Anda di halaman 1dari 16

NON GENITAL WARTS I.

PENDAHULUAN Veruka vulgaris atau kutil adalah proliferasi jinak pada kulit dan mukosa yang disebabkan olehhuman papillomavirus (HPV).Saat ini, lebihdari 100jenis HPVtelah diidentifikasi.HPV tipetertentucenderungterjadi di

lokasianatomitertentu, namun kutildari setiap jenisHPVdapat terjadidi daerah manapun.(1)Human Papillomavirusdapat ditemukanpada manusiadan

sejumlahspesies lain dan merupakan genum dari papillomaviridae.Penyebab yang paling sering HPV subtype 1, 2, 3, 4, 5 dan 8 yang terdeteksi.(2) Virus initidak menghasilkantanda-tandaakut ataugejala, tetapimenyebabkanlesiyang tumbuh lambatyang dapat tetapsubklinisuntukjangka waktu yang lama. subsethuman papillomavirus(HPV) telah dikaitkandengan perkembangankeganasanepitel.(3) Pada Veruka Vulgaris danberbagai

manifestasiklinisnyaadalahbersisik,kasar,papulaberduriataunodul

ukuranmulai dari 1mm sampailebih besardari 1 cmyang dapat ditemukanpada permukaankulit, paling sering di tangan dan kaki.(2) HPV tipe 1, 2, 3, dan 4 dapat diisolasi dari kutil kulit. Penularan biasanya melalui kontak langsung atautidak langsung,(4) Faktor predisposisimeliputigangguan

terhadappenghalangepitelnormal.Pengobatanbisa sulit jika terdapat kegagalan dan kekambuhan.Namun, banyakmenghilang secara spontandalam beberapa tahun.(1) Hasil studi histologis diantara semua jenis hampir mirip. Mereka menunjukkan alcanthosis, perpanjangan dari papilla dermal, adanya sel vakuol dengan inti padat dan keriput dan dengan inklusi basofilik keratin yang abnormal pada lapisan dangkal dari epidermis. (5) Kutilvirussangat umum, jinakdan biasanyamembatasi diri.infeksi

selepidermisdenganhuman papillomavirus(HPV) menghasilkan proliferasi sel danmenebal, papulberkutilpada kulit.tempat yang paling
(6)

seringterlibat

adalahtangan dan kakitetapi setiapdaerah kulitdapat terinfeksi.

II.

EPIDEMIOLOGI Kutil tersebar luas pada populasi di seluruh dunia.(1)Tidak ada informasi

yang dapat dipercaya tentang infektivitas dari common wart, tetapi pengalaman secara subtansial tidak mendukung. Risiko penularan dari ibu ke anak dengan perkembangan penyakit selanjutnya pada anak telah diperkirakan antara 1 dalam 80 sampai 1 dalam 1500.Cara transmisi kutil menyebar dengan kontak langsung atau tidak langsung langsung (melalui objek yang terkontaminasi). Autoinokulasi (melalui garukan) dari satu lokasi ke lokasi yang lain di badan juga bisa menyebarkan virus HPV.
(7)

Penurunan fungsi penghalang epitel, oleh trauma

(termasuk lecet ringan), maserasi atau keduanya, sebagai predisposisi untuk inokulasi virus, dan umunya diasumsikan sebagai cara masuknya infeksi paling tidak pada lapisan keratin kuit. (8) Veruka Vulgaris diperkirakan mempengaruhi sekitar 7-12% dari populasi meskipun frekuensinya tidak diketahui. Pada anak usia sekolah, prevalensinya 1020%. Frekuensi meningkat juga terlihat di antara pasien imunosupresi. Meskipun kutil dapat mempengaruhi ras apapun, kutil umum muncul sekitar dua kali lebih sering pada orang kulit putih daripada orang kulit hitam atau Asia. Hiperplasia epitel fokal (penyakit Heck) adalah lebih umum di kalangan Indian Amerika dan Inuit.Male-wanita pendekatan rasio 1:1.Warts dapat terjadi pada semua usia. Peningkatan kejadian di antara anak usia sekolah, dan puncak pada 12-16 tahun.(1) Adabeberapadata mengenai populasipada insidendan prevalensikutil umum. prevalensimungkinsangat bervariasiantara berbagaikelompok umur, populasi dan periodewaktu.Dua studi besar mengenai 0-84% anak-anakdan dan dewasa populasimenemukan 12-9%.Tingkat muda.studipada padaanak usia4-

tingkatprevalensimasing-masing prevalensitertinggiadalahpada populasisekolahtelah

menunjukkan

tingkatprevalensi12%

6tahundan 24% pada 16-18tahun.(6) Insiden usia spesifik kutil non-genital berbeda dari kutil genital yang jarang terjadi pada anak. (3)

III. ETIOLOGI Kutildisebabkanoleh Human Papilloma Virus (HPV)yang adalebih dari 70jenis yang berbeda.(6) Veruka vulgaris adalah jenis kutil yang banyak ditemukan dan disebabkan terbanyak oleh HPV serotip 2 dan 4.(5) HPV

adalahvirus DNA rantai gandadengankapsidikosahedraldari 72capsomersdan5055nm yangmerupakan family Papovaviridae, kelompok Papova dansubkelompokpapiloma. Lebih dari 55jenisHPVyang telah diakui.(9) HPV sulit untuk dipahami karena tidak dapat dibiakkan pada kultur jaringan. Namun kemajuan dalam biologi molekulertelah memungkinkankarakterisasi darigenomHPV danidentifikasi beberapafungsi genHPV.(7) Lesi klinikal Commons Warts Flat warts Plantar Warts Acuminated Condylomata Laryngeal Papilloma Oral Leukoplakia Lesi atipikal pada Tipe HPV 1, 2, 3, 4, 7, 10, 16, 29, 41, 60, 65 3, 10 1, 2, 3, 4, 10 6, 10 6, 11 16, 18 pasien 20, 27, 49

immunocompromised. Tabel 1: Kaitan antara lesi klinikal dan tipe Human Papillomavirus (HPV)(9)

Virus

hanyadapat

bereplikasi itu

di

keratinosit.Hal

itu

menyebabkanproliferasiepitel.Setelah kemudianmenjadi reaktif.Masa

infeksidapat mulai

menjadilatendan dari berminggu-

inkubasibervariasi

minggusampai satu tahun.Jenis-jenis kutil dapatbervariasi tergantung daripada kulit dan mukosa serta lokasi predileksinya.Mereka ditransmisikansecara langsung (orang ke orang) maupun secara tidak langsung.Hanya dalampersentase yang sangatkecil kasuskutil menjadidisplastiklesineoplastikatautergantung

padajenis HPVdan faktorgenetik dan lingkungan.Pertahanan tubuhterhadap resikoHPVbelum dipahami dengan baik.Mungkintergantung padaimunitas seluler,

karena jika imunitas seluler menurunkejadian kutillebih besar, penyebaranlebih luasdan ada risikoyang lebih tinggi menjadi ganas.(9)Infeksi HPVtidak hanyaumum ditemukan tetapijuga sulituntuk mengobati dan mencegah.Sering adaperiode latenyang panjangdan infeksisubklinis,dan HPVDNA dapatditemukan padajaringan normalorang dewasa. (7)

IV. PATOGENESIS Infeksi HPV terjadi melalui inokulasi virus pada epidermis yang viabel melalui defek pada epitel.Maserasi kulit mungkin merupakan faktor predisposisi yang penting, seperti yang ditunjukkan dengan meningkatnya insidens Veruka Plantar pada perenang yang sering menggunakan kolam renang umum.Mesti faktor reseptor seluler untuk HPV belum diidentifikasi, permukaan sel heparan sulfat, yang dikode oleh proteoglikan dan berikatan dengan partikel HPV dengan afinitas tinggi, dibutuhkan sebagai jalan masuknya.Untuk mendapat infeksi yang persisten, mungkin penting untuk memasuki sel basal epidermis yang juga sel punca (sel stem) atau diubah oleh virus menjadi sesuatu dengan properti (kemampuan/karakter) seperti sel punca. Dipercayai bahwa single copy atau sebagian besar sedikit copy genom virus dipertahankan sebagai suatu plasmid ekstrakromosom dalam sel basal epitel yang terinfeksi. Ketika sel-sel ini membelah, genom virus juga bereplikasi dan berpartisi menjadi tiap sel progeni, kemudian ditranportasikan dalam sel yang bereplikasi saat mereka berimigrasi ke atas untuk membentuk lapisan yang berdifferensiasi.(3) Setelah eksperimen inokulasi HPV, veruka biasanya muncul dalam 2 sampai 9 bulan.Observasi ini mengimplikasikan bahwa periode infeksi subklinis yang relatif panjang dan dapat merupakan sumber yang tidak terlihat dari virus infeksius.Permukaan yang kasar dari kutil dapat merusak kulit yang berdekatan dan memungkinkan inokulasi virus ke lokasi yang berdekatan, dengan perkembangan kutil yang baru dalam periode minggu sampai bulan. Tiap lesi yang baru diakibatkan paparan inisial atau penyebaran dari kutil yang lain. Tidak

ada bukti yang meyakinkan untuk disseminasi melalui darah. Autoinokulasi virus pada kulit yang berlawanan seringkali terlihat pada jari-jari yang berdekatan dan di regio anogenital.(3) Ekpresi virus (transkripsi) sangat rendah sampai lapisan Maplphigi bagian atas, persis sebelum lapisan granulosum, dimana sintesis DNA virus menghasilkan ratusan salinan genom virus tiap sel. Protein kapsid virus disintesis menjadi virion di sel nukleus. DNA virus yang baru disintesis ini dikemas menjadi virion dalam nukleus sel-sel Malphigi yang berdifferensiasi ini.protein virus yang dikenal dengan E1-E4 (produk RNA yang membelah dari gen-gen E1 dan E4) dapat mengiduksi terjadinya kolaps dari jaring-jaring filamen keratin sitoplasma ini. Hal ini dipostulasikan untuk memfasilitasi pelepasan virion dari sitoskeleton yang saling berikatan silang dari keratinosit sehingga virus dapat diinokulasikan ke lokasi lain atau berdeskuamasi ke lingkungan.(3) HPV tidak bertunas dari nukleus atau membran plasma, seperti halnya banyak virus seperti virus herpes simpleks atau human immunodeficiency virus (HIV).Oleh karena itu, mereka tidak memiliki selubung lipoprotein yang menyebabkan kerentanan terhadap inaktivasi yang cepat oleh kondisi lingkungan seperti pembekuan, pemanasan, atau dehidrasi dengan alkohol.Berlainan dengan itu, virion HPV resisten terhadap desikasi dan deterjen nonosinol-9, meskipun paparan virion dengan formalin, deterjen yang kuat seperti sodium dodesil sulfat, atau temperatur tinggi berkepanjangan mengurangi infektivitasnya.HPV dapat tetap infeksius selama bertahun-tahun ketika disimpan di gliserol dalam temperatur ruangan. Memang, bentuk L1 dan L2 membentuk kapsid protein yang sangat stabil dan terbungkus rapat.(3)

V.

GAMBARAN KLINIS Ada beberapa jenis verruca vulgaris yang memiliki karakteristik klinis

diagnostik nama sesuai dengan fitur klinis, jenis virus dan situs yang terkena. a. Plantar wart Veruka vulgaris yang terjadi pada telapak kaki.Sebuah bentuk lesi keratotik tanpa elevasi yang berbeda. Menyerupai tylosis dan clavus, tetapi dapat dibedakan dengan cara dikorek. Jika permukaan scraping dari lesi menyebabkan keratotik petechiae, diagnosis kutil plantar. b. Myrmecia Kecil, bentuk kubah berbentuk nodul pada telapak kaki.Hal ini disebabkan oleh infeksi HPV-1 dan mungkin menyerupai moluskum kontagiosum.Hal ini juga disebut kutil palmoplantar yang dalam.Memiliki penampilan berwarna merah, dan seperti kawah. c. Pigmented wart Hal ini disebabkan oleh infeksi HPV-4 atau HPV-65, atau HPV-60 dalam kasus yang jarang.Ini memiliki fitur klinis veruka vulgaris dan pigmentasi kehitaman, juga disebut kutil hitam. d. Punctate wart Hal ini disebabkan oleh infeksi HPV-63.Beberapa, belang-belang, putih lesi keratotik 2mm sampai 5mm terjadi pada tangan dan telapak kaki. e. Filiform wart Memiliki penampilan panjang, penonjolan kecil, tipis dengan diameter beberapa milimeter terjadi pada daerah kepala, wajah atau leher.(3)

VI.

PEMERIKSAAN PENUNJANG

a. Histopatologi Verruca terdiri dari epidermis yang akantotik dengan papillomatosis, hiperkeratosis, dan parakeratosis.(9,10)Rete ridges yang memanjang seringkali tertuju langsung pada pusat kutil. Pembuluh darah kapiler dermis ialah prominen dan mungkin mengalami trombosis.Sel-sel mononuklear mungkin ada. Keratinosit besar dengan nukleus piknosis eksentrik dikelilingi oleh halo perinukleus (sel koilositotik atau koilosit) merupakan karakteristik dari papilloma yang dikaitkan dengan HPV. Koilosit yang divisualisasikan dengan pengecatan Papanicolaou (Pap) menggambarkan tanda terjadinya infeksi HPV.Sel yang terinfeksi PV mungkin memiliki granul-granul eosinofilik kecil dan kelompok padat granulgranul keratohialin basofilik.Granul-granul tersebut dapat terdiri dari protein HPV E4 (E1-E4) dan tidak menunjukkan banyaknya partikel-partikel virus.Kutil yang datar kurang memiliki akantosis dan hiperkeratosis dan tidak memiliki parakeratosis atau papillomatosis. Sel koilositotik biasanya sangat banyak, menunjukkan sumber lesi virus.(3)

Gambar 1: (A) Veruka Vulgaris pada lengan, papul berbatas tegas dan hiperkeratotik. (B) Epidermal hiperplasia berbentuk seperti jari dengan gambaran lapisan granular yang jelas dan koilocytes. (C) Epidermal hiperplasia berbentuk verrucous dan akantosis dengan proliferasi basaloid dan keratinosit. (D) Kista horn dengan keratinosit yang mild atypia dan gambaran inflamasi.(14) b. Diagnosis Gambaran klinis dan riwayat penyakit, papul yang lama kelamaan membesar biasanya mengarahkan pada diagnosis kutil virus.Pemeriksaan histologi dapat digunakan untuk mengkonfirmasikan diagnosis tersebut.Antibodi untuk detergent-disrupted HPV particles yang terpapar dengan antigen L1 dan L2 terdapat pada sebagian besar HPV. Deteksi imunohistokimia dapat digunakan untuk mendeteksi kapsid protein ini pada materi-materi klinis, termasuk jaringan yang difiksasi dengan formalin, akan tetapi tidak sensitif.(3) VII. DIAGNOSIS BANDING a. Prurigo Nodularis Biasanya pada ekstremitas bagian bawah disertai rasa gatal.Dapat dibedakan dengan veruka vulgaris dari pemeriksaan histopatologi.

Gambar 2: Prurigo Nodularis (15)

b. Veruka plana Kutil yang berwarna kehitaman, lunak, berbentuk papula-papula datar berdiameter 1-3mm, terutama timbul di derah wajah, leher, permukaan ekstensor lengan bawah dan tangan.

Gambar 3: Veruka Plana(15)

c. Molluskum kontagiosum Pada Molluskum kontagiosum terlihat lesi solid dan tersebar berupa papul berdiameter 1-2mm. pada bagian tengahnya terdapat daerah umbilikasi disebut dele berisi badan moluskum.

Gambar 4: (A) Molluskum Kontagiosum pada badan. (B) Molluskum Kontagiosum pada penis.(15)

VIII. PENATALAKSANAAN Sebenarnya, sebagian veruka dapat mengalami involusi (sembuh) spontan dalam masa 1 atau 2 tahun.Pengobatan dapat berupa tindakan bedah atau non bedah. Tindakan bedah antara lain bedah beku N2 cair (Cryoteraphy), bedah listrik, dan bedah laser. Cara non bedah antara lain dengan bahan keratolitik, misalnya asam salisilat ; bahan kaustik misalnya asam triklorasetat, dan bahan lain misalnya kantaridin. (4) a. Asamsalisilat Produk yang mengandung asam salisilat dengan atau tanpa asam laktak sangat efektif untuk pengobatan veruka vulgaris yang dimana efikasinya sebanding dengan cryotheraphy.Efekkeratolitikasam ketebalan respon.Sebuahpersiapanyang

salisilatmembantuuntukmengurangi kutildandapatmerangsanginflamasi

mengandung12-26%salisilatasam,mungkindengantambahanasamlaktat,dalam collodiondasaratauakrilat,pengobatannyapilihanpertamauntukkutilumumdan plantar.Dalamstudibandingpenggunaanharianselama3bulanmencapai angka

kesembuhandari67%untukkutiltangan,84%untukkutilplantarsederhanadan45% untukkutilmosaikplantar,membandingkan baikdenganmetodelain.Penghapusan

permukaan keratindansisa-sisadariaplikasisebelumnyadenganmenggunakanbatu apungbatu,amrilpapanadalahawal membantudalamsemuakutildanpenting dalam kutilplantarhiperkeratotik.Namun,abrasioverenthusiastic merupakankesalahan

yangmungkinmeningkatkanpenyebaranvirusdenganinokulasikedalamkulityang berdekatan. Setelah kutilkering, deposit keputihan menetap. Penetrasi ketebal keratin,sepertiditingkatkanolehoklusiplesterperekat,yangmenyebabkanmaserasi lapisankeratindan penurunanfungsipenghalang.Oklusidapatmeningkatkantingkat responuntukpengobatandenganasamsalisilat.Namundapatsangatiritasipadakulit wajah, meskipunsangat berhati-hati aplikasi atau penggunaan formulasi lemah, sepertiasamsalisilat4%dicollodion fleksibel,mungkinbisaberhasil.
(3) (12,13)

Retinoic

acid pula sering digunakan terutamanya untuk flat warts, dan kemungkinan memiliki mekanisme bertindak yang sama.

Podofilin resin topikal juga merupakan antara pengobatan yang sering digunakan, terutamanya untuk veruka pada mukosa. NamunPodofilin tidak diberikan pada pasien yang hamil kerna potensi dari obat ini bisa berubah-ubah.(3) Bleomycin intralesi bisa menghilangkan virus HPV sekaligus tetapi harus digunakan dengan berhati-hati kerna bisa menyebabkan nekrosis jaringan yang berlebihan.(3) b. Glutaraldehida Sifatvirucidaldari glutaraldehidadapatdigunakandalam

pengobatankutil.Sediaandapatmengandungglutaraldehid10%dalam etanolberair ataudalamformulasigel.Faktabahwaglutaraldehidamengeringkedalamkulittanpa permukaandeposito(yangmungkinterhapus)bergunaaplikasiuntukkutilpadakaki.S ebuahsediaanGlutaraldehida20%dalamlarutan airmenghasilkan 72%angka

kesembuhanuntukberbagaikutilkulityangberbedadalam25individu.Dermatitis kontakalergiuntukglutaraldehida komplikasiyangjarangterjadi.(12) c. Cimetidin Cimetidin oral dengan dosis 30-40 mg/kgBB/hari telah dilaporkan mampu meresolusi veruka vulgaris.Dalamsebuahstuditerbuka18pasien yang diobati dengan 30-40 mg/kg setiap hari selama 3 bulan, dua pertiga menunjukkan yangterjadisesekalidannekrosiskulitadalah

resolusilengkapdarimerekakutiltanpakekambuhansetelah1tahun. Namun,dalamplasebo-terkontroldari54pasien,tidakadamanfaatyangsignifikan terapi simetidindiamati,dengansekitarsepertigameresponbaikpengobatandan

kelompokplasebo.Cimetidinjugatelahdigunakanpadaanakdengandosiskecil untukmengobaticommonwartsetelahpengobatangagaldengansensitisasikontak menunjukkanresponberpotensi.(3, 12, 13) d. Intralesional bleomycin. Bleomycin memiliki efikasi yang tinggi dan penting untuk pengobatan veruka vulgaris terutama yang kronik.Bleomycin yang digunakan memiliki konsentrasi 1 U/mLyang diinjeksikan di dekat bagian bawah veruka hingga terlihat memucat. Protocol bervariasi, tetapi biasanya bleomycin sulfat 0.25-1 mg/mL

disuntikkansampai tiga kali untuk maksimum dosis total 4 mg; atau 1000 unit/mL

sampai dua suntikan dan total dosis maksimum 2000 unti. Seorang yang lebih endah konsentrasi 500 unit/mL tampak efektif. Suntikan ke dalam kutil itu sendiri, dikonfirmasi dengan mengamati blanching dalam lesi, volume per lesi disuntikkan berkisar antara 0,2 dan 1,0 mL. suntikan sangat menyakitkan dan anastesi local sebelumnya atau bersamaan harus dipertimbangkan, terutama untuk situs-situs sensitive seperti jari-jari dan telapak. Sebuah eschar berdarah berkembang 2-3 minggu kemudian; itu dikelupas kebawah, jika belum mengelupas secara spontan.Studi ini meloprkan tingkat obat untuk kutil sebelumnya refraktori kutil antara 30-100%.Komplikasi local suntikan kuku termasuk kehilangan kuku atau distropi periungual, seperti pada Fenomena Raynaud.Risiko penyerapan sistemik merupakan kontrindikasi untuk bleomycin intralesi dalam kehamilan.(12,13) e. Cryotherapy Pengobatan ini merupakan lini pertama yang selalu digunakan pada kasus veruka vulgaris.Cryotherapy merupakan nitrogen cair umum digunakan di praktek rumah sakit. Instrument canggih yang tersedia untuk memproduksi aliran tipis cairan yang akan diarahkan pada lesi, dapat juga dengan aplikasi cotton bud yang dicelupkan ke dalam cairan. Setiap keratin yang tebal harus dikupas. Hal ini akan meningkatkan tingkat penyembuhan kutil plantar yang dalam. Permukaan mukosa harus akan kering untuk menghindari pembentukan es permukaan, maka ujung kuncup tidak harus emperan permukaan kutil. Dalam pengobatan standar, aplikasi dilanjutkan sampai tepi jaringan es (mudah dilihat sebagai warna putih) lebar sekitar 1 mm berkembang dalam posisi kulit normal sekitar kutil.Hal ini dapat merangsang pengembangan respon imun. Setelah pencairan, kedua siklus beku akan meningkatkan angka kesembuhan di kutil plantar, meskipun manfaat kurang ditandai dalam kutil tangan. Respon terhadap pengobatan dengan cryotherapy sebanding dengan yang dicapai dengan sama salisilat. Pengobatan diulang setiap 3 minggu memberikan angka kesembuhan 30-70% untuk kutil tangan setelah 3 bulan. Lebih sering pengobatan dapat meningkatkan respon tetapi akan menyebabkan rasa sakit, dan interval yang lebih panjang. Jika ini gagal, sebagaimana dapat terjadi selama tonjolan tulang di kaki, lebih lama aplikasi,

biasanya sampai 30 detik, mungkin diulang setelah pencairan, dapat digunakan untuk mencapai efek destruktif yang lebih besar. (12, 13) Kerugian utama dari pembekuan adalah nyeri.Hal ini tak terduga dan mengejutkan variable antara pasien, tetapi dalam beberap kasus, terutama dengan waktu pembekuan lebih lama, itu bisa berat dan menetap selama beberap jam atau bahkan beberapa hari.Aspirin oral dan steroid topical yang kuat dapat membantu.Kulit melepuh, kadang-kadang berdarah, mungkin terjadi dalam satu atau dua hari namun tidak prasyarat untuk resolusi kutil, dan biasanya mengikuti overtreatment.Setelahwaktupembekuanbiasasingkat,reaksiakancenderungmemili kidiselesaikan dibawahnyabisa dalam waktu2-3minggu.Kadang-kadang,kerusakan jaringan

terjadi,misalnyauntuktendonataumatrikskuku,danberlebihan

kalipembekuan harus dihindari. Depigmentasi mungkinterjadi, dan bisa menjadi kelemahan kosmetikyangsignifikandalampasiendengankulitgelapberpigmen. (12) f. Laser Laser karbondioksida telah digunakan untuk mengobati berbagai

bentukyangberbedadarikutil,baikkulitdanmukosa.Halinidapatefektifdalam memberantas beberapa kutil sulit, seperti kutil periungual dan subungual, yangtelahtidakresponsifterhadappengobatanlainnya.Jarakpada12bulanhingga 70%darikutilindividudilaporkan.Namun,sebagaimetodeyangmerusak,karbo n dioksidaterapilaserdapatmenyebabkanrasasakitpasca-operasi
(12)

yangsignifikan,

jaringanparutdanhilangnyafungsisementara.

IX.

PROGNOSIS Sekitar 23% dari kutil regresi spontan dalam waktu 2 bulan, 30% dalam

waktu 3 bulan dan 65%-78% dalam 2 tahun. Pasien yang sebelumnya telah terinfeksi memiliki risiko lebih tinggi untuk pengembangan kutil baru daripada mereka tidak pernah terinfeksi.Tingkat kesembuhan dipengaruhi oleh factorfaktor seperti jenis virus, status kekebaln tubuh, tingkat dan durasi kutil. Common Wart memiliki insiden untuk menjadi suatu keganasan, banyak studi yang menunjukkan DNA HPV terdapat pada actinic keratoses, basal cells carcinomas dan SCCs dan psoriasis dalam kadar rendah. Namun etiologi dan petogenesis dari lesi jinak, pre-malignant tersebut masih kontoversial, karena dalam suatu penelitian yang menggunakan PCR dapat mendeteksi DNA HPV pada kulit normal dan pada folikel rambut normal. (12,13)

DAFTAR PUSTAKA 1. Senefeit P.D. Non-genital warts (online), cited 2011, June 30th, available from www.medscape.com 2. Haroen M.S, Purba H.M, Kartadjukardi E, Sularsito S.A. Giant Verruca Vulgaris: a case report in Med J Indones Vol. 18, No. 2, April-June; Haroen et al.; 2009. p. 135-138. 3. Androphy E.J, LowyD.R. Wart : Human Papiloma Virus, Common : Wart edited by Wolff K, Goldsmith L.A, Freedberg I.M, Eisen A.Z, Austen K.F, Katz S.I in Fitzpatricks : Dermatology in General Medicine, 7th Ed. McGraw-Hill: New York: 2008, p.1914-1922. 4. Sjamsoe E.S, Daili, Menaldi Sri Linuwih, Wisnu I Made. Veruka Vulgaris (kutil). Penyakit Kulit yang Umum di Indonesia. Jakarta Pusat: Medikal Multimedia Indonesia: 2005. p.69-72. 5. A. Guerra, E. Gonzalez, C. Rodriguez. Common Clinical Manifestations of Human Papilloma Virus (HPV) infection in The Open Dermatology Journal Vol. 3. Bentham Open; 2009. p.103-110. 6. Sam Gibbs. Local Treatment for Cutaneous Warts edited by Hywel Williams, Michael Bigby, Thomas Diepgen, Andrew Herxheimer, Luigi Naldi, Berthold Rzany in Evidence-based Dermatology, BMJ Books: London: 2003, p.423430. 7. G. Fabbrocini, S. Cacciapuoti, G. Monfrecola. Human Papillomavirus Infection in Child in The Open Dermatology Journal Vol. 3. Bentham Open; 2009. p.111-116. 8. A.Alba, M.Cararach, C. Rodriguez. The Human Papilloma Virus (HPV) in Human Pathology: Description, Pathogenesis, Oncogenic Role, Epidemiology and Detection Techniques in The Open Dermatology Journal, Vol. 3. Bentham Open; 2009. p.90-102. 9. Roberto Arenas. Viral Warts/Focal Epithelial Hyperplasia edited by Roberto Arenas, Roberto Estrada in Tropical Dermatology. Landes Bioscience: Georgetown, Texas: 2001, p. 273-279.

10. Gayle S. Westhoven. Papillomatosis, Atrophy and Alterations of the Granular Layer edited by Ramon L. Sanchez, Sharon S. Raimer in Dermatopathology. Landes Bioscience: Georgetown, Texas: 2001, p. 20-28. 11. John Hunter, John Savin, Mark Dahl in Clinical Dermatology, 3rd ed. Blackwell Publishing: Oxford: 2002, p. 201-205 12. Sterling, J.C. Viral Infection: Human Papiloma Virus, Common Wart in Rooks Textbook of Dermatology 7th Ed. Blaxkwell Publishing Inc. USA: 2004, p.25.39-25.53. 13. James WD, Berger TG, Elston DM. Papovavirus group. Andrews Disease of the Skin Clinical Dermatology. 10thEd: Philadelpia: McGraw-Hill:2006, p.403-407. 14. Jane M. Grant in Color Atlas of Dermatopathology. Dermatology: Clinical & Basic Science Series: San Francisco: 2007 15. Klaus Wolff, Richard Allen Johnson, Dick Suurmond. in Fitzpatricks Color Atlas & Synopsis of Clinical Dermatology: McGraw-Hills Access Medicine: 2007