BAB I PENDAHULUAN

1.1 Ciri Umum Kelompok Bacillus Secara umum, Kelompok Bacillus merupakan bakteri berbentuk batang (basil), dan tergolong dalam bakteri gram positif yang umumnya tumbuh pada medium yang mengandung oksigen (bersifat aerobik) sehingga dikenal pula dengan istilah aerobic sporeformers. Kebanyakan anggota genus Bacillus dapat membentuk endospora yang dibentuk secara intraseluler sebagai respon terhadap kondisi lingkungan yang kurang menguntungkan, oleh karena itu anggota genus Bacillus memiliki toleransi yang tinggi terhadap kondisi lingkungan yang berubah-ubah. Beberapa anggota Bacillus memiliki S-layer yang merupakan lapisan crystalline dipermukaan subunit protein atau glikoprotein. Bagian kapsul kebanyakan anggota Bacillus mengandung D atau L-glutamic acid, sedangkan beberapa lainnya memiliki kapsul yang mengandung karbohidrat. Variasi struktur dinding sel seperti pada kebanyakan bakteri gram negatif tidak ditemukan pada genus Bacillus. Dinding sel vegetatif kebanyakan anggota Bacillus terbuat dari peptidoglikan yang mengandung Meso-Diaminopimelic acid (DAP) dengan tipe Glyserol Teichoic Acid sangat bervariasi diantara spesies. Kebanyakan anggota genus Bacillus merupakan bakteri yang bersifat motil dan memiliki flagela tipe peritrik. Bakteri Bacillus sp. biasanya banyak ditemukan di tanah. Cara untuk mendapatkan bakteri Bacillus sp. yaitu dengan mengambil sampel tanah menggunakan sendok yang telah disterilisasikan terlebih dahulu kemudian ambil tanah sekitar kedalaman 3 cm dari permukaan tanah. Bacillus sp. merupakan bakteri gram positif dengan sel batang berukuran 0,3-22x1,27-7 πm, sebagian bersifat motil (mampu bergerak) mobilitasnya ini disebabkan oleh flagel, jika dipanaskan akan membentuk endospora, yaitu bentuk dorman sel vegetatif sebagai bentuk pertahanan diri yang muncul saat kondisi ekstrim yang tidak menguntungkan bagi bakteri. Kandungan air endospora sangat rendah bila dibandingkan dengan sel vegetatifnya, maka endospora berbentuk sangat padat dan sangat refraktil bila dilihat di bawah mikroskop. Endospora dibentuk dalam sporangium di dalam sel dan dibentuk saat sel masak. Endospora memiliki dinding tebal, reaktif, dan sangat resisten. Letak endospora dalam sel ukuran selama pembentukannya tidak sama antara spesies satu

1

dengan lainnya. Beberapa spesies memiliki spora sentral, terminal, atau letal. Endospora dapat berbentuk oval, silindris, bulat, atau lainnya. Bacillus sp. bersifat aerob sampai anaerob fakultatif, metabolisme dengan fermentasi dan respirasi. Isolat-isolat murni tersebut dipelihara dalam medium agar miring. Untuk memastikan bahwa koloni-koloni tersebut adalah Bacillus, maka dilakukan serangkaian pengujian yang bersifat spesifik yaitu pengecetan gram, pengecetan negatif dan motilitasnya. Bacillus dibedakan dari anggota familia Bacillaceae lainnya berdasarkan sifat-sifatnya yaitu: keseluruhannya merupakan pembentuk spora, hidup pada kondisi aerob baik sebagai jasad yang sepenuhnya aerob maupun aerob fakultatif, selnya berbentuk batang, dan memproduksi katalase.

1.2 Jenis-jenis Bacillus Kebanyakan anggota genus Bacillus adalah organisme saprofit yang lazim terdapat dalam tanah, air, udara, dan tumbuh-tumbuhan, seperti Bacillus cereus dan Bacillus subtilis. Beberapa di antaranya patogen bagi insekta Bacillus cereus dapat tumbuh pada makanan dan menghasilkan enterotoksin yang menyebabkan keracunan makanan. Organisme ini kadang-kadang dapat menimbulkan penyakit pada orang fungsi imun yang terganggu (misalnya meningitis, endokarditis, endoftalmitis, konjungtivitis, atau gastro enteritis akut). Bacillus anthracis, penyebab antraks adalah bakteri patogen utama genus ini.

1.

Bacillus anthracis Kuman antraks banyak ditemukan pada penyakit zoonosis, infeksi pada ternak lembu, kambing, domba dan babi. Kuman dikelurakan melalui feses, urin dan saliva binatang yang terinfeksi dan bertahan hidup di ladang dalam bentuk spora untuk waktu yang lama sekali.

Morfologi Batang dengan ukuran 1 x 3-4 µm, dapat tersusun dengan seperti bamboo, bentuk batangnya persegi atau cekung ujungnya, sendiri-sendiri, berpasangan atau membentuk rantai pendek, tidak bergerak, berspora oval yang letaknya sental, kadang-kadang berkapsul.

2

Struktur Antigen Bahan simpai B anthracis, yang terdiri atas polipeptida berbobot molekul tinggi yang mengandung asam D-glutamat, adalah suatu hapten. Badan bakteri mengandung protein dan suatu polisakarida somatic, keduanya bersifat antigenik.

Patogenesis Antraks terutama merupakan penyakit pada biri-biri, sapi, kuda, dan hewan lainnya; manusia jarang terserang. Infeksi biasanya didapat dengan masuknya spora melalui luka pada kulit atau selaput lendir, jarang dengan inhalasi spora ke dalam paru-paru. Pada hewan, pintu masuknya adalah mulut dan saluran pencernaan. Spora dari tanah yang tercemar mudah masuk bila termakan bersama tumbuhan berduri atau yang merangsang. Pada manusia, goresan pada kulit atau inhalasi menyebabkan timbulnya infeksi. Spora tumbuh pada jaringan di tempat masuk, dan pertumbuhan organisme vegetative mengakibatkan pembentukkan edema gelatinosa dan kongesti. Basil menyebar melalui getah bening ke dalam aliran darah, bakteri berkembang biak dengan bebas dalam darah dan jaringan segera sebelum dan setelah kematian hewan. Dalam plasma hewan yang mati karena antraks, telah ditemukan suatu faktor toksik. Bila diinokulasikan, zat ini mematikan mencit atau marmot dan secara spesifik dinetralisasi oleh antiserum antraks. Eksudat antraks mengandung polipeptida yang identik dengan polipeptida pada

simpai Bacillus, dan dapat menimbulkan reaksi histologik yang sama seperti reaksi akibat infeksi antraks. Protein lain yang diisolasi dari eksudat merangsang kekebalan yang kuat terhadap antraks bila disutikkan pada hewan. Dari filtrat (“toksin antraks”), telah dipisahkan tiga zat dengan filtrasi gelas dan kromatrografi: (1) antigen proktektif, (2) faktor edema, dan (3) faktor letal. Campuran dari (1), (2), dan (3) lebih toksik pada hewan, dan campuran seperti ini lebih imunogenik daripada masing-masing zat sendirisendiri. Pembentukan toksik berada di bawah pengaruh suatu plasmid; bila plasmid ini hilang, toksik tidak diproduksi. Tipe antraks yang lain adalah antraks pernapasan (“penyakit tukang sortir wool”). Spora atraks yang terhirup dari debu wool, bulu atau kulit mengakibatkan berkembangnya spora dalam paru-paru atau dalam kelenjar getah bening trakebronkial dan menimbulkan mediastinitis hemoragik, pneumonia, meningitis, dan sepsis yang biasa cepat menimbulkan kematian jumlah organisme dalam darah melebihi 10⁷/ mL.

3

antraks menimbulkan infeksi kulit (pustula ganas). Pada antraks pernapasan. Simpai lambat laun mengalami disintegrasi dan menghilang. gejala dini dapat berupa mediastinitis. setelah itu terkumpul sejumlah besar leukosit. dan akhirnya menjadi ulkus nekrotik. dahak. Karena itu. organisme berkembang biak di tempat masuk. Mula-mula timbul popula dalam 12-36 jam setelah masuknya organisme atau spora melalui goresan. Antraks dapat diidentifikasi pada sediaan kering dengan teknik pewarnaan imunofluoresensi. sedangkan organisme tidak patogen yang sejenis (misal B cereus) menunjukkan pergerakkan dengan “menyebar”. organisme kemudian dengan cepat menyebar dan mencapai aliran darah. Tes Diagnostik Laboratorium A. dan organisme dikelilingi oleh sejumlah besar cairan seperti protein yang mengandung sedikit leukosit. Simpai tetap utuh. lalu infeksi dapat menyebar. menimbulkan septikemia. B. C. 4 . Hewan sering terkena antraks dengan memakan sporanya dan organisme menyebar lewat saluran usus. Peragian karbohidrat tidak bermanfaat. Biakan: Bila dibiakkan pada lempeng agar darah. tetapi pada manusia hal ini jarang terjadi. Pneumonia hemoragik dengan syok merupakan gejala yang terakhir. kemudian pustula. Biakan antraks virulen mematikan mencit atau marmot bila disutikkan secara intraperitoneal. Gambaran Klinik Pada manusia. basil antraks selalu tidak bergerak. muntah dan diare berdarah jarang merupakan tanda-tanda klinik. organisme ini membentuk koloni kelabu nonhemolitik dengan morfologi mikroskopis yang khas. sakit perut. Pewarnaan Sediaan: Dari lesi lokal atau darah hewan yang mati. Pada perbenihan setengah padat. organisme berkembang biak selama beberapa jam. meningitis atau edema paru-paru hemoragik. rantai bakteri terbentuk batang besar Gram-positif sering terlihat. Bahan: Cairan atau nanah dari lesi lokal. Papula ini dengan cepat berubah menjadi visikel. Pada hewan yang resisten.Patologi Pada hewan yang peka. sepsis. Organisme tetap terlokalisasi. darah.

Kenyataan ini diperkirakan akibat sejumlah mekanisme pertahanan: aktivitas leukosit.5 pada suhu yang cocok. Tes Serologi: Antibodi penyebab presipitasi atau hemaglutinasi dapat diperlihatkan dalam serum orang atau hewan yang telah divaksinasi atau terinfeksi. eritromisin. Spora-spora ini dapat tetap hidup selama puluhan tahun. Epidemiologi. Terdapat banyak variasi mengenai kemanjuran berbagai vaksin. Imunisasi antraks didasarkan pada percobaan klasik Louis Pasteur. atau klidamisin mungkin efektif. Kotak dengan hewan yang terinfeksi atau dengan kulit. dengan suspensi spora. suhu badan. yang pada tahun 1881 membuktikkan bahwa biakan yang telah tumbuh dalam kaldu pada 42-52°C selama beberapa bulan akan kehilangan sebagian besar virulensinya dan dapat disuntikkan hidup-hidup pada biri-biri dan sapi tanpa menyebabkan penyakit. dimana mortilitas tetap tinggi. Tetrasiklin. Polipeptida tertentu yang mematikan hasil antraks telah diisolasi dari jaringan hewan. Pengobatan Banyak antibiotika efektif terhadap antraks pada manusia. Tindakan pengendalian meliputi (1) pembuangan bangkai hewan dengan membakar atau 5 . dan daya bakterisidal darah. Pencegahan dan Pengendalian Tanah tercemar oleh spora antraks dari bangkai hewan. rambut dan bulunya merupakan sumber infeksi pada manusia.D. sedangkan yang lain (tikus) sangat resisten terhadap infeksi antraks. Resistensi dan Kekebalan Beberapa hewan (marmot) sangat peka. Beberapa basil Gram-positif lainnya mungkin resisten terhadap penisilin karena membentuk-β-laktamase. Hewan merumput yang terinfeksi melalui luka pada selaput lendir menjadi penyambung rantai infeksi terus-menerus. Serum imun kadang-kadang disuntikkan bersama dengan basil hidup pada hewan. Mungkin spora dapat tumbuh dalam tanah pada pH 6. kecuali pada pengobatan antraks pernapasan. Polilisin sintetik mempunyai daya kerja yang mirip. tetapi pengobatan harus dimulai sedini mungkin. Penisilin cukup memuaskan. atau dengan antigen proktektif dan filtrate biakan. selanjutnya hewan-hewan ini terbukti kebal. Kekebalan aktif terhadap antraks dapat diinduksi pada hewan yang peka oleh vaksinasi dengan basil hidup yang telah dilemahkan.

6 . Enterotoksin Bacillus cereus memiliki karakter yang mirip dengan Bacillus thuringiensis dan Bacillus anthracis. Pada medium cair membentuk turbiditas moderate . spora elipsoidal. endoftalmitis dan panoftalmitis (khasnya bakteri masuk ke dalam mata melalui benda asing yang berkaitan dengan trauma). keratitis berat. sentral atau parasentral. biasanya muncul dalam bentuk rantai panjang tipe R. Orang yang mempunyai resiko besar karena pekerjaanya harus diimunisasi dengan vaksin bebas-sel yang dapat diperoleh dari Centers for Disease Control. Tidak membentuk kapsul. 2. Dalam pertumbuhan Bacillus cereus menghasilkan toksin selama pertumbuhan atau selama sporulasi. spora jarang keluar dari sporangia. Enterotoksin penyebab diare bersifat keracunan lewat makan (diarrheal type). kejang otot perut. Atlanta. GA 30333. (3) baju dan sarung tangan pelindung waktu mengenai bahan-bahan yang mungkin tercemar dan (4) imunisasi aktif hewan peliharaan dengan vaksin hidup yang dilemahkan. thuringiensis).9 – 1. opague terkadang waxy. Enterotoksin penyebab muntah berkaitan pada nasi panas tercemar (emetic type) dengan gejala mual. motilitas positif. (2) dekontaminasi produk-produk hewan (biasanya dengan autoklaf). Bacillus cereus menghasilkan beberapa enterotoksin dapat dalam makanan atau dibentuk dalam usus penyebab penting dari infeksi mata. sedangkan B.2 µm dan panjang 3 – 5 µm. Bentuk koloni irregular. Morfologi Bacillus cereus merupakan salah satu anggota genus Bacillus yang pertama kali diisolasi pada tahun 1969 dari darah dan cairan pleura pasien pneumonia. namun tetap dapat dibedakan berdasarkan determinasi motilitas (kebanyakan Bacillus cereus bersifat motil) dan adanya kristal toxin (hanya dihasilkan oleh B. Bacillus cereus Dapat menyebabkan keracuann makanan dan juga menyebabkan pneumonia.mengubur pada sumur yang dalam disertai kapur. Bacillus cereus memiliki beberapa karakter morfologi diantaranya: Gram positif dengan lebar sel 0. anthracis bersifat non-hemolitik). aktivitas hemolisis (B cereus memiliki sifat ini. bronkopneumonia dan luka.

Bacillus cereus merupakan mikroorganisme yang dapat tumbuh pada kisaran temperatur yang luas dan terdapat strain yang tergolong psychrophilic hingga thermophilic.5 – 78 mikrogram/mL. Bacillus cereus memproduksi Biocercin yang efektif menghambat Staphylococcus aureus dan Staphylococcus albus dengan menggunakan protease pepton agar sebagai medium uji. Bacillus cereus (Cerexin. Bacillus cereus BMG 366-UF5 melalui fermentasi dengan menggunakan spora sebagai inokulum awal. Zwitermicin). pepsin. Spesies ini diketahui bersifat antagonistik terhadap Fusarium roseum var sambucinum yang merupakan agen penyebab Potato Dry Root dengan menggunakan medium uji potato dextrose agar. Colistin). 7 . Bacillus circulans (contoh: Circulin) . dapat memproduksi Prumycin yang merupakan antibiotik yang juga diproduksi oleh Streptomyces kagawaensis dengan aktivitas yang tidak jauh berbeda. namun beberapa diantaranya yang bersifat saprofitik dapat bermanfaat sebagai probiotik dan juga penghasil antibiotik yang potensial.Beberapa strain dari Bacillus cereus bersifat patogen dan berbahaya bagi manusia karena dapat menyebabkan foodborne illness. Karena kebanyakan strain Bacillus cereus hidup dalam gastro-intestinal dan menyebabkan infeksi diarrhoeal. Tyrothricin). Bacillus licheniformis (contoh: Bacitracin). Bacillus polymyxa (Polymixin. Antibiotika Beberapa species utama genus Bacillus yang dapat memproduksi peptida antibiotik diantaranya: Bacillus brevis (contoh: Gramicidin. Cerexin B merupakan antibiotik yang efektif terhadap bakteri gram positif yang diproduksi oleh Bacillus cereus Gp-3 dan merupakan antibiotik amphoteric acylpeptide. Bacillus laterosporus (contoh: Laterosporin). Bacillus cereus merupakan salah satu anggota genus Bacillus yang memiliki potensi antibiotik. pH ekstrim serta tahan terhadap enzim pencernaan seperti: trypsin. 2) diarrhoeal yang dimediasi oleh enterotoksin yang labil terhadap panas dan asam. Bacillus cereus kebanyakan ditemukan terkandung dalam bahan pangan dan menyebabkan 2 tipe keracunan makanan: 1) emetic yang merupakan keracunan yang dimediasi oleh toksin yang sangat stabil yang dapat bertahan pada temperatur tinggi. Bacillus pumilus (contoh: Pumilin) dan Bacillus subtilis (Difficidin. maka temperatur 37oC merupakan temperatur pertumbuhan yang optimal. Subtilin. Mycobacillin). Bacillus cereus memproduksi Mycocercin yang merupakan antibiotik peptida yang efektif terhadap beberapa jenis yeast maupun mold dengan rentang minimal inhibitory concentration antara 19.

UW 89. Keberadaan B. Keracunan makanan tipe emetik ditandai dengan mual dan muntah dalam waktu 0. cereus merupakan penamaan secara umum. Umumnya gejala terjadi selama kurang dari 24 jam. gejala-gejala ini tetap berlangsung selama 24 jam. licheniformis telah diisolasi dari kambing dan ayam yang dicurigai menjadi penyebab kasus keracunan makanan. UW 96. cereus dalam jumlah besar (lebih dari 10 6 organisme/g) dalam makanan merupakan indikasi adanya pertumbuhan dan pembelahan sel bakteri secara aktif. Beberapa strain B. dan berpotensi membahayakan kesehatan. Penyakit dengan gejala diare (tipe diare) disebabkan oleh protein dengan berat molekul besar. UW 64.Zwittermicin A merupakan salah satu antibiotik golongan aminopolylol yang diketahui efektif dalam menghambat beberapa patogen yang menyerang tanaman dengan spektrum luas meliputi bakteri (baik gram positif maupun gram negatif). sementara penyakit dengan gejala muntah (tipe emetik) diyakini disebabkan oleh peptida tahan panas dengan berat molekul rendah. Pada sebagian besar kasus. Gejala-gejala keracunan makanan tipe ini mirip dengan gejala keracunan makanan yang disebabkan oleh Staphylococcus aureus . 8 . Gejala-gejala keracunan makanan tipe diare karena B. juga memproduksi Kanosamin yang merupakan antibiotik dengan spektrum luas. cereus mirip dengan gejala keracunan makanan yang disebabkan oleh Clostridium perfringens . Diare berair. beberapa fungi (seperti: oomycetes) dan protista (contohnya: alga). cereus . tetapi jarang terjadi muntah (emesis). UW 52. Zwittermicin A diketahui diproduksi oleh beberapa strain Bacillus cereus diantaranya: Bacillus cereus UW 11. Beberapa strain tersebut selain memproduksi Zwittermycin A. dan rasa sakit mulai terjadi 6-15 jam setelah konsumsi makanan yang terkontaminasi. UW 32.UW 119 dan UW 120. Gejala-gejala Penyakit Keracunan makanan karena B. UW 56. walaupun ada dua tipe penyakit yang disebabkan oleh dua metabolit yang berbeda.5 sampai 6 jam setelah mengkonsumsi makanan yang terkontaminasi. Kadang-kadang kram perut dan/atau diare dapat juga terjadi. UW 78. kram perut. Rasa mual mungkin menyertai diare. Organisme-organisme ini menghasilkan racun yang sangat tahan panas yang mungkin mirip dengan racun penyebab muntah yang diproduksi oleh B. subtilis dan B.

meskipun beberapa strain psychrotrophic hasil pertumbuhan bakteri dalam produksi 9 . nutritive agar serta nutritive agar dengan 7 – 10 % darah domba. menyebabkan mual muntah. Patogenesis Bacillus cereus bertanggung jawab untuk sebagian kecil penyakit bawaan makanan (2-5%). Dalam medium GA. atau (3) dengan cara mengisolasi Bacillus cereus dari makanan yang dicurigai dan menentukan kemampuannya dalam menghasilkan enterotoxin ( enterotoxigenicity ) dengan uji serologis (untuk toxin penyebab diare) atau uji biologis (untuk tipe diare dan emetik). Bacillus cereus telah mencapai fase eksponensial pada 6 jam inkubasi dan mencapai fase stasioner 20 jam setelah inkubasi. Makanan dimasak tidak dimaksudkan untuk dipakai sendiri atau pendinginan yang cepat dan pendinginan harus disimpan pada suhu di atas 60 ° C (140 ° F). Sel vegetatif dari Bacillus cereus dapat tumbuh pada rentang temperatur 5– 50 oC dengan temperatur optimal antara 35 . Tes Diagnostik Laboratorium Bacillus cereus non pathogen menunjukkan pergerakan dengan penyebaran (swarming) pada media kultur seengah padat. Perkecambahan dan pertumbuhan umumnya terjadi antara 10-50 ° C (50-122 ° F).3. antara 20 – 30 menit. seringkali sudah cukup untuk mendiagnosis keracunan makanan tipe ini. Terjadi karena kelangsungan hidup endospora bakteri ketika makanan tidak benar matang. yang memungkinkan endospores untuk berkecambah. atau muntahan pasien menunjukkan adanya sejumlah besar Bacillus cereus dari serotip yang dikenal sebagai penyebab keracunan makanan. Pada tipe emetik. Waktu generasi relatif singkat. atau (2) hasil isolasi bakteri dari makanan yang dicurigai.40 oC.Diagnosis Bacillus cereus dipastikan sebagai penyebab suatu kasus keracunan makanan. resisten terhadap pH 4. Memasak suhu kurang dari atau sama dengan 100 ° C (212 ° F) memungkinkan beberapa spora Bacillus cereus untuk bertahan hidup. Masalah ini diperparah ketika makanan itu tidak benar didinginkan. Dapat tumbuh pada anaerobic agar dan nutrien broth dan penambahan NaCl 7%. didukung dengan beberapa bukti pada makanan. waktu yang cepat munculnya gejala segera setelah infeksi. apabila (1) hasil isolasi Bacillus cereus menunjukkan bahwa strain-strain dari serotip yang sama ditemukan pada makanan yang dicurigai dan dari kotoran atau muntahan pasien. kotoran.5–9. parah dan diare penyakit bawaan makanan Bacillus.

diare dan muntah (muntah) sindrom . pudding. yang disimpan dengan cara yang tidak benar (misalnya nasi. Spora dari jenis bakteri ini tahan terhadap panas dan kondisi lingkungan yang tidak menguntungkan dan mampu membentuk kecambah dalam larutan yang mengandung NaOH dan HCL. Tipe emetik umumnya berkaitan dengan makanan yang mengandung tepung.. Untuk bakteri Bacillus cereus sendiri merupakan bakteri gram positif. et al. Campuran makanan seperti saus. Namun demikian. sayuran. Penyimpanan dengan benar (di bawah 7°C dan hanya untuk beberapa hari) akan mencegah pertumbuhan mikroorganisme dan produksi racun. pasta). termasuk daging. dan salad sering dicurigai sebagai penyebab dalam kasus-kasus keracunan makanan. bersifat aerobik. salah satunya sangat tahan terhadap panas dan pH antara 2 dan 11. konsumsi menyebabkan dua jenis penyakit.. Walaupun demikian. casserole (sejenis makanan yang dimasak dalam wadah tertutup di atas api kecil). dan disimpan dengan benar umumnya aman dari racun yang menyebabkan muntah. dan mampu membentuk spora yang dapat ditemukan di tanah.enterotoksin. Epidemiologi Bacillus sp termasuk kedalam family Bacillaceae. berkaitan dengan penyebab keracunan makanan tipe diare. Populasi Rentan Semua orang diyakini rentan terhadap keracunan makanan oleh Bacillus cereus. dan keju juga dapat menjadi penyebabnya. Resiko paling besar yaitu kontaminasi silang. makanan bertepung lainnya seperti kentang. dipanaskan. 10 . susu. yakni apabila makanan yang sudah dimasak bersentuhan dengan bahan mentah atau peralatan yang terkontaminasi (misalnya alas pemotong). Kasus-kasus tipe emetik umumnya berkaitan dengan makanan dari beras. Pencegahan Pencegahan secara total mungkin tidak dapat dilakukan. pada sayuran maupun produk pangan (Tay. dan ikan. pasta. sup. Makanan yang Terkait Berbagai jenis makanan. makanan yang dimasak. 1982). pastry (sejenis kue).

3. Bacillus subtilis tidak dianggap sebagai patogen walaupun kontaminasi makanan tetapi jarang menyebabkan keracunan makanan. dapat mencemari makanan tetapi jarang menyebabkan keracunan makanan. Bacillus subtilis mempunyai kemampuan untuk membentuk endospora yang protektif yang memberi kemampuan bakteri tersebut mentolerir keadaan yang ekstrim. Bacillus subtilis selnya berbentuk basil. Biasanya bentuk rantai atau terpisah.dan Iga keluarnya. Sporanya dapat tahan terhadap panas tinggi yang sering digunakan pada makanan dan bertanggung jawab terhadap kerusakan pada roti. Kemudian nama Bacillus subtilis dikenalkan oleh Ferdinand Cohn pada 1872. Bacillus subtilis menghasilkan enzim proteolytic yang subtilisin. Tidak seperti species lain seperti sejarah. Bakteri ini termasuk bakteri gram positif. katalase positif yang umum ditemukan di tanah. yang pada pencernaan telah ditemukan secara signifikan untuk kekebalan aktivasi antibodi spesifik GM. tetapi ditolak popularitasnya setelah pengenalan konsumen antibiotik murah walaupun kurang menyebabkan reaksi alergi kesempatan yang cukup rendah dan racun normal flora usus. Bacillus subtilis produces the proteolytic enzyme subtilisin . IgG . infeksi mata dan lain-lainnya. Bacillus subtilis merupakan jenis kelompok bakteri termofilik yang dapat tumbuh pada kisaran suhu 45 °C – 55 °C dan mempunyai pertumbuhan suhu optimum pada suhu 60 °C – 80 °. Morfologi Bacillus subtilis termasuk jenis Bacillus. Bacillus subtilis telah digunakan sepanjang 1950 sebagai alternatif dari obat karena efek immunostimulatory sel dari masalah. Toksik Bacillus subtilis tidak dianggap sebagai manusia pathogen. endokarditis. Semua membentuk endospora yang berbentuk bulat dan oval. ada yang tebal dan yang tipis. Bacillus subtilis Dapat menyebabkan meningitis. Sebagian motil dan adapula yang non motil. Bakteri ini dipasarkan di seluruh Amerika dan Eropa dari 1946 sebagai immunostimulatory bantuan dalam usus dan perawatan dari penyakit urinary tract seperti Rotavirus dan Shigella. Bacillus subtilis spores dapat hidup yang ekstrim pemanasan yang sering digunakan 11 . Bacilus Subtilis ini awalnya bernama Vibro subtilis oleh Christian Gottfried Ehrenberg pada tahun 1835. Bacillus subtilis diklasifikasikan sebagai obligat anaerob walau penelitian sekarang tidak benar.

yang memberikan B. yang merupakan contoh sederhana dari diferensiasi selular. pBE2C1 dan Bacillus subtilis str. 12 . terutama dari sporulation. recombinants Bacillus subtilis str. memungkinkan organisme untuk terus berada di dalam lingkungan sampai kondisi menjadi baik. Bacillus subtilis terbukti untuk manipulasi genetik. Endospore adalah yang dibentuk pada saat gizi stres. dan bertanggung jawab untuk menyebabkan kekentalan yang lengket. asam.untuk memasak makanan. dapat dikonversi menjadi peledak berbahaya compounds dari nitrogen. dan garam. pBE2C1AB digunakan dalam produksi polyhydroxyalkanoates (PHA) dan agar mereka dapat menggunakan gandum terendam air limbah sebagai sumber karbon untuk menurunkan biaya produksi PHA. Hal ini masih banyak digunakan di Eropa Barat dan Timur Tengah sebagai alternatif obat. Sebelum proses untuk menghasilkan spora bakteri melalui proses produksi flagella dan mengambil DNA dari lingkungan. populer di seluruh dunia sebelum pengenalan konsumen antibiotik immunostimulatory sebagai agen untuk membantu perawatan gastrointestinal dan penyakit urinary tract. Bacillus subtilis dapat membagi asymmetrically. memproduksi sebuah endospore yang tahan terhadap faktor lingkungan seperti panas. Bacillus subtilis strain QST 713 (dipasarkan sebagai QST 713 atau serenade) memiliki alam berhubung dgn fungisida aktivitas. karena itu telah menjadi banyak diadopsi sebagai model organisme untuk penelitian laboratorium. Keguanaan lain bakteri ini cukup banyak sekarang dangan berkembangnya teknologi. Hal ini juga sangat flagellated. karbon dioksida. yang dapat berada di dalam lingkungan dalam jangka waktu yang lama. dan bekerja sebagai agen kontrol biologi. membenang konsistensi yang disebabkan oleh bakteri produksi panjang rantai polysaccharides dan manja dalam adonan roti. subtilis kemampuan untuk bergerak sangat cepat. dan air.

Ose dibakar sampai steril. suspensi sampel) Cara penanaman: 1. Goresan sejajar : (isolasi) a. Dengan ose yang sudah steril diambil sampel atau bakteri culture. Ose dibalik dengan melanjutkan goresan-goresan sejajar pertama. Dengan ose steril yang lain. pulasan itu digores-goreskan sejajar sampai memenuhi permukaan media. dinginkan b. dipulaskan di salah sisi/ tepi media jangan menyentuh dinding petridish c. Berdasarkan wujud atau bentuk media dan sifat media. dengan salah satu sisinya d. Dengan ose steril yang lain. Dengan ose yang sudah steril diambil sampel atau bakteri cultur.BAB II IDENTIFIKASI 2.1 Metode Penanaman Bakteri Penanaman bakteri atau biasa disebut juga inokulasi adalah pekerjaan memindahkan bakteri dari medium yang lama ke medium yang baru dengan tingkat ketelitian yang sangat tinggi. 2. dinginkan b. setelah medianya diputar 90°C 13 . Ose dibakar sampai steril. Untuk melakukan penanaman bakteri (inokulasi) terlebih dahulu diusahakan agar semua alat yang ada dalam hubungannya dengan medium agar tetap steril. Goresan sejajar melingkar : (isolasi) a. hal ini agar menghindari terjadi kontaminasi. dimana dikenal beberpa cara penanaman bakteri. yaitu: A. pulasan itu digores-goreskan sejajar pada salah satu tepi media. dipulaskan di salah sisi/ tepi media jangan menyentuh dinding petridish c. Penanaman pada media padat bentuk plate Tujuan: Untuk mengisolasi/ memisahkan pertumbuhan bakteri satu dengan lainnya (yang ditanam specimen) Untuk memperbanyak bakteri (yang ditanam culture bakteri atau koloni bakteri) Untuk menghitung jumlah kuman (yang ditanam.

1 atau 1 ml secara steril b. Suspensi sampel. menjalar. dengan tujuan “memperbanyak”. sampel cair atau cultur bakteri di dalam media cair diambil dengan pipet steril sebanyak 0. Dengan ose yang dimiringkan goresan-goresan sejajar kedua.1 ml diteteskan di permukaan media plate tepat ditengah-tengahnya b. Bentuk 4. Media diputar 90°C. sampai memenuhi permukaan media plate. hitam. bergelombang. serabut. haemolytis. Koloni bakteri yang tumbuh pada media padat bentuk plate. hijau. sebanyak sampai menutupi semua permukaan dasar petridish c. Sifatnya : diukur berapa diameternya dengan satuan mm : putih. yang penting diperhatikan selain adanya pertumbuhan koloni juga kemurniaan koloni itu 14 . Warna 3.e. halus (smooth) : keruh. Suspensi sampel/ sampel cair diteteskan ke dalam petridish steril ssebanyak 0. cekung. digoreskan sejajar lagi setelah medianya diputar 90°C f. tetesan itu diratakan pada seluh permukaan media plate. masuk incubator 37°C 48 jam Catatan: Media yang digunakan tergantung dari jenis bakteri yang dihitung. cembung. rhizoid dan sebagainya : datar. Ukuran 2. Cara taburan : (isolasi dan memperbanyak) a. berlendir. tunggu sampai agar-agarnya membeku d. Cara penuangan : (penghitungan) a. 3. melekat pada perbenihan. Dituangi media padat steril yang dicairkan. 4. Pembacaan: Pertumbuhan bakteri pada media padat disebut “koloni” yaitu kelompokankelompokan bakteri yang tumbuh pada media tersebut Koloni bakteri pada media padat dengan tujuan isolasi dapat dibedakan berdasarkan criteria sebagai berikut: 1. goresan-goresan sejajar yang ketiga digoreskan sejajar lagi dengan ose yang sudah dibalik. yang sudah steril dan dingin. kasar (rough). Dibalik. kuning. Campur baik-baik. anhaemolytis dan sebagainya. Permukaan 5. kering. Dengan menggunakan spatel yang terbuat dari kaca/kawat. merah dan sebagainya : bulat. jernih.

dengan tujuan “penghitungan”. C.- Koloni bakteri yang tumbuh pada media padat bentuk plate. Ose dibakar lagi sampai steril Contoh: Media nutrient agar 2. Tutup tabung media dibuka dengan menjepit menggunakan jari kelingking kanan. Mulut tabung dibakar lagi. Goresan zig-zag: a. B. Penanaman pada media padat di dalam tabung bentuk miring Tujuan: Untuk memperbanyak bakteri Untuk identifikasi Untuk menyimpan bakteri Cara penanaman: 1. diambil koloni bakteri b. segera ditutup dengan tutupnya e. Ose yang sudah berisi koloni bakteri digoreskan zig-zag pada permukaan media. betul-betul ditengah media tidak terlalu kebawah/ keatas dan juga tidak terlalu kekiri/ kekanan d. Penanaman pada media semisolid di dalam tabung Tujuan: Untuk identifikasi bakteri Untuk menyimpan bakteri 15 . Goresan zig-zag dan ditusuk: Pelaksanaan penanamannya seperti nomor 1 dengan perbedaan sebagai berikut: Urutan c setelah digoreskan zig-zag kemudian ditusukkan ditengah-tengahnya 1 sampai 2 kali. Dengan ose yang sudah steril dan dingin. kemudian dibaca perubahanperubahan yang terjadi pada media dengan atau tanpa penambahan reagensia. mulut tabung dibakar dengan nyala api tidak berjelaga c. tetapi tinggal dihitung saja. criteria koloni tidak perlu diperhatikan. Contoh: Media TSIA Pembacaan: Koloni yang tumbuh diperhatikan kemurniannya.

disamping kekeruhan dapat juga diikuti perubahan warna indikatornya yang merupakan pertanda adanya perubahan/ pemecahan gula/bahan kimia yang terkandung dalam itu. dan sebagainya) dengan atau tanpa penambahan reagensia. Kalau tidak tumbuh medianya tetap jernih. Dengan ose itu diambil koloni bakteri c. D. mulutnya dibakar d. ose yang sudah ada koloni bakterinya ditusukkan tegak lurus di permukaan bagian tengah sampai dasar tabung e. Penanaman pada media cair Tujuan: Untuk memperbanyak cultur bakteri Untuk melihat gerak bakteri Untuk identifikasi Cara penanaman: a. Dengan ose yang sudah steril dan dingin. medianya menjadi keruh. Mulut tabung dibakar lagi dan ditutup kembali.Cara penanaman: a. Begitu pula osenya dibakar/ disteril kembali. Tutup tabung dibuka dengan menggunakan jari kelingking kanan d. Ose yang sudah berisi koloni bakteri digores-goreskan pada dinding tabung bagian dalam sebelah atas yang tadinya tertutup oleh cairan media e. gerak. kemudian dibaca perubahanperubahan yang terjadi pada media itu (warna. goresan bakteri akan terendam cairan media. Ose dibakar sampai steril. dinginkan b. Mulut tabung dibakar. Tutup tabung media dibuka. Mulut tabung dibakar sebentar. Pembacaan: Koloni yang tumbuh diperhatikan kemurniannya dahulu. 16 . tutup kembali. Apabila bakterinya ditanam didalam media yang untuk identifikasi. dinginkan b. diambil koloni bakteri c. Pembacaan: Kalau bakteri yang ditanam dapat tumbuh didalam media cair itu. Ose jarum penanam steril. Setelah tabung diletakkan pada raknya (ditegakkan). Ose bekas pakai juga dibakar sampai steril f.

yaitu: 1. Alat Jarum ose Object glass Mikroskop Mikrometer Kertas merang Tabung reaksi Pipet tetes Beaker glass Cawan petri Oven Pembakar spirtus Inkubator Wrapper B. Pedoman perawatan klinis 3. Menentukan uji kepekaan terhadap antibiotika 4. Menentukan arti penting pengobatan 2.3 Isolasi dan Identifikasi Bacillus A. yaitu: 1. Identifikasi mikroorganisme menggunakan kriteria Fenotif: Mikroskopis dengan pewarnaan Gram Isolasi : morfologi koloni dengan identifikasi Kebutuhan lingkungan untuk pertumbuhan Kepekaan terhadap antibiotika Kebutuhan nutrisi dan kemampuan metabolik 2.2. Bahan Aquades Alkohol 70% Alumunium foil Medium Nutrient Agar (NA) Nitrat Broth (NB) Malachite Green Sterch Agar (SA) SIMA Semisolid Skim Milk Agar (SMA) Simon Citrat 17 . Menentukan apakah jenis mikroorganisme berbahaya berpengaruh pada kesehatan Adapun prinsip identifikasi.2 Identifikasi Bakteri Tujuan identifikasi bakteri. Identifikasi mikroorganisme menggunakan kriteria Genotip: Identifikasi karakteristik bakteri menggunkan teknik molekuler untuk analisis DNA dan RNA 2.

D. (hasil pada Hari II) Hari II : Koloni yang tersangka dari Blood agar plate dicat Gram.5%. b. Tahap Isolasi Bacillus 1. Sampel diambil dengan cepat dan dengan hati-hati dimasukkan ke dalam alumunium foil steril kemudian ditutup rapat. Masuk inkubator 37°C 24 jam.- MR-VP Broth KOH-Alfanafto Reagen A dan B. (hasil pada Hari III) Hari III : Dibaca dan dicatat pertumbuhan pada media gula dan media lainnya. Sampel tanah dimasukkan ke dalam tabung pengenceran pertama 3. dilakukan test kimia. Preparasi suspensi dilakukan 2. Cara Kerja a. dan 10 %) Kristal Violet Lugol’s Iodine - Safranin Etanol 96% Reagen H₂O₂ Media Rafinosa Laktosa Reagen Oksidase C. Sampel tanah direbus pada suhu 80oC selama 10 menit 18 . Pengambilan Sampel 1. Masuk inkubator 37°C 24 jam. NB 0% NB +NaCl (6. Kalau ditemukan Gram (+) batang kemudian ditanam pada media gula dan media lainnya. Metode Hari I : Spesimen ditanam pada Blood agar plate dan Mac Conkey. Alumunium foil disiapkan yang sebelumnya disterilkan terlebih dahulu dengan alkohol 70% 3. Tanah diambil secara aseptis 2.

Tahap Pemurnian Dengan Metode Streak Kuadran 1. Diamati perbedaan bentuk koloni. kemudian difiksasi 2. diangkat lalu didinginkan melewati streak sekunder dan kemudian dilanjutkan kestreak tersier tanpa kembali kestreak primer dan sekunder diinkubasi pada suhu 30oC selama 2 x 24 jam d. Disiapkan mikroskop yang telah dipasang mikrometer okuler yang sudah terkalibrasi 2. elevasi. ukuran. Dibuat biakan pada media Nutrient Agar (NA) cawan 2. Jarum ose dibakar. Jarum ose dibakar. Dipilih satu koloni yang nampak terdiri dari satu tipe sel 2. Diamati dibawah mikroskop 19 . Dicuci dengan air mengalir. dibiarkan selama 45 detik. Dibuat preparat ulas bakteri uji dengan metode pewarnaan sederhana mengggunakan pewarna Methylen Blue 3. Ditetesi dengan gram B (lugol’s iodine). Dicuci dengan air mengalir. kemudian dihitung panjang dan lebar sel sebenarnya f. Ditetesi dengan gram D (safranin). Diukur panjang dan lebar sel. lalu dikeringanginkan 4. e. Pengukuran Panjang Dan Lebar Sel 1. setelah dingin disentuhkan ke permukaan koloni bakteri yang akan disteak pada plating NA 3. Diinkubasi 2 x 24 jam pada suhu 30oC 3. dibiarkan selama 60 detik 3. Jarum ose dibakar.c. Uji Pewarnaan Gram 1. Pengamatan Morfologi Koloni 1. Dibuat ulasan bakteri pada object glass. diangkat lalu didinginkan dan disteakan melewati streak primer kesatu atau kedua dan kemudian dilanjutkan kestreak sekunder tanpa kembali kestreak primer 5. margin. Streak ini dianggap sebagai sterak primer pada permukaan NA 4. dan permukaan. Ditetesi dengan gram A (Kristal violet). dicuci dan dikeringanginkan 8. dibiarkan selama 60 detik 5. Dicuci dengan gram C(ethanol 96%) setetes demi settee sampai etanol yang jatuh berwarna bening 7. lalu dikeringanginkan 6.

dan jika tidak terbentuk zona jernih (warna biru reagen) menandakan hasil uji negatif j. Dilihat pertumbuhan koloni bakterinya yang ada pada amedium SIMA semisolid i. jika terbentuk zona jernih di sekitar koloni menandakan hasil uji positif. Diinokulasikan bakteri uji pada medium cair MR-VP sebanyak 1 ose 2. Dibuat ulasan bakteri pada object glass lalu ditutupi dengan kertas merang 2. Diinkubasi selama 2 x 24 jam pada temperatur 30oC 3. 2. Bakteri ditetesi dengan alfanaftol 3 tetes dan KOH 40 % 2 tetes 4. Diamati perubahan yang terjadi. jika media berubah menjadi merah muda s. Uji Pewarnaan Endospora 1. Uji VP (Voges Proskauer) 1. Uji Hidolisis kasein 1. dan jika warna media tetap menandakan hasil uji negatif k. Diinokulasikan bakteri uji pada medium SIMA semisolid sebanyak 1 ose 2. Uji Hidrolisis Starch 1.g. Diinkubasi selama 2 x 24 jam pada temperatur 30oC 3. ditambahkan lagi Malachite Green h. Ditetesi dengan Malachite Green diatas kertas merang dan diletakkan di atas air mendidih 3. jika terbentuk zona jernih di sekitar koloni menandakan hasil uji positif. Diinkubasi selama 2 x 24 jam pada temperature 30oC 3. Diinokulasikan bakteri uji pada medium padat SMA sebanyak 1 ose. Diamati perubahan yang terjadi. jika pinggir mulai mongering. Diamati perubahan yang terjadi. Permukaan media ditetesi dengan larutan Lugol’s Iodine. Diinkubasi selama 2 x 24 jam pada temperatur 30oC 3. 2. Dibiarkan selama lim menit.d merah setelah penambahan alfanaftol dan KOH 40% menandakan hasil uji positif. Diinokulasikan bakteri uji pada medium padat Starch Agar sebanyak 1 ose. dan jika tidak terbentuk warna tersebut maka menandakan hasil uji negatif 20 . Uji Motilitas 1. 4.

Ditetesi dengan reagen oksidase 3. Diinokulasikan bakteri uji pada medium cair Nitrate Broth sebanyak 1 ose 2. hasil positif jika media berubah warna dari ungu menjadi kuning dan hasil negatif jika media tetap berwarna ungu. Hasil positif jika terbentuk warna merah tua/ merah gelap. Uji Oksidase 1. hasil uji negatif yaitu tidak terbentuk warna biru marun n. ditambahkan bubuk seng (sampai dengan 5 mg/ml media) dan diamati jika terbentuk warna merah maka hasi pengujian positif 21 . Hasil positif jika berwarna biru marun. jika hasil positif media berwarna biru sedangkan hasil negatif tetap berwarna hijau. Diamati perubahannya. Uji Gula 1. Uji Penggunaan Sitrat 1. Jika terbentuk gelembung gas menunjukka bahwa hasil uji positif dan sebaliknya m. Uji Reduksi Nitrat 1. Ditetesi dengan larutan H2O2 3. Diinkubasi selama 2 x 24 jam pada temperatur 30oC 3. Diamati perubahan yang terjadi 4. jika belum terbentuk warna merah. Diamati perubhan yang tejadi. o. Diinkubasi selama 2 x 24 jam pada temperatur 30oC 3. p. Uji Katalase 1. Dibuat preparat ulas bakteri pada objek glass.l. Diamati perubahan yang terjadi 4. Diteteskan 1 ml nitrat reagen A dan dilanjutkan dengan nitrate reagen B 4. Bakteri uji ditumbuhkan pada medium Rafinosa dan Laktosa 2. Diinkubasi selama 2 x 24 jam pada temperatur 30oC 3. tutup dengan potongan tissue 2. Diinokulasikan bakteri uji pada medium agar miring Simon’s Citrate sebanyak 1 ose 2. Dibuat preparat ulas bakteri pada objek glass 2.

Ditentukan persen homologinya dengan rumus % Homologi = Jumlah karakter yang sama x 100% Jumlah karakter yang diujikan E. Isolat diinokulasikan dengan streak kontinyu 2. 4. 7. 2. Hasil Tabel 1. 2. dan 10 % 1.q. Hasil Pengamatan dan Pembahasan a. 5. 4. Data-data yang diperoleh dibandingkan dengan data karakter bakteri dari sumber 2. Diinkubasi selama 2 x 24 jam pada temperatur 30oC 3. Jenis Uji Gram Endospora Katalase Starch Casein Rafinossa NaCl 10% Isolat + + + + + + + + + + d + + d + + d + + + d 22 A + + B + + C + + D + + E + + . Penentuan Spesies Melalui Pendekatan Homologi 1. 5. Uji Toleransi NaCl Dibuat tiga buah tabung Nutrient Broth yang mengandung Nacl 0%.5 %. Diamati hasilnya dengan melihat tingkat kekeruhan pada media r. 3. 3. 6. Perbandingan Isolat dan Spesies-spesies Bacillus No 1. Pengamatan Morfologi Sel No 1. Pengamatan Bentuk koloni Ukuran Elevasi Margin Permukaan Circular Moderate Convex Entire Halus mengkilap Hasil Tabel 2. 6.

Pada Media Gula-gula No 1. VP 11. 3. 3. Oksidase 1 1 1 Jumlah karakter 8 7 7 yang sama % Homologi = Jumlah karakter yang sama x 100% Jumlah karakter yang diujikan = 8 x 100 % 10 Keterangan : d = 16-84% strain positif A = Bacillus anthracis B = Bacillus cereus = 80 % C = Bacillus thuringiensis D = Bacillus megaterium E = Bacillus subtilis 23 . 5. 7. 6. Spesies B. subtilis Glukosa Laktosa Mannitol Maltosa + + + Sukrosa + +/+ - + + + ± Tabel 4. Pengukuran Homologi No 1. 2.8. anthracis B. Oksidase Tabel3. cereus B. 4. 8. 2. Sitrat Motilitas + + + d d + + d + + + d + + - + + + - 10. 9. 9. Jenis Uji Gram Endospora Starch Casein Rafinossa NaCl 10% Sitrat Motilitas VP IA 1 1 1 1 1 0 0 1 1 IB 1 1 1 1 1 0 0 0 1 IC 1 1 1 1 1 0 0 0 1 ID 1 1 1 1 0 1 0 0 0 0 5 IE 1 1 1 1 0 0 0 0 1 0 5 10.

24 .

amati bakteri Bacillus sp. Terbentuknya endospora bertujuan untuk melindungi bakteri dari lingkungan yang kurang menguntungkan (Sudjadi. maka pembungkus spora segera pecah dan bakteri kembali memulai aktivitas hidupnya sebagaimana biasanya. Isolasi Bacillus sp. masukkan kedalam alumunium foil yang sebelumnya disterilisasikan terlebih dahulu dengan menggunakan alkohol 70% kemudian ditutup rapat. ukuran. Proses perebusan dilakukan agar bakteri yang diinginkan (Bacillus sp. Dilakukan dengan prosedur kerja aseptik dengan senyawa desinfektan yang sesuai.) membentuk endospora. banyak mengandung bahan kimia. dilakukan dengan cara sampel tanah yang telah didapat dimasukkan kedalam tabung yang berisi akuades steril kemudian direbus 10 menit dengan suhu 80°C diatas dandang.b. inokulasikan ke media NA disteak kuadran kemudian diinkubasi selama 2x24 jam dengan suhu ruang 30oC. dan margin didapatkan hasil koloni berbentuk bulat atau circular. Jika keadaan lingkungan membaik. inkubasi selama 2x24 jam dengan suhu ruang. oleh karena itu bakteri yang menghasilkan endospora dapat bertahan hidup pada lingkungan yang ekstrim. Hasil pemurnian ambil koloni tunggal kemudian diamati bentuk. 2006). Endospora memiliki dinding yang tebal. Pengambilan sampel dilakukan dengan mensterilisasikan alat terlebih dahulu agar dapat dilindungi dari kontaminasi. Contoh bakteri yang menghasilkan endospora adalah Bacillus dan Clostridium (Sudjadi. 25 . lingkungan yang terlalu kering. 2006). Pemurnian sampel dari hasil yang telah diisolasi dilakukan dengan cara pemilihan satu koloni (koloni tunggal) yang nampak terdiri dari satu tipe sel. elevasi. Misalnya. Menyesuaikan wadah sampel yang diambil dan metode yang sesuai dengan jenis sampel. tanah rebusan diinokulasikan kedalam cawan yang telah berisi medium NA kemudian disreak sinambung. permukaan. Pembahasan Pengambilan sampel (tanah kandang) dilakukan dengan cara sterilisasi sendok yang ingin dipakai terlebih dahulu dengan menggunakan autoklaf kemudian ambil sampel tanah kedalaman 3cm dari permukaan. dan panas yang terlalu tinggi. Kemudian sampel yang mengandung bakteri tersebut dijaga agar tetap menggambarkan kondisi yang ada sebelum memasuki tahap analisa.

digunakan untuk melakukan berbagai macam uji.berukuran sedang atau moderate. dan margin entre. memiliki permukaan yang halus dan mengkilap.2 μm. Pewarna basa yang biasa digunakan untuk pewarnaan sederhana ialah memilen biru. permukaan halus mengkilap. dibuat preparat ulas bakteri uji dengan metode pewarnaan sederhana dengan menggunakan pewarnaan metilen blue kemudian diukur panjang dan lebar sel kemudian dihitung panjang dan lebar sel sebenarnya (µm). Zat-zat warna yang digunakan untuk pewarnaan sederhana umumnya bersifat alkolin. krisdal violet dan karbol fuehsin (Sudjadi. Bacillus berbentuk bulat (coccus).5 µm. Koloni tunggal yang terbentuk diperiksa menggunakan pewarnaan Gram untuk melihat karakteristik dinding sel dan bentuk dari sel tersebut. Selain diamati ciri-ciri morfologi koloninya hasil pemurnian juga digunakan untuk pembuatan stok di media NA miring kemudian diinkubasi selama 2x24 jam pada suhu ruang. Uji pewarnaan gram dilakukan dengan mengulas bakteri pada object glass kemudian difiksasi selama 3-5 kali tujuan dari fiksasi adalah untuk 26 . skala panjang dikali hasil kalibrasi yaitu 2.0-1. skala lebar dikali hasil kalibrasi yaitu didapatkan 2. Pengamatan dengan mikroskop dilakukan dengan menggunakan mikroskop jenis mikroskop cahaya.5 µm. Hasil perhitungan kalibrasi dimana skala object dibagi dengan skala okuler dikali 10 µm didapatkan hasil 2. elevasi convex. lebar 1-1. 2006). Dengan pewarnaan sederhana dapat mengetahui bentuk dan rangkaian sel-sel bakteri. 2006). digunakan perbesaran sebesar 1000x dan menggunakan minyak imersi.5 μm (Sudjadi.5 µm kemudian lebar sel sebenarnya. Bacillus thuringiensis atau biasa disebut Bt berbentuk batang dengan ukuran panjang 3-5 μm dan lebar 1. Untuk pengamatan dinding sel bakteri. Disebut sederhana karena hanya menggunakan satu jenis zat warna untuk mewarnai organisme tersebut. Bacillus antracis yaitu bakteri berbentuk batang berukuran panjang 1-8 μm. Pembuatan stok dilakukan dua kali. Pewarnaan sederhana merupakan teknik pewarnaan yang paling banyak digunakan. sehingga didapatkan panjang sel sebenarnya. Pengukuran panjang dan lebar sel dilakukan dengan menyiapkan mikroskop yang telah dipasang micrometer okuler yang terkalibrasi.

Bakteri gram positif mempertahankan zat warna gentian violet dan bakteri gram negatif mempertahankan warna merah (Udin. Didiamkan selama 45 detik. hasilnya hanya tumbuh diatas permukaan medium. Uji pewarnaan endospora dilakukan dengan mengulas bakteri pada object glass kemudian ditutup dengan kertas merang lalu ditetesi dengan malachite green diatas kertas merang kemudian diuapkan diatas dandang. Jangan sampai mengering jika kering ditetesi lagi malachite green. Uji mortilitas bakteri yang diinokulasikan pada medium SIMA semisolid sebanyak 1 ose kemudian diinkubasi selama 2x24 jam pada suhu ruang 30oC. 2008). dicuci keringanginkan kemudian diamati dibawah mikroskop didapatkan hasilkan endospora berwarna hijau sedangkan sel vegetative berwarna merah. nutrisi. Setelah terwarnai dicuci keringanginkan kemudian dicuci dengan gram C (ethanol 96%) setetes demi setetes sampai ethanol yang jatuh berwarana bening. Kemudian bilas dengan aquades lalu ditetesi dengan safranin sebagai counterstain yang digunakan untuk melumuri bagian warna dari sel yang lain daripada endospora (James. 2008). membuka poripori dari sel bakteri sehingga mudah terwarnai.mematikan sel bakteri tanpa merubah bentuk dan strukturnya. pemberian Kristal violet bertujuan untuk memberikan warna dasar atau pewarna primer yaitu pewarnaan dinding sel bakteri. Kemudian dicuci keringanginkan. 2001). Kemudian ditetesi dengan gram A yaitu Kristal violet didiamkan selama 60 detik. Banyaknya koloni bakteri yang tumbuh pada suatu substrat sangat dipengaruhi oleh tersedianya kondisi fisik. Hasil yang didapat terlihat warna ungu muda. 2001). Berfungsi untuk melarutkan pewarna (decolorizing agent) kemudian ditetesi dengan gram D (safranin) dibiarkan 45 detik lalu cuci keringanginkan. ditetesi lugol’s iodine dibiarkan selama 60 detik bertujuan sebagai pewarna kedua atau pewarna pengganti. menunjukan tidak adanya pertumbuhan koloni pada medium tegak SIMA yang telah ditusuk dengan jarum ose. Pemanasan bertujuan untuk membantu warna menembus dinding endospora. Setelah itu amati dibawah mikroskop. pemberian malachite green bertujuan untuk melumuri fiksasi panas. dan merekatkan bakteri ke object glass (Udin. pemberian safranin digunakan sebagai pewarna pembanding (James. dan sifat 27 . namun jangan sampai terlalu banyak.

Uji VP (Voges Proskaner) menggunakan medium cair MR-VP yang telah diinokulasikan dengan 1 ose bakteri kemudian diinkubasi selama 2x24 jam pada temperature 30oC.3-butanadiol. 2011). Bila bakteri memfermentasikan karbohidrat menjadi 2. Uji hidrolisis starch dengan menggunakan medium padat Starch Agar sebanyak 1 ose yang diinkubasi selama 2x24 jam dalam suhu ruang kemudian permukaan media digenangi dengan larutan Lugol’s iodine menghasilkan positif karena terbentuknya zona jernih pada media hal ini disebabkan karena enzim amilase yang bersifat eksoenzim akan memecah amilum menjadi monomer-monomernya. Starch atau pati dipecah menjadi unit-unit yang lebih kecil yaitu dengan memotong ikatan-ikatan glikosidiknya. 2009). berukuran 1. Hasil menunjukan positif yaitu terdapatnya zona jernih pada media SMA. 2006). Kaseinase akan memecah kasein menjadi parakaseinase yang dapat bereaksi dengan susu tersebut sehingga menghasilkan kalsium parakaseinat. Penambahan alfanaftol akan bereaksi dengan aseton sedangkan pemberian KOH 40% untuk mengoksidasi proses tersebut sehingga terjadi warna orange sampai merah. Uji hidrolisis kasein menggunakan medium padat Skim Milk Agar (SMA) diinokulasikan bakteri sebanyak 1 ose kedalam medium tersebut kemudian diinkubasi selama 2x24 jam suhu ruang. bakteri ditetesi dengan alfanaftol sebanyak 3 tetes dan KOH 40% 2 tetes menunjukan hasi positif karena warna media menjadi orange muda mendekati merah.hudupnya (Priyani.6 µm. 28 . tidak mempunyai alat gerak atau motil (Akoso. Uji ini digunakan untuk mengidentifikasi mikroorganisme yang melaksanakan fermentasi 2. Namun ada beberapa spesies Bacillus yang tidak bersiat motil salah satunya adalah Bacillus anthracis merupakan bakteri berbentuk batang. Pertumbuhan dipermukaan medium ini dikarenakan Bacillus merupakan bakteri yang bersifat aerob.3-butanadiol sebagai produk utama. hal ini disebabkan pada saat menginokulasikan bakteri dengan menggunakan jarum ose. bakteri tersebut tidak masuk ke dalam media hanya tertanam dipermukaan. Salah satu yang dapat memotong ikatan glokosidik adalah enzim amilase (Anonim. Prinsip dari uji ini adalah menentukan kemampuan beberapa mikroorganisme untuk menghasilkan produk akhir yang netral (asetil-mythyil karbinol) dari fermentasi glukosa. Namun tidak membuktikan mortilitas.

ditetesi dengan reagen oksidase kemudian diamati perubahan yang terjadi. berarti bakteri tersebut mampu memproduksi enzim katalase. bahkan ada yang menghasilkan superoksida yang sangat beracun. Enzim oksidase memegang peranan penting dalam transport electron selama respirasi aerobik. Uji katalase dilakukan dengan membuat preparat ulas bakteri pada object glass. Sitokrom oksidase mengkatalisis oksidasi dan reduksi sitokrom oleh molekul oksigen. fakultatif aerob maupun mikroaerofilik yang menggunakan jalur repirasi aerobik. Uji oksidase dilakukan dengan membuat preparat ulas bakteri pada object glass. Penambahan KOH adanya asetolin ditunjukan oleh perubahan warna kaldu menjadi merah muda. ditetesi dengan larutan H2O2 kemudian diamati perubahan yang terjadi hasil menunjukan positif karena terbentuknya gelembung gas. Jika dihasilkan gelembung gas. Enzim oksidase dihasilkan oleh bakteri aerob. Hasil yang didapat positif karena hasil ulasan yang telah ditetesi reagen oksidase berwarna biru marun. 2006). Perubahan warna ini diperjelas dengan penambahan larutan alfanaphtol.3-butanadiol dioksidasi kembali menjadi asetolin sehingga memperjelas hasil reaksi (Sudjadi. Perubahan warna kaldu biakan lebih jelas pada bagian yang berhubungan dengan udara. dan mikroaerofilik. karena sebagian 2. ditutup dengan potongan tissue. Superoksida dismutase adalah enzim yang bertanggung jawab untuk menguraikan khususnya superoksida pada organisme aerob yang bersifat katalase negatif. suatu senyawa pemuka dalam sintetis 2. 2006). Senyawa ini dalam jumlah yang besar akan menyebabkan kematian pada mikroorganisme.3-butanadiol. Selama respirasi aerobik (proses fosforilasi oksidatif).akan terjadi penumpukan bahan tersebut dalam media pertumbuhan (Sudjadi. Jika tidak dihasilkan gelembung gas berarti uji katalase dinyatakan negative. Senyawa ini dihasilkan oleh mikroorganisme aerobik. Produksi katalase bisa diidentifikasikan dengan menambahkan reagen H2O2 pada suspense bakteri. mikroorganisme menghasilkan hydrogen peroksida. Penambahan 40% KOH dan 5% larutan alfanaphtol dalam etanol dapat menentukan adanya asetolin (asetilmethylkarbinol). Sifat kemoorganotrop dan fakultatif anaerob pada 29 . fakultatif anaerob.

Berdasarkan hasil perhitungan persen homologi. Menyebabkan bakteri ini mampu memanfaatkan sumber karbon tersedia (Priyani. 6. sebagai akseptor elektron terakhir selama penguraian karbohidrat untuk menghasilkan energi. isolate diinokulasikan kedalam ketiga tabung masing-masing 1 ose. Positif tertunda (warna biru muncul antara 10-60 detik setelah ditetesi) menandakan bahwa bakteri uji memiliki sedikit enzim. Hasil yang didapat tingkat kekeruhan yang paling tinggi adalah pada konsentrasi NaCl 0%. diinkubasi selama 2x24 jam pada temperature 30oC kemudian diamati perubahan warna pada media. Kemampuan bakteri memproduksi sitokrom oksidase dapat diketahui dari reaksi yang ditimbulkan setelah pemberian reagen oksidase pada koloni bakteri. inkubasi selama 2x24 jam pada temperature 30oC kemudian diamati perubahan yang terjadi. Enzim ini merupakan bagian dari kompleks enzim yang berperan dalam proses foforilasi oksidatiif.phenylenediaminedihyrocloride. hasil yang didapat adalah negatif karena media tetap berwarna biru. Uji penggunaan sitrat dilakukan dengan menginokulasikan bakteri uji pada medium agar miring Simon Citrate sebanyak 1 ose. 2006). Uji lactose dan raffinosa dilakukan dengan cara bakteri uji ditumbuhkan pada medium lactosa dan raffinosa. hasil menunjukan bahwa warna media tidak berubah tetap berwarna ungu.5%. dan 10%. 2008). Penentuan spesies melalui pendekatan homologi dilakukan dengan mengumpulkan data-data yang diperoleh kemudian dibandingkan dengan data karakter bakteri dari sumber.Bacillus sp. Sumber karbon asam sitrat akan dipecah menjadi oksalo asetat kemudian menjadi asam asetat. Uji toleransi NaCl dibuat tiga buah tabung Nutrient broth yang mengandung NaCl 0%. Karena adanya proses peningkatan ph sehingga berwarna biru. Reagen akan mendonorkan electron terhadap enzim ini sehingga akan terosidasi membentuk senyawa yang berwarna biru kehitaman. Reagen yang digunakan adalah tetramethylD. Tidak adanya perubahan warna mengindikasikan bahwa uji yang dilakukan negatif (James. Mikroorganisme ini menggunakan oksigen. diinkubasi selama 2x24 jam pada temperature 30oC kemudian diamati hasilnya dengan melihat tingkat kekeruhan media. jumlah terbesar adalah 80% yaitu antara isolat dengan spesies A 30 .

kuda. Vegetasi sel berukuran panjang 8 mikron dengan lebar 1-1. Misalnya domba. 31 . unta. 2009). sejenis campuran kuda-keledai. air. dan kambing. Bacillus anthracis termasuk klasifikasi gram positif. Bakteri ini banyak menyerang hewan herbivora. lembu. atau benda apa pun. Kuman ini berkembang dan bertahan tahunan dalam berbagai keadaan di tanah. Karena pengambilan sampel tanah disekitar kandang maka tanah tersebut mengandung banyak Bacillus anthracis. nonmotile.5 mikron ini mampu hidup selama bertahun-tahun di tanah (Akoso.(Bacillus anthracis). yang menjadi cikal bakal bakteri spora. rusa.

aerobik. air. misalnya. Di alam bebas bakteri ini membentuk spora yang tahan puluhan tahun dalam tanah dan bisa menjadi sumber penularan pada hewan dan manusia.1 Kesimpulan Kelompok Bacillus merupakan bakteri berbentuk batang (basil). air. Bacillus cereus dapat menyebabkan keracuann makanan oleh enterotoksin yang terdapat pada makanan seperti nasi yang telah dimasak tetapi kemudian diletakkan ditempatyang hangat sehingga terjadi sporulasi dan terbentuklah toksin itu. memerlukan oksigen untuk hidup. ada beberapa penelitian ditemukan bahwa penambahan Bacillus subtilis perairan dapat meningkatkan kualitas perairan dengan 32 .Antraks otak terjadi jika bakteri terbawa darah masuk ke otak. Iturin membantu Bacillus subtilis berkompetisi dengan mikroorganisme lain dengan cara membunuh mikroorganisme lain atau menurunkan tingkat pertumbuhannya. dan tergolong dalam bakteri gram positif yang umumnya tumbuh pada medium yang mengandung oksigen (bersifat aerobik) sehingga dikenal pula dengan istilah aerobic sporeformers. tanaman. Karenanya ada empat tipe antraks yaitu antraks kulit. mampu membentuk endospora. pada pekerja di pabrik wool atau kulit binatang. Dapat juga menyebabkan pneumonia. mengonsumsi produk hewan yang kena antraks: atau melalui udara yang mengandung spora. bronkopeumonia dan luka. Bacillus adalah organisme saprofit yang lazim terdapat dalam tanah. maupun bahan dari hewan sakit (kulit. Penyebab antraks adalah bakteri Bacillus anthracis. Iturin juga memiliki aktivitas fungisida terhadap pathogen. antraks usus (pencernaan). udara dan materi tumbuhan yang terdekomposisi. tulang atau darah). antraks paru (pernapasan) dan antraks otak. dan tumbuh-tumbuhan. salah satunya adalah iturin. Bakteri ini adalah jenis bakteri yang umum ditemukan di tanah. Penularan pada manusia bisa lewat kontak langsung spora yang ada di tanah.BAB III PENUTUP 3. Hewan tertular akibat memakan spora yang menempel pada tanaman yang dimakan. Hewan yang mati akibat antraks harus langsung dikubur atau dibakar. Termasuk kelompok bakteri gram positif. Bacillus subtilis memiliki kemampuan memproduksi antibiotik dalam bentuk lipopeptida. Bakteri ini bersifat aerob. udara. daging. tidak boleh dilukai supaya bakteri tidak menyebar.

uji hidrolisis kasein.5 sedangkan Panjang sel sebenarnya 2. jumlah terbesar adalah 80% yaitu isolat Bacillus anthracis karena sampel yang digunakan adalah tanah kandang. Berdasarkan hasil perhitungan persen homologi. uji VP. dan margin entre. uji hidrolisis starch. Selain itu Bacillus subtilis secara alami bersimbiosis pada saluran pencernaan udang windu. elevasi convex. 33 . Hasil uji positif yaitu uji pewarnaan gram. Bacillus sp. dan uji oksidase. Penggunaan Bacillus subtilis pada tambak udang menunjukkan bahwa Bacillus subtilis mampu meningkatkan kesintasan larva udang windu dan mencegah dari penyakit vibriosis akibat Vibrio harveyi. dan uji toleransi NaCl. pewarnaan endospora. memiliki ciri-ciri morfologi sebagai berikut: koloni berbentuk bulat atau circular. Hasil uji negatif yaitu uji lactose dan raffinosa. Lebar sel Bacillus sebenarnya 2.5 . uji penggunaan sitrat. berukuran sedang atau moderate. uji katalase.mengurangi konsentrasi CO2 perairan. uji motilitas. permukaan halus mengkilap.

A. Melnick dan Adelberg. Vol. Dwipayana. Cambridge: University Press. 1996... Priyani. Penerbit Kanisius (Anggota IKAPI): Yogyakarta. Uji Potensi Bacillus sp. Penerbit Yudhistira. N. Bandung. 2006. I and Feltham. Soemarno. Akoso. 2008. Australia. Dasar – dasar Mikrobiologi..blogspot. D. S. Barrow. 2000. N. Colin. Rahim. 1994. Sudjadi. Herto. J. 2009. 1 (2). 2006. R. Abdul dkk. Hal 35-37. James. D. B. EGC: Jakarta. Buku Ajar Mikrobiologi Kedokteran Edisi Revisi. dan Escherichia coli dalam Mendegradasi Alkil Berzen Sebagai Bahan Aktif Sumatra. Laila.DAFTAR PUSTAKA Jawetz. B. Akademi Analis Kesehatan: Yogyakarta.K. G. Prinsip-Prinsip Sains untuk Keperawatan. 2010. ISSN 1907-5537. Binarupa Aksara: Jakarta. Epidemiologi dan Pengendalian Anthrax Penyakit Menular pada Hewan dan Manusia. B. http://dede-bogel. Biologi Sains dalam Kehidupan.. Liliyanto.shvoong. Environmental Engineering Study Program..1993.com/2011/07/karakteristik-dan-potensi-antibiotik. Dwidjoseputro.. Penerbit Erlangga: Jakarta. Identification of Bacterial Diversity in Waste Recycling Paint Sludge by Conventuonal Microbiological Technique. 1998. dan Kiki.com/exact-sciences/biochemistry/2174115-bakteri-bacilluscereus/#ixzz1raKQo3MA 34 Detergen. Isoalsi dan Identifikasi Bakteri Klinik. Djambatan: Malang. Cowan and Steel’s Manual for The Identification of Medical Bacteria Third Education.Jurnal Biologi . Mikrobiologi Kedokteran.html http://id.

com/2008/11/22/4141 file:///F:/laporan-isolasi-dan-identifikasi.com/2011/02/bacillus-subtilis-dan-aplikasinya-dalam.wordpress.http://lutfiblurry.html http://yongkikastanyaluthana.blogspot.html 35 .

Sign up to vote on this title
UsefulNot useful