar tetap menggambarkan kondisi yang ada sebelum memasuki tahap analisa. Terbentuknya endospora bertujuan untuk melindungi bakteri dari lingkungan yang kurang menguntungkan (Sudjadi. masukkan kedalam alumunium foil yang sebelumnya disterilisasikan terlebih dahulu dengan menggunakan alkohol 70% kemudian ditutup rapat. tanah rebusan diinokulasikan kedalam cawan yang telah berisi medium NA kemudian disreak sinambung. dan margin didapatkan hasil koloni berbentuk bulat atau circular. Jika keadaan lingkungan membaik. permukaan. banyak mengandung bahan kimia. Endospora memiliki dinding yang tebal. dilakukan dengan cara sampel tanah yang telah didapat dimasukkan kedalam tabung yang berisi akuades steril kemudian direbus 10 menit dengan suhu 80°C diatas dandang. Misalnya.) membentuk endospora. Menyesuaikan wadah sampel yang diambil dan metode yang sesuai dengan jenis sampel. 2006).b. dan panas yang terlalu tinggi. Hasil pemurnian ambil koloni tunggal kemudian diamati bentuk. Dilakukan dengan prosedur kerja aseptik dengan senyawa desinfektan yang sesuai. oleh karena itu bakteri yang menghasilkan endospora dapat bertahan hidup pada lingkungan yang ekstrim. Pengambilan sampel dilakukan dengan mensterilisasikan alat terlebih dahulu agar dapat dilindungi dari kontaminasi. inkubasi selama 2x24 jam dengan suhu ruang. 2006). Pemurnian sampel dari hasil yang telah diisolasi dilakukan dengan cara pemilihan satu koloni (koloni tunggal) yang nampak terdiri dari satu tipe sel. elevasi. ukuran. maka pembungkus spora segera pecah dan bakteri kembali memulai aktivitas hidupnya sebagaimana biasanya. Pembahasan Pengambilan sampel (tanah kandang) dilakukan dengan cara sterilisasi sendok yang ingin dipakai terlebih dahulu dengan menggunakan autoklaf kemudian ambil sampel tanah kedalaman 3cm dari permukaan. lingkungan yang terlalu kering. 25 . Isolasi Bacillus sp. Contoh bakteri yang menghasilkan endospora adalah Bacillus dan Clostridium (Sudjadi. Proses perebusan dilakukan agar bakteri yang diinginkan (Bacillus sp. inokulasikan ke media NA disteak kuadran kemudian diinkubasi selama 2x24 jam dengan suhu ruang 30oC.

Uji pewarnaan gram dilakukan dengan mengulas bakteri pada object glass kemudian difiksasi selama 3-5 kali tujuan dari fiksasi adalah untuk 26 . Bacillus berbentuk bulat (coccus). elevasi convex. skala panjang dikali hasil kalibrasi yaitu 2. digunakan untuk melakukan berbagai macam uji. Selain diamati ciri-ciri morfologi koloninya hasil pemurnian juga digunakan untuk pembuatan stok di media NA miring kemudian diinkubasi selama 2x24 jam pada suhu ruang. Disebut sederhana karena hanya menggunakan satu jenis zat warna untuk mewarnai organisme tersebut. sehingga didapatkan panjang sel sebenarnya. Pengukuran panjang dan lebar sel dilakukan dengan menyiapkan mikroskop yang telah dipasang micrometer okuler yang terkalibrasi. 2006).berukuran sedang atau moderate.5 µm kemudian lebar sel sebenarnya. Pembuatan stok dilakukan dua kali. memiliki permukaan yang halus dan mengkilap.5 μm (Sudjadi. 2006). dan margin entre.0-1.5 µm. Bacillus antracis yaitu bakteri berbentuk batang berukuran panjang 1-8 μm. digunakan perbesaran sebesar 1000x dan menggunakan minyak imersi. lebar 1-1. Pewarna basa yang biasa digunakan untuk pewarnaan sederhana ialah memilen biru. Pengamatan dengan mikroskop dilakukan dengan menggunakan mikroskop jenis mikroskop cahaya. Dengan pewarnaan sederhana dapat mengetahui bentuk dan rangkaian sel-sel bakteri.5 µm. Zat-zat warna yang digunakan untuk pewarnaan sederhana umumnya bersifat alkolin. Koloni tunggal yang terbentuk diperiksa menggunakan pewarnaan Gram untuk melihat karakteristik dinding sel dan bentuk dari sel tersebut. Untuk pengamatan dinding sel bakteri. krisdal violet dan karbol fuehsin (Sudjadi.2 μm. Hasil perhitungan kalibrasi dimana skala object dibagi dengan skala okuler dikali 10 µm didapatkan hasil 2. Bacillus thuringiensis atau biasa disebut Bt berbentuk batang dengan ukuran panjang 3-5 μm dan lebar 1. Pewarnaan sederhana merupakan teknik pewarnaan yang paling banyak digunakan. permukaan halus mengkilap. dibuat preparat ulas bakteri uji dengan metode pewarnaan sederhana dengan menggunakan pewarnaan metilen blue kemudian diukur panjang dan lebar sel kemudian dihitung panjang dan lebar sel sebenarnya (µm). skala lebar dikali hasil kalibrasi yaitu didapatkan 2.

Uji pewarnaan endospora dilakukan dengan mengulas bakteri pada object glass kemudian ditutup dengan kertas merang lalu ditetesi dengan malachite green diatas kertas merang kemudian diuapkan diatas dandang. 2001). Jangan sampai mengering jika kering ditetesi lagi malachite green. namun jangan sampai terlalu banyak. nutrisi. Kemudian bilas dengan aquades lalu ditetesi dengan safranin sebagai counterstain yang digunakan untuk melumuri bagian warna dari sel yang lain daripada endospora (James. hasilnya hanya tumbuh diatas permukaan medium. Bakteri gram positif mempertahankan zat warna gentian violet dan bakteri gram negatif mempertahankan warna merah (Udin. pemberian Kristal violet bertujuan untuk memberikan warna dasar atau pewarna primer yaitu pewarnaan dinding sel bakteri. Setelah terwarnai dicuci keringanginkan kemudian dicuci dengan gram C (ethanol 96%) setetes demi setetes sampai ethanol yang jatuh berwarana bening. 2008). Kemudian ditetesi dengan gram A yaitu Kristal violet didiamkan selama 60 detik. menunjukan tidak adanya pertumbuhan koloni pada medium tegak SIMA yang telah ditusuk dengan jarum ose. Setelah itu amati dibawah mikroskop. 2008). dicuci keringanginkan kemudian diamati dibawah mikroskop didapatkan hasilkan endospora berwarna hijau sedangkan sel vegetative berwarna merah. Hasil yang didapat terlihat warna ungu muda. 2001). Uji mortilitas bakteri yang diinokulasikan pada medium SIMA semisolid sebanyak 1 ose kemudian diinkubasi selama 2x24 jam pada suhu ruang 30oC.mematikan sel bakteri tanpa merubah bentuk dan strukturnya. pemberian malachite green bertujuan untuk melumuri fiksasi panas. dan sifat 27 . Berfungsi untuk melarutkan pewarna (decolorizing agent) kemudian ditetesi dengan gram D (safranin) dibiarkan 45 detik lalu cuci keringanginkan. Banyaknya koloni bakteri yang tumbuh pada suatu substrat sangat dipengaruhi oleh tersedianya kondisi fisik. Didiamkan selama 45 detik. Pemanasan bertujuan untuk membantu warna menembus dinding endospora. pemberian safranin digunakan sebagai pewarna pembanding (James. ditetesi lugol’s iodine dibiarkan selama 60 detik bertujuan sebagai pewarna kedua atau pewarna pengganti. membuka poripori dari sel bakteri sehingga mudah terwarnai. dan merekatkan bakteri ke object glass (Udin. Kemudian dicuci keringanginkan.

Uji VP (Voges Proskaner) menggunakan medium cair MR-VP yang telah diinokulasikan dengan 1 ose bakteri kemudian diinkubasi selama 2x24 jam pada temperature 30oC. Uji hidrolisis kasein menggunakan medium padat Skim Milk Agar (SMA) diinokulasikan bakteri sebanyak 1 ose kedalam medium tersebut kemudian diinkubasi selama 2x24 jam suhu ruang. Hasil menunjukan positif yaitu terdapatnya zona jernih pada media SMA. 2006). Starch atau pati dipecah menjadi unit-unit yang lebih kecil yaitu dengan memotong ikatan-ikatan glikosidiknya. berukuran 1.3-butanadiol. 2009). Uji ini digunakan untuk mengidentifikasi mikroorganisme yang melaksanakan fermentasi 2. Uji hidrolisis starch dengan menggunakan medium padat Starch Agar sebanyak 1 ose yang diinkubasi selama 2x24 jam dalam suhu ruang kemudian permukaan media digenangi dengan larutan Lugol’s iodine menghasilkan positif karena terbentuknya zona jernih pada media hal ini disebabkan karena enzim amilase yang bersifat eksoenzim akan memecah amilum menjadi monomer-monomernya. Bila bakteri memfermentasikan karbohidrat menjadi 2. Kaseinase akan memecah kasein menjadi parakaseinase yang dapat bereaksi dengan susu tersebut sehingga menghasilkan kalsium parakaseinat. 28 .hudupnya (Priyani. tidak mempunyai alat gerak atau motil (Akoso.6 µm. Namun ada beberapa spesies Bacillus yang tidak bersiat motil salah satunya adalah Bacillus anthracis merupakan bakteri berbentuk batang. Prinsip dari uji ini adalah menentukan kemampuan beberapa mikroorganisme untuk menghasilkan produk akhir yang netral (asetil-mythyil karbinol) dari fermentasi glukosa. Pertumbuhan dipermukaan medium ini dikarenakan Bacillus merupakan bakteri yang bersifat aerob. 2011). bakteri ditetesi dengan alfanaftol sebanyak 3 tetes dan KOH 40% 2 tetes menunjukan hasi positif karena warna media menjadi orange muda mendekati merah. Namun tidak membuktikan mortilitas. Salah satu yang dapat memotong ikatan glokosidik adalah enzim amilase (Anonim. Penambahan alfanaftol akan bereaksi dengan aseton sedangkan pemberian KOH 40% untuk mengoksidasi proses tersebut sehingga terjadi warna orange sampai merah. hal ini disebabkan pada saat menginokulasikan bakteri dengan menggunakan jarum ose.3-butanadiol sebagai produk utama. bakteri tersebut tidak masuk ke dalam media hanya tertanam dipermukaan.

Senyawa ini dihasilkan oleh mikroorganisme aerobik. ditetesi dengan reagen oksidase kemudian diamati perubahan yang terjadi. Sitokrom oksidase mengkatalisis oksidasi dan reduksi sitokrom oleh molekul oksigen. Jika tidak dihasilkan gelembung gas berarti uji katalase dinyatakan negative. Sifat kemoorganotrop dan fakultatif anaerob pada 29 . Jika dihasilkan gelembung gas. Uji katalase dilakukan dengan membuat preparat ulas bakteri pada object glass. Superoksida dismutase adalah enzim yang bertanggung jawab untuk menguraikan khususnya superoksida pada organisme aerob yang bersifat katalase negatif. karena sebagian 2. bahkan ada yang menghasilkan superoksida yang sangat beracun. mikroorganisme menghasilkan hydrogen peroksida. Enzim oksidase dihasilkan oleh bakteri aerob. dan mikroaerofilik. suatu senyawa pemuka dalam sintetis 2. fakultatif aerob maupun mikroaerofilik yang menggunakan jalur repirasi aerobik. Penambahan 40% KOH dan 5% larutan alfanaphtol dalam etanol dapat menentukan adanya asetolin (asetilmethylkarbinol). Hasil yang didapat positif karena hasil ulasan yang telah ditetesi reagen oksidase berwarna biru marun.akan terjadi penumpukan bahan tersebut dalam media pertumbuhan (Sudjadi. Perubahan warna kaldu biakan lebih jelas pada bagian yang berhubungan dengan udara. berarti bakteri tersebut mampu memproduksi enzim katalase. Produksi katalase bisa diidentifikasikan dengan menambahkan reagen H2O2 pada suspense bakteri. fakultatif anaerob. ditutup dengan potongan tissue. Senyawa ini dalam jumlah yang besar akan menyebabkan kematian pada mikroorganisme. Selama respirasi aerobik (proses fosforilasi oksidatif). Uji oksidase dilakukan dengan membuat preparat ulas bakteri pada object glass.3-butanadiol. ditetesi dengan larutan H2O2 kemudian diamati perubahan yang terjadi hasil menunjukan positif karena terbentuknya gelembung gas. 2006). Penambahan KOH adanya asetolin ditunjukan oleh perubahan warna kaldu menjadi merah muda. Perubahan warna ini diperjelas dengan penambahan larutan alfanaphtol. Enzim oksidase memegang peranan penting dalam transport electron selama respirasi aerobik.3-butanadiol dioksidasi kembali menjadi asetolin sehingga memperjelas hasil reaksi (Sudjadi. 2006).

Karena adanya proses peningkatan ph sehingga berwarna biru. 6. Sumber karbon asam sitrat akan dipecah menjadi oksalo asetat kemudian menjadi asam asetat. Tidak adanya perubahan warna mengindikasikan bahwa uji yang dilakukan negatif (James. Kemampuan bakteri memproduksi sitokrom oksidase dapat diketahui dari reaksi yang ditimbulkan setelah pemberian reagen oksidase pada koloni bakteri.5%. Uji toleransi NaCl dibuat tiga buah tabung Nutrient broth yang mengandung NaCl 0%. hasil yang didapat adalah negatif karena media tetap berwarna biru. Reagen yang digunakan adalah tetramethylD.Bacillus sp. Reagen akan mendonorkan electron terhadap enzim ini sehingga akan terosidasi membentuk senyawa yang berwarna biru kehitaman. Mikroorganisme ini menggunakan oksigen. Penentuan spesies melalui pendekatan homologi dilakukan dengan mengumpulkan data-data yang diperoleh kemudian dibandingkan dengan data karakter bakteri dari sumber. 2008). inkubasi selama 2x24 jam pada temperature 30oC kemudian diamati perubahan yang terjadi. sebagai akseptor elektron terakhir selama penguraian karbohidrat untuk menghasilkan energi. Uji penggunaan sitrat dilakukan dengan menginokulasikan bakteri uji pada medium agar miring Simon Citrate sebanyak 1 ose. Berdasarkan hasil perhitungan persen homologi. diinkubasi selama 2x24 jam pada temperature 30oC kemudian diamati hasilnya dengan melihat tingkat kekeruhan media. Positif tertunda (warna biru muncul antara 10-60 detik setelah ditetesi) menandakan bahwa bakteri uji memiliki sedikit enzim. Enzim ini merupakan bagian dari kompleks enzim yang berperan dalam proses foforilasi oksidatiif.phenylenediaminedihyrocloride. dan 10%. Hasil yang didapat tingkat kekeruhan yang paling tinggi adalah pada konsentrasi NaCl 0%. Uji lactose dan raffinosa dilakukan dengan cara bakteri uji ditumbuhkan pada medium lactosa dan raffinosa. Menyebabkan bakteri ini mampu memanfaatkan sumber karbon tersedia (Priyani. diinkubasi selama 2x24 jam pada temperature 30oC kemudian diamati perubahan warna pada media. hasil menunjukan bahwa warna media tidak berubah tetap berwarna ungu. jumlah terbesar adalah 80% yaitu antara isolat dengan spesies A 30 . isolate diinokulasikan kedalam ketiga tabung masing-masing 1 ose. 2006).

lembu. atau benda apa pun. sejenis campuran kuda-keledai. dan kambing. rusa. 31 . Karena pengambilan sampel tanah disekitar kandang maka tanah tersebut mengandung banyak Bacillus anthracis. unta. Vegetasi sel berukuran panjang 8 mikron dengan lebar 1-1. Bakteri ini banyak menyerang hewan herbivora. Kuman ini berkembang dan bertahan tahunan dalam berbagai keadaan di tanah. 2009). Bacillus anthracis termasuk klasifikasi gram positif. kuda.5 mikron ini mampu hidup selama bertahun-tahun di tanah (Akoso. yang menjadi cikal bakal bakteri spora. nonmotile. air.(Bacillus anthracis). Misalnya domba.

Bacillus subtilis memiliki kemampuan memproduksi antibiotik dalam bentuk lipopeptida. Dapat juga menyebabkan pneumonia. mampu membentuk endospora. tidak boleh dilukai supaya bakteri tidak menyebar. bronkopeumonia dan luka. Bakteri ini adalah jenis bakteri yang umum ditemukan di tanah. salah satunya adalah iturin. Penyebab antraks adalah bakteri Bacillus anthracis. daging. misalnya. dan tergolong dalam bakteri gram positif yang umumnya tumbuh pada medium yang mengandung oksigen (bersifat aerobik) sehingga dikenal pula dengan istilah aerobic sporeformers. Karenanya ada empat tipe antraks yaitu antraks kulit. mengonsumsi produk hewan yang kena antraks: atau melalui udara yang mengandung spora. Hewan tertular akibat memakan spora yang menempel pada tanaman yang dimakan. maupun bahan dari hewan sakit (kulit. memerlukan oksigen untuk hidup. Di alam bebas bakteri ini membentuk spora yang tahan puluhan tahun dalam tanah dan bisa menjadi sumber penularan pada hewan dan manusia. air. air. antraks usus (pencernaan). Termasuk kelompok bakteri gram positif. Hewan yang mati akibat antraks harus langsung dikubur atau dibakar. aerobik. udara. antraks paru (pernapasan) dan antraks otak. tanaman. udara dan materi tumbuhan yang terdekomposisi. Bacillus adalah organisme saprofit yang lazim terdapat dalam tanah. Bacillus cereus dapat menyebabkan keracuann makanan oleh enterotoksin yang terdapat pada makanan seperti nasi yang telah dimasak tetapi kemudian diletakkan ditempatyang hangat sehingga terjadi sporulasi dan terbentuklah toksin itu. Bakteri ini bersifat aerob. ada beberapa penelitian ditemukan bahwa penambahan Bacillus subtilis perairan dapat meningkatkan kualitas perairan dengan 32 . pada pekerja di pabrik wool atau kulit binatang.1 Kesimpulan Kelompok Bacillus merupakan bakteri berbentuk batang (basil).BAB III PENUTUP 3. dan tumbuh-tumbuhan. Iturin membantu Bacillus subtilis berkompetisi dengan mikroorganisme lain dengan cara membunuh mikroorganisme lain atau menurunkan tingkat pertumbuhannya. Iturin juga memiliki aktivitas fungisida terhadap pathogen. tulang atau darah).Antraks otak terjadi jika bakteri terbawa darah masuk ke otak. Penularan pada manusia bisa lewat kontak langsung spora yang ada di tanah.

berukuran sedang atau moderate. elevasi convex. dan uji oksidase. Hasil uji positif yaitu uji pewarnaan gram.5 sedangkan Panjang sel sebenarnya 2. permukaan halus mengkilap. memiliki ciri-ciri morfologi sebagai berikut: koloni berbentuk bulat atau circular. uji hidrolisis starch. Penggunaan Bacillus subtilis pada tambak udang menunjukkan bahwa Bacillus subtilis mampu meningkatkan kesintasan larva udang windu dan mencegah dari penyakit vibriosis akibat Vibrio harveyi. uji VP. Selain itu Bacillus subtilis secara alami bersimbiosis pada saluran pencernaan udang windu.mengurangi konsentrasi CO2 perairan. 33 . Lebar sel Bacillus sebenarnya 2. uji motilitas. pewarnaan endospora. dan margin entre. jumlah terbesar adalah 80% yaitu isolat Bacillus anthracis karena sampel yang digunakan adalah tanah kandang. Bacillus sp. Hasil uji negatif yaitu uji lactose dan raffinosa. uji katalase.5 . dan uji toleransi NaCl. uji hidrolisis kasein. uji penggunaan sitrat. Berdasarkan hasil perhitungan persen homologi.

Soemarno. Binarupa Aksara: Jakarta. Abdul dkk. Hal 35-37. Liliyanto. Colin.shvoong. Dasar – dasar Mikrobiologi.DAFTAR PUSTAKA Jawetz. Mikrobiologi Kedokteran.A. D. Sudjadi. dan Kiki. 1996.. http://dede-bogel. Buku Ajar Mikrobiologi Kedokteran Edisi Revisi. 1998. J. Penerbit Kanisius (Anggota IKAPI): Yogyakarta. Epidemiologi dan Pengendalian Anthrax Penyakit Menular pada Hewan dan Manusia. dan Escherichia coli dalam Mendegradasi Alkil Berzen Sebagai Bahan Aktif Sumatra. Vol. 1994. Identification of Bacterial Diversity in Waste Recycling Paint Sludge by Conventuonal Microbiological Technique. EGC: Jakarta. Uji Potensi Bacillus sp. James. Prinsip-Prinsip Sains untuk Keperawatan. G. Laila. Environmental Engineering Study Program.K. Akademi Analis Kesehatan: Yogyakarta.html http://id.. Dwipayana. Isoalsi dan Identifikasi Bakteri Klinik. Rahim. Barrow. B. Priyani. S.com/2011/07/karakteristik-dan-potensi-antibiotik. Penerbit Erlangga: Jakarta. ISSN 1907-5537..Jurnal Biologi . Penerbit Yudhistira. 2006. D. Melnick dan Adelberg. Cambridge: University Press. Akoso..com/exact-sciences/biochemistry/2174115-bakteri-bacilluscereus/#ixzz1raKQo3MA 34 Detergen. N.. Biologi Sains dalam Kehidupan. Australia. R. 2000. I and Feltham. Herto. 1 (2). Cowan and Steel’s Manual for The Identification of Medical Bacteria Third Education. 2009. Dwidjoseputro.. Bandung. B. B. Djambatan: Malang.1993.blogspot. N. 2010. 2006. 2008.

com/2011/02/bacillus-subtilis-dan-aplikasinya-dalam.com/2008/11/22/4141 file:///F:/laporan-isolasi-dan-identifikasi.wordpress.html 35 .html http://yongkikastanyaluthana.http://lutfiblurry.blogspot.

You're Reading a Free Preview

Mengunduh
scribd
/*********** DO NOT ALTER ANYTHING BELOW THIS LINE ! ************/ var s_code=s.t();if(s_code)document.write(s_code)//-->