Anda di halaman 1dari 45

Informtica Geral

CESPE
Questes de Concursos de 2010
(250 questes)

Prof. Belfort
professorbelfort@gmail.com

Braslia/DF
01/12/2010

!"#$%&'%$%&()&!*+,)&-+&..&%&./

0123456759
0

0123456717839717:6;<;=>715971:?43=7178;<<7@715>3A3B7=@CD<;1C1E=>;6=;>1FG:AC6;61H1IEFHJK
LC1M5;18C=8;6=;1719C@C<1@;15>3A3B7NOC1@;1>;8=CAC437<P12;6679;=>7<P Yx y76717Z636P1;9179Z3;=>;1o3=@Cw<P15971:A7=3Az718637@71;9
7:A387>3QC<1;1:6C8;@39;=>C<17<<C837@C<171E=>;6=;>1;1RSTUVSWTP1; 79Z3;=>;1r3=5GP1`1=;8;<<?6371713=<>7A7NOC1@;1591{e|}RS
8C=<3@;67=@C17123456717839717:6;<;=>7@7P1X5A45;1C<13>;=<1<;453=>;<K 7:6C:637@C1@;18C=Q;6<OC1=C18C9:5>7@C61M5;15<71C1o3=@Cw<K
YY 0C1<;18A38761C1ZC>OC1 P1C<1[WW\]1@71:?43=71<;6OC1;G3Z3@C<K Y~ ;P17C1<;18A387618C91C1ZC>OC1@36;3>C1@C1|]W1=713974;91M5;
^WW\_`15918C=>;a@C126;M5;=>;9;=>;17>57A3B7@C1;1:5ZA387@C ;<>?1=71:?43=71Q3<57A3B7@718C91C1EFHP1ml12C615971@7<
:C61591<b>3CK
C:Nd;<17:6;<;=>7@7<P1;=>OCP17C1<;18A38761;<<71C:NOCP1713974;9
Yc 0C1<;18A3876171C:NOC1
P1<;6OC17:6;<;=>7@7<1@3Q;6<7< <;6?18C:37@71:767171?6;71@;1>67Z7AzC1;1:C@;6?1<;613=<;63@71;9
C:Nd;<P1;=>6;1;A7<171M5;1:;693>;1;=Q376171:?43=71C51<;51eRSf1:C6 591>;G>C1;@3>7@C18C91C1o63>;61@C1v6i2238;K
8C66;3C1;A;>6g=38CK
08;6871@;18C=8;3>C<1@;1<3<>;97<1@;13=2C697Nd;<1;1@;1<;4567=N71@7
Yh i1>;G>C1@71:?43=71:C@;1<;61;@3>7@C1;1:5ZA387@C15>3A3B7=@CD<;
71C:NOC1jklml1=C1n386C<C2>1oC6@1;1<7AQ7=@CDC18C9C1pqnrK 3=2C697NOCP1X5A45;1C<13>;=<1<5Z<;M5;=>;<K1
016;<:;3>C1@;18C=8;3>C<1;19C@C<1@;15>3A3B7NOC1@;17:A387>3QC<1;1@; Y Vf|{P1591:6C8;@39;=>C1M5;1@;Q;1<;616;7A3B7@C19;=<7A1C5
<3<>;97<1C:;6783C=73<P1X5A45;1C<13>;=<1@;1.s&71./P171:76>361@71234567
7=57A9;=>;P1>;917123=7A3@7@;1@;14767=>36171:6C>;NOC1@;1@7@C<P
7:6;<;=>7@7K
3=8A5<3Q;18C=>6717>7M5;<1@;1U]K
Yt u7<C1<;1@;<;X;18C:3761591>;G>C1@71:?43=71Q3<57A3B7@718C91C
EFH1:767159176M53QC1;@3>7@C18C91C1o63>;61@C1v6i2238;P1@;Q;D c 013=2C697NOC1`15917>3QC1M5;P18C9C1M57AM5;61C5>6C17>3QC
<;1<;A;83C=761C1>;G>C1;17A>;6761712C=>;1:7671591>3:C1@3<:C=bQ;A 39:C6>7=>;1:7671C<1=;483C<P1>;91Q7AC61:767171C647=3B7NOC1;P
=C1v6i2238;P15971Q;B1M5;1;G3<>;13=8C9:7>3Z3A3@7@;1@;12C=>;
:C613<<CP1@;Q;1<;617@;M57@79;=>;1:6C>;43@7K
;=>6;1C<17:A387>3QC<1@C1o3=@Cw<1;1@C1v6i2238;K
 



0123456759
03

 !"#$%&'(!%()! (*()!*#!+,-$-.%&'(!*#!,#/0($(1-%)2!3#""% #0,%)2 Ay g %!4:1-0%!9+#!#),-5#"!)#0*(!5-)+%$-.%*%!/( !(!70,#"0#,


%4$-/%,-5()!#!4"(/#*-#0,()!%))(/-%*()!6!70,#"0#,2!8+$1+#!()!-,#0)!% <4$("#"!4(*#!)#"!)%$5%!/( (!+ !%"9+-5(!*(!d"-,#"!*(
)#1+-"2!%!4%",-"!*%!3-1+"%!%/-%2!9+#!(),"%!+ %!4:1-0%!%/#))%*% zO{||PoF2!/%)(!#),#!)#8%!(!#*-,("!*#!,#<,(!-0),%$%*(!0(
+,-$-.%0*(;)#!(!70,#"0#,!<4$("#"!=!>7=?@!
/( 4+,%*("@
AA B( !%!%,-5%&'(!*%!(4&'(!CDEFGDHIJKLMNOPEDQFK0(!RSTU
2!-03(" %&V#)!*%!)#))'(!*#!0%5#1%&'(2!,%-)!/( (
WXXYZS[2!%"9+-5()!*#!70,#"0#,!,# 4(":"-()!#!\-),]"-/(2!)'( A} p(!)#!/$-/%"!%!,#/$%! !*(!,#/$%*(!*(!/( 4+,%*("2!+ %
#</$+^*%)!9+%0*(!(!7!_!3#/\%*(@
"_4$-/%!*%!-%1# !0%!,#$%!*(!(0-,("!)#":!/(4-%*%!4%"%!%!:"#%
*#!,"%b%$\(!#!4(*#":!)#"!-0)#"-*%!# !+ !,#<,(!9+#!#),#8%!)#0*(
A` a!)^b($(! !%4"#)#0,%*(!0%!4:1-0%!-$+),"%*%!0%!3-1+"%
-0*-/%!#""(!0%!0%5#1%&'(!*#/(""#0,#!*#!%!4:1-0%!,#"!)-*(!/"-%*% #*-,%*(!/( !(!d"-,#"!*(!"a33-/#@
4%"%!0%5#1%&'(!# !)-),# %!c-0+<!#!#),%"!)#0*(!%/#))%*%!#
(!9+#!)#!"#3#"#!%!/(0/#-,()!*#!)-),# %)!*#!-03(" %&V#)!#!*#
/( 4+,%*("!/+8(!)-),# %!(4#"%/-(0%$!_!(!d-0*(e)@
Af g,-$-.%0*(;)#!(!/% 4(!hijOFkkIJKlFKmnkoDK#<-b-*(!0#))% )#1+"%0&%!*%!-03(" %&'(2!8+$1+#!()!-,#0)!)+b)#9+#0,#)@
4:1-0%2!_!4())^5#$!$(/%$-.%"2!0(!)^,-(!*%!p*5(/%/-%;q#"%$!*%
g0-'(!>pqg?!(+!# !(+,"()!)^,-()!*%!70,#"0#,2!-03(" %&V#)!9+# A g !%"9+-5(!/"-4,(1"%3%*(!3-/%!4"(,#1-*(!/(0,"%!/(0,% -0%&'(
/(0,#0\% !%!#<4"#))'(!*-1-,%*%!0#))#!/% 4(@
4("!5^"+)@
p/#"/%!*#!/(0/#-,()!#! (*()!*#!+,-$-.%&'(!*#!%4$-/%,-5()!#!*# ` p!"#%$-.%&'(!*#!+ !WYU2!(+!/]4-%!*#!)#1+"%0&%2!/(0)-),#
)-),# %)!(4#"%/-(0%-)2!8+$1+#!()!-,#0)!*#!rs!%!rt@
# !/(4-%"!*%*()!*#!+ !*-)4()-,-5(!*#!%" %.#0% #0,(!4%"%
Au a!,% %0\(!*%!3(0,#!# !+ %!4:1-0%!5-)+%$-.%*%!/( !(!
70,#"0#, (+,"(2!*#! (*(!9+#!#))#)!*%*()!4())% !)#"!"#),%+"%*()!#
<4$("#"2!# !+ !/( 4+,%*("!/+8(!)-),# %!(4#"%/-(0%$!_!(
d-0*(e)!vw2!4(*#!)#"!%+ #0,%*%!4("!#-(!*%!(4&'(!xJMQFk /%)(!*%!4#"*%!*()!*%*()!("-1-0%-)!4"(5(/%*%2!4("!#<# 4$(2!4("
%4%1% #0,(!%/-*#0,%$!(+!/(""+4&'(!*#!*%*()@
0(!4%-0#$!*#!/(0,"($#@





3
$%&'()*+,

-./01234./564/.4/.47648/91:4.4;<98/<:4=>0./9?91<9?0./?0/4?@<0:@9A
?0/BCDEFGHICHJDFKLG/?4/MNOPOQRMRS/-..@;9A4/9/012T0/48/564/0.
.@;9@./?4/10;<692T0/.T0/481:479?0./=0::4<984;<4S
U -/V09/;0<W=@9/19:9/0./;0X0./V4;4Y@=@Z:@0./?0/1:07:4..0/?0/19W.
[/564/0/.9AZ:@0/8[?@0/?4/5648/4.<Z/4;<:9;?0/;0/84:=9?0
910;<9/<4;?\;=@9/?4/9A<9]/=08/0/=>989?0/9684;<0/:49A/^_Z
?4.=0;<9?0/0/`abcdS
e a0/fA<@80/<:@84.<:4]/>06X4/9684;<0/?4/P]ghi/48/:4A92T0/90
84.80/14:W0?0/?4/QRRN]/=08/0/X9A0:/8[?@0/.9@;?0/?4
jk/hlQ]mg/19:9/jk/lMn]hRS/oZ/1:4X@.34./?4/564/0/19W.]/9<@;_9
68/=:4.=@84;<0/9;69A/;9/=9.9/?0./Q/8@A>34./?4/10.<0./;0/9;0
?4/QRMRS
p q9@./74;<4/481:479?9]/1:0?6r@;?0/.@7;@Y@=9/14:.14=<@X9/?4
74:92T0/?4/:@564r9]/=:4.=@84;<0/;0/1:0?6<0/@;<4:;0/V:6<0/89@.
74;<4/0=619?9/4/A0;74/?0/?4.4.14:0/4/?9./<4;<9234./?0/=:@84]
68/10X0/=08/9/96<04.<@89/48/9A<9S
s aT0/Y9A<98/4.<6?0./564/80.<:98]/68/84A>0:/?4.4814;>0
4.=0A9:/?9./=:@9;29./569;?0/4A9./;T0/<\8/?4/X4:/0/19@/48/=9.9]
?4/V:920./=:6r9?0.]/9V9<@?0]/10:564/;T0/<48/689/Y0;<4/?4
:4;?9/19:9/.6.<4;<9:/.69/Y98WA@9S
t aT0/[/1:4=@.0/14.56@.9:/86@<0/19:9/14:=4V4:/564]/=08/89@.
74;<4/<:9V9A>9;?0]/0./79.<0./=08/9..@.<\;=@9/.0=@9A/4/84.80
=08/:48[?@0./=0;<:9/?04;29./?4/Y6;?0/;4:X0.0]/.T0
.@7;@Y@=9<@X984;<4/:4?6r@?0./569;?0/9./14..09./4.<T0/89@.
0=619?9./=08/<:9V9A>0S
$%&'()*+uv

-./01234./564/.4/.47648/91:4.4;<98/1:010.<9./?4/<:4=>0./?4
19:4=4:S/-..@;9A4/9/012T0/=6_0/<4w<0/=0::4.10;?4/90/564/1:4=4@<698
9./;0:89./?4/:4?92T0/0Y@=@9AS
U a0..0./4.<6?0./<[=;@=0./?480;.<:98/564/9/=:x;@=9/?0/_070/;0
y:9.@A/[/:41A4<9/?4/4w481A0./564/?4.9=0;.4A>98/9/A479A@r92T0]
=080/9/X@0A\;=@9/?9./79;764./564/=0;<:0A98/4A4]/A9X9748/?4
?@;>4@:0/4/=001<92T0/?4/96<0:@?9?4./19:9/Y9r4:48/X@.<9/7:0..9
?@9;<4/?9./@A479A@?9?4.S
e -=:4?@<980./564/0/10?4:/?0/?@;>4@:0/.6_0/4/;0_4;<0/?0/_070
;T0/<48/A@8@<4.S/b0:/.69/X4r]/9./@;.<@<6@234.]/.46./z:7T0./4
Y6;=@0;Z:@0./;T0/.T0/@814:84ZX4@./{/=0::612T0/564/=0;<98@;9
0/.@.<489/9?8@;@.<:9<@X0S/`..0/[/689/14;9S
p |V.4:X9}.4/564/?4.?4/0./9;0./NR]/569;?0/0./=929};W564@./4/0.
V@;70./@;X9?@:98/9./=@?9?4.]/;T0/Y9A<98/41@.z?@0./19:9/80.<:9:
9/X6A;4:9V@A@?9?4/?0./974;<4./?0/10?4:/1fVA@=0/90/=9;<0/?9
.4:4@9/564/4=09/?0./=0Y:4./4810:=9A>9?0./?9/_079<@;9S
s ~/@;=0;<ZX4A/0/;f84:0/?4/10A@=@9@./=9;9A>9.]/<:919=4@:0./4
X979V6;?0./^@;=A6.@X4/?4/9A<0./4.=9A34.d/48/<0?0/0/19W.]
A@79?0./{/=0;<:9X4;2T0/{/V9;?@?9748S
t |./4;X0AX@?0./;0/_070/;T0/>4.@<98/48/914A9:/19:9/9/X@0A\;=@9
4/9/4A@8@;92T0/YW.@=9S/-A[8/?@..0]/0/.4=:4<Z:@0/;9=@0;9A
9;<@?:079./?9/b:4.@?\;=@9/?9/j41fVA@=9/@?4;<@Y@=9/;0.
456@1984;<0./4A4<:x;@=0./?4/_070./?4/9r9:/689/Y0:89/?4
A479A@r92T0/?0/?@;>4@:0/?0/;9:=0<:ZY@=0/@;<4:;9=@0;9AS


0123456759
703
34 
$%&'()*+uu

c08/:4A92T0/90/.@.<489/014:9=@0;9A/@;6w]/9..@;9A4/9/012T0
=0::4<9S
U 8/689/?@.<:@V6@2T0/?0/.@.<489/@;6w]/[/10..WX4A/4;=0;<:9:
/?4.<@;9?0./9/?@X4:.9./Y@;9A@?9?4.]/=080/19:9/1:0X4:
.4:X@20/?4/9=4..0/{/`;<4:;4<S/a0/98V@4;<4/@;6w]/<98V[8/.4
?@.134/?4/689/Z:49/?4/<:9V9A>0/^`d/19:9/6.0/?0/.@.<489
014:9=@0;9A/9/19:<@:/?4/689/@;<4:Y9=4/7:ZY@=9S
e b4A0/Y9<0/?4/.4:/68//1:01:@4<Z:@0]/569A564:/6.6Z:@0
10?4/Y9r4:/9A<4:9234./;0/98V@4;<4/4/=0A9V0:9:/19:9/9/84A>0:@9
?0/.@.<489/@;6wS
p |/=z?@70}Y0;<4/?0/.@.<489/014:9=@0;9A/@;6w/;T0/10?4/.4:
9A<4:9?0/10:/4..9/:9rT0/4A4/;T0/[/?@.<:@V6W?0/.0V/9/A@=4;29/b
06/a]/564/[/1fVA@=9/4/14:8@<4/80?@Y@=9234./;0/=z?@70S
s /c0;<:0A/c4;<4:/[/9/Z:49/?4/<:9V9A>0/?0/@;6w/14A9/569A/.4
Y9r/9=4..0/9/91A@=9<@X0./@;.<9A9?0./;0/=0816<9?0:]/=080/0
y:|YY@=4/4/06<:0.S
t |/@;6w/;T0/14:8@<4/564/.4_98/@;.<9A9?0./06<:0./.@.<489.
014:9=@0;9@./;9/84.89/8Z56@;9]/10@./@..0/9Y4<9:@9/0
?4.4814;>0/?0/=0816<9?0:]/<0:;9;?0}0/A4;<0S/
$%&'()*+u

-..@;9A4/9/012T0/=0::4<9/=08/:4Y4:\;=@9/9/4?@2T0/?4/<4w<0.]
1A9;@A>9./4/91:4.4;<9234./48/98V@4;<4/@;6wS
U |/y:|YY@=4/;T0/10..6@/@;<4:014:9V@A@?9?4/=08/06<:0.
98V@4;<4./10:/@..0]/19:9/564/0./9:56@X0./74:9?0./;0/yj|YY@=4
.4_98/A47WX4@./48/06<:0./=0816<9?0:4.]/[/;4=4..Z:@0/.9AXZ}A0.
;0/Y0:89<0/S1?Y
e y9.4/[/0//6<@A@r9?0/19:9/.4/=:@9:/1A9;@A>9./4A4<:x;@=9.
9/19:<@:/?4/?9?0./@810:<9?0./?4/06<:0./91A@=9<@X0.]/=080/0
q9<>/4/0/c9A=S
p |/`81:4../14:8@<4/9/=:@92T0/?4/@8974;./X4<0:@9@./^?4.4;>0.d]
9./569@./10?48/.4:/@81:4..9./10:/84@0/?4/569A564:/91A@=9<@X0
?0/y:|YY@=4S/
s |./91A@=9<@X0./?0/yj|YY@=4/14:8@<48/9/=:@92T0/?4/9:56@X0.
;0./Y0:89<0./<W1@=0./?4/06<:0./98V@4;<4.]/=080]/10:/4w481A0]
?9/.6W<4/q@=:0.0Y</^qd/|YY@=4S/4..9/Y0:89]/4..4./9:56@X0.
10?48/.4:/9V4:<0./4/9A<4:9?0./14A0/91A@=9<@X0/=0::4.10;?4;<4
?0/q/|YY@=4S
t |/:@<4:]/0/4?@<0:/?4/<4w<0./?0/y:|YY@=4]/[/=919r/?4/74:9:
9:56@X0./;0/Y0:89<0/S?0=/06/0?<]/89./;T0/14:8@<4/9/4?@2T0/06
9A<4:92T0/?4/9:56@X0./48/><8AS

!!

"#"

4
$%&'()*+,-

./01/23453676809235:012/75;2<3=7;45>6?32667;2<03235:@A53/511082B
C D2123603E2F013GHIHJJK;53=7;45>6?3L3;0/066M1753E0/N21385456356
2:<7/287O563PQ030680R2930930S0/Q@A530?309360TQ742?3406<7T2135
/59:Q824513:2123PQ030<03603107;7/703/593Q93Q6QM175347E010;80B
U V<7/213032112682135WR08563;53=7;45>63L3Q92342636Q26
/212/801X687/263PQ03E2/7<7829323;5@A5306:2/72<3453Q6QM175B3Y662
/212/801X687/23:0197803T12O213Q923:2682340;8153403Q9321PQ7O5?
W2682;453211268213/59353ZH[\]353X/5;032665/72453^3:268230
:567/75;M_<5365W10353;590345321PQ7O53PQ0310/0W01M323:2682B
` .53603/<7/213/59353W58A5347107853453ZH[\]365W10323M102340
812W2<N53453=7;45>6?3809_6032/0665323Q923R2;0<23PQ03/5;8L9
47O0162637;E5192@a0634536768092?3/595323PQ2;874240340306:2@5
093476/53Q87<7F242?3093EQ;@A53456321PQ7O56303:15T12926
;0<037;682<2456B
b c3:566XO0<3<5/2<7F213Q9321PQ7O53PQ030680R232192F0;2453;2
0681Q8Q12340347108d17563453=7;45>6?323:218713423E011290;82
efghijgkl?3476:5;7W7<7F2423253603/<7/213/59353ZH[\]K65W1035
W58A53mnjojklB3Y66235:@A535E010/03Q923R2;0<23453T010;/72451340
21PQ7O56?3/595353=7;45>63YS:<5101?3/593/29:53:212
47T782@A53453801953/51106:5;40;803:2123:06PQ76235Q3;590
06:0/XE7/5345321PQ7O5B
p q3=7;45>63r:42803L3Q9310/Q165340328Q2<7F2@A534536768092
=7;45>6?353PQ2<35E010/035:@a06340310;5O2@A53403<7/0;@2340
Q65303829WL9340328Q2<7F2@A53453\HJstuv]32;87OX1Q6306:0/XE7/5
423w7/1565E8B
$%&'()*+,x

.667;2<03235:@A53/511082323106:07853403/5;/07856?3E011290;826?
2:<7/287O56303:15/04790;8563403y;801;08B
C .3y;801;083L3E7;2;/72423:0<53/Q68534530;O75340390;62T0;6
0<081z;7/26?3263PQ27636A53/5;82W7<7F24263:0<563:15O045106340
2/06653^3y;801;0830310:26624263:212353Q6QM175323:2187134236Q2
/5;82380<0Ez;7/2?3459L687/235Q309:1062172<B
U D21232/0665323Q92310403403/59Q;7/2@A53:51390753403Q923<7;N2
80<0Ez;7/235Q3403Q9367680923403{|323/2W5?3L3;0/066M175353Q65
4530PQ7:290;85340;597;2453ZH}]ZB
` {2;85353y;801;083YS:<51013/595353~55T<03VN15903:019780932
047@A53032<8012@A5340321PQ7O53;53E5192853N89<35Q3N89B
b D2123PQ03563424563812E0TQ093E2/7<90;803;23y;801;08?3Q87<7F29_60
2:0;263563:1585/5<563{VDyD3:21232/06653^31040?3030;O75340
]ZuG30321PQ7O56B
p D513PQ068a06340360TQ12;@23453/59:Q82451?3Q92390;62T09340
/51107530<081z;7/536590;803:540360132W01823603N5QO013\HJstuv]
2;87OX1Q637;682<2453;239MPQ7;2B3


0123456759
703
34 
$%&'()*+,

V5;674012;45323E7TQ1232/792?3PQ037<Q68123Q923:MT7;230<081z;7/2?
2667;2<03235:@A53/5110823/59310<2@A53253Q653453y;801;083YS:<5101
yY3423w7/1565E8B
C .:d6360347T78213530;4010@53403Q923:MT7;232360132/066242?35
W58A53 3:0197803/5;E01713603066030;4010@53068M35Q3;A5
/511085B
U .3:218713453Z][3
3453yY?3L3:566XO0<3O76Q2<7F21
PQ2<PQ013:MT7;23PQ030680R2321PQ7O2423;536X8753PQ03603068M
2/0662;453;539590;85?303;A532:0;26323:MT7;237;7/72<
HZ]uI]B
` D21236032/0662134080197;24536X875?3L3;0/066M17537;60171360Q
0;4010@53;23W211234030;4010@56?35Q30;8A5?3Q87<7F2;45_603403Q9
90/2;76953403WQ6/23/5;E5190353423E7TQ12395681242?3WQ6/21
Q93<5/2<3:513:2<2O12_/N2O035Q30;8A53:513Q93;590306:0/XE7/5
4536X87534060R24535Q340360Q3/5;8045B
b .3E7TQ1232/79232:1060;82323:MT7;23:17;/7:2<34536X8753~55T<0?
PQ03:54036013Q87<7F2453:2123:06PQ76263;23y;801;08?3/26535
/59:Q8245130680R23/5;0/8245?35Q3:019780323WQ6/2340
7;E5192@a063<5/2<90;80?360353/59:Q824513453Q6QM1753;A5
0687O013/5;0/82453^31040B
p q3W58A53
3476:5;7W7<7F23EQ;/75;2<7424063PQ0
:01978093O76Q2<7F213Q923<76823403:MT7;263927632/06624263:0<5
yY3;23y;801;08B
$%&'()*+,

./01/234263EQ;@a0637;6878Q/75;2763423D?32667;2<03235:@A53/511082B
C q37;681Q90;853403812;62@A535Q3/5;/7<72@A5310E010;42453:513Q9
D3:2662323O2<013/59538X8Q<530S0/Q87O53RQ47/72<B
U .3D3:540328Q213093E2O513403:066523RQ1X47/2?382;85309
:15/066532497;7681287O53/5953RQ47/72<?30938542632637;68;/726
5147;M17263030S8125147;M1726B
` c3O042453253D328Q213;563RQ7F2456306:0/7276B
b 2632@a063:0;276?323/2:2/742403:568Q<28d1723453D340/5110
0S/<Q67O290;803423:15/Q12@A535Q851T2423:0<23OX87923253D
4067T;2453:212353/265B
p .3D340O01M32/59:2;N2137;PQL178563:5<7/7276?37;/<Q67O0326
:176a063093E<2T12;80?380;45353:10653/5;6878QX45324O5T245
5Q3;A5B

!!

"#"

5
+,-./0123

456789:;<=57>79?@8A@A8;7B57@9C@5797;57D5E;FA:G8H57I9:9796J89K;B5L
;??HI;:97;75J<=57E5889@;M
N O7J;:;D8;7PQRPSTRUVW79?@G7H6J:XEH@;7:5K57;JY?757D5EGFA:5
Z;:KAI?[7I57@89E\57Z]HE;IB57;:KAI?7;:H^;B5?7B57J85E9??5
B9EH?Y8H5[7_`MabcadeM
f O7?AF?@H@AH<=57B97Z?5F89[7_`Mbde7J587WVg7;:@98;8H;757?9I@HB5
58HKHI;:7B57@9C@5L76;?76;I@98H;7?A;7E598hIEH;797?A;7E5889<=5
K8;6;@HE;:M
i j7@89E\579I@897@8;D9??k9?7I;?7:HI\;?7la797lb79CJ:HE;7;
9CJ89??=57Z@5B5?75?79ID5:DHB5?[7_`MllclaeM
m j7D5EGFA:57Z89E58B9[7_`Mlde7@;6Fn67J5B98H;7?987E5889@;69I@9
K8;];B57E567;E9I@57o7pqrVpRsM
t O7?AF?@H@AH<=57B97ZE56J5?@;7B9[7_`Mlue7J587rVQWvPvUTRwxRs
;E;889@;8H;7J89^AXy57B97?9I@HB57;57@9C@5M
+,-./012z

0123456759
703

+,-./012

456789:;<=57;57?H?@96;75J98;EH5I;:797;57;6FH9I@97HIACL7;??HI;:9
;75J<=57E5889@;M
N j77n7A677{A97?97HI?@;:;7B9I@857B57HIAC797];y
E567{A9757HIAC7J5??;7?987BH?@8HFAXB57K8;@AH@;69I@9M
f j7HIAC75]989E97;75J<=57B97{A97A67I5D57A?AG8H57J5??;7;F8H8
A6;7?9??=57B97A?57B57;6FH9I@97J;8;7A@H:Hy;87?9A?7;J:HE;@HD5?
69?657{A975A@857A?AG8H579?@9^;7:5K;B57I57?H?@96;M
i j7HIAC7J5B97?987;E9??;B57;7J;8@H87B;7G89;7B97@8;F;:\57B5
I5697;J9I;?L7J5H?7577n7A6;77{A97?Y7J5B97?98
A@H:Hy;B;7967E56JA@;B587{A97@HD987HI?@;:;B5757HIB5?7J;8;
A?57?H6A:@|I95M
m 9FH;I7n7A6;7B;?7BH?@8HFAH<k9?7B57HIAC76;H?7A@H:Hy;B;?7I5
6AIB57I579I@;I@5L7?A;7HI@98];E97I=57?AJ58@;7;7:XIKA;
J58@AKA9?;L7?9IB57I9E9??G8H57E5I\9EH69I@57B97HIK:h?7J;8;
;E9??5M
t j7HIAC75]989E97];EH:HB;B97B97HI@98;<=579I@8977B9
BHD98?;?7J:;@;]586;?7I579I@;I@5L7I=57J986H@97{A97?9^;6
E8H;B5?77B97E5I]HKA8;<=57J;8;7{A975A@85?7
J5??;6785B;87I57HIACM

45I?HB98;IB57;?79?@8A@A8;?7B57@9C@5L7;??HI;:97;75J<=57E5889@;7I57{A9
BHy789?J9H@57>7E5IE58B|IEH;M
N O7;:@98;<=57B97Z?9^;67K;8;I@HB;?[7_`Ma}e7J;8;7Ws~wxwpwQvPRV
I=57HI@98]9897I;7E5889<=57K8;6;@HE;:7B57J98X5B5M
f O?7]586;?7D98F;H?7ZK;8;I@96[7_`Mble797Z5F8HK;6[7_`Mbae
E5IE58B;67E567Z9:9H<k9?7J98HYBHE;?[7_`MbleM
i O7HI?98<=57B;7]586;7D98F;:7wQvsps7I57:AK;87B97Z6;I@98[L
967Z6;I@987A675:\57I;75JHIH=57B57J5D5[7_`MbbeL7;E;889@;8H; +,-./012
J89^AXy57?HI@G@HE57;57@9C@5M
m O758;<=57sPWvPwxwUQWxwvVpsWxPQSPwgPPwRVpsWxJ;8;]8;?9H; O??HI;:97;75J<=57E5889@;7;789?J9H@57B;79BH<=57B97@9C@5?L7J:;IH:\;?79
B9765B57K8;6;@HE;:69I@97E5889@5757@89E\57Z;:KAI?7];@589?7?9 ;J89?9I@;<k9?7967;6FH9I@97HIACM
;J89?9I@;8;67E5657HIDH;FH:Hy;B589?[7_`MuceM
t OHIB;7{A9757D5EGFA:57ZI9E9??HB;B9[7_`Ml}e79?@HD9??9 N 67;8{AHD579BH@;B57J9:57j]]HE97967]586;@57I;@HD57J5B97?98
]:9CH5I;B57I57J:A8;:L7;7]586;7D98F;:7ZHB9I@H]HE5A[7_`Mlde ;F98@57J587{A;:{A9875A@857;J:HE;@HD57B57698E;B5L7J5H?79:97]5H
B9D98H;7J986;I9E987I57?HIKA:;8M
]9H@57J;8;7?987;F98@5797E56J;@XD9:7E567@5B5?75?7;6FH9I@9?L7I5
+,-./012
9I@;I@5757E5I@8G8H57I=57n7D98B;B9H85M
45I?HB98;IB57;?7I586;?7B9789B;<=575]HEH;:L7;??HI;:97;75J<=5 f j74;:E7n7A6;7]988;69I@;7@H:7I;7E5I?@8A<=57B97]Y86A:;?
E5889@;M
6;@96G@HE;?7J;8;7EG:EA:5L7J5??AH7;?769?6;?7]AIEH5I;:HB;B9?
N 5B5?75?79CJ9BH9I@9?75]HEH;H?7B9D967?9KAH87;769?6; B57CE9:7B;7HE85?5]@L76;?7J5??AH7?HI@;C97B97]Y86A:;?
BH]989I@97B;?7A@H:Hy;B;?7J5879?@9M
BH;K8;6;<=5M
f j7A?57B57J;B8=57EA:@57B;7:XIKA;7B9D97?9879DH@;B57I;?789B;<k9? i j7j]]HE97n7A6;7?AX@97B97;J:HE;@HD5?7{A97J5??AH7D98?k9?
5]HEH;H?L7J5H?7BH]HEA:@;7579I@9IBH69I@57B5?7@9C@5?7J587J;8@97B; 9?J9EX]HE;?7J;8;7HIAC797J;8;7HIB5?7I579I@;I@5L7J;8;
J5JA:;<=57967K98;:M
i O789B;<=57B97A67B5EA69I@575]HEH;:7B9D97DH?;8 9C9EA@Gc:57I57HIB5?L7n7I9E9??G8H57];y987797;E9??;875
J8H658BH;:69I@97579I@9IBH69I@57B;769I?;K967J9:57?9A HIAC7J;8;7A@H:HyGc:5M
8969@9I@9L7J;8;7{A96L7B97];@5L79:;7n7H6J58@;I@9M
m 576J89??L7n7J5??XD9:7E8H;87A6;7I5D;7;J89?9I@;<=57B97
m j789KH?@857B97H6J89??k9?7J9??5;H?7I;?7E56AIHE;<k9?75]HEH;H? 97?;:DGc:;7I57]586;@57J;B8=57I;@HD57B97;8{AHD5?7J;8;79??9
I=57B9D975E58898L7;HIB;7{A97579CJ9BH9I@97;J89?9I@97?HKI;@G8H5 ;J:HE;@HD5M
97B9?@HI;@G8H57HB9I@H]HE;B5?7I56HI;:69I@9M
t 45657]586;7B97AIH]586Hy;87;?7E56AIHE;<k9?75]HEH;H?L t O@A;:69I@9L757]586;@57J;B8=57B5?7;8{AHD5?7B578H@987n75
96J89K;c?975769?657D5E;@HD57967@5B;?79:;?L L7967?AF?@H@AH<=57;57jL7{A97;J89?9I@;D;7BHD98?;?
HIB9J9IB9I@969I@97B97?9A7B9?@HI;@G8H5M
:H6H@;<k9?7B97E56J;@HFH:HB;B9M7
 !"#$%&'()&

!*!

0123456759
703

+,-./01234

56789:;<=>68<68?@68:8A@86B=C:@8D68E6FG;;<8HG9:I6JK8L:MD68N6768O<@:8<8IGP?9<8<NG7<8Q?:876@L9<8?7<8BRPGM<8<N:@@<D<8N678:@@:8M<S:P<D69K
<@@GM<;:8<86B=>68N699:L<T
U 5<@68?78N<D:<D68I:NV<D68LGS:@@:8@GD68<B9:@:ML<D68M6896D<BW8D:@@<8BRPGM<K8:;:8GMDGN<9G<8Q?:868HG9:I6J8:@LR8N6M:NL<D68<8?78@:9SGD69
XYZ8Q?:8B96S[8@?B69L:8<68\]]^8@:P?96T
_ `@<MD6868O6L>68
K8W8B6@@aS:;8L:98<N:@@68G7:DG<L68<6@8D:F8@aLG6@87<G@8<N:@@<D6@8:78L6D<8<8bML:9M:L8:8IGN<98B698D:ML968D6@
B9GMNGB<G@8<N6ML:NG7:ML6@T8]<7OW78W8B6@@aS:;8N6MIGP?9<98:@@<86B=>68B698<@@?ML686?8R9:<8L:7RLGN<K8B<9<8@:8;G@L<986@8B9GMNGB<G@8@aLG6@
N699:;<L6@T
c d<86B=>68efghijkljmnop8D68qYrs8 K8W8B6@@aS:;8L:98<N:@@68<68NtDGP68uvwx8D68D6N?7:ML68:8I<F:98<;L:9<=C:@8M:N:@@R9G<@K8N<@6
V<y<8<;P?78:9968D:8N<99:P<7:ML68M<8BRPGM<T
z ^698B<D9>6K8<68@:8N;GN<9868O6L>68 K8@:9R8<O:9L<8?7<8M6S<8L:;<K8N678687:@768N6ML:{D68D<8L:;<876@L9<D<8M<8IGP?9<T
| }86B=>68
8D<8O<99<8D:8qYrs~:JGO:8<@8S:9@C:@8<ML:9G69:@8D<@8BRPGM<@8D68@aLG68D<8^`K8yR8B?O;GN<D<@T
+,-./0123

56789:;<=>68<6@8<B;GN<LGS6@8B<9<8:DG=>68D:8L:JL6@K8B;<MG;V<@8:
<B9:@:ML<=C:@8:78<7OG:ML:8GMD6@K8<@@GM<;:8<86B=>68N699:L<T
U d6876D68D:8<B9:@:ML<=>68D:8~Y~8D68E^6:9^6GMLK8Q?:
B6D:8@:98<NG6M<D68B6987:G68D<8L:N;<88 86?8D68O6L>68 K
W8B6@@aS:;8SG@?<;GF<986@8~Y~8D:8?7<8<B9:@:ML<=>68:7
N6My?ML6@8D:8Q?<L968~Y~8B698L:;<T8
_ }68@:8GM@:9G98:78?78D6N?7:ML68D6869D8?78aMDGN:8<M<;aLGN6K
W8M:N:@@R9G68Q?:8L6D<@8<@8:ML9<D<@8D68aMDGN:8:@L:y<787<9N<D<@
B6987:G68D:8?78:@LG;68:@B:NaIGN6T
c 8N67<MD68lf8D:8?7<8L<O:;<8D6869D8B:97GL:8<NG6M<9
68JN:;8B<9<8Q?:8B6@@<8@:98GMN;?aD<K8D:ML968D68D6N?7:ML6K8?7<
L<O:;<8D68JN:;8N678N<7B6@8B9WI697<L<D6@8B<9<8NR;N?;6@
M?7W9GN6@T
z }8:JL:M@>68D:8<9Q?GS6@8T8D68GMD6@8W8?7<8<;L:9M<LGS<
B<9<8Q?:8@:y<78@<;S6@8L:JL6@8Q?:8B6@@<78@:98<O:9L6@8:786?L96@
<7OG:ML:@86B:9<NG6M<G@K8N676868GM?JK8B698:J:7B;6T8
| d6869DK8B6D:@:8GM@:9G98?7<8Q?:O9<8D:8BRPGM<8<Bt@8<8{;LG7<
;GMV<8DGPGL<D<8L:N;<MD6@:8@G7?;L<M:<7:ML:88 8:8 T

 !"#$%&'()&

+,-./0123

}@@GM<;:8<86B=>68N699:L<8<89:@B:GL68D:8N6MN:GL6@8OR@GN6@K
I:99<7:ML<@K8<B;GN<LGS6@8:8B96N:DG7:ML6@8D:8bML:9M:LT
U `@<MD68<8I:99<7:ML<8]:;M:LK8B6D:@:8S:9GIGN<98@:8?7<87RQ?GM<
:@LR86?8M>68M68<9K8:8<LW87:@7686OL:9868:MD:9:=68b^8D:@@<
7RQ?GM<T
_ 8?@68D6876D:;68b8B:97GL:8?7<87:;V698GML:9N6M:J>68:ML9:
6@8DGS:9@6@8B96L6N6;6@8D:89:D:@K8Q?:8@>68:@L9?L?9<D6@8:78@:L:
N<7<D<@K8DGSGDGD<@8:78L9[@8P9?B6@8:ML9<D<K8B96N:@@<7:ML68:
@<aD<T
c 8N699:G68:;:L9MGN68W8?78@:9SG=68D:8L96N<8D:87:M@<P:M@8D:
L:JL6K8Q?:8B6D:78N6ML:98<9Q?GS68<M:J<D6T8@@:8@:9SG=68?LG;GF<
?78B96L6N6;68:@B:NaIGN68D:M67GM<D68H]^T
z `78qYq8}8W8?78:Q?GB<7:ML68Q?:8B:97GL:8Q?:8?7<
;GMV<8L:;:IMGN<8@:y<8N67B<9LG;V<D<8@G7?;L<M:<7:ML:8B69
L9RI:P68<M<;tPGN68D:8S6F8:86?L968DGPGL<;8D:8D<D6@T
| :8<8N6ML<8D:8Yq8:@LR8;6N<;GF<D<8:78?78@:9SGD698D68LGB6
JNV<MP:8:9S:9K8Q?<MD6868?@?R9G68<N:@@<98<@8@?<@87:M@<P:M@K
:;<@8@>68<?L67<LGN<7:ML:8O<GJ<D<@8B<9<8<87RQ?GM<8?@<D<8B:;6
?@?R9G68B<9<8I<F:9868<N:@@68A8N6ML<K8M>68IGN<MD68NtBG<8D<@
7:M@<P:M@8<N:@@<D<@8M6@8@:9SGD69T
!*!

7
)*+,-./012

345678958:9;<=>5?8:9@A656><A=8:B95::A65C<9598DEF89>8==<75G
H I9;<=>5?89;86<7J=A8B9<:7=474=5?89D5=59>86@<=A=9CAK4A?<L9M
<>868;A5B9>5=5>7<=AL5N:<9D8=98D<=5EO<:9?<9C86P89D=5L89K4<
47ACAL5;9>8;89=<@<=Q6>A59D=A6>AD5C95975R59?<9>S;TA8G
U I9VWX9D8?<9CA;A75=B9:<;D=<9K4<96<><::J=A8B959=<;46<=5EF89?<
8D<=5EO<:9<9:<=YAE8:9T56>J=A8:9<9@A656><A=8:G
Z I9?<:>86789?<97[74C8:9\94;598D<=5EF897[DA>59?89;<=>5?89?<
>=\?A789D8=9;<A89?59K45C989>CA<67<95?A56759=<>4=:8:9589T56>8B
K4<B9<;9>867=5D5=7A?5B95::4;<959=<:D86:5TACA?5?<9D<C8
D5P5;<6789?59?4DCA>5759849?5968759D=8;A::]=A59689:<4
Y<6>A;<678G9
^ _<95>8=?89>8;959C<PA:C5EF89YAP<67<B9>8;D<7<9589`aVbX
A67<=YA=9689;<=>5?89;86<7J=A89D8=9;<A89?596<P8>A5EF89?<
7[74C8:9D=]D=A8:9689;<=>5?895T<=789<9?59>86><::F89?<
<;D=\:7A;8:9589c<:84=89X5>A865CG
d V5T<9589`aVbX9<9M9V8;A::F89?<9e5C8=<:9W8TACAJ=A8:9fVeWg
<:75T<C<><=968=;5:9K4<9?A:>ADCA6<;95:957AYA?5?<:9?5:9T8C:5:9?<
Y5C8=<:9<9?8:9>8==<78=<:9?<9@46?8:9DhTCA>8:G

01234567594

3 
)*+,-./0pq

X89`=5:ACB95:9A6:7A74AEO<:9@A656><A=5:9DhTCA>5:9:F89>86:A?<=5?5:
H <67A?5?<:9=<:D86:JY<A:9D<C59<R<>4EF89?59D8C[7A>597=AT47J=A59?8:
P8Y<=68:G
U ]=PF8:954RACA5=<:9?59<R<>4EF89?59D8C[7A>59?<9>=\?A789?8
P8Y<=689@<?<=5CG
Z <67A?5?<:9@A:>5CAL5?8=5:9?89lA:7<;59oA656><A=89X5>A865CG
^ <67A?5?<:9D=<:75?8=5:9?<9:<=YAE8:9?89`aVbXG
d ]=PF8:9<R<>478=<:9?59D8C[7A>59?<9A6Y<:7A;<678:9?89P8Y<=68
@<?<=5CG
)*+,-./0pr

)*+,-./01i

a9=<:D<A789?89>j<K4<B95::A65C<9598DEF89>8==<75G
H X59jAD]7<:<9?<9A6:4@A>AQ6>A59?<9@46?8:9?89>8==<67A:75B95
C<PA:C5EF8957=AT4A9589T56>89:5>5?8959=<:D86:5TACA?5?<9D<C8
D5P5;<6789?89>j<K4<9589>=<?8=G9
U I9>j<K4<9?<Y8CYA?89D8=9@5C759?<9@46?8:9659D=A;<A=5
5D=<:<675EF898T=AP5989T56>8959A6>C4A=9:<49<;A7<67<9689>5?5:7=8
?<9<;A7<67<:9?<9>j<K4<:9:<;9@46?8:G
Z I9>j<K4<95?;A6A:7=57AY8B97[74C89<;A7A?89D<C89D=]D=A89T56>8B
D8?<9:<=9<;A7A?89589D8=75?8=G
^ a9C<PA:C5EF89K4<9?A:>ADCA65989>j<K4<96F895?;A7<989>j5;5?8
<6?8::89:<;9P5=567A5B9D<C89K45C989<6?8::567<9<RD=<::5;<67<
:<9<RA;<9?598T=AP5EF89?<9D5P5;<6789?897[74C89<;9@5Y8=9?8
?<Y<?8=9D=A6>AD5CG
d _<95>8=?89>8;959k4=A:D=4?Q6>A59?89l4D<=A8=9c=AT465C9?<
m4:7AE5B9595D=<:<675EF89567<>AD5?59?<9>j<K4<9D=\N?575?8
>5=5>7<=AL59?5689;8=5CG

V8;9=<C5EF89M9k56<C59?89sA6?8t:9bRDC8=<=9;8:7=5?59D5=>A5C;<67<
5>A;5B95::A65C<9598DEF89>8==<75G
H X59@5C759?<9>86<RF89?89>8;D475?8=9>8;959u67<=6<7B989sA6?8t:
bRDC8=<=9@A>59A6?A:D86[Y<C9D5=59894:4J=A8G9
U a9D5=7A=9?89[>86<
B9\9>8==<78
A6@<=A=9K4<989>8;D475?8=9<;94:897<;95D<65:94;5946A?5?<9?<
<67=5?59D5=59_e_B9<96F89:4D8=759@8=;578:9P=5YJY<A:9<;9V_G
Z I9T87F89 B9j5TACA75?89659k56<C59AC4:7=5?5B9\947ACAL5?89K456?8
:<9?<:<k59YA:45CAL5=95:9D5:75:9>8;9A6@8=;5EO<:9?<75Cj5?5:9?<
)*+,-./01n
75;56j8B97AD89<9?5759?<9;8?A@A>5EF8G
a9<R<>4EF89?8:9:<=YAE8:9T56>J=A8:9?<9A67<=<::<9?89P8Y<=689@<?<=5CB ^ a9D5=7A=9?59k56<C59;8:7=5?5B9\9>8==<789A6@<=A=9K4<
5::A;9>8;89?<9A67<=<::<9?<9:45:95475=K4A5:B9>5T<B9D=A6>AD5C;<67<B
\989?A=<7]=A89=5AL9?<9;5A:95C759jA<=5=K4A5968
:A:7<;598D<=5>A865C9sA6?8t:G9X<::<9?A=<7]=A8B9<:7F89>867A?8:
H M9VeWG
78?8:98:9?<;5A:B9>8;89vwxyz{|}x~w|y9<9vwxz}|~x{|B
U 58:9T56>8:9>88D<=57AY8:G
YA:[Y<A:9D<C8:9T87O<:9?<9<RD56?A=9<9=<>45= G
Z 589`aVbXG
^ 589`56>89?89`=5:AC9lGaG
d I9[>86<
A6?A>5989?A:>89=[PA?89?8
d 589`56>89X5>A865C9?89_<:<6Y8CYA;<6789c=AT47J=A89< >8;D475?8=B986?<9@A>5;9P=5Y5?8:98:95=K4AY8:9?89:A:7<;5
8D<=5>A865C9sA6?8t:G
oA656><A=8G


 !"#$%

&'(&

01234567594

3 

)*+,-./012

456789:;<6953<3=8>?;<3<@8A<B3C?:38D?7E;<3<3F<6:D<3GHIJKLMNKMOPJQRPLKS953T8695U7B3<7786<D:3<35VWX53@5;;:E<Y
Z [5;3A:8539:3=?6@856<D89<9:73:6@56E;<9<736<3F<6:D<3<775@8<9<3<53\@56:3 B3]3V577\^:D35_E:;386=5;A<W`:73>:;<87375_;:353787E:A<
5V:;<@856<DB3_:A3@5A53@56=8>?;<;353V;5@:77539:35_E:6WX53:3867E<D<WX539:3<E?<D8a<W`:73953T8695U7Y3
b c5
?A<
:;A8
9:3;37::93:@7D83@@<<;_35:<3\9@<5763:53?37:A3=85B39:79B:373C:;?d:3B<3_6:5;3@E<<3AV
533F<<V6;:5DV<;398<593e5639E::;767:<E33Ffg
<6V:DD<5B;3:7;:BF3<5338C6?=:53;VA<
95E3:5335:36<9@::7;:75W53<33@?5A<
AV3VD:dE>58369<<33hi
Vdj>B836V<53;C3?A:
:3785:
9:7:F<3<@:77<;B37:A3:;;5739:398>8E<WX5Y
k [?75?;d3A:
57?77\^5:YD3<@:77<;398;:E<A:6E:3<73@56E<739:3ilmnop3:3<73d;:<739:3<;A<a:6<A:6E53:7V:@\=8@<73957
;858753@39<593<\@7E5;6<:93573653@5AV?E<95B3;]33:VA3
q c7
6<9?<E<793<55;33\:@A3
56?:375B39:3=5;A<3<369X:5^3@:<A3
37:335<9V8:@;8<5@685<365<?D3Y;:A5^:3C?<DC?:;3V;5>;<A<
C?:3=3?:67E@:8F5<638<6D789E<<D9<:9753;36:D5<3@@855AV
?77<:;;338?6E78DE8<a_<89D8<97<379::AV
365;3:783C7E?::A<
r 4<7537:39:7:F:35?^8;3As78@<35?3<@:77<;353<A_8:6E:39:3d?9853V<;<3:g:@?E<;3<;C?8^573953E8V53Y<^8B3]3V577\^:D3=<atuD53V5;3A:8539:
=?6@856<D89<9:73:6@56E;<9<73<537:3@D8@<;353\@56:3
Y
)*+,-./01v

)*+,-./01

c3;:7V:8E53953<A_8:6E:3w86?gB3<7786<D:3<35VWX53@5;;:E<Y 45A3;:D<WX53y73=:;;<A:6E<73953V<@5E:3x==8@:B3<7786<D:3<35VWX5
@5;;:E<Y
Z x3<@:7753y3e6E:;6:E3653<A_8:6E:3w86?g3]3;:<D8a<95B3V5; Z fA3?A3<;C?8^53@;8<953V:D53<VD8@<E8^534<D@B3]3V577\^:D3<;A<a:6<;365
V<9;X5B3V5;3A:853953<VD8@<E8^53z:;6:DY
g8A53E;t73VD<68D|<73:D:E;68@<7B3<73C?<873V59:A3@56E:;3=;A?D<7
b {53<A_8:6E:3w86?gB3V59:3|<^:;398^:;7573E8V5739: Ad
9:3@dD@?D573:3oipo3V<;<35?E;<73;:=:;t6@8<73:3_<6@5739:39<957Y
86E:;=<@:73:3?7539:3D8@:6W<7Y3}A<39:77<7386E:;=<@:73]35 b x73<;C?8^573>:;<9573V:D53x==8@:3657398^:;7573=5;A<E573V59:A
7:;3@56=8>?;<9573V<;<38AV;:77X53V:D53eAV;:77B39:3<@5;953@5A3<7
z~fB3C?:3?E8D8a<3<3D8@:6W<3{}Y
;:=:;t6@8<73953?7?d;853:3@56789:;<6953<73@<;<@E:;\7E8@<739<
k c3987E;8_?8WX53~:_8<63953w86?g3E:A3<37?<3?E8D8a<WX5 V8AV
;:775;<3@56:@E<9<3<53@5AV?E<95;Y
D8A8E<9<3V5;36X535=:;:@:;3=:;;<A:6E<73<9A8687E;<E8^<7 k x3T;
<VD8@<E8^53953x==8@:3:C?8^<D:6E:3<53T5;939<
6:A386E:>;<WX53@5A35?E;573<A_8:6E:73@5AV?E<@856<87Y 8@;578E5:=;E3B3]V3:5;3A8
<;3V;<E8@<A:6E:3<73A:7A<73<W`:739:
q x3w86?g3]3?A3787E:A<3>;<E?8E539:7:6^5D^8953653;<78D ;:9<WX53:3:98WX53E986:39E:5g3;E5:<73D78a8AV
D:73:3A?DE8A\98<B3A<7B3<53@56E;d;85
@5A3535_F:E8^539:3;:7E;86>8;353?7539:3787E:A<7 953T5;9B36X53V:;A8E:3C?:37:F<A37<D^573<;C?8^573653=5;A<E53Y[~B
5V:;<@856<8739:3<DE53@?7E5B3@5A5353T8695U7B3657 :A3=?6WX539:386@5AV<E8_8D89<9:3@5A:;@8<DY
q {573poi3:D<_5;<9573V5;3A:853953eAV;:77B3]3V577\^:D386@D?8;365E<7
@5AV?E<95;:739573;>X573>5^:;6<A:6E<87Y
8WX539:3E:gE573C?:35;8:6E:A3<386E:;V;:E<WX53953@56E:s95395
r cV<@|:3]3<39:65A86<WX539:3?A<3@5A?689<9:39: Vp<o;<i3Y:39x3
^87\^:D3V<;<3<3<?98t6@8<3C?<695357
9:7:6^5D^:95;:739:3hni3>;<E?8E53V<;<3<@:7753y3T:_B poi3:7EEX:5g3E75:3699<5363:5gE<8_3689X5573=368@5<33A5
:7:6E<WX539:3poiY
C?:3=583=5;A<9<36573f7E<9573}6895739<3cA];8@<B3A<7 r <7:3]353<VD8@<E8^53953x==8@:3C?9:533V<:V;;A8
3<3@;8<WX539:39:7:6|57
|5F:3:7Ed39877:A86<9<3:A3^d;8573V<\7:7B386@D?78^:365 ^:E5;8<873:A3<A_8:6E:3w86?gB3E:6953<E7:3A:
7A<73=<@8D89<9:7
:6@56E;<9<7365345;:D~cT3:3653[<86E39<38@;575=EY
;<78DY


 !"#$%

&'(&

01234567594

3 

)*+,-./011

23456789:473;:;<6=>9:;:?6@:A;B>8;6C>5D9:;>@:;E:48C:;73;F397;7:;5>GD8;H6?9353<D;I<<6?8A;?3@;>@;73?>@84D3;8@;J93?8553;78;876KL3A
:5564:C8;:;3JKL3;?3998D:M
N I;?34E>4D3;78;3JKO85;78;<39@:D:KL3;765J34GP865;8@;
;J89@6D8;78<6469A;43;<39@:D3
J:79L3;J:9:;:;F8QA;:5;?34<6=>9:KO85;78;R6J89D8SD3;8;D:@QT@;78;P65>:C6U:KL3;73;73?>@84D3;8@;876KL3M
V W:;56D>:KL3;7:;E:48C:;@35D9:7:A;T;?3998D3;:<69@:9;B>8;:;8SJ9855L3;XWIYZ[\;][;^W_I`Hab^2cd;85De;58C8?634:7:;8;D8@;:;<34D8
8@;48=96D3M;f:9:;58;8C6@64:9;3;<39@:D3;48=96D3;7855:;8SJ9855L3A;T;5><6?684D8;?C6?:9;3;Q3DL3; A;4:;Q:99:;78;<899:@84D:5M
g c;J:9D69;7:;<6=>9:;@35D9:7:A;T;?3998D3;64<8969;B>8;D373;3;D8SD3;76=6D:73;85De;?3@;:;<34D8;8@;48=96D3;8;B>8;3;73?>@84D3;8@;876KL3;D8@
:5;7>:5;@:9=845A;85B>897:;8;76986D:A;E>5D6<6?:7:5M
h I;G?348; A;B>8;:J:98?8;C3=3;:Q:6S3;73;73?>@84D3A;6476?:;B>8;Re;?3998KO85;78;=9:<6:;:;5898@;?34<8967:5;43;D8SD3;76=6D:73M;
i f39;@863;78;<>4?634:C67:785;765J346Q6C6U:7:5;43;jklm;
A;T;J355GP8C;?34<6=>9:9;3;D:@:4R3;7:;<34D8A;:;765J356KL3;735
J:9e=9:<35;8;@:9=845A;:556@;?3@3;6458969;B>8Q9:5;78;C64R:A;4n@893;78;Je=64:;73;73?>@84D3;3>;3>D9:5;<39@:D:KO85;78;85D9>D>9:M
)*+,-./01o

)*+,-./01

c?89?:;735;?34?86D35;78;^4D8948D;8;plqrslkqA;:5564:C8;:;3JKL3
?3998D:M
N [@;>@:;plqrslkqA;:;D93?:;78;7:735;84D98;?C684D85;8
589P673985;T;98:C6U:7:;?3@;3;>53;73;J93D3?3C3;F6t_6M
V [@;=9:4785;e98:5;78;>@:;?67:78A;?3@3;:893J39D35;8
uvwxxply;zklqkruA;439@:C@84D8;58;84?34D9:;765J34GP8C
:;D8?43C3=6:;FcWA;B>8;T;>@;D6J3;78;9878;58@;<63;J:9:
:?8553;{;^4D8948DM
g I;:?8553;:;Je=64:5;|k}A;7:;^4D8948D;3>;78;>@:
plqrslkqA;T;<86D3;?3@;3;>53;73;~bbf;3>;J93D3?3C3;78
R6J89D8SD3M
h \Hbf;T;>@:;D8?43C3=6:;>D6C6U:7:;:J84:5;4:;plqrslkqA
B>:473;4L3;8S65D8;?348SL3;?3@;:;^4D8948DM;
i _bf;T;3;J93D3?3C3;78;84P63;8;98?8Q6@84D3;78;kjsp
>D6C6U:73;B>:473;:5;@845:=845;78;?399863;8C8D946?3
4L3;J355>8@;98@8D84D85M

>:4D3;{;39=:46U:KL3;78;:9B>6P35;76=6D:65A;:5564:C8;:;3JKL3;?3998D:M
N I5;:9B>6P35;78;645D:C:KL3;78;J93=9:@:5;78P8@;<6?:9;:9@:U84:735;8@
>@;7698D963;D8@J39e963;73;565D8@:;3J89:?634:CA;:;<6@;78;<:?6C6D:9;:
5>:;98@3KL3;B>:473;3?3998;J93QC8@:5;78;8S8?>KL3M;W8558;?:53A
T;5><6?684D8;78C8D:9;3;98<89673;7698D963;D8@J39e963M
V W:;9878;78;?3@J>D:73985;78;>@:;8@J985:A;98?3@847:t58;B>8;35
:9B>6P35;?3@;64<39@:KO85;6@J39D:4D85;58E:@;=9:P:735;:J84:5;4:5
@eB>64:5;735;>5>e9635A;J365A;@85@3;8@;?:53;78;<:CR:;4:;9878A;3
>5>e963;J378;?34D64>:9;D9:Q:CR:473;58@;64D899>JKO85M
g W3;:@Q684D8;F64735A;J:9:;58;=9:P:9;>@;:9B>6P3;4:;J:5D:
A;T;48?855e963;B>8;3;:9B>6P3;85D8E:;43;<39@:D3;M73?A;Ee
B>8;855:;J:5D:;T;8S?C>56P:;J:9:;:9@:U84:9;73?>@84D35;?96:735;43
F397A;8;4L3;J89@6D8;=9:P:KO85;78;:9B>6P35;?3@;3>D935;<39@:D35M;
h f39;@863;73;F64735;[SJC3989A;J:9:;58;?3J6:9;D3735;35;:9B>6P35;78
>@;7698D963;J:9:;3>D93;785D643A;T;5><6?684D8;98:C6U:9;3;58=>64D8
J93?876@84D3;58C8?634:9;D3735;35;:9B>6P35;73;7698D963;43;jklm
A;?C6?:9;:;3JKL3;;58C8?634:9;3;7698D963;785D643;7858E:73
?C6?:9A;43;jklm;A;:;3JKL3;M
i W3;:@Q684D8;64>SA;J:9:;8P6D:9;J93QC8@:5;78;7858@J84R3;73
?3@J>D:739A;98?3@847:t58;B>8;>@;7698D963;?34D84R:;:9@:U84:735;:DT
;:9B>6P35A;?:7:;>@;78C85;?3@;D:@:4R3;78A;43;@eS6@3A;;HM



 !"#$%

&'(&

10

01234567594

3 

)*+,-./012

3456789:;584<;<=7>?:;<;@7A;B<C?9<7D?6E:;<?A;<F;59D;<84<G4HH7D;<I7:9=4JB<@4A<?A;<KL>75;<9A<9J7M7NO4B<;6675;D9<;<4KNO4<@4::9E;P
Q R<K;:E7:<8;<75=4:A;NO4<9<84<675;D<89<;87NO4<STU<9A<
B<V<@4::9E4<75=9:7:<C?9<?A;<54W;
KL>75;<XYZB<@4A<4<A96A4<@45E9[84<8;<KL>75;<9A<9J7M7NO4B<96EL<876K45\W9D<9A<4?E:4<9589:9N4<8;<]9MP
^ _<\@459< <7587@;<C?9<;<KL>75;<9A<9J7M7NO4<K466?7<9::46<89<K:4>:;A;NO4<9<K489<69:<95W7;8;<;4<9589:9N4<C?9<96EL<69584<;@966;84
K;:;<:9@7@D;>9A<87>7E;DB<;<=7A<89<C?9<69?<@`87>4<69F;<;K:4W97E;84<K4:<4?E:46<K:4>:;A;84:96P
a b;<67E?;NO4<8;<F;59D;<A46E:;8;B<V<@4::9E4<75=9:7:<C?9<4<6\E74<@4::96K45895E9<;4<9589:9N4<cEEK6deefffP@;7J;P>4WPM:<K:4W;W9DA95E9
96E;W;<=4:;<84<;:B<54<A4A95E4<9A<C?9<4<;@9664<=47<E95E;84P
g _<A484<hiijklY<V<?E7D7H;84<K;:;<5;W9>;NO4<9A<KL>75;6<89<klmnolYm<;K95;6<K;:;<?6?L:746<@;8;6E:;846<K9D4<;8A7576E:;84:<8;<:989<K4:
A974<89<?A;<695c;<K9664;D<9<75E:;56=9:\W9DP
p G96A4<9A<A484<hiijklYB<V<K466\W9D<?E7D7H;:<4<G4H7DD;<I7:9=4J<K;:;<W76?;D7H;:<?A;<KL>75;<XYZ<9A<=4:A;E4<cEAD<4?<9C?7W;D95E9B<C?9
96E9F;<;:A;H95;8;<54<@4AK?E;84:<9A<?64P
)*+,-./01q

R6675;D9<;<4KNO4<@4::9E;<;<:96K97E4<89<@9:E7=7@;NO4<87>7E;DP
Q R?E4:78;89<@9:E7=7@;84:;<V<;<8954A75;NO4<89<?6?L:74<C?9<E9A
K489:96<89<;@9664<r6<75=4:A;Ns96<@45E78;6<9A<?A;<A956;>9A
;6675;8;B<K:7W;8;<9<@9:E7=7@;8;P
^ R<;?E4:78;89<:9>?D;84:;<E9A<;<=?5NO4<89<9A7E7:<@9:E7=7@;846
87>7E;76B<=?5@745;584<@4A4<?A<@;:E`:74<8;<t5E9:59EP
a _<tut<St56E7E?E4<b;@745;D<89<u9@54D4>7;<8;<t5=4:A;NO4U<V
E;AMVA<@45c9@784<@4A4<R?E4:78;89<39:E7=7@;84:;<v;7H
w:;67D97:;P
g xyt<4?<t3x<V<4<54A9<8;84<;4<@9:E7=7@;84<C?9<=47<9A7E784<K4:
?A;<;?E4:78;89<@9:E7=7@;84:;P<
p zA<@9:E7=7@;84<87>7E;D<V<K9664;DB<75E:;56=9:\W9D<9<5O4<K466?7
8;E;<89<W;D78;89P


)*+,-./0{|

R@9:@;<89<;6675;E?:;<87>7E;DB<;6675;D9<;<4KNO4<@4::9E;P
Q x;:;<;6675;:<?A;<A956;>9A<87>7E;DB<4<:9A9E95E9<?6;<?A;<@c;W9
K:7W;8;P<
^ _<896E75;EL:74<?6;<;<@c;W9<K:7W;8;<84<:9A9E95E9<K;:;<:9@9M9:
?A;<A956;>9A<87>7E;D<;6675;8;P
a x;:;<;6675;:<?A;<A956;>9A<87>7E;DB<4<896E75;EL:74<?6;<?A;
@c;W9<K[MD7@;P
g zA;<A956;>9A<87>7E;D<64A95E9<K489<69:<;6675;8;<K9D4
896E75;EL:74<8;<A96A;P
p R<@c;W9<K[MD7@;<V<?A;<@c;W9<C?9<K9:A7E9<;M:7:<E48;6<;6
;6675;E?:;6<87>7E;76<846<?6?L:746<89<?A;<9AK:96;P

 !"#$%

&'(&

11

www.pciconcursos.com.br

12

!"#$"%&'('#)*+(,-"+&'#'$"!,.%'+,%#"$,.'&"#('##%#&"-,#
/%+('0#"1%+*234*56*"'#%&"+#7*"#"#"6*"-8
9: ;#%#&"-,'$"!,.%'+,5<*-,$5,&,)'!-,3'*#"4,3*-,"#$<.%"
("=,#"#'=!",7*,5#>'"2".*&,('#'#$!'6!,-,#*#,('#"*-.'-$*&,('!85<-(%##'3&!,(*?,#&,!"),#!"7*%#%&,(,#$"5'
*#*@!%' '* $'!$!'6!,-,#$,!, *-, 5%+6*,6"- 7*" '
.'-$*&,('!.'-$!""+(,8
9A B=*+&* < *- #%#&"-, '$"!,.%'+,5.'- =,#" "- 1%+*2
("#"+C'5C%('$,!,DEFGHEEIJ3KGJIFELJ"#"!C%('!"#8
9M ;#%#&"-,'$"!,.%'+,5/%+('0#<-,%##"6*!'('7*"'1%+*23
*-,C"?7*"'1%+*2$'##*%.N(%6',="!&'"),.%5%&,,
'.'!!O+.%,("C*5+"!,=%5%(,("#8
99 #)*+PQ"#('R!;))%."#>'#%-%5,!"#S#)*+PQ"#('$,.'&"
;))%."(,T%.!'#')&+'7*"#"!")"!"S"(%P>'("&"2&'#"
$5,+%5U,#"5"&!V+%.,#8

W'+#%("!,+(',)%6*!,,.%-,37*"-'#&!,*-,&"5,('X+&"!+"&
Y2$5'!"!Z8[3'#.'+."%&'#=@#%.'#"'#-'('#("*&%5%?,P>'("
&".+'5'6%,#3)"!!,-"+&,#3,$5%.,&%C'#"$!'."(%-"+&'#,##'.%,('#S
X+&"!+"&"\DF]^DGF34*56*"'#%&"+#,#"6*%!8
'#".5%.,!,'$P>'
3#"!@,.%'+,('*-#%#&"-,("
#"6*!,+P,7*"6,!,+&",$!'&"P>'.'+&!,C`!*#"F]Ea^DJ8
9b '.5%.,!,'$P>'
3'*#*@!%'&"- ,."##',*-,
)"!!,-"+&,("=*#.,7*"$"!-%&"5'.,5%?,!3$'!"2"-$5'3
%-,6"+#!"5,.%'+,(,#S$,5,C!,cYY18

9_

'#".5%.,!,)"!!,-"+&, 3#"!@)"%&,,("#.'+"2>'(,
X+&"!+"&8
9e f,!,#""+C%,!,$@6%+,,$!"#"+&,(,$'!Ggh^\i3<#*)%.%"+&"
.5%.,!,)"!!,-"+&, 3(%6%&,!'Ggh^\i('("#&%+,&@!%'"
.5%.,!,'$P>'jklmno8
9d

9p

'#".5%.,!,)"!!,-"+&, 3,#$@6%+,#(,cYY1"('
q''65"#"!>'"2%=%(,#"--%+%,&*!,8

4 1
1 9 

0123456759
55

c'7*"#"!")"!",'#$'("!"#,(-%+%#&!,&%C'#",'#$!%+.`$%'#7*"
!"6"-,,(-%+%#&!,P>'$r=5%.,34*56*"'#%&"+##*=#"7*"+&"#8
9s t",.'!('.'- '$!%+.`$%'(,5"6,5%(,("3,,(-%+%#&!,P>'
$r=5%.,#'-"+&"$'("),?"!'7*",5"%5U"$"!-%&"8
_: W'-'(".'!!O+.%,(,!"5,P>'U%"!@!7*%.,$!"#"+&"+'u-=%&'
(,,(-%+%#&!,P>'$r=5%.,3*- N!6>'("U%"!,!7*%,#*$"!%'!
$'(",C'.,!,&!%=*%PQ"#("*-N!6>'#*='!(%+,('3("#("7*"
"#&,#+>'#"4,-(".'-$"&O+.%,"2.5*#%C,8
v*56*"'#$!N2%-'#%&"+#3,!"#$"%&'('#"!C%P'$r=5%.'"('
.'+&!,&',(-%+%#&!,&%C'8
_A ; $!%+.`$%'(,.'+&%+*%(,("('#"!C%P'$r=5%.'3#"6*+(''
7*,5'#"!C%P'$r=5%.'+>'$'("#"!%+&"!!'-$%('3<,$5%.@C"5
,' "2"!.`.%' (, )*+P>' $r=5%.,3-,#+>' ,'#.'+&!,&'#
,(-%+%#&!,&%C'#8
_M ;##"!C%P'#$!"#&,('#$'!$"##',#4*!`(%.,#"- !"6%-"("
.'+."##>' '* $"!-%##>'3,%+(, 7*" $,!, #,&%#),?"! ,#
+"."##%(,("#.'5"&%C,#3+>'#>'.'+#%("!,('##"!C%P'#$r=5%.'#3
4@7*"+>'#>'$!"#&,('#(%!"&,-"+&"$"5'Y#&,('8
W'- !"5,P>','%+#&%&*&'(,5%.%&,P>'",'#,&'#,(-%+%#&!,&%C'#3
4*56*"'#%&"+#7*"#"#"6*"-8
_9 ;$!"6>'.'+#&%&*%-'(,5%(,("("5%.%&,P>'$,!,,7*%#%P>'("
#"!C%P'#.'-*+#37*,57*"!7*"#"4,'C,5'!"#&%-,('(,
.'+&!,&,P>'8
__ !"C'6,P>'(',&',(-%+%#&!,&%C'37*"%-$5%.,"2&%+P>'("*,&'C@5%('3$!'(*?")"%&'#!"&!',&%C'#8
v*56*"'$!N2%-'%&"-3!"5,&%C','$!'."##',(-%+%#&!,&%C'8
_b ;$!%+.`$%'(,'="(%O+.%,S)'!-,",'#$!'."(%-"+&'#&",$5%.,P>',=#'5*&,+'$!'."##',(-%+%#&!,&%C'3!,?>'$"5,7*,5
'#,&'#('$!'."##',(-%+%#&!,&%C'#"-$!"("$"+("!>'("
)'!-,("&"!-%+,(,8
!"#$"%&'('#$!%+.`$%'#)*+(,-"+&,%#3('#(%!"%&'#"(,#6,!,+&%,#
)*+(,-"+&,%#34*56*"'#%&"+#,#"6*%!8
_d ;#C,5'!"##'.%,%#(' &!,=,5U' " (, 5%C!" %+%.%,&%C,3,
.'+#&!*P>'("*-,#'.%"(,("5%C!"4*#&,"#'5%(@!%,",6,!,+&%,
(' ("#"+C'5C%-"+&' +,.%'+,5.'+#&%&*"- )*+(,-"+&'#(,
w"$r=5%.,x"("!,&%C,('R!,#%58
_e t",.'!('.'- ,W'+#&%&*%P>'x"("!,5("yzZZ{Wx|3+,
U%$N&"#"("%-%+"+&"$"!%6'$r=5%.'3,,*&'!%(,(".'-$"&"+&"
$'(" *#,! $!'$!%"(,(" $,!&%.*5,!3 ,##"6*!,+('}#" ,'
$!'$!%"&@!%'3+'.,#'("(,+'3,%+("+%?,P>'*5&"!%'!8
 !"#$"%&' (, '!6,+%?,P>' $'5`&%.'},(-%+%#&!,&%C, (' Y#&,('
=!,#%5"%!'"(,,(-%+%#&!,P>'$r=5%.,34*56*"'#%&"+##"6*%+&"#8
_p  Wx ,(-%&" , %+.'!$'!,P>'3 , #*=(%C%#>' '* '
("#-"-=!,-"+&'(""#&,('#8
_s f,!,")"%&'#("!"-*+"!,P>'("$"##',5('#"!C%P'$r=5%.'3,
Wx$"!-%&",C%+.*5,P>''*"7*%$,!,P>'("7*,%#7*"!"#$<.%"#
!"-*+"!,&N!%,#8
v*56*"'%&"-,=,%2'3!"5,&%C','f'("!Y2".*&%C'8
b: ; $!"#%("+&" (, w"$r=5%., +>' (%#$Q" (" .'-$"&O+.%,
.'+#&%&*.%'+,5$,!, .'+."("! %+(*5&'3$'! #" &!,&,! ("
.'-$"&O+.%,"2.5*#%C,('f'("!v*(%.%@!%'8
99

13

,-./012345-/3-/6789:-/81/;<963/83/=>??@A/BC2:C1/-D/9<1ED
D1:C9E<1DF
GH I/6-.J0-.9DD-A/3/6--J10345-/1/3/<03EDJ30KE693/D5-/L32-01D
MC1/81L1./J3C<30/3D/34N1D/83/=>??@/1/3/6-E8C<3/8-D/D1CD
3:1E<1D/JOP296-DF
GQ ID/3:1E<1D/JOP296-D/83/=>??@A/3-/1R16C<301./34N1D/81
.3E1903/D-298S093/E3/PCD63/83/.12T-093/83/MC3298381/81/L983/83
D-6918381/1./:1032/1A/1./J30<96C230A/8-D/CDCS09-D/8-D/D10L94-D
81/1E10:93/12;<0963A/.3E9U1D<3./-/L32-0/83/01DJ-ED3P9298381
D-6932/1./DC3/6-E8C<3/J0-U9DD9-E32F
GV =/
=>??@/<1./6-.-/C./81/D1CD/6-.J0-.9DD-D/3/J0-.-45-/81
34N1D/81/630S<10/18C63<9L-/J303/3/89DD1.9E345-/81/C.3/6C2<C03
;<963A/1/DC3D/298103E43D/81L1./6-.J0-.1<10WD1/6-./3
89DD1.9E345-/81DD3/6C2<C03/E3D/-0:3E9X34N1DF
GY ID/D10L98-01D/83/=>??@/81L1./6-.J0-.1<10WD1/6-./-D
L32-01D/83/-0:3E9X345-A/1R1061E8-/DC3D/3<9L98381D/6-./X12-/1
81896345-/E3/81U1D3/8-D/9E<101DD1D/.39-01D/83/E345-A/1D<3E8-A
J-0<3E<-A/9.J1898-D/81/J03<9630/3<9L98381/J-2Z<96-WJ30<98S093F
[\ ]<929X30WD1/83/J0-R9.98381/6-./C./DCJ109-0/T910S0MC96-/J303
-P<10/U3L-01D/J1DD-39D/1/89DD1.9E30/9EU-0.34N1D/MC1/<1ET3.
6-E<1O8-/J-2Z<96-WJ30<98S09-/D5-/6-E8C<3D/9E6-.J3<ZL19D/6-.
-D/L32-01D/1/6-.J0-.9DD-D/81623038-D/E-/6789:-/81/;<963/83
=>??@A/DCB19<3E8-/-D/3:1E<1D/MC1/3D/J03<96301./^/,-.9DD581/_<963/1/`9D69J29E3/8-/a9E9D<;09-/83D/a9E3D/1/?E10:93F
?./6383/C./8-D/J07R9.-D/9<1EDA/;/3J01D1E<383/C.3/D9<C345T9J-<;<963A/D1:C983/81/C.3/3DD10<9L3/3/D10/BC2:383/6-./012345-/^D
J1E3298381D/J01L9D<3D/E3/@19/bFccdecffgF
[G h-5-A/D10L98-0/JOP296-/83/=>??@A/<1L1/DC3/81.9DD59EL3298383/J-0/8169D5-/38.9E9D<03<9L3F/>1DD3/D9<C345-A/h-581L10S/D10/019E<1:038-/3-/630:-/3E<109-0.1E<1/-6CJ38-A
1D<3E8-/DC3/3J-D1E<38-093/3C<-.3<963.1E<1/DCB19<3/3/63DD345-F
[[ i3C2-A/1./UCE45-/83/019E<1:0345-/81/C./6-21:3A/D10S
016-E8CX98-/3-/630:-/MC1/3E<109-0.1E<1/-6CJ3L3A/63P1E8-W2T1
81L-2L10/3-/10S09-/-D/1.-2C.1E<-D/J1061P98-D/E-/J10Z-8-F
>1DD3/D9<C345-A/63D-/i3C2-/E5-/U343/3/81L-2C45-/8-D/01U1098-D
1.-2C.1E<-D/E-/J03X-/81/E-L1E<3/893DA/121/1D<30S/DCB19<-/^
DCDJ1ED5-/1/3-/J3:3.1E<-/81/.C2<3/89S093F
jC3E<-/3-D/3<-D/81/9.J0-P98381/38.9E9D<03<9L3A/BC2:C1/-D/9<1ED/3
D1:C90F
[k ,-ED<9<C9/1E09MC169.1E<-/92Z69<-/-/3<-/81/C./3:1E<1/JOP2960161P10/J303/D1C/U92T-/C./3C<-.7L12/X10-/MC92l.1<0-/6-.J01D1E<1/81/C./1.J01DS09-/MC1/<1ET3/<98-/9E<101DD1/8901<3.J3038-/J-0/-.9DD5-/816-001E<1/83D/3<09PC94N1D/81DD1/3:1E<1
JOP296-/6-.-/D10L98-0/JOP296-F
[m ,-ED98101/MC1/i180-/<1ET3/81ECE6938-/-/3:1E<1/JOP296-/h-5J-0/3<-/81/9.J0-P98381A/D3P1E8-/MC1/1D<1/103/9E-61E<1F/>1DD1
63D-A/i180-/J10810S/3C<-.3<963.1E<1/DC3/UCE45-/JOP2963/1/<10S
D1CD/89019<-D/J-2Z<96-D/DCDJ1ED-DA/32;./81/D10/6-E81E38-/^/J1E3
81/0162CD5-/1/3-/J3:3.1E<-/81/.C2<3F

0123456759
55

=/01DJ19<-/81/;<963/1/.-032A/BC2:C1/-/9<1./3P39R-F
[n =/;<963/E-/D10L94-/JOP296-/89X/01DJ19<-/D-.1E<1/^D/01234N1D/81
6-.3E8-/1/-P189KE693A/1EMC3E<-/3/.-032/3J2963WD1/^D/01234N1D
81/6-.J0-.9DD-/1/01DJ19<-/3-D/J09E6ZJ9-D/1/L32-01DF
,-./012345-/3-D/3.P91E<1D/1/^D/U1003.1E<3D/o9E8-pD/1/@9ECRA
BC2:C1/-D/9<1ED/3/D1:C90F
[H ?./3.P91E<1/o9E8-pDA/-/369-E3.1E<-/D9.C2<qE1-/83D/<1623D
A/ /1/ /J10.9<1A/1E<01/-C<03D/34N1DA/U9E329X30
C.3/<301U3/J1E81E<1/E-/6-.JC<38-0A/J-0/1R1.J2-A/1E610030/C.
3J2963<9L-/MC1/E5-/1D<1B3/01DJ-E81E8-A/6-.-/-/o-08/-C/uE<10E1</?RJ2-010F
[Q i303/D1/01329X30/3/<0-63/81/CDCS09-/E-/o9E8-pDA/D1./81D29:30
-/6-.JC<38-0A/81L1WD1/D12169-E30/3/-J45-/vwxyz{|}~}A
1E6-E<0383/E-//wzA/3/U9./81/1E610030/3/D1DD5-/3<C32/81
<03P32T-/1/819R30/-/6-.JC<38-0/89DJ-EZL12/J303/-C<0-/CDCS09-F
[V =/DCZ<1/81/3J2963<9L-D/8-/@9ECR/<30IUU961A/89DJ-EZL12
:03<C9<3.1E<1/E3/uE<10E1<A/J10.9<1/3/18945-/81/8-6C.1E<-D/6-.
89U101E<1D/J380N1DA/-D/MC39D/J-81./D10/3P10<-D/J303
.-89U9634N1D/1./3J2963<9L-D/o9E8-pDF
[Y >-/a960-D-U</o-08A/J303/D1/3P090/C./8-6C.1E<-/189<38-/EIJ1EIUU961A/;/E161DDS09-/:1030/C./30MC9L-/E-/U-0.3<-/F-8</1A
J-0/.19-/83/-J45-/}zwz{}y}A/1E6-E<0383/E-/
z}{}{}zA/6-EL10<10/-/01U1098-/30MC9L-/J303/-/U-0.3<F8-6F
k\ ID/
LZ0CD/81/.360-/MC1/83E9U963./8-6C.1E<-D/8-/o-08/J-81.
D10/129.9E38-D/6-./3/9ED<32345-/8-/3J2963<9L-/9DC32/3D96/U-0
=JJ2963<9-EDA/8-/o9E8-pDF
hC2:C1/-D/9<1ED/DCPD1MC1E<1DA/3/01DJ19<-/81/6-E619<-D/1/U1003.1E<3D
81/uE<10E1<F
kG =/D9E<3R1/81/1E81014-D/81/6-0019-/121<0lE96-/E3/uE<10E1</<1./D1:C9E<1/J3805-/E-.1/8-/CDCS09-A/D1:C98-/8-/DZ.P-2-//1A/3
D1:C90A/-/8-.ZE9-/-C/A/MC1/;/-/1E81014-/8-/D10L98-0/MC1
DCJ-0<3/-/D10L94-/81/F
k[ =/29E:C3:1./a@A/C<929X383/J303/60930/8-6C.1E<-D
T9J10<1R<-DA/J-81/D10/9E<10J01<383/J-0/MC32MC10/E3L1:38-0/1
E5-/J0169D3/D10/6-.J92383F
kk i/;/C./J0-<-6-2-/81/6-.CE96345-/MC1/J10.9<1/-/1EL9-/81
30MC9L-D/3E1R-D/3/.1ED3:1ED/81/6-0019-/121<0lE96-A/D1./3
E161DD98381/81/6-.J36<30/1DD1D/30MC9L-DF
km ;/C./<9J-/81/3<3MC1/E3/uE<10E1</MC1/<1E<3/9E8CX90A/J-0
.19-/81/.1ED3:1ED/81//-C/DZ<9-D/.32969-D-DA/-D/CDCS09-D
3/9EU-0.301./838-D/J1DD-39D/-C/6-EU981E6939DF
>-/MC1/D1/01U101/3-D/J-8101D/38.9E9D<03<9L-D/1/3-D/J09E6ZJ9-D/MC1
01:1./3/38.9E9D<0345-/JOP2963A/BC2:C1/-D/9<1ED/DCPD1MC1E<1DF
kn I/J09E6ZJ9-/83/.-03298381/38.9E9D<03<9L3/<1./1R9D<KE693
3C<lE-.3/E-/-081E3.1E<-/BC0Z896-/E369-E32/1/81L1/D10
-PD10L38-/E5-/D-.1E<1/J12-/38.9E9D<038-0/JOP296-A/6-.<3.P;./J12-/J30<96C230/MC1/D1/012369-E3/6-./3/38.9E9D<0345JOP2963F
kH ,-./UCE83.1E<-/E-/J-810/89D69J29E30A/3/38.9E9D<0345JOP2963A/3-/<10/6-ET169.1E<-/81/J0S<963/81/U32<3/J-0/D10L98-0
JOP296-A/J-81/1D6-2T10/1E<01/3/9ED<3C0345-/-C/E5-/81
J0-6189.1E<-/81D<9E38-/3/J0-.-L10/3/6-001DJ-E81E<1/3JC034583/9EU0345-F

rs

!"# $%&'"&()

*+*

14
QUESTO 50

UnB/CESPE CAIXA/NM1
QUESTO 52

Acerca dos modos de utilizao de aplicativos do ambiente


Microsoft Office, assinale a opo correta.

A A barra de ferramentas de formatao dos aplicativos da sute

Com relao ao Windows, assinale a opo correta.


A Por meio do menu Iniciar do Windows XP, tem-se acesso
opo Executar, que permite abrir arquivos editados em

Office permite que seja aplicada a determinado contedo uma

aplicativos da sute Microsoft Office, sem que os respectivos

srie de aes, tais como salvar, copiar, colar e apagar.

B O recurso denominado Selecionar tudo, acionado a partir do


conjunto das teclas + T, permite que, com o apoio do

aplicativos sejam previamente executados.

B A opo Definir acesso e padres do programa, que pode ser


acessada a partir do menu Iniciar do Windows, permite que

mouse, o usurio selecione trechos arbitrrios de documentos,

sejam especificados programas-padro a serem utilizados para

planilhas ou apresentaes editados, respectivamente, no

realizar atividades como navegao na Internet e envio de

Word, no Excel e no PowerPoint.

C Ao ser inserida em um documento editado no Word, uma

planilha criada utilizando-se o Excel convertida em tabela,


que deixa de ter vnculo com a planilha original e, por isso,

mensagens de e-mail, entre outras.

C No Windows, fazer logoff de usurio significa excluir do

sistema um usurio cadastrado e seus arquivos armazenados,

alteraes na tabela no afetam o contedo da planilha, nem


vice-versa.

D No Excel, o recurso de mesclar clulas de uma planilha

alm de tornar sua senha invlida.

D Por meio da janela Meu Computador, possvel acessar o


diretrio Arquivos de programas, que consiste em um diretrio

permite criar uma clula de planilha a partir de clulas vizinhas

especial do Windows para instalao e remoo de programas.

selecionadas.

Para a remoo correta de determinado programa, suficiente

E Ao ser inserida em um documento editado no Word, uma

figura deve ser dimensionada no tamanho desejado, pois,

uma vez inserida no documento, ela no poder ser


redimensionada.

excluir desse diretrio o programa desejado.

E O Windows disponibiliza ao usurio uma lista de documentos

recentes, que pode ser utilizada para acesso rpido a arquivos,


desde que estes arquivos tenham sido salvos recentemente no

QUESTO 51

Acerca dos aplicativos da sute BR Office, assinale a opo correta.


A A opo de exportar um documento editado no Writer como
PDF (portable document format) permite que esse documento
seja visualizado utilizando-se aplicativo no pertencente sute
BR Office.

computador em uso.
QUESTO 53

Acerca do sistema operacional Linux, assinale a opo correta.


A No Linux, pode-se definir um caminho de diretrios a partir do

uso de barras invertidas (\), diferentemente do Windows, em

B No Writer, a opo que permite salvar o contedo de um

documento como mensagem de e-mail s estar ativada se o


computador no qual o aplicativo estiver sendo executado
possuir acesso Internet.

C O Calc um aplicativo da sute BR Office que permite, no

ambiente Linux, a realizao de operaes matemticas


simples, como adio e subtrao, e equivalente ao aplicativo

que so utilizadas barras no invertidas (/).

B O Linux disponibiliza, na barra de inicializao rpida, recurso

para ligar ou desligar o computador com maior velocidade,


empregando o conceito de boot parcial da mquina.

C O Linux tem a desvantagem, com relao ao Windows, de ser

mais vulnervel a vrus de computador, que se propagam com

Calculadora do Windows.

rapidez nesse ambiente, tornando os aplicativos lentos e

D No Impress, a opo de duplicar slide permite que seja inserido


um novo slide em branco imediatamente aps o slide em
edio.

infectando os arquivos.

D Em ambiente operacional, o gerenciador de arquivos


utilizado para se visualizar a estrutura de diretrios e

E As rguas existentes para edio de texto, acessveis pelo menu

respectivos arquivos. No Linux, o Konqueror constitui

Exibir, no podem ser ocultadas na sute BR Office, de forma a

garantir que o espaamento entre caracteres e a disposio


espacial das pginas sejam visveis.
Cargo: Tcnico Bancrio Novo

exemplo de gerenciador de arquivos.

E O diretrio raiz do Linux o C:\.

Caderno ALFA

www.pciconcursos.com.br

12

15
QUESTO 56

QUESTO 54

Com relao a conceitos de Internet e intranet, assinale a opo


correta.

Com relao Internet, assinale a opo correta.


A

meio de uma rede local, no sendo possvel esse acesso a


partir de um computador conectado Internet, garantindose, assim, segurana.
B A Internet e as intranets diferenciam-se pelos tipos de

atividade, dispensa-se o servidor.

B
C

realizao de ligaes telefnicas em tempo real e com baixo


custo.
D

A Internet emprega o modelo de comunicao cliente-servidor.

Denomina-se domnio da Internet o servidor que contm as

acesso ao servio de correio eletrnico o http.

informaes que se deseja acessar para diversas finalidades,

tais como correio eletrnico, transferncia de arquivos, acesso

D Os mecanismos de busca atualmente utilizados na Internet,

Web etc.

como os utilizados pelo Google, por exemplo, permitem o


acesso a pginas de intranets de empresas.

QUESTO 57

E O acesso Internet por meio de redes ADSL, que


empregam a linha telefnica e modems como recursos
tecnolgicos para a transmisso de dados, possvel e
permite obter taxas de transmisso superiores a 10 Mbps.

Acerca dos conceitos de organizao de informaes, assinale a opo


correta.
A

Com relao aos aplicativos para acesso Internet, assinale a

Para o armazenamento de arquivos, o Windows possui estrutura

de diretrios rgida, sendo desnecessrio e impossvel ao usurio

QUESTO 55

criar diretrios prprios.


B

opo que apresenta apenas navegadores web.

No Linux, arquivos com terminaes diferentes, indicando terem

sido gerados por programas diferentes, devem ser armazenados

A Netscape Navigator, Internet Explorer, Mozzila Firefox,

em diretrios especficos e distintos.


C

Uma das formas para otimizar o uso do espao em disco a


compactao de arquivos, que pode ser feita por meio de

Opera

programas especficos para tal finalidade, tais como o WinZip e

B Thunderbird, Netscape Navigator, Internet Explorer,


Outlook
C Opera, Internet Explorer, Painel de Controle, Mozzila

o RAR.
D

seja feito o backup, o arquivo excludo do sistema de

D Outlook Express, Internet Explorer, Netscape Navigator,


Internet Explorer

armazenamento.
E

E Windows Explorer, Internet Explorer, Thunderbird,

No Linux, os arquivos so armazenados com prazo de validade.


Ao se encerrar o prazo de armazenamento demandado, caso no

Firefox

Cargo: Tcnico Bancrio Novo

VoIP uma tecnologia atualmente promissora que, ao otimizar o

uso da linha telefnica residencial ou empresarial, permite a

embasada no protocolo TCP/IP e as intranets, no protocolo


C Na Internet, o protocolo de comunicao padro para

Uma VPN uma rede virtual privada utilizada como alternativa


segura para usurios que no desejam utilizar a Internet.

protocolos de comunicao utilizados: a Internet


Telnet.

O cliente de e-mail consiste em um programa que permite acesso


caixa postal do usurio de correio eletrnico; para essa

A O acesso ao que se denomina intranet deve ser feito por

Mozzila Firefox, Outlook

UnB/CESPE CAIXA/NM1

O Linux no permite a criao de mais de cinco subdiretrios


dentro de um diretrio raiz, nem um caminho superior a cinco
diretrios.

Caderno ALFA

www.pciconcursos.com.br

13

16

UnB/CESPE CAIXA/NM1

QUESTO 58

Tendo como base a janela ilustrada acima, assinale a opo correta acerca do Windows Explorer.
A Denomina-se desktop o diretrio raiz do Windows, no qual esto armazenados todos os outros diretrios do sistema operacional.
B Em
, esto listados os stios da Internet recentemente acessados pelo usurio.
C Para se alterar o modo de exibio da lista de arquivos e diretrios exibidos na janela, deve-se acionar o boto

D O boto
utilizado para se abrir, com o mouse, um diretrio selecionado pelo usurio. Esse procedimento para se abrir um
diretrio pode tambm ser realizado por meio de clique duplo.
E A barra de endereo permite tanto navegar pela estrutura de diretrios quanto acessar a Web ou outros servios de Internet, tais como
o FTP.
q 59
QUESTO

QUESTO 60

Com relao a certificao e assinatura digital, assinale a opo

Acerca de certificao digital, assinale a opo correta.

A A assinatura digital facilita a identificao de uma

A A infraestrutura de chaves pblicas uma rede privada que

correta.

comunicao, pois baseia-se em criptografia simtrica de uma

garante que seus usurios possuem login e senha pessoais e

nica chave.

B Quando um usurio com assinatura digital envia e-mail para


um destinatrio, a mensagem ser assinada por uma chave

pblica do destinatrio, para garantir que seja aberta apenas

intransferveis.
B Uma autoridade de registro emite o par de chaves do usurio
que podem ser utilizadas tanto para criptografia como para

pelo destinatrio.

C No Windows, no necessrio utilizar assinatura digital, pois

todos os aplicativos, principalmente os navegadores web,

assinatura de mensagens eletrnicas.


C A autoridade certificadora raiz emite certificados para usurios

utilizam essa tecnologia de maneira automtica e transparente

de mais alto nvel de sigilo em uma organizao com uma

ao usurio.

D Uma desvantagem dos aplicativos da sute BR Office, em

relao aos da sute Microsoft Office, no possuir suporte a

chave de criptografia de 128 bits.


D A autoridade de registro recebe as solicitaes de certificados
dos usurios e as envia autoridade certificadora que os emite.

assinaturas digitais nem exibir certificados digitais criados para


os usurios.

E O destinatrio de uma mensagem assinada utiliza a chave

E O uso de certificado digital garante o repdio de comunicaes

pblica do remetente para garantir que essa mensagem tenha


sido enviada pelo prprio remetente.

Cargo: Tcnico Bancrio Novo

oriundas de usurios ou stios que possuem certificados vlidos


e emitidos por entidades confiveis.

Caderno ALFA

www.pciconcursos.com.br

14

17

012345675965
356

) *+,-./01/,./2,/,./2-31/,-,45+,.-1-,52,1/6,78+36,-,6+9570,6+,0+:70-;,2-045+,3-,<=>?@ABCADCEF=EG@E;,H-0-,.-1-,78+2I,/,.-2H/
1+6793-1/,./2,/,.J179/,K;,.-6/,L5M95+,/,78+2,KNOPQR,/5,/,.-2H/,1+6793-1/,./2,/,.J179/,N;,.-6/,L5M95+,/,78+2ANOOSTQU,V-0-6,1+W71-6,2-0.-XY+6;,56+,-,<=>?@ABCADCEF=EG@E;,Z37./,1/.52+38/,W[M71/,H-0-,-,./00+X\/,1-6,65-6,0+6H/68-6U
) ]/6,78+36,45+,-W-M7-2,./3^+.72+38/6,1+,73:/02[87.-;,-,2+3/6,45+,6+L-,+_HM7.78-2+38+,73:/02-1/,/,./380[07/;,./3671+0+,45+I,8/1/6
/6,H0/90-2-6,2+3.7/3-1/6,+68\/,+2,./3:7950-X\/`H-10\/;,+2,H/08595a6R,/,bcdefg+68[,./3:7950-1/,H-0-,H+66/-6,1+680-6R,+_H0+66Y+6
./2/,h>ih@D;,h>ijkCAEilF>CEA+,h>ijkCABkF>=A0+:+0+2`6+,-,.M745+6,./2,/,m/8\/,+645+01/,1/,bcdefR,GCh>@DA./00+6H/31+,n,/H+0-X\/,1+
H0+667/3-0,52-,8+.M-,+;,0-H71-2+38+;,M7m+0[`M-;,-.7/3-31/`-,-H+3-6,52-,W+oU,p/3671+0+,8-2mq2,45+,3\/,^[,0+6807XY+6,1+,H0/8+X\/;,1+
:53.7/3-2+38/,+,1+,56/,+2,0+M-X\/,-/6,H0/90-2-6;,-0457W/6;,170+8J07/6;,0+.506/6,+,+457H-2+38/6,2+3.7/3-1/6U

rstuvrwxvtysz{|v}~wz

=D@iEAl@h?CGCEACAlCD=EA
EC@l=EAEClFDCAklAF=kh=ABCEh=<i@B=E,

/03-76,,72H0+66/6,/5,+M+8037./6,,./6852-2;
H+07/17.-2+38+;,0+80-8-0,/,1+6+2H+3^/,1-,+./3/27-,+,1/
9/W+03/U,V-0-,766/;,H0+.76-2,80-m-M^-0,./2,2+171-6;
7
317.-1/0+6,45-3878-87W/6U,p/3851/;,/6,7317.-1/0+6,45+
./368052/6,3J6,/5,+M+6,3\/,6\/,3+580/6;,3\/,6\/
731+H+31+38+6,1/,M59-0,+2,45+,+68-2/6;,3-,6/.7+1-1+U,,3\/
6
\/,731+H+31+38+6,1/,052/,45+,H0+8+31+2/6,1-0,n,6/.7+1-1+
,/,3/66/,H0/L+8/;,-,3/66-,71+/M/97-U,
-o,8+2H/,45+,+68-W-,-2-150+.+31/,-,H/Ma27.-,6/m0+
+
66+6,7317.-1/0+6,,.0+6.72+38/,+./327./,+,+2H0+9/U,[
H/5./6,2+6+6;,3/,.-1+03/,1+,+./3/27-,1/,L/03-M,QANEG@B=ABC
@k>=;,52,-0879/,1+,./M53768-,/:7.7-M,1/,L/03-M;,m-68-38+
.
/36+0W-1/0-;,.0787.-W-,/,1+6+2H+3^/,1-,+./3/27-,+,1/
9/W+03/;,-:702-31/;,H/0,+_+2HM/;,45+,-,+./3/27-,7-,2-M,+,/
1+6+2H0+9/,.0+6.7-U,]-,2+62-,+17X\/;,2-6,+2,/580/,.-1+03/;
52,
0/2-3.768-,+,./M53768-,1+,L/03-76,+,0+W768-6;,/\/,m-M1/
7m+70/;,17o7-,-M9/,6727M-0I,3-1-,.0+6.7-,3/,0-67M;,-,3\/,6+0,/6
72H/68/6U,,-66/2m0/6/,q,45+,-,H073.7H-M,2-8q07-,1+66+
-1+03/,1+,+./3/27-;,3+66-,2+62-,+17X\/,1/,NEG@B=;,./2
.
90-31+,1+68-45+;,+0-,-M9/,-6672I,p0+6.+,/,+2H0+9/,+,+2H0+9/
:/02-M;,+,-,2-66-,6-M-07-M,-52+38-,3-,W+M/.71-1+,1+,,m7,H/0
2a
6U
,M+78/0,1+6./3:7-1/,H+09538-07-I,/,45+,-./38+.+5
6,./M53768-6,3\/,M++2,/,H0JH07/,L/03-M,]\/;,3\/,q,766/U
,.
/M53768-,3\/,+68-W-,H0/15o731/,73:/02-X\/;,+68-WH0/15o731/,52-,738+0W+3X\/,3/,1+m-8+;,52-,738+0W+3X\/
2/87W-1-;,52-,73:/02-X\/,738+0+66-1-;,2/87W-1-,H+M-,65 H/6
7X\/,H/M87.-U,,/,0/2-3.768-,+68-W-,6+,0+:+0731/;
72HM7.78-2+38+;,n,+171-,V0/W76J07-,V,3,;,45+
-52+38-07-,72H/68/6,H-0-,-6,8-76,+2H0+6-6,H0+68-1/0-6,1+
6
+0W7X/6;,3-6,45-76;,H0/W-W+M2+38+;,+M+,707-,6+0,+345-10-1/U
]-1-,2-76,3-850-M,45+,+6H+03+7+2,+,45+,W+L-2,/,2531/,1+
/580-,2-3+70-U,,52-,H+0.+HX\/,1/,2531/;,2-0.-1-,H+M/,M59-0
+
2,45+,+M+6,+68\/,+,H+M/6,:-8/6,45+,H+0./00+2,65-,+_768a3.717[07-U
,V,3,;,8\/,6500-1-,H+M-,217-;,172735-,/
7
2H/68/,1+,0+31-,,H-0-,/6,-66-M-07-1/6,+,H+367/3768-6,+;
H0/H/0.7/3-M2+38+;,-52+38-W-,/,72H/68/,1-6,8-76,+2H0+6-6U
66-6;,3/6,ZM872/6,-3/6;,873^-2,671/,/,176H/6787W/,H+M/,45-M
+
2H0+6-6,+,:53.7/3[07/6,45-M7:7.-1/6,873^-2,+2H0++3171/,8+0.+707o-X\/,1/,-66-M-07-1/;,./2,67937:7.-87W-,0+15X\/,1+
.-09-,807m58[07-U,M952,L/03-M,8/./5,3+66-,0+M-X\/,]\/,6+,:-M 1+
,./01-,+2,.-6-,1+,+3:/0.-1/U
5M95+,/6,78+36,1+,,-,;,-.+0.-,1-6,H0/H07+1-1+6,8+_85-76,+
90-2-87.-76,1/,8+_8/,-.72-U
,+2H0+9/,1-6,-6H-6,3-,M73^-,,
-L51-,-,./3680570,/,8/2,7037./
45+,/,-58/0,72H072+,-/,8+_8/,+,+68[,0+M-.7/3-1/,n,71+7-,.+380-MU
66-,0+M-X\/,H/1+,6+0,+_H0+66-,1-,6+95738+,:/02-I,65HY+`6+,45+
/6,0+80-8/6,6+L-2,.JH7-6,1-,0+-M71-1+;,2-6,/,-58/0,H0/.502/680-0,45+,-,0+-M71-1+,H/1+,6+0,1768/0.71-,H+M-,H/67X\/,45+,-6
H+66/-6,/.5H-2,3-,6/.7+1-1+U
]-,M73^-,;,6+,-,H-M-W0-,8+2H/,:/66+,65m687851-,H+M+_H0+66\/,B=iEA@=E;,-,:/02-,W+0m-M,:-o,1+W+07-,6+0
65m687851-,H/0,<@ClU
 !"#$% & '(

]/,80+.^/,,-66/2m0/6/,q,45+,-,H073.7H-M,2-8q07-,1+66+
.-1+03/,1+,+./3/27-,U`;,-,H-M-W0-,-66/2m0/6/,+68[
+2H0+9-1-,./2/,52,65m68-387W/;,/,45+,6+,./2H0/W-,H+MH0+6+3X-,1/,-0879/,45+,-,-38+.+1+U
*+,-./01/,./2,/,-58/0;,-,./M53768-,1/,.-1+03/,1+,+./3/27^-W7-,M71/,-6,2-8q07-6,+6.078-6,H+M/6,./M+9-6,1+,L/03-M,+,6+
/H53^-,-,+M+6;,2-6,+M+6,3\/,87W+0-2,-.+66/,n,/H737\/,1-,./M+9-38+6,1-,H5mM7.-X\/,+,1-,W+7.5M-X\/,1/,L/03-MU
,./3+.87W/,45+,737.7-,/,80+.^/,,/,0/2-3.768-,+68-W-,6+
0+:+0731/,U,8+2,W-M/0,+_HM7.-87W/,+,H/1+07-,6+0,65m687851/
H/0,=iE;,6+2,H0+L5o/,H-0-,/6,6+3871/6,/07973-76,1/,8+_8/U
,+2H0+9/,1/,-.+38/,90-W+,+2,,/,0/2-3.768-,+68-W-,6+
0+:+0731/;,72HM7.78-2+38+;,n,+171-,V0/W76J07-,V,3U,
U`AL5687:7.-`6+,H+M-,0+9a3.7-,1+,0+:+0731/,+,H+M/
+2H0+9/,1+,-0879/,:+27373/,-38+.+1+31/,+171-,V0/W76J07-U
5M95+,/6,78+36,45+,6+,6+95+2;,-,0+6H+78/,1+,./3.+78/6,1+
73:/02[87.-U
V-0-,-,./3+_\/,1+,52,./2H58-1/0,n,38+03+8;,q,3+.+66[07/,8+0;
+380+,/580/6,./2H/3+38+6,1+,f;,52-,HM-.-,1+,0+1+,/5
52,bcfbU,,HM-.-,q,56-1-,3/,.-6/,1+,/,./2H58-1/0
H+08+3.+0,-,52-,0+1+,1+,./2537.-X\/;,+345-38/,45+,/,bcfb
q,3+.+66[07/,45-31/,-,./3+_\/,q,0+-M7o-1-,W7-,M73^-,8+M+:37.-U
]/,-HM7.-87W/,_.+M;,52,673-M,1+,.7:0\/,,1+W+,6+0,587M7o-1/
72+17-8-2+38+,-38+6,1+,52-,0+:+0a3.7-,-m6/M58-,-,6+0,:7_-1-U
66+,H0/.+172+38/,+W78-,45+,-,0+:+0a3.7-,1-,.qM5M-,H/66-,6+0
-M8+0-1-,-/,6+0,56-1-,52-,-MX-,1+,H0++3.^72+38/,/5,./2-31/6;
./2/,./H7-0,+,./M-0U
V/0,
H-10\/;,/,6768+2-,/H+0-.7/3-M,731/6,176H/37m7M7o-;,H-0-,0+-M7o-X\/,1+,.[M.5M/6,672HM+6;,52-,.-M.5M-1/0-,.7+38:7.45+,/:+0+.+,/HXY+6,H0[87.-6,H-0-,2-37H5M-XY+6,1/6,0+65M8-1/6
1-6,/H+0-XY+6;,/6,45-76,H/1+2,6+0,6-MW/6,+2,-0457W/;,H-0-,56/
H/0,/580/6,H0/90-2-6;,/5,736+071/6,+2,HM-37M^-6,1/,_.+MU
p/2,/,56/,1+,H0/90-2-6,-H0/H07-1/6;,q,H/66W+M,7368-M-0,2-76
1+,52,6768+2-,/H+0-.7/3-M,+2,52,./2H58-1/0;,8-M,45+;,-/,6+
737.7-0,52-,6+X\/,1+,80-m-M^/;,H/1+`6+,6+M+.7/3-0,45-M,6768+2/H+0-.7/3-M,6+0[,587M7o-1/U
,-.+66/,-,52,
-0457W/,45+,+68+L-,-02-o+3-1/,+2,52,170+8J07/
/.5M8/,/5,M/.-M7o-1/,+2,52-,5371-1+,H+08+3.+38+,-,52-,0+1+
1+,./2H58-1/0+6,H/1+,6+0,0+-M7o-1/,170+8-2+38+,H/0,2+7/,1+
52,./3+,1+,-8-M^/,./3:7950-1/,3-,[0+-,1+,80-36:+0a3.7-U,]+66+
.-6/;,/,-.+66/,-/,-0457W/,q,/m871/,./2,-,-HM7.-X\/,1+,52
.M745+,15HM/,./2,/,m/8\/,170+78/,1/,bcdef,6/m0+,/
0+:+071/,./3+U

%

18

01234567594

3 6

 !"#$

%&'()*+,-./0*1*23-&4-15&6/&

789:;;<=>?8@AB>C8D>9E;FG:8HIDFJFA?8>K8JL>MI>N8J:K8>OJ>PQ:8D:;8D>9E;FG:;8HIDFJFAF;8>
>OGCAHIDFJFAF;8RQ:8GCFSIGTCF:;8C>?AGF=:;8U8VRFQ:8>8:;8GCFSIGTCF:;8>8RQ:8GCFSIGTCF:;8C>?AGF=:;8A
@IRD:;89WS?FJ:;N8AIGACMIFA;N8@IRDAPX>;89WS?FJA;8>8D>KAF;8>RGFDAD>;8@>D>CAF;8FRG>YCARG>;
D:;8:CPAK>RG:;8@F;JAF;8>8DA8;>YICFDAD>8;:JFA?N8D>;D>8MI>8AG>RDA8A:;8;>YIFRG>;8C>MIF;FG:;Z
ab888;>HA8@>FG:8R:8=A?:C8>OAG:8DA8YIFA8D>8D>9E;FG:[
ab888;>HA8>KFGFD:89>?:8D>9:;FGARG>N89ACG>;8:I8C>9C>;>RGARG>8?>YA?[
ab888;>HA8R:CKAGF=:8U8\]^_]8:I8A:8ECYQ:8J:K9>RG>`
cd

efghijklmgjfnmnoipqlmnmrismtnuqknivqhwlmnqsmnxmgkvmnjfnyfljnz{{|nrfsnqsnjfrqskgwfnksnkji}~ftnmhhigmvknmnf}~fnrfllkwmnmnlkhkiwfnjk
rfgrkiwfhnknsfjfhnjknqwivim}~fnjfhnmvirmwifhnirlfhfownooirknknnooirk
njfrqskgwfnksnkji}~fnfjknhklnrmllkpmjfnknmvwklmjfnkvfnmvirmwifnyliwktnjfnnooirktnjkhjknuqknmnokllmskgwmnnkhwkxm
ighwmvmjmngfnrfsqwmjflnksnqhfn
flnskifnjknoqgrifgmvijmjkhnjihfgiivimjmhnmfnhknrvirmlngmnhkwmnksn tnnfhhkvnmvwklmlnfnwifnjknsmlrmjflnqhmjfngf
jfrqskgwfnksnkji}~f
njfrqskgwfnksnkji}~fng~fnrfgwsnmvflkhngqslirfhnflwmgwftng~fnfjknhklnwlmghoklijfnmlmnqsmnvmgivmnjfnrkvn
emhfnfnjfrqskgwfnksnkji}~fnhkxmnrfimjfnknrfvmjfngfnfklfigwtnhkl~fnrlimjfhnwlhnnqsnmlmnfnwwqvfnjfnjfrqskgwfnfqwlf
mlmnfnmlplmofnknfnwklrkilfnmlmnmhnwlhnvigmhnrfsnsmlrmjflkh
mlmnoflsmwmlnrfsnlkrqfnnkhuqkljmnfnmlplmofnigirimjfnflnnfhhkvtnnhqoirikgwknhkvkrifgvfnktnmnhkpqiltnrvirmlnfnfw~fn
 !"#

rklrmnjfhnhihwksmhnfklmrifgmihnyigjfhnknigqtnmhhigmvknmnf}~f
rfllkwm
luqifhnrlimjfhngfnigqnfjksnhklnvijfhngfnyigjfhnfl
skifnjmnokllmskgwmntnkihwkgwkngfn
njfnyigjfhn
fnigqtnfnlfplmsmnvmgemvrnklsiwknmnkvmflm}~fnjk
vmgivmhnkvkwlgirmhtnjknoflsmnkuqimvkgwknmfnrkvngf
yigjfh
fnhihwksmnyigjfhtnfnmvirmwifnyigjfhnvflklnwksnm
oqg}~fnkrvqhimnjknomriviwmlnfnpklkgrimskgwfnjmhnigoflsm}kh
ksnqsnrfsqwmjfltnklsiwigjfnrlimltnkrvqilnknlkgfskml
mluqifhnknmhwmhnkguqmgwfnfngwklgkwnvflklnnqsn
uqknklsiwknmngmkpm}~fngmngwklgkw
flnhklnnvilktnfnqhqlifnwksnmnvikljmjknjknrfimlnk
sfjioirmlnqsmnjihwliqi}~fnjfnigqtnhksnhfviriwmlnuqmvuqklnwif
jknklsihh~f
flnskifnjmnf}~fntnnfhhkvnmxqhwmlnjmwmt
flmnknoqhfnfllifnjfnrfsqwmjfln


 !"#

nlkhkiwfnjknrfgrkiwfhnknsfjfhnjknqwivim}~fnjknwkrgfvfpimh
mhhfrimjmhnngwklgkwnknntnmhhigmvknmnf}~fnrfllkwmn
ngmkpmjflngwklgkwnvflklnklsiwknomklnjk
mluqifhnknhmvvfhnksnmhwmhnknhqmhwmhnjfnjihrfnlpijfngf
rfsqwmjflnvfrmvn
nqwivim}~fnjfnqwvffnlkhhnwksnmnmgwmpkstnksnlkvm}~f
mfnirlfhfownqwvfftnjkng~fngkrkhhiwmlnjknrfgoipqlm}~f
limnmlmnfnkgifnknlkrkiskgwfnjknskghmpkghnjknrfllkif
kvkwlgirf
mlmnhknomklnnjknqsnmluqifnmlsmkgmjfngfnjihrf
lpijfnjfnrfsqwmjfltnngkrkhhlifnmgkmlnfnmluqifnmnqsm
skghmpksnjfnrvikgwknjknn
snmluqifnuqknoflnlkrkijfnksnmgkfnmnqsmnskghmpksnjk
rfllkifnkvkwlgirfnfjknhklnmlsmkgmjfnksnqsmnmhwm
uqmvuqklnjfnjihrfnlpijfnjfnrfsqwmjfltnjkhjknuqknfngfsk
jfnlkoklijfnmluqifng~fnhkxmnmvwklmjf
mntnfhnmluqifhnh~fnmlsmkgmjfhnksnhklijflkh
vfrmvimjfhnoihirmskgwkngmnkslkhmnkguqmgwftngmngwklgkwtnfh
mluqifhnh~fnmlsmkgmjfhnksnhklijflkhnkwklgfhn



19
Com referncia redao de correspondncias oficiais, julgue os
itens a seguir.

Documentos oficiais em forma de ofcio, memorando, aviso


e exposio de motivos tm em comum, entre outras
caractersticas, a aposio da data de sua assinatura e
emisso, que deve estar alinhada direita, logo aps a
identificao do documento com o tipo, o nmero do
expediente e a sigla do rgo que o emite.
 Desconsiderando-se as margens e os espaos adequados,
respeitam as normas de redao de um documento oficial
encaminhado por um chefe de seo a seu diretor o seguinte
trecho, contendo o pargrafo final e fecho de um ofcio.
(...)
4.
Por fim, por oportuno informamos que as
providncias tomadas, e aqui mencionadas,
tambm j so do conhecimento das partes
envolvidas.
Atenciosamente
[assinatura]
Pedro lvares Cabral
Chefe da seo de logstica
e distribuio de pessoal (SLDP).



Julgue os seguintes itens, acerca da Organizao Internacional de


Polcia Criminal (INTERPOL).








Trata-se de organizao subordinada ao secretrio-geral da


Organizao das Naes Unidas.
A INTERPOL administra cinco presdios, um em cada
continente, utilizados na guarda provisria de presos
procurados pelas polcias nacionais e no encarceramento de
criminosos de guerra.
A autoridade legal da INTERPOL para realizar prises est
condicionada autorizao prvia da polcia nacional.
A INTERPOL, que funciona como agncia de ligao entre
os organismos policiais dos pases-membros, mantm base
de dados que os auxilia no combate ao crime.
Tal organizao tem sede em Lyon, na Frana, e chefiada
por um secretrio-geral eleito por assembleia geral dos
pases-membros, para um mandato de cinco anos.

A figura acima mostra a parte superior de uma janela do Internet


Explorer 7 (IE7), em execuo em um computador com sistema
operacional Windows Vista, em que a pgina da Web
http://www.google.com.br est sendo acessada. Com relao a
essa janela, ao IE7 e a conceitos de Internet, julgue os itens que
se seguem.




Ao se clicar o boto
, a pgina que estiver sendo exibida
no navegador passar a ser a pgina inicial do IE7 sempre
que este navegador for aberto.

O Google um instrumento de busca que pode auxiliar a


execuo de diversas atividades, como, por exemplo,
pesquisas escolares.

Julgue os itens a seguir, acerca de hardware e de software usados


em computadores pessoais.




ROM um tipo de memria no voltil, tal que os dados


nela armazenados no so apagados quando h falha de
energia ou quando a energia do computador desligada.

Existem dispositivos do tipo pendrive que possuem


capacidade de armazenamento de dados superior a 1 bilho
de bytes. Esses dispositivos podem comunicar-se com o
computador por meio de porta USB.

Com relao Usina Hidreltrica de Itaipu e ao acordo firmado


entre Brasil e Paraguai, em julho de 2009, no qual so revistas
clusulas do Tratado de Itaipu, julgue os itens que se seguem.

Segundo o acordo, o Paraguai pode vender parte da energia


gerada por Itaipu diretamente no mercado de energia
brasileiro.
 Localizada na fronteira brasileiro-paraguaia, Itaipu a maior
usina hidreltrica do mundo em capacidade de gerao de
energia eltrica.
 Em contrapartida s concesses brasileiras, o Paraguai
autorizou no acordo a instalao, em seu territrio, do
gasoduto Patagnia-So Paulo.
 Os diretores e os conselheiros de Itaipu so indicados, em
igual nmero, pelo governo brasileiro e pelo paraguaio.
Julgue os itens subsequentes, a respeito de Internet e intranet.


As intranets, por serem redes com acesso restrito aos


usurios de empresas, no utilizam os mesmos protocolos de
comunicao usados na Internet, como o TCP/IP.
 Um cookie um arquivo passvel de ser armazenado no
computador de um usurio, que pode conter informaes
utilizveis por um website quando este for acessado pelo
usurio. O usurio deve ser cuidadoso ao aceitar um cookie,
j que os navegadores da Web no oferecem opes para
exclu-lo.



Considerando a figura acima, que mostra o canto inferior


esquerdo do desktop do Windows XP, julgue os itens seguintes.




Ao se clicar, com o boto direito do mouse, o cone


,
exibida uma lista de opes, entre elas, a que permite iniciar
ao para esvaziar a Lixeira do Windows.
Ao se clicar uma vez sobre o cone
, a respectiva
pasta ser aberta, e os cones associados aos arquivos nela
contidos podero ser visualizados.

UnB/CESPE MJ/DPF

Cargo: Agente de Polcia Federal

www.pciconcursos.com.br

20
Com relao a conceitos de Internet, julgue o item abaixo.


A sigla FTP designa um protocolo que pode ser usado para


a transferncia de arquivos de dados na Internet.

Julgue os itens a seguir, com base nos conceitos e normas


aplicveis escriturao contbil.






Considerando a figura acima, que mostra uma janela do Word


2002, com um texto em edio, em que nenhuma parte est
formatada como negrito, julgue os prximos itens.






Ao se clicar direita da palavra devidamente e, em

seguida, clicar o boto


, o smbolo
direita da referida palavra.

ser exibido

Ao se aplicar um clique duplo em um local da barra de ttulo


que no contenha boto ou cone, a janela mostrada ser
maximizada.

O contedo da primeira linha do texto mostrado ser


centralizado, aps a realizao da seguinte sequncia de
aes: selecionar a referida linha; pressionar e manter
pressionada a tecla ; acionar a tecla C, pressionando-a
e liberando-a; liberar a tecla .











Para se calcular o preo total das oito cadeiras a serem


adquiridas, suficiente clicar a clula D3, digitar =B3*C3 e,

em seguida, teclar .

Para se inserir uma nova linha entre as linhas 1 e 2,


movendo os contedos das linhas 2 e 3 para baixo,
suficiente clicar no cabealho da linha 2
e, em

seguida, clicar o boto

Em decorrncia da aplicao do mtodo das partidas


dobradas, as contas retificadoras do patrimnio lquido tm
seu saldo aumentado quando so debitadas, e diminudo
quando so creditadas.

O fato contbil registrado no lanamento de 4. frmula


abaixo pode ser entendido como recebimento por uma venda
a prazo, aps o vencimento da obrigao, e concesso de
abatimento por problemas com a mercadoria ou sua entrega.
D bancos
D abatimentos
C cliente
C juros
De acordo com a doutrina e a legislao contbeis, a
prescrio de uma dvida e o perecimento de um direito
correspondem, respectivamente, a uma realizao de receita
e incorrncia de uma despesa.

A respeito da composio e da avaliao do patrimnio, julgue os


itens seguintes.



Julgue os itens a seguir, considerando a figura acima, que mostra


uma planilha em edio no Excel 2002, com uma lista de preos
unitrios de mesas e cadeiras, bem como a quantidade a ser
adquirida de cada item.

Os livros dirio e razo, por constiturem os registros


permanentes de uma entidade e por serem obrigatrios,
devem ser registrados no registro pblico competente.

Suponha que uma empresa mineradora tenha adquirido os


direitos de explorao de uma mina por R$ 5 milhes, por
meio de um contrato com cinco anos de vigncia. Nesse
caso, aps dois anos de explorao, se tiverem sido extrados
30% da possana da mina, o referido ativo, classificado no
imobilizado, dever estar avaliado no balano da empresa
por R$ 3 milhes.

Constituem eventos que afetam o patrimnio lquido, como


acrscimo ou reduo, ajustes de exerccios anteriores,
resultado lquido do exerccio e resultado na venda de aes
em tesouraria.

Suponha que o saldo da conta de resultado do exerccio,


antes do clculo do imposto de renda devido, seja positivo
em R$ 1,5 milho e o valor desse imposto, de R$ 2 milhes.
Nesse caso, o fato estar adequadamente representado pelo
seguinte lanamento em reais.
D
D
C



resultado do exerccio
reservas de lucros
proviso para imposto de renda

1.500.000
500.000
2.000.000

Na demonstrao dos fluxos de caixa, classificam-se no


fluxo de financiamento, entre outras operaes, a colocao
de debntures, a distribuio de juros sobre o capital prprio
e a integralizao de capital em espcie.

UnB/CESPE MJ/DPF

Cargo: Agente de Polcia Federal

www.pciconcursos.com.br

21

UnB/CESPE BRB

Com relao aos conceitos de informtica, ambientes operacionais

Texto II

e aplicativos usados para a criao de textos, planilhas eletrnicas


e apresentaes, julgue os itens a seguir.


O Calc um aplicativo includo na sute de pacote de software


do BROffice e disponibilizado gratuitamente para uso a partir

de um modelo de troca, no qual, se o usurio concordar em

contribuir com adaptaes e mudanas nos programas, ele

poder ento receber um conjunto de cpias assim que as


nome cientfico: Ginkgo biloba L.
nome popular: nogueira-do-japo
origem: Extremo Oriente
aspecto: as folhas dispem-se em leque e so semelhantes ao trevo;
a altura da rvore pode chegar a 40 metros; o fruto lembra uma
ameixa e contm uma noz que pode ser assada e comida
Texto III

mudanas forem aceitas.




download na Internet, tem a desvantagem de no permitir a

gravao de dados em formatos comerciais, tal como o PDF,


uma vez que no possvel integrar funcionalidades desse
ambiente com outros softwares proprietrios.


D para confiar?
Nas farmcias brasileiras, os comprimidos de extrato de
ginkgo vendidos s com receita mdica competem com cpsulas de
p modo e folhas, em embalagens expostas nas prateleiras ao
alcance do consumidor. Muita gente relata efeitos benficos
advindos dessas frmulas alternativas. Mas seriam elas to eficazes
quanto os comprimidos vendidos com receita? A resposta no.
Pesquisadores da UFSC fizeram testes para saber quanto h de
componentes do extrato EGb 761 nessas cpsulas e nas folhas da
planta. Concluso: para obter a mesma quantidade de um nico
comprimido de 120 mg, seriam necessrias 20 cpsulas de 200 mg
de p modo. Quanto ao ch, a eficcia depende da qualidade da
matria-prima. Mas seria preciso ingerir grande quantidade, j que
os teores das substncias ativas no ch caseiro so baixos, afirma
a autora do trabalho e pesquisadora da UFSC. Segundo ela, a
proporo ideal s obtida com os extratos secos padronizados.






do usurio, podem ser adequados audincia para a qual ser


apresentado o contedo, podendo-se escolher o formato como

retrato ou paisagem, e variar os tipos de design e leiaute, os


estilos e a formatao.

A respeito dos conceitos relacionados Internet, julgue os itens que


se seguem.




ADSL, dispensa o uso de modem, visto que, nesse caso, a

conexo ocorre diretamente a partir de infraestrutura das


empresas de telefonia fixa ou mvel (celular).


Para que o SMTP, um protocolo de recebimento de mensagens


de e-mail pela Internet, seja utilizado, necessrio um

endereo IP do servidor que armazene as mensagens de correio


eletrnico do usurio do servio.


Com o surgimento da WWW (world wide web), o acesso a

arquivos de contedo apenas textual evoluiu para arquivos que

agregam diversos formatos, com destaque para os documentos

O contedo do texto III no contradiz as afirmaes do texto


I em relao s recomendaes sobre os tipos de extratos do
Ginkgo biloba a serem usados para fins teraputicos.

No primeiro perodo do texto III, mantm-se a correo


gramatical caso se coloque uma vrgula logo aps s com
receita mdica, a fim de se ressaltar o carter explicativo do
termo.

O acesso Internet em alta velocidade por meio de conexo


dial-up, via linha telefnica, tambm conhecido como servio

Os textos II e III so predominantemente descritivos.

Infere-se do texto III que h diferentes formas de se encontrar


o G. biloba nas farmcias brasileiras, mas nem todas so
igualmente eficazes.

O Impress um software que permite a edio de

apresentaes de slides, os quais, de acordo com a preferncia

Internet: <www.saude.abril.com.br> (com adaptaes).

Acerca da interpretao e dos aspectos gramaticais dos textos II e


III e considerando as informaes do texto I, julgue os itens
subsequentes.

O editor de texto Writer do BROffice, disponvel para

hipermdia, que so a unio de hipertexto com multimdia, ou

seja, textos com links, imagens, sons, vdeos, entre outros


recursos.



No Internet Explorer (IE), a partir de Opes da Internet,

encontrada no menu Ferramentas, possvel configurar uma

srie de parmetros como, por exemplo, a pgina inicial que

ser acessada toda vez que o IE for aberto e em que pasta


devem ser armazenados os arquivos temporrios da Internet.


 



www.pciconcursos.com.br

22
Acerca da organizao e da segurana da informao em meio
eletrnico, julgue os prximos itens.






Confidencialidade, um dos princpios bsicos da segurana da


informao, tem como caracterstica garantir que uma
informao no seja alterada durante o seu trnsito entre o
emissor e o destinatrio.

Os worms so pouco ofensivos, pois referem-se ao envio


automtico de mensagens indesejadas de correio eletrnico a
um grande nmero de destinatrios, que no as solicitaram ou
que tiveram seus endereos eletrnicos copiados de um stio
pirata.
Em um ambiente computacional, a perda das informaes por
estragos causados por vrus, invases indevidas ou intempries
pode ser amenizada por meio da realizao de cpias de
segurana (backup) peridicas das informaes, as quais
podem ser feitas da mquina do usurio, de servidores e de
todos os demais dispositivos de armazenamento, local ou
remoto, de dados.

Srgio e Carla chegam ao autoatendimento de uma agncia


bancria para sacarem, respectivamente, R$ 430,00 e R$ 210,00.
Nessa agncia, esto em operao 10 caixas automticos, todos
indicando, na tela, que contm notas de 5, 10, 20 e 50 reais. No
entanto, efetivamente, 2 deles contm apenas notas de 10 reais, 3
contm somente notas de 20 reais, e os demais contm notas de
todos os valores indicados na tela. Nos caixas, existem notas
suficientes para os saques, cada um deles tem fila individual, e
Srgio e Carla tomaram filas de caixas diferentes.

UnB/CESPE BRB

A esposa, o filho e a filha de Marcos so correntistas de


uma mesma agncia do BRB. Certo dia, entregaram os cartes
magnticos a Marcos para sacar dinheiro de suas contas, que tm as
senhas de nmeros 201001, 201002 e 201003, e os cdigos de trs
letras BRB, RBB e BBR. Marcos sabia a quem pertencia cada
carto e lembrava-se das senhas e dos cdigos, mas no das
associaes entre cartes, senhas e cdigos. Ele recordava apenas
que a senha do carto da esposa era 201001 e o cdigo de trs letras
associado senha 201002 era BBR. Marcos decidiu telefonar para
casa e obteve a informao de que o cdigo do carto da conta do
filho era RBB.
Com base nessas informaes, julgue os itens a seguir.






A senha do carto do filho de Marcos 201003.


O cdigo do carto da filha de Marcos BRB.

Marcos no tinha necessidade de telefonar para casa. As


informaes de que dispunha eram suficientes para que
encontrasse as associaes, sem a referida informao do
cdigo do carto do filho.
Considerando-se que, no banco de dados dos clientes do banco
BRB, existam pelo menos 35 contas-correntes cujos cdigos de
trs letras usam apenas as letras B e R, que apenas um
correntista use o cdigo BBB e que, no mximo, trs
correntistas usem o cdigo BRB, ento existem pelo menos
cinco correntistas do BRB com o mesmo cdigo de trs letras,
usando apenas as letras B e R.

4#5%70*1

Considerando a situao hipottica apresentada, julgue os itens que


se seguem.








A quantidade de escolhas de pares de filas diferentes


disponveis para o casal Srgio e Carla superior a 100.
A quantidade de escolhas de pares de filas diferentes
disponveis para Srgio e Carla tal que ambos consigam
realizar os saques desejados maior que 20.

A quantidade de escolhas de pares de filas diferentes


disponveis para Srgio e Carla tal que pelo menos um deles
no consiga fazer o saque menor que 20.

Considere que as senhas de banco de Srgio e de Carla sejam


compostas de uma primeira parte numrica de 6 algarismos que
assumem valores de 0 a 9 e uma segunda parte constituda de
trs letras entre as 26 letras do alfabeto. Considere ainda que
as partes alfabticas das senhas de Srgio e Carla sejam,
respectivamente, TMW e SLZ, e que no sejam permitidas
senhas numricas com todos os nmeros iguais. Nessa
situao, o nmero total de senhas possveis nesse banco cuja
parte alfabtica no contenha nenhuma das letras existentes na
senha de Srgio ou na de Carla menor que 8 bilhes.


 



www.pciconcursos.com.br

23
UnB/CESPE BRB

A respeito dos conceitos de tecnologias e protocolos utilizados na Web,


julgue os itens a seguir.









O conjunto de tcnicas usadas no protocolo WWW permite a


criptografia das conexes de rede realizadas por meio dos
protocolos XML, HTTP e FTP.
O DNS (domain name system) um protocolo de aplicao que faz
a converso de um nome em um endereo IP.
O uso de HTTPS (HTTP seguro) permite que as informaes
enviadas e recebidas em uma conexo na Internet estejam
protegidas por meio de certificados digitais.
O protocolo FTP, utilizado para videoconferncia na Internet, tem
um modo de conexo ativo, em que o cliente negocia os
parmetros da conexo.
A linguagem HTML utilizada para formatar o contedo de uma
pgina da Internet e pode ser editada com o uso de qualquer editor
de texto.

Acerca de segurana e proteo de computadores, julgue os prximos


itens.









Um worm se aloja no servidor de e-mail e infecta automaticamente


o computador do usurio sempre que este realiza uma conexo ao
servio de correio eletrnico.
O firewall, mecanismo que auxilia na proteo de um computador,
permite ou impede que pacotes IP, TCP e UDP possam entrar ou
sair da interface de rede do computador.
Um vrus mutante de computador capaz de assumir mltiplas
formas com o intuito de burlar o software de antivrus.
Quando o firewall padro do sistema operacional Windows detecta
uma tentativa de ataque por meio do protocolo MSN, ele
automaticamente desabilita o software, aciona o antivrus e
bloqueia o usurio do MSN para evitar novas tentativas de ataque.
Vrus de computador so capazes de usar arquivos executveis
para se espalhar. Alguns tipos de vrus detectam e contaminam
automaticamente arquivos e pastas que podem estar armazenados
em um pendrive.

Em determinado dia, dois amigos foram os ltimos


clientes a chegarem ao atendimento de uma agncia bancria,
no momento em que quatro operadores de caixa estavam
fazendo o atendimento. Nas filas desses caixas estavam, naquele
momento, 11, 14, 12 e 10 clientes. Os tempos mximos de
atendimento de cada cliente por esses operadores de caixa so
iguais, respectivamente, a 3, 2, 2,5 e 2,8 minutos. At o final do
expediente, no ocorreu atendimento especial e os clientes no
mudaram de fila at serem atendidos.

Considerando as informaes acima e que os dois amigos


tambm foram atendidos, julgue os itens a seguir.






O tempo mximo esperado para que todos os clientes


sejam atendidos superior a 40 minutos.
Se todos os clientes estivessem organizados em uma fila
nica, ento o tempo mximo para o atendimento de todos
eles seria inferior a 34 minutos.
Existem 16 maneiras distintas de os dois amigos se
posicionarem ao final dessas quatro filas.
Considerando todas as possibilidades de escolha de filas
pelos dois amigos, o tempo mximo em que um deles, aps
ter sido atendido, ficar esperando at que termine o
atendimento do outro inferior a 4 minutos.

4#5%70*1

Com relao aos aplicativos BrOffice Writer, Calc e Impress, julgue os


itens subsequentes.



O Writer no permite a gerao de arquivos do tipo RTF (rich text


format), entretanto suporta a criao e a manipulao de tabelas.
O Impress capaz de exportar uma apresentao para o formato
PDF.

A seguir, so apresentadas proposies relativas a um cliente de uma


instituio financeira.

<
<
<
<

Se Carlos fizer um emprstimo na instituio financeira, ento ele


no viajar.
Se Carlos no viajar, ento ele comprar um carro novo.

Se Carlos comprar uma moto ou usar o carto de crdito, ento ele


no comprar um carro novo.
Se Carlos viajar, ento ele usar o carto de crdito.

Considerando que essas proposies sejam verdadeiras, julgue os


seguintes itens.





A proposio se Carlos viajar, ento ele no far um emprstimo


na instituio financeira verdadeira.
A proposio se Carlos comprar um carro novo, ento ele no
comprar uma moto nem usar o carto de crdito falsa.
A proposio se Carlos no usar o carto de crdito, ento ele
comprar um carro novo verdadeira.
A proposio se Carlos fizer um emprstimo no banco, ento ele
comprar uma moto verdadeira.





 

w ww.pciconcursos.com.br

24
Considerando aspectos lingusticos do texto Reparao duas
dcadas depois, julgue os itens a seguir.












O texto caracteriza-se como essencialmente informativo.

O emprego do sinal indicativo de crase em luta de


classes (R.2) justifica-se pela regncia dos termos
subverso e incitamento e pelo gnero do substantivo
classe.

O emprego da vrgula aps latifundirios (R.3) justifica-se


por isolar o termo explicativo.

As palavras amaznico e viva acentuam-se de acordo


com a mesma regra de acentuao grfica.

Julgue os itens a seguir acerca de conceitos de informtica.










No segmento Faltava reparar a injustia cometida pelos


militares (R.6) o complemento do verbo reparar poderia
estar precedido da preposio em, com a devida contrao
com o artigo a, sem prejuzo para o sentido e a correo
gramatical do texto.

Provedores de e-mails na Internet criam, no momento do


cadastro, stios postais para os usurios, que so capazes de
armazenar mensagens recebidas com limite de tamanho
diversificado.
Existem stios na Internet que disponibilizam a opo para
entrar na intranet mediante a exigncia de usurio e senha
previamente cadastrados.

O Internet Explorer apresenta ferramenta que permite criar


uma nova mensagem como um cliente Microsoft Office
Outlook, desde que este esteja configurado como cliente
padro.

Software livre o mesmo que software aberto, e o seu


objetivo popularizar o uso do computador promovendo a
incluso digital.

No perodo que se inicia na linha 8, o sujeito da orao


principal est posposto ao verbo.

O termo onde (R.19) introduz orao adjetiva de sentido


explicativo.
O verbo participar (R.24) est empregado, no perodo,
como termo substantivo.

Os termos portanto (R.28) e enquanto (R.29), estabelecem


idnticas relaes de sentido.

Ainda com base no texto de Leandro Fortes e considerando


aspectos textuais e gramaticais, julgue os prximos itens.












A expresso Na poca, no incio do ltimo pargrafo do


texto, refere-se ao perodo em que Chico Mendes foi
perseguido pela ditadura militar.
Pelas opinies apresentadas no texto, verifica-se que o
ministro da Justia e a conselheira possuem posies opostas
no que se refere atuao poltica de Chico Mendes.

Estaria de acordo com o que estabelece a prescrio


gramatical para textos escritos no nvel formal da linguagem,
tais como documentos oficiais, a substituio da expresso
dali para a frente (R.3) por dali pra frente.

A conjuno E (R.7), por ter, no perodo, valor adversativo,


pode ser substituda pela conjuno Mas, sem prejuzo para
as informaes do texto.

Na linha 8, o vocbulo cujo estabelece relao sintticosemntica entre os termos resultado e Comisso de
Anistia.

O termo o documento (R.14) refere-se a portaria de


anistia (R.12).

Com base na figura acima, que contm uma planilha em edio


no Excel 2003, julgue os itens de 25 a 30.


A formatao dos valores da coluna Desmatamento como


percentual foi obtida selecionando a referida coluna e
clicando a ferramenta



Para calcular a mdia aritmtica do desmatamento nos 4


trimestres suficiente digitar a frmula =Mdia(B2:B5) e
pressionar a tecla



O grfico do tipo personalizado, disponvel na ferramenta


, denominada assistente de grfico.

UnB/CESPE IBAMA

Caderno L

Tema 5: Conservao, Manejo e Proteo das Espcies da Fauna

www.pciconcursos.com.br

25


Para copiar o grfico e a planilha, ao mesmo tempo, para o


Word 2003, suficiente selecionar os nmeros de linhas de
1 a 20, clicar a opo Copiar do menu

, abrir o

documento do Word e clicar a ferramenta






Considerando-se que o tamanho do arquivo seja igual a


1 MB, ele poder ser enviado tanto para o disquete quanto
para um pen drive com capacidade de 1 GB.

Para criar uma cpia de segurana da planilha, tambm


conhecida como backup, suficiente clicar a ferramenta

Julgue os itens subsequentes acerca da poltica nacional do meio


ambiente (PNMA).



Considerando essa situao hipottica e o que estabelece a


Lei n. 8.112/1990, julgue os itens que se seguem no que se refere
a dirias.






Marcos, analista ambiental do IBAMA, lotado em


Braslia, precisou afastar-se de seu local de trabalho para
colaborar em uma grande operao de fiscalizao no estado do
Par, por 10 dias. O IBAMA custeou os gastos de hotelaria,
alimentao e locomoo urbana de Marcos. Com o incio dos
trabalhos, percebeu-se que a equipe conseguiria terminar as
tarefas antes e, de fato, no quinto dia, Marcos retornou a Braslia.

Segundo a lei de PNMA, o IBAMA ter competncia para


o licenciamento ambiental de empreendimentos poluidores
sempre que as atividades e obras a serem realizadas gerarem
significativo impacto ambiental de mbito nacional ou
regional.
O Sistema Nacional do Meio Ambiente (SISNAMA)
constitudo por rgos e entidades da Unio, estados,
Distrito Federal, municpios e territrios, responsveis pela
proteo e melhoria da qualidade ambiental, e sua
composio conta com um rgo superior, que o conselho
de governo; um rgo consultivo e deliberativo, que o
Conselho Nacional do Meio Ambiente (CONAMA); bem
como com um rgo central, um rgo executor, rgos
seccionais e locais.

Paulo, proprietrio rural, decidiu instituir uma servido


ambiental em sua propriedade, por 10 anos. Procurou o rgo
ambiental competente, que deu anuncia instituio da servido.
Com cinco anos do incio da servido, Paulo precisou vender o
imvel rural e encontrou um comprador, que exigiu a
modificao da destinao da rea, pois pretendia explorar a
cultura de soja na fazenda.



A servido ambiental instituda por Paulo ser averbada na


matrcula do imvel, no cartrio de registro de imveis
competente, para que, na venda da propriedade ao
comprador, se verifique a existncia da servido e se altere
a destinao da rea.

A servido ambiental instituda por Paulo se estende a toda


a rea de sua propriedade, includas as de preservao
permanente e de reserva legal, se houver.

Marcos tem direito a receber as passagens de ida e volta e


uma diria por dia de trabalho.

Maria, servidora do IBAMA, recebeu a notcia de que


sua me estava com cncer e que precisaria se submeter a
tratamento radioterpico em cidade diversa da residncia atual de
ambas. Como era filha nica, afastou-se das suas atividades no
IBAMA para acompanhar a me no tratamento, requerendo
licena por motivo de doena em pessoa da famlia. Em razo dos
gastos com esse tratamento, que eram excessivos, Maria decidiu
se dedicar a alguma atividade que pudesse aumentar a renda
familiar. Passou ento, a realizar trabalhos de consultoria em sua
rea de formao durante o perodo de licena.
Considerando essa situao hipottica, julgue os itens seguintes
acerca da licena por motivo de doena em pessoa da famlia,
segundo a Lei n. 8.112/1990.




legtimo o exerccio da atividade de consultoria por Maria,


j que se destina ao custeio do tratamento em razo do qual
est licenciada.

A licena de Maria ser precedida do exame de sua me por


mdico ou junta mdica oficial e, constatado o cncer nesta,
sero desnecessrios novos exames a cada pedido de
prorrogao da licena, se houver.

Julgue os itens de 39 a 42, em conformidade com as normas


previstas na Lei n. 8.666/1993, que trata de licitaes e
contratos.


Considerando essa situao hipottica, julgue os itens a seguir.




Como Marcos retornou a sua sede em prazo inferior ao


inicialmente previsto, deve restituir as dirias recebidas em
excesso, no prazo de 5 dias.



O processamento das compras por meio de sistema de


registro de preos deve ser realizado sempre que se mostre
possvel. O sistema de registro de preos demanda prvia e
ampla pesquisa de mercado, publicao trimestral dos preos
registrados por meio da imprensa oficial e permite que
qualquer cidado impugne preo constante do quadro geral,
caso verifique a incompatibilidade desse preo com o
vigente no mercado.
O autor do projeto bsico ou executivo da obra, servio ou
fornecimento de bens que estejam sendo alvo de licitao
no pode dela participar na fase licitatria, mas pode atuar
na fase da execuo do contrato, como consultor ou tcnico,
em funes especficas e exclusivamente a servio da
administrao pblica.

UnB/CESPE IBAMA

Caderno L

Tema 5: Conservao, Manejo e Proteo das Espcies da Fauna

www.pciconcursos.com.br

26

UnB/CESPE TRE/BA

De acordo com o comando a que cada um dos itens a seguir se refira, marque na folha de respostas, para cada item: o campo
designado com o cdigo C, caso julgue o item CERTO; ou o campo designado com o cdigo E, caso julgue o item ERRADO. Para
as devidas marcaes, use a folha de respostas, nico documento vlido para a correo das suas respostas.
Nos itens que avaliam conhecimentos de informtica, a menos que seja explicitamente informado o contrrio, considere que: todos
os programas mencionados esto em configurao-padro, em portugus; o mouse est configurado para pessoas destras; expresses
como clicar, clique simples e clique duplo referem-se a cliques com o boto esquerdo do mouse; teclar corresponde operao de
pressionar uma tecla e, rapidamente, liber-la, acionando-a apenas uma vez. Considere tambm que no h restries de proteo, de
funcionamento e de uso em relao aos programas, arquivos, diretrios, recursos e equipamentos mencionados.

%10*'%+/'0615$5+%15

10

13

16

19

22

25

28

31

Quase todo mundo conhece os riscos de se ter os


documentos usados de forma indevida por outra pessoa, depois
de t-los perdido ou de ter sido vtima de assalto. Mas um
sistema que comeou a ser implantado na Bahia pode resolver
o problema em todo o pas.
A tecnologia usada atualmente para a emisso de
carteiras de identidade na Bahia pode evitar esse tipo de
transtorno. A foto digital, impressa no documento, dificulta
adulteraes.
A principal novidade do sistema o envio imediato
das impresses digitais, por computador, para o banco de
dados da Polcia Federal em Braslia. Dessa forma, elas
podem ser comparadas com as de outros brasileiros e
estrangeiros cadastrados.
Se tudo estiver em ordem, o documento entregue em
cinco dias. Ao ser retirada a carteira, as digitais so conferidas
novamente.
Voc pode at ter a certido de nascimento de outra
pessoa, mas, quando tentar tirar a carteira por ela, a
comparao das impresses digitais vai revelar quem voc,
diz a diretora do Instituto de Identificao da Bahia.
Na Bahia, a troca pelo modelo novo ser feita aos
poucos. As atuais carteiras de identidade vo continuar valendo
e sero substitudas quando houver necessidade de emitir-se a
segunda via. Por enquanto, s a Bahia est enviando os dados
para a Polcia Federal.
Segundo o Ministrio da Justia, a partir de 2011,
outros estados devem integrar-se gradativamente ao sistema.
A previso que, em nove anos, todos os brasileiros estejam
cadastrados em uma base de dados unificada na Polcia
Federal.








A nova tecnologia de emisso de carteira de identidade, criada


na Bahia, reduz o risco de fraudes e adulteraes.
No texto, tanto o termo todo (R.1) quanto todo o (R.5)
expressam totalidade.

O texto, que , predominantemente, descritivo, apresenta


detalhes do funcionamento do sistema de identificao que
deve ser implantado em todo o Brasil.

Os vocbulos impressa (R.8) e entregue (R.15) so


particpios irregulares dos verbos imprimir e entregar,
respectivamente; tais verbos admitem, tambm, as formas
participiais regulares: imprimido e entregado.
A palavra mas (R.19), no texto, tem sentido semelhante ao
expresso pelo conectivo e no seguinte perodo: Assinou o
documento, e se esqueceu de lev-lo.

Depreende-se do texto que a implantao da nova carteira de


identidade proporcionar mais agilidade aos servios prestados
pelos institutos de identificao do Brasil.

O emprego das expresses vo continuar valendo (R.23) e


est enviando (R.25), as quais indicam haver uma ao em
curso, usualmente, deve ser considerado vcio de linguagem.
Do trecho Por enquanto, s a Bahia est enviando os dados
para a Polcia Federal (R.25-26) infere-se que, pelo menos, um
outro estado brasileiro tambm adotou o novo sistema de
identificao, mas no enviou, ainda, as impresses digitais
para atualizao do banco de dados da Polcia Federal.

Na linha 28, o emprego da preposio a na combinao ao


exigncia sinttica do verbo integrar.
Infere-se do texto que o novo sistema de identificao
representa um avano para o trabalho da polcia brasileira.

O Microsoft Word possui opes que permitem


maior agilidade durante a edio de documentos, por
exemplo, evitando perdas de informaes digitadas
ou formataes realizadas. Entre essas opes, os botes
permitem, respectivamente, recortar um objeto
qualquer no documento, como um trecho do texto ou
uma imagem, copiar esse objeto para a rea de transferncia
e colar tal objeto em determinado local no documento.
Essas aes tambm podem ser realizadas com o uso das teclas

Com relao ao texto acima apresentado, julgue os itens de 1 a 12.

Infere-se do texto que o processo de emisso da nova carteira


de identidade ser menos dispendioso para o cidado, visto que
as fotos necessrias para o documento sero feitas pelo prprio
instituto de identificao.

A respeito dos conceitos e aplicativos dos ambientes Microsoft


Office e BROffice, julgue os itens a seguir.

Internet: <www.g1.globo.com> (com adaptaes).

A supresso da vrgula que sucede a palavra ordem (R.15)


no acarreta prejuzo correo gramatical do perodo em
questo.

+ X, + C e + V, respectivamente.


No Microsoft Word, ao se selecionar um trecho de um texto


digitado, esse trecho aparecer na tela do monitor com uma
marcao, que pode ser uma tarja preta sobre ele. Nessas

condies, caso se pressione a tecla


, o trecho selecionado
ser substitudo por completo pelo caractere referente tecla
pressionada.


No BROffice Writer, para se desfazer ou restaurar uma


digitao, necessrio, inicialmente, selecionar com o mouse
o trecho do texto que se deseja alterar e, em seguida, clicar os
botes adequados na barra de ferramentas ou acionar,
respectivamente, as teclas

%CTIQ6EPKEQ,WFKEKTKQTGC#FOKPKUVTCVKXC

+ Z e + Y.



www.pciconcursos.com.br

27
Acerca de navegao, correio eletrnico, grupos de discusso e
ferramentas de busca e pesquisa na Internet, julgue os itens que se
seguem.






Ao verificar a caixa postal de correio eletrnico, na realidade, o


usurio acessa o servidor central de e-mail da Internet, chamado de
cliente de e-mail, o qual direciona as mensagens que possuem o
endereo do usurio reconhecido por sua senha pessoal e
intransfervel.
Uma das formas de busca de informaes na Internet utilizando os
stios de busca, como o Google, por meio da utilizao de
operadores booleanos, os quais podem variar dependendo da
ferramenta de busca utilizada.
Um stio de chat ou de bate-papo um exemplo tpico de grupo de
discusso em que os assuntos so debatidos em tempo real. Para essa
finalidade, a comunicao pode ser de forma assncrona, o que
significa que desnecessria a conexo simultnea de todos os
usurios.

Com relao aos sistemas operacionais Windows XP e Linux, julgue os


prximos itens.




As informaes de espao livre em um disco rgido de uma mquina


que tenha instalado o sistema Windows XP podem ser obtidas a
partir do menu Arquivo do Windows Explorer, acessando-se a opo
Propriedades, que exibe informaes especficas sobre a unidade
selecionada.
O Linux um sistema operacional que pode ser usado apenas em
servidores, no sendo adequado para a utilizao em estaes de
trabalho do tipo PC. No entanto, um sistema cujo cdigo-fonte fica
disponvel para alteraes, permitindo que os usurios contribuam
para a sua melhoria.

Quanto ao uso seguro das tecnologias de informao e comunicao,


julgue os itens que se seguem.




As intranets so estruturadas de maneira que as organizaes possam


disponibilizar suas informaes internas de forma segura, irrestrita e
pblica, sem que os usurios necessitem de autenticao, ou seja, de
fornecimento de nome de login e senha.
Uma das formas de bloquear o acesso a locais no autorizados e
restringir acessos a uma rede de computadores por meio da
instalao de firewall, o qual pode ser instalado na rede como um
todo, ou apenas em servidores ou nas estaes de trabalho.

UnB/CESPE TRE/BA

O jogo de domin tradicional jogado com 28


peas, igualmente divididas entre 4 jogadores sentados face
a face em torno de uma mesa retangular. As peas so
retangulares e possuem uma marcao que as divide em duas
metades iguais; em cada metade: ou no h nada gravado, ou
est gravado um determinado nmero de buracos que
representam nmeros. As metades representam 7 nmeros: 1,
2, 3, 4, 5, 6 e 0, sendo este ltimo representado por uma
metade sem marcao. Cada nmero ocorre em 7 peas
distintas. Em 7 peas, denominadas buchas, o nmero aparece
nas duas metades. Existe tambm uma variao de domin
conhecida como double nine, em que as metades representam
os nmeros 0, 1, 2, 3, 4, 5, 6, 7, 8 e 9, em um total de 55
peas.
M. Lugo. How to play better dominoes. New York:
Sterling Publishing Company, 2002 (com adaptaes).

A partir dessas informaes, julgue os itens subsequentes.




Uma variao de domin cujas metades representem os


nmeros 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11 e 12 ter um
total de 82 peas.



No domin tradicional, os 4 jogadores podem se sentar


mesa de 6 maneiras distintas.



Considere que cada jogador, na sua vez, retire as 7 peas


ao mesmo tempo. Nesse caso, as peas de um domin
tradicional podero ser divididas entre os 4 jogadores de
maneiras distintas.



Entre todas as possveis divises das peas de um


domin tradicional entre os 4 jogadores, em mais de
100 milhes delas algum deles comear o jogo com
todas as 7 buchas.

4#5%70*1

%CTIQ6EPKEQ,WFKEKTKQTGC#FOKPKUVTCVKXC



www.pciconcursos.com.br

28










As expresses Meu caro Paz (R.2) e o velho amigo (R.10)


correspondem, respectivamente, ao vocativo e epgrafe da
comunicao particular em questo.
Em senti-lhes o afeto antigo (R.4), a forma pronominal lhes
refere-se s expresses tuas palavras e a teu abrao ambas
na linha 3.
Na orao se a solido me abate (R.6), a substituio do
conector se por acaso no prejudicaria o sentido expresso
nessa orao e a correo gramatical.
As formas verbais anuncias (R.8), concluas (R.9) e aludes
(R.9) esto conjugadas na segunda pessoa do singular do
mesmo tempo e do mesmo modo verbal.
Em oxal concluas a viagem (R.8-9), o vocbulo oxal
pode ser substitudo por tomara que, mantendo-se, assim, o
sentido do trecho em que se insere.

UnB/CESPE TRE/BA

Com relao ao uso seguro das tecnologias de informao e


comunicao, julgue os itens subsequentes.






No acesso Internet por meio de uma linha digital assimtrica


de assinante (ADSL), a conexo feita usando-se uma linha de
telefone ligada a um modem e os dados trafegam em alta
velocidade.
Firewall um recurso utilizado para a segurana tanto de
estaes de trabalho como de servidores ou de toda uma rede
de comunicao de dados. Esse recurso possibilita o bloqueio
de acessos indevidos a partir de regras preestabelecidas.
Confidencialidade, disponibilidade e integridade da
informao so princpios bsicos que orientam a definio de
polticas de uso dos ambientes computacionais. Esses
princpios so aplicados exclusivamente s tecnologias de
informao, pois no podem ser seguidos por seres humanos.

Acerca da redao de correspondncias oficiais, julgue o item


abaixo.

Julgue os itens que se seguem, a respeito dos sistemas operacionais


Windows XP e Linux.





Como vocativo das comunicaes oficiais destinadas a


senadores, juzes, ministros e governadores, recomenda-se
evitar o ttulo acadmico de Doutor e usar o pronome de
tratamento Senhor.

Com relao aos conceitos e aplicativos dos ambientes Microsoft


Office e BROffice, julgue os itens de que se seguem.


A impresso de um documento do Word pode ser feita a partir


do boto de impressora

, localizado na barra de

ferramentas, ou acionando-se as teclas


+
.
A diferena entre essas duas aes que a primeira permite a
configurao de impresso de acordo com as opes desejadas,
enquanto a segunda envia o documento diretamente para a
impressora padro que estiver configurada no computador
em uso.





No Windows XP, possvel tornar um diretrio restrito,


usando-se funcionalidade encontrada na aba Compartilhamento,
que acessada a partir da opo Propriedades do menu Arquivo
do Windows Explorer.
O Linux tem a caracterstica de ser um sistema desenvolvido
de maneira colaborativa, tal que os software da sute BROffice,
por exemplo, podem ser alterados durante o uso, depois de
instalados. Assim, possvel modificar os comandos referentes
aos cones dispostos na barra de ferramentas, alterar as teclas
de atalho e tambm o idioma do aplicativo.

4#5%70*1

No Microsoft Word, os botes


permitem,
respectivamente, desfazer uma ao indesejada e refazer uma
ao desfeita. Esses efeitos tambm podem ser obtidos por

Z R



meio da combinao de teclas


+
e
+
,
respectivamente.
Para se inserir dados em uma planilha do Microsoft Excel,
deve-se, inicialmente, selecionar a clula onde os dados sero
inseridos. Esse procedimento pode ser realizado com o uso do
mouse, posicionando o cursor na clula desejada, ou a partir

das setas do teclado, ou teclando


, para, em seguida, se
digitar os dados na clula e, por fim, confirmar a operao
com



No BROffice Writer, a partir do menu Exibir, possvel inserir,


no documento em edio, um objeto do tipo grfico, frmula,
som ou vdeo.

Acerca de navegao, correio eletrnico, grupos de discusso e


ferramentas de busca e pesquisa, julgue os prximos itens.




A caixa postal de correio eletrnico um diretrio criado no


servidor de e-mail, o qual fica localizado no computador do
usurio. Ao ser ligada a mquina, esse servidor recebe da
Internet, via provedor de acesso, as mensagens que foram
enviadas para o endereo do usurio.
Um grupo de discusso uma maneira fcil e imediata de se
interagir na Internet, a exemplo dos chats que, em tempo real,
possibilitam a duas ou mais pessoas se comunicarem de forma
assncrona. Os blogs e os fotologs tambm constituem
exemplos de grupos de discusso.

 


 


  

w ww.pciconcursos.com.br

  

29
Texto para os itens de 15 a 20
Entrevista: Marina Silva
Protagonismo feminino na Amaznia muito forte

10

13

16

19

22

25

28

31

34

As mulheres, em todo o mundo, tm de passar por


muitos obstculos entre eles o preconceito. Para voc, o que
ser uma mulher na regio amaznica? Quais os desafios e vantagens?
Marina Silva Primeiro que ser uma mulher na
Amaznia, ainda que com suas peculiaridades, guarda
semelhanas com ser uma mulher no Brasil. As dificuldades, os
preconceitos, que muitas vezes elas tm de enfrentar, no so
diferentes porque se trata da Amaznia. Isso no vai ser
diferente do que a gente vai encontrar nas diversas regies do
pas.
Acho que uma caracterstica importante que na
Amaznia elas foram assumindo um protagonismo muito forte
em todos os sentidos. Se voc pega a luta dos seringueiros,
voc vai ver figuras femininas. A primeira presidente do
Sindicato dos Trabalhadores Rurais de Xapuri, na poca do
Chico Mendes, era uma mulher [Dona Raimunda], que agora
novamente est no sindicato. A formao do Conselho
Nacional dos Seringueiros tem uma forte participao das
mulheres, inclusive da Dona Raimunda.
Voc tambm pode observar isso na poltica, na
academia. A presidente do museu Goeldi tambm uma
mulher. Voc tem uma forte participao da mulher. Ento ser
uma mulher na Amaznia comporta a dor e as delcias de ser
uma mulher no Brasil, com as dificuldades tpicas de cada regio.
E quais seriam essas dificuldades tpicas da regio
amaznica?
Marina Silva Acho que o atendimento das
demandas de Sade e Educao, aquelas demandas que so
bsicas e essenciais e que para uma grande parte das mulheres
na Amaznia so algo muito distante. Voc tem uma ausncia
do Estado muito grande na prestao de servios elementares:
do atendimento da sade da mulher, planejamento familiar,
atendimento da infncia e algo que sobrecarrega muito as
mulheres.
Thais Iervolino.
amazonia.org>

Internet: <www.portal
(com adaptaes).

Tendo em vista as informaes veiculadas no texto, alm de seus


aspectos gramaticais e textuais, julgue os itens seguintes.

Seria mantida a concordncia verbal no trecho As mulheres,


em todo o mundo, tm de passar por muitos obstculos (R.1-2)
retirando-se o acento circunflexo da forma verbal tm.
16 O pronome elas em elas tm de enfrentar (R.7) refere-se
mulher que vive na Amaznia.
17 Para a entrevistada, as dificuldades da mulher que vive na
Amaznia so semelhantes s que mulheres de outras regies
encontram para se afirmar na sociedade, embora ocorram em
escala menor.
18 O trecho Se voc pega a luta dos seringueiros (R.13) tem
caractersticas da linguagem informal e poderia ser reescrito,
mantendo-se o significado, da seguinte forma: Se tomarmos
como exemplo a luta dos seringueiros.
Considerando o texto e os seguintes requisitos: A redao oficial
deve caracterizar-se pela impessoalidade, uso do padro culto de
linguagem, clareza, conciso, formalidade e uniformidade
(Manual de Redao da Presidncia da Repblica, 2002), julgue
os itens que se seguem.

Em fevereiro de 1999, Hugo Chvez iniciou o seu primeiro


mandato como presidente venezuelano. A respeito de seus
onze anos de governo, julgue os itens a seguir.
21

22

23

Chvez defende novas formas de cooperao internacional


entre os pases latino-americanos, destacando-se a criao da
Aliana Bolivariana para as Amricas, em oposio ao Tratado
de Livre Comrcio das Amricas.
A nacionalizao de empresas estrangeiras de diversos setores
e o maior controle estatal da economia tm sido marcas do
governo de Hugo Chvez.

A poltica externa de Hugo Chvez marcada pela criao de


fortes laos com a Colmbia, base de seu projeto de
bolivarianismo do sculo XXI.

Com relao ao impacto da ocupao humana na Amaznia, julgue


os itens que se seguem.
24

25

26

27

Na Amaznia, as usinas termeltricas produzem quantidades


desprezveis de CO2, quando comparadas s usinas
hidreltricas.

Menos de 10% das terras da Amaznia Legal tm ttulos de


propriedade vlidos, uma das consequncias da ocupao
desordenada da regio.
A principal rea de devastao ambiental da Amaznia o
chamado arco do desmatamento, regio que se estende de
Rondnia ao Maranho.

As cidades tm pouco impacto ambiental porque, ao contrrio


do restante do Brasil, a maior parte da populao da Amaznia
ainda vive no campo e est envolvida em atividades tpicas do
desenvolvimento sustentvel.

O Painel Intergovernamental sobre Mudanas Climticas (IPCC) se


tornou referncia nas discusses sobre possveis mudanas no clima
do planeta. Acerca do IPCC e de seus relatrios, julgue os itens
subsequentes.
28

15

O quarto pargrafo Voc tambm (...) cada regio


(R.20-24) no seria adequado para compor um documento
com o padro ofcio.
20 As respostas da entrevistada, na ordem em que so
apresentadas, poderiam fazer parte do corpo de um relatrio.

UnB/CESPE

29
30

No quarto relatrio produzido pelo rgo, em 2007, foi


avaliado que, desde meados do sculo XX, o aquecimento
global inequvoco e quase certamente causado pela ao do
homem.
O IPCC ligado ao governo dos Estados Unidos da Amrica,
o que, por vezes, tem posto em dvidas os relatrios do rgo.
Em 2009, o IPCC foi agraciado, juntamente com o presidente
americano Barack Obama, com o prmio Nobel da Paz, em
razo dos servios prestados para a melhoria do conhecimento
climtico do planeta.

A respeito dos ambientes Windows XP e Linux, julgue os itens a


seguir.
31
32

33

19

34

Os sistemas Windows XP e Linux tm kernel comum, aberto,


que pode ser facilmente customizado pelo usurio.
O Linux, um sistema multitarefa e multiusurio, disponvel
em vrias distribuies, entre as quais, Debian, Ubuntu,
Mandriva e Fedora.

O Windows XP possui, por padro, uma interface grfica,


enquanto o Linux tem disponveis vrias interfaces grficas,
que podem ser instaladas e customizadas segundo a
necessidade do usurio.
Tanto o Linux quanto o Windows XP possuem suporte nativo
ao protocolo TCP/IP para acesso Internet.

Banco da Amaznia S.A. Cargo 23: Tcnico Bancrio

w ww.pciconcursos.com.br

30
Considerando que, em uma empresa, um computador seja usado por
vrias pessoas para acesso Intranet, julgue os itens que se seguem.
35

36

37

38

39

40

Em uma situao normal, caso um usurio deseje acessar a


Internet e a intranet da empresa ao mesmo tempo, ele deve
usar duas verses diferentes de navegador, por questo de
incompatibilidade de tecnologia entre a Internet e a intranet.
Na situao em questo, o uso de correio eletrnico pode ser
feito por meio de um cliente de correio, como o Microsoft
Outlook, ou com o uso de uma interface web. Em ambos os
casos, possvel que as mensagens de correio do usurio
fiquem armazenadas no servidor de e-mail da empresa.

UnB/CESPE

Acerca de matemtica financeira, julgue os itens subsequentes.


46

47

48

Para melhorar o nvel de controle de acesso dos usurios


Internet, possvel o uso de mecanismos de segurana como
firewalls e antivrus.

Caso se deseje usar o referido computador para gerar


documentos no Windows XP, possvel salvar esses
documentos na pasta Meus Documentos, mas, por padro,
nenhuma pasta ou subpasta pode ser excluda desse
computador, e tambm no possvel enviar documento
anexado a correio eletrnico.
Se o acesso Internet for feito mediante um servidor proxy,
pode ser impedido o acesso a determinadas pginas e tipos de
software, em funo de configuraes de restrio que podem
ser realizadas.

TCP/IP o protocolo padro para o acesso Internet. No caso


da intranet, o acesso realizado, por padro, com o uso do
protocolo IPv6.

49

50

Considerando 1,1 e 1,0489 como valores aproximados de


1,0128 e 1,0124, respectivamente, correto afirmar que a taxa
anual de juros equivalente taxa de juros compostos de 1,2%
ao ms inferior a 15%.

Se um emprstimo de R$ 1.000,00 for quitado em 10


prestaes, mensais e consecutivas, a juros de 2% ao ms, pelo
sistema de amortizao constante (SAC), e se a primeira
prestao vencer um ms aps a contratao do emprstimo,
ento o valor da terceira prestao ser igual a R$ 116,00.

Considerando que a instituio financeira X oferea aos


clientes a taxa de desconto de 2,4% ao ms para desconto de
ttulos, e que a instituio concorrente Y oferea uma reduo
de 25% na taxa praticada pela X, para descontos dos ttulos
com vencimentos em at 90 dias, ento o valor atual, com
desconto simples por fora, pago pela Y para um ttulo com
valor de face de R$ 1.000,00 e que vence em 2 meses inferior
a R$ 960,00.

Caso uma loja de roupas oferea o desconto de 5% sobre o


preo de cada pea para pagamento vista, ou o pagamento em
duas parcelas, mensais e iguais, sem acrscimo, com a primeira
devendo ser paga no ato da compra, ento a taxa mensal de
juros que a loja embute nos preos para vendas a prazo
superior a 10%.
Se um cliente aplicou seu dinheiro em uma instituio
financeira taxa de juros (aparente) de 7,52% ao ano, durante
determinado ano em que a inflao oficial apurada foi de 5%,
ento o valor aplicado por esse cliente, nesse ano, rendeu juros
reais acima de 2,5%.

4#5%70*1

Os saldos dos depsitos em poupana dos correntistas


Miguel, Norberto, Orlando e Paulo, em uma agncia bancria,
somavam R$ 64.000,00. Em um mesmo dia, foram realizadas as
seguintes operaes nessas contas de poupana:

<
<
<
<

Miguel fez um depsito de R$ 3.000,00;


Norberto fez um saque de R$ 3.000,00;
Orlando depositou o dobro do montante que j possua de
saldo;
Paulo sacou dois teros do seu saldo.

Aps essas operaes, os quatro clientes ficaram com o


mesmo saldo em suas respectivas contas de poupana.
Com referncia a essa situao hipottica, julgue os itens a seguir,
a respeito dos saldos das contas desses correntistas antes de
realizadas as citadas operaes.
41
42
43
44
45

O saldo da conta de Paulo era igual ao triplo do saldo da conta


de Orlando.
O saldo da conta de Miguel era igual metade do saldo da
conta de Norberto.

A soma dos saldos das contas de Miguel e de Norberto era


igual a dois teros do saldo da conta de Paulo.
O saldo da conta de Orlando era igual a R$ 4.000,00.

O saldo da conta de Norberto era superior a R$ 16.000,00.

Banco da Amaznia S.A. Cargo 23: Tcnico Bancrio

w ww.pciconcursos.com.br

31
Acerca de informtica, julgue os itens a seguir.
31

41

clulas na direo em que o usurio arrastar o mouse, seja de

por caracteres, sendo que cada caractere, representado por 0 ou


bit.
32

cima para baixo, da direita para a esquerda ou na diagonal.

42

maisculas e minsculas.

intermediria que guarda as informaes oriundas da memria


a essas informaes.

33

43

insero de uma planilha com tabelas e frmulas de formatao

do tipo Ethernet e servem para conectar computadores a redes


34

A principal caracterstica das impressoras multifuncionais

reunir, em um nico equipamento, diversas funcionalidades


que antes eram segregadas em dispositivos independentes,
como impressora, copiadora e escner.

automtica, por meio de opo encontrada no menu Arquivo.

No que se refere a tecnologias de Internet e intranet e segurana


da informao, julgue os itens subsequentes.
44

conectados aos servidores que funcionam como provedores


de acesso e de servios de correio eletrnico, transferncia

No Windows XP, a barra de inicializao rpida oferece um

espao para cones associados a programas utilizados com


mais frequncia, os quais podem ser acionados com apenas um

de arquivos e acesso a pginas web.


45

estabelecido em um servidor, o qual deve ser responsvel por

No Windows XP, a janela Meu Computador, que pode estar

enviar os e-mails para usurios cadastrados.

acessvel tanto pelo desktop quanto pelo menu Programas,

permite acesso ao ambiente de gerenciamento de pastas e

arquivos, o qual, quando acionada a opo de visualizao de

46

cabo UTP dedicado, ligado entre o computador do usurio e o

A partir do menu Arquivo do Windows Explorer, o Windows

XP oferece a opo de se criar um arquivo em formato editvel


no Excel, no Word e no PowerPoint, e tambm de criar

provedor de acesso.
47

38

No Linux, o aplicativo KDE Controle Center tem

nublados, porque utiliza infraestrutura por satlite.


48

Mozilla Firefox, um programa utilizado para acessar os

configurao para a permisso de acesso aos usurios do

ou organizaes.

computador.

servidores que armazenam, na Internet, as pginas de usurios


49

computadores de determinada empresa, j que esse tipo de

Office e BROffice, julgue os itens de 39 a 43.

rede configurado de modo a bloquear qualquer arquivo que

A barra de ferramentas de formatao do Excel contm opes


que permitem inserir, em uma planilha, figuras, formas e linhas
e tambm configurar cores e autoformas.

No Word, o recurso de autocorreo do menu Ferramentas til

para a correo grfica e sinttica de palavras e frases digitadas


em um documento em edio.

Uma rede do tipo VPN (virtual private network) fundamental


para evitar que vrus ou programas maliciosos entrem nos

A respeito da utilizao de aplicativos dos ambientes Microsoft

40

Cliente web ou WWW, a exemplo do Internet Explorer e do

funcionalidades equivalentes ao Painel de controle do Windows,

ambos permitindo o gerenciamento de pastas e arquivos e a

39

A Internet por rdio, no Brasil, ainda um servio de baixa

velocidade, sujeito a intempries e inoperante no caso de dias

arquivos da sute BROffice, desde que esses software estejam


instalados no computador em uso.

O servio de acesso Internet por ADSL no necessita de


modem para estabelecer uma conexo, que realizada por um

pastas, apresenta a mesma interface do Windows Explorer.


37

Um servidor de sada de e-mails, ou servidor POP,

obrigatrio para que um servio de correio eletrnico seja

clique do mouse.
36

A Internet funciona a partir do modelo cliente/servidor, no

qual os computadores dos usurios operam como clientes

Com relao a sistemas operacionais, julgue os itens que se seguem.


35

Para a criao de apresentaes de slides com dados


matemticos, o Calc do BROffice oferece a possibilidade de

As placas de rede do tipo Wi-Fi operam sob uma arquitetura

do tipo WAN (wide area network), por cabo de par tranado.

No Writer do BROffice, a opo Alterar capitalizao, disponvel

no menu Formatar, permite inverter a fonte usada no texto entre

A memria cache do computador um tipo de memria


principal, com a finalidade de agilizar o acesso do processador

No Excel, a ala de preenchimento utilizada para a

duplicao de um dado inserido em uma clula para as demais

As informaes processadas nos computadores so compostas

1, chamado de byte, e um conjunto de oito bytes constitui um

UnB/CESPE

no seja reconhecido pelo firewall nela instalado.


50

Port scanner um programa que, se instalado em um

computador, permite que um invasor volte a acess-lo quando


quiser para invadi-lo. Geralmente instalado a partir de
programas do tipo cavalo-de-troia ou at por e-mail.

Banco da Amaznia S.A. Cargo 1: Tcnico Cientfico rea: Administrao

www.pciconcursos.com.br

32
Em relao aos sistemas operacionais Windows XP e Linux,
julgue os itens a seguir.








No Windows XP, as teclas

pressionadas simultaneamente, permitem


rapidamente entre os programas abertos.

quando

alternar

O Windows XP disponibiliza, por meio do menu Iniciar>


Todos os Programas> Acessrios> Ferramentas do Sistema, a
ativao do programa Desfragmentador de disco, que pode ser
utilizado para recuperar fragmentos de arquivos danificados
por falhas de disco.

No sistema operacional Linux tpico, o subdiretrio /dev do


diretrio raiz contm os arquivos executveis (binrios) de
comandos essenciais pertencentes ao sistema, e que so
usados com frequncia pelas aplicaes.
No sistema operacional Linux, um ponto (.) no incio do
nome identifica os arquivos ocultos.

Quanto aos aplicativos do Microsoft Office e do BrOffice.org,


julgue os itens que se seguem.


No aplicativo Writer do BrOffice.org, para se fechar um


arquivo que esteja sendo editado, possvel usar qualquer
uma das duas seguintes combinaes de teclas:
ou





+ .

+W

O aplicativo Microsoft Word 2003, na sua configurao


padro, permite, a partir do menu Exibir, quatro modos de
visualizao do texto: Normal, Layout da web, Layout de
impresso e Estrutura de tpicos.

No aplicativo Microsoft PowerPoint 2003, uma das maneiras


possveis de se iniciar a apresentao dos slides de um
arquivo em edio clicar no menu Apresentaes e
selecionar a opo Exibir Apresentao.

Acerca de conceitos de organizao de arquivos e Internet, julgue


os itens seguintes.






Firewall o mecanismo usado em redes de computadores


para controlar e autorizar o trfego de informaes, por meio
do uso de filtros que so configurados de acordo com as
polticas de segurana estabelecidas.
No Internet Explorer, ao se clicar o boto

Quanto s competncias e atribuies dos entes da Federao em


matria de sade, julgue os itens seguintes.


aos municpios, no mbito administrativo, elaborar a


proposta oramentria do Sistema nico de Sade (SUS).


natureza financeira de interesse da sade, autorizadas pelo


Senado Federal.


disponibilizada, clicar a opo Excluir.

e, na lista

Cabe Unio, com seus recursos prprios, financiar o


Subsistema de Ateno Sade Indgena.



Entre as atribuies estabelecidas pela lei direo estadual

do SUS, destaca-se a de formar consrcios intermunicipais,

em benefcio da populao dos municpios inseridos na sua


esfera territorial.

No que se refere aos servios privados de assistncia sade,


julgue o item subsequente.


O SUS pode recorrer aos servios prestados pela iniciativa

privada quando suas disponibilidades forem insuficientes


para garantir a cobertura assistencial populao de

determinada rea, sempre por intermdio de entidades


filantrpicas sem fins lucrativos.

Acerca da participao da comunidade na gesto do SUS, julgue


os itens que se seguem.


O SUS conta, em cada esfera de governo, com o Conselho


de Sade, rgo colegiado composto exclusivamente pelos

representantes do governo e pelos usurios, o qual atua na

formulao de estratgias, no controle da execuo da


poltica de sade na instncia correspondente e nos aspectos

possibilidade de configurar o endereo URL do site que ser


exibido ao iniciar o navegador Internet Explorer.

direito do mouse, manter pressionada a tecla

Conforme legislao do SUS, constitui competncia

exclusiva da Unio a realizao de operaes externas de

, o usurio tem

No Windows Explorer, para se excluir um arquivo


definitivamente, sem que ele seja enviado para a Lixeira,
necessrio clicar sobre o nome do arquivo com o boto

Compete Unio, aos estados, ao Distrito Federal (DF) e

econmicos e financeiros.


A Conferncia de Sade, que se rene a cada quatro anos


para avaliar a situao de sade e propor diretrizes para a
formulao da poltica de sade nos nveis correspondentes,
pode ser convocada pelo Conselho de Sade.

UnB/CESPE MS

Conhecimentos Bsicos (para todos os cargos de nvel superior)

www.pciconcursos.com.br

33
&'()*+,-.

/0123456780260926:5;<6=;>092?02@;<3090A=2BAA;<4C2699;D6542620:780
<0334=6E
F G12?0<H14D=02456I036?02D02J03?2:0?429432965>02412H1
63KH;>02<012H12D014249:4<LA;<02<0D=4D?0262=431;D67802E?0<C
941262H=;5;M67802?42<636<=4349249:4<;6;92=6;92<0102:0D=024
>L3NH562OPQ242I63362ORQE2S994263KH;>02:0?429432N36>6?02412H16
:69=62<3;6?62D621TKH;D62412H9020H2412T3462?;9:0DL>45241234?4
?42<01:H=6?0349C2942U0H>43E
V /01202H902?02W0X43W0;D=C2Y2:099L>452<3;6326:3494D=67Z49
<0D=4D?02H12<0D[HD=02?42\]^_`\2412H12aD;<0263KH;>0242;D943;3
D0>092\]^_`\2:3499;0D6D?0b942692=4<5692 2c2 20H
<5;<6D?02620:7802defeghijklC2D02m`no2pqjrjsE
t B2\uvwxyz`2S{<452?;9:0D;I;5;M62AHD<;0D65;?6?492:6362<3;632H1
I6D<02?42?6?092KH42:431;=626990<;632=6I4569242<05HD692?4
A0316203N6D;M6?6C2;D=4N36?624249=3H=H36?6E
| B234<H3902}~hlsjsgrlih2?02J03?2:431;=4262<3;67802?42=6I4569
KH426990<;6125;DU69242<05HD69C2D692KH6;92:0?4294323465;M6?0
<T5<H5026H=01T=;<02?42?6?09C2<0102412H162:56D;5U62454=3D;<6C
9412KH4294[62D4<499T3;02H=;5;M63C2:636545614D=4C2=6I45692S{<45E
W6362942A6M43262=6IH567802412H12?0<H14D=0C241249:4<;652D6
4?;7802?42?0<H14D=0920A;<;6;92<0121H;=092:63TN36A09C2;=4D924
9HI;=4D9C2?4>4b942:3499;0D63262=4<562 24262I63362?4
49:6709C202KH42N636D=42H1265;DU614D=02?42=4{=0242:63TN36A09
?4216D4;362:6?30D;M6?62429412?49>;09E2

0123456759
53

&'()*+,-

99;D6542620:7802<0334=62<012345678026029;9=41620:436<;0D65
J;D?0X92WE

F B2J;D?0X92W2:099H;C26:634D=42412=0?0920926:5;<6=;>092KH4
98024{4<H=6?092D499429;9=41620:436<;0D65C2H162I63362?4
A433614D=692?42[6D4562:6?3802<0120:7Z492?426I3;320H2A4<U63
63KH;>0920H2:69=69C26<499632HD;?6?42?4234?42425;N6320H2?495;N63E
V 20:7802lsg~jkklgklgslklC26<4996?62?;34=614D=42:450
L<0D42 C2:431;=42;?4D=;A;<6320D?4249=T250<65;M6?02H1
63KH;>02KH42942?494[624D<0D=3632D621TKH;D62412H90E
t W03214;02?620:7802sesjlkklh2?62I63362?42=634A69242?02m`no
}~jjs2?02J;D?0X92WC2Y2:099L>452=4326<499023T:;?0242;14?;6=0
920:7Z492?42ifsC2}sjjsC2}ess242pqess209263KH;>092KH4
9802H=;5;M6?092:4502H9HT3;0E
| S12sesjlkklhgklgjhegieig2?02J;D?0X92WC2Y2:099L>45
=4326<4990262;DA03167Z4926<43<62?62KH6D=;?6?42?4249:6702H96?0
42?4249:67025;>342D02E261IY12Y2:099L>4526<4996326
A433614D=62jlgklgkjhe2:63620=;1;M63262?;9=3;IH;7802?4
63KH;>092D02E
B2j~ligklge~seilg?02J;D?0X92W20A434<42H12<0D[HD=02?4
&'()*+,-
D=692a=4;92:6362KH42092H9HT3;092<0DA;NH34129H692=634A69
H6D=0260926:5;<6=;>092?0261I;4D=42BAA;<4C2699;D6542620:780 IA4T393;6<14
69C2<010234<4I432424D>;632`my^]\C26<499632092:30N36169
<0334=6E
42692A433614D=692?424D=34=4D;14D=02426<49963262:69=62lh
F 20:7802ifsgke2?02J3;=432:431;=42965>632412H12aD;<0 kel~ehC24D=3420H=369E2
?0<H14D=02=0?69269265=4367Z492KH42A03612A4;=692D4542:032H120H
&'()*+,-
16;92H9HT3;09E
V 026:5;<6=;>02/65<C2Y2:099L>45210D=632A31H5692?42<T5<H50216;9 /01234567802602H902?62D=43D4=242?62^nwzyn`wC2699;D6542620:780
6>6D76?69242<0120:7Z492KH42D8024{;9=412D02S{<45C2>;9=02KH4
02:3;14;302Y2H12\uvwxyz`25;>342?494D>05>;?0242?;9:0D;I;5;M6?0 <0334=6E
:6362H9021H;=026D=492?02a5=;10E2
t 029426=H65;M632H12?0<H14D=02D02J3;=43C2Y2:099L>452?49A6M43 F 92^nwzyn`w\29802?49=;D6?692602H90241250<6;923410=09C20D?42D80
69265=4367Z492A4;=69C2<0D9;?436D?020249=TN;02412KH424542A0; 942?;9:Z42?426<4990262:30>4?03492?426<499022D=43D4=E
965>02:4562a5=;162>4MC262:63=;32?02<016D?02lssls2?02m`no
sjfeE
V W63629423465;M632H162<0D4{8022^nwzyn`wC2Y2D4<499T3;02H1
| G162?692>6D=6N4D92?0926:5;<6=;>092?629HL=42BAA;<42Y26 :30>4?032?426<49902;D9=656?02D621TKH;D62?02H9HT3;0242H12<6I0
6H9D<;62?42699;9=4D=492?42:30?H7802?42?0<H14D=09C2:0;924549 ?42I6D?62563N62:636262=36D9A43D<;62?4263KH;>092?42?6?09E
9802?42:0H<626[H?6242<0DAHD?41202H9HT3;02?H36D=42624?;7802?4
?0<H14D=0920H26:3494D=67Z49C2>;9=02KH42D802:099H412;D=43A6<4 t 62D=43D4=C2026<49902?4?;<6?02Y2A4;=02:03214;02?42H1625;DU6
61;NT>4520H2H1625;DNH6N412:3{;162?02H9HT3;0E
:3;>6=;>6C2<012<0D4{802?;9:0DL>4522U03692:032?;6E
W6362942;D943;32H162D0>62A31H562D02/65<C2?4>4b942H9632620:780 | 2
<0D4{8022D=43D4=2:0320D?692?423T?;02:431;=4262H=;5;M67802?4
iis2?02m`no2lssl~hE
=
4
<
D050N;6929412A;0C2:6362KH42942:09962<6:=6329;D652426<49963
&'()*+,-
?;34=614D=4269234?492?42<01HD;<6780262:63=;32?42M0D6923H36;9C
99;D6542620:7802KH42<0D=Y126:4D692A433614D=692?42D6>4N6780242?4 169234KH432KH42U6[625;DU692=454AD;<692A;{692;D9=656?692D69
<0334;02454=3D;<02H=;5;M6?69241234?492?42<01:H=6?0349E
:30{;1;?6?49E
F D=43D4=2S{:50343C2@0M;5562;34A0{C2BH=500C2BH=5002S{:3499 2D=43D4=C2=61IY12?4D01;D6?62JJJC2Y2H162aD;<6234?42?4
V /U6=C2/C2@C2X;==43
<01:H=6?0349C2?426I36DND<;621HD?;65C2A0316?62:032;Da14369
t JC2J4IC2JJJC2;DN43
^nwzyn`w\C2692KH6;92?;9:0D;I;5;M612692;DA03167Z492KH42=36A4N61
| 0U43C2G94D4=24X9C2J6;9C24=D4X9
D62D=43D4=2412=41:023465E
3H1C2014W6N4C2W699X03?C2G94D4=
!"##$

%

34

%&'()*+,*)*+*-+.(/-01/-+2/+33+*+34

0123456759
53

YZ[\]^_`a

b?T@8DB;<TD?6<8TD<6<6789:;<6D?6N;O778=B6P;8AB;6QRSc6<@@8T<CB6<
?VWX?6r:B68TD8=<6?6V;?=BD8>BTA?6=?;;BA?6V<;<6BUV?;A<;6?6ABUA?6V<;<
?6P?;DR
d bC8=<;6<6?VWX?6onmnnoD?6Ly6
c
@BCB=8?T<;6<6V<@A<6DB@Bu<D<6B6V?;678>6=C8=<;6R
p bC8=<;6<6?VWX?6on6D?6Ly6 c6@BCB=8?T<;6<6V<@A<
DB@Bu<D<6Bc6B>6@B9:8D<c6=C8=<;6R6
z 5?
;B7B6@;BBT6=ABC86<=?<;6A68@V??i6D;BB66<<;6r?:V8WsX??6V6<;<6BUcV6@?B;;At<6W<XV?;RB65@BVT{A@<6=DC<86=<<6;?6?V6AW8VX??
DB6<;r:8s?6DB@Bu<D?c6h6@:78=8BTAB6@BCB=8?T<;6<6?VWX?6on6B
=C8=<;6R
bC8=<;6?6Ly6 6B6<;;<@A<;6?6ABUA?6V<;<6:><6u<TBC<6D?
P?;Dc6TB=B@@8A<TD?6DB@@<67?;><6<i;8;6:><6T?s<6ABC<6D?
N;O778=B6P;8AB;6QRSR6

bC
VWX?6njoo6D?6Ly6noc6@BCB=8?T<;6<6?VWX?
56789:;<6<=8><6>?@A;<6:><6ABC<6D?6EFGHIJKLMN;O778=B6P;8AB6QRS 8=no<;o6<m6?o
nknoB6=C8=<;6?6i?AX?6nR
=?TABTD?6:>6ABUA?6B>6V;?=B@@?6DB6BD8WX?R
/0+/+&'()*+,*)*+*-+.(/-01/-+3+/+3
YZ[\]^_`aa
b?T@8DB;<TD?6<6@8A:<WX?6>?@A;<D<6T<6789:;<c6<@@8T<CB6<6?VWX?
=?;;BA<R
d e<;<6@B6=BTA;<C8f<;6?6AgA:C?6D?6ABUA?c6h6@:78=8BTAB6=C8=<;6@?i;B
BCB6Bc6B>6@B9:8D<c6@BCB=8?T<;6<6?VWX?6jklmno6T?6=<>V?
R
p e<;<6@B6=?>V<;A8Cq<;6?6<;r:8s?6=?>6:@:t;8?@6D<6;BDB6<6r:B6?
=?>V:A<D?;6B@ABu<6=?TB=A<D?6h6@:78=8BTAB6=C8=<;6<
7B;;<>BTA<6 6B6D898A<;6?@6vFwxyE6D<@6VB@@?<@6<:A?;8f<D<@R
z 5?6@B6V?@8=8?T<;6?6=:;@?;6C?9?6<V{@6<6V<C<s;<6|sB;B<D?;}6Bc6B>
@B9:8D<c6V;B@@8?T<;6<6AB=C<6 c6?6=?;V?6D?6ABUA?c6>?@A;<D?6T<
ABC<c6@B;t6;BD:f8D?6<6:>6T8=?6V<;t9;<7?R
5?6@B6><;=<;6<6V<C<s;<6|CB9BTD<@}6Bc6B>6@B9:8D<c6<VC8=<;6:>
A;8VC?6=C8r:B6@?i;B6BC<c6?6=?;V?6D?6ABUA?6@B;t6@BCB=8?T<D?R6
e<;<6@B6@:iC8Tq<;6?6AgA:C?c6h6@:78=8BTAB6@BCB=8?TtC?6B6=C8=<;
T<67B;;<>BTA<6 R

YZ[\]^_`a

b?>6;BC<WX?66789:;<6B66:A8C8f<WX?6D?6N;O778=B6P;8AB;6QRSc6<@@8T<CB
<6?VWX?6=?;;BA<R
d 56789:;<6<V;B@BTA<6<6Vt98T<66DB6:>6ABUA?6r:B6=?TAh>6S
Vt98T<@R6
p 568TD8=<WX?6
6<V;B@BTA<D<6T?6=<TA?68T7B;8?;
D8;B8A?6D<6ABC<6Bs8DBT=8<6r:B6:><6@BTq<6V<;<6<=B@@?6B@At6@BTD?
;Br:8@8A<D<R6
z 56?VWX?6 6T<6V<;AB68T7B;8?;6D<6ABC<68TD8=<6r:B6?6ABUA?67?8
8T@B;8D?6<6V<;A8;6DB6:><6Vt98T<6D<6TAB;TBAR6
e<;<6@B6BUV?;A<;6?6ABUA?6V<;<6?67?;><A?6e6h6@:78=8BTAB6=C8=<;
@?i;B6<6?VWX?6 c6D898A<;6?6T?>B6D?6<;r:8s?6<V;?V;8<D?6B
=C8=<;6<6?VWX?6nR6
e<;<6@B6C8>V<;6<67?;><A<WX?6D?6ABUA?6h6@:78=8BTAB6@BCB=8?TtC?
B6=C8=<;6<67B;;<>BTA<6 R
!"#

56ABC<6<=8><67?869B;<D<6<6V<;A8;6D?6<VC8=<A8s?6N;O778=B6b<C=R6QRS6B
<V;B@BTA<6:><6VC<T8Cq<6<6V<;A8;6D<6r:<C67?869B;<D?6?69;t78=?
>?@A;<D?R
YZ[\]^_`a

b?T@8DB;<TD?6<6789:;<c6<@@8T<CB6<6?VWX?6=?;;BA<R
d O69;t78=?6>?@A;<D?67?86=;8<D?6=?>6i<@B6T<@6=hC:C<@6DB66<6R
p 56
e?;7AB<;T;<A?>B
c6<T?A6@<B66<CAB;<6;68?T@D6s8=<<C?6r;B:@B6D6<?66V9C<;tT788C=q?<66?T6X9?;t67h86=D?86TTX?>8
6@B=;?tR
<CAB;<D?R6
z e<;<6@B6<CAB;<;6<@6=?;B@6D?69;t78=?c6h6@:78=8BTAB6@BCB=8?TtC?6B
=C8=<;6@?i;B6<@6=?;B@6DB@Bu<D<@6T?6=<>V?6
R
e<;<6@B6=BTA;<C8f<;6?6ABUA?6T<6=hC:C<c6h6@:78=8BTAB6=C8=tC<6B
<u:@A<;6<6?VWX?6
R
5TAB@6DB6=;8<;6?69;t78=?c67?86TB=B@@t;8?6DB78T8;6<6B@=<C<6<6@B;
:A8C8f<D<6V<;<6?6B8U?6R

$

35
%&'()*+,-.

/0123456714089:58028474028178;<713<=78478>3?:678@AB<:<728A0C
47402D8E3F5225C823408?567402878;76E368408GHA5<8IJJKL8722317<587
0;MN089:587;65251E7L8652;5AE3F7C51E5L8728>O6C:<728A0665E728;767825
A7<A:<76808E0E7<85878CB437840285<53E06528108GHA5<8IJJKP
Q RSTUVWXYZ[\]^_S58RS`abcWYZ[d]^_
e RfU`WY]gd]^_S58RS`abcWY]gd]^_
h RTUVWXY]gd]^_S58RS`abcWSY]g\]^_
i RfU`WYZ[jS]^_S58RS`abcWYZ[k]^_
l RfU`WYZ[d]^_S58RS`abcWYZ[d]^_

0123456759
53

%&'()*+,-

/012345671408A01A53E02845825?:671M7847831>06C7MN0L8722317<587
0;MN08A0665E7P8

Q n825?:671M78472831>06C7M5289:58E67123E7C8;5<78q1E5615E8B845
E0E7<8652;01273<34745840874C3132E6740684586545P
e q12E7<76858:E3<376871E3F6:285C8:C8A0C;:E74068B8:C787MN0
;65F51E3F789:585<3C3178A0C;<5E7C51E5878;02233<34745845
7E79:52878769:3F02858;72E72P8
%&'()*+,-m
h n08258:E3<37688B8?7671E340808<09:5308458F6:2858L
n22317<58780;MN089:587;65251E78:C8;60E0A0<08652;012oF5<8;5<0 ;0328782:78;631A3;7<8>:1MN08B83451E3>3A768585<3C31768769:3F02
51F308458C5127?51285<5E6p13A728178q1E5615EP8
A0660C;3402P8
Q rst
i {5A:6202858312E7<7M528458;60A5227C51E0845831>06C7M52
e tutv
A6E3A7280:82512F532840815?OA30845F5C82568C71E347285C8o6572
h wxyt
25?:672L8;60E5?34728;068:C8;56C5E60845825?:671M7845>31340L
i wyzt
A0C876653672845825?:671M787;60;637472858A01E60<584587A5220P
l {zt
l u28232E5C7280;567A3017328C04561028;022:5C8C5A7132C0289:5
%&'()*+,-|
/012345671408028232E5C7280;567A3017328}3140~28t85831:HL 5F3E7C878;60;7?7MN08458F6:2858A7F7<028458E6037P8z732
C5A7132C02845F5C825687E3F74028;068C5308408?5651A37406845
722317<58780;MN08A0665E7P
769:3F0280:8;5<08?5651A3740684587;<3A7E3F02P8
Q 10C58B808232E5C78?5651A374068458:2:o630840831:HP8
e n80;MN08jSU`VWbUS108}3140~28t87;65251E7872 %&'()*+,
A767AE562E3A728408:2:o63087E:7<P
h x0831:HL8;76782587A52276878q1E5615E8B82:>3A351E5851E676810 /0123456714080287;<3A7E3F028408y3A6020>E8u>>3A5L8722317<58780;MN0
A0665E7P8
}3140~28GH;<0656P
i u8WcjXSbjSUVUXjS40831:H8;02233<3E7878A637MN08458769:3F02
58;72E72P
452F71E7?5C8458258:E3<376808yw8}0648;767878543MN0845
l x7:E3<:28B8:C8;60?67C7825C5<=71E58708}3140~28GH;<065689:5 Q n8
E75<728B8783C;02233<347458458A63768>O6C:<728;7678E0E7<376
;56C3E58?5651A3768769:3F02P8
F7<0652P8
%&'()*+,-
/012345671408028A01A53E028o23A028458E5A10<0?372858>5667C51E72 e n08258A63768:C787;65251E7MN08108yw8t0~568t031EL8B8;022F5<
31256368E5HE028408yw8}06480:8478q1E5615E8587314783125636
7220A3747288q1E5615E858L8722317<58780;MN08A0665E7P
;<713<=78408yw8GHA5<85C8A0C083C7?512858F4502845843F56202
Q t76782587A52276878q1E5615E80:8:C78L8B82:>3A351E589:580 E3;02P8
:2:o6308E51=7808q1E5615E8GH;<06568312E7<74085C825:8A0C;:E7406P
e n8E5A10<0?378v8432;0133<378256F3M028458E5<5>013785 h x08yw8GHA5<8IJJKL878A637MN08458C7A6028B8;022F5<8A0C87
E6712C322N0845847402878<01?728432E1A372L85C8:C87C351E5 312E7<7MN08408`WUWjP
COF5<L831A<:31408087A5220878q1E5615EP8
h u8u:E008GH;65228;022:38C7328>:1A3017<34745284089:580 i n08258A0;3768:C8652:<E7408458:C78>O6C:<78A637478108yw8GHA5<
58A0<o<085C8:C865<7EO6308A637408108yw8}064L89:7140
y3A6020>E8u:E<00L8A0C0L8;0685H5C;<0L8ZjbW858UVWVUP
i n88432;0133<378256F3M02825C5<=71E5287028478q1E5615E 7<E5674028028474028108yw8GHA5<L808F7<0687;65251E7408108yw
451E608458:C7865458<0A7<L8C7281N08;56C3E589:58522528256F3M02 }0648256o87<E5674087:E0C7E3A7C51E5P
257C87A522740284580:E6028<0A732P8
l nsw8B8:C8256F3M083C;<5C51E7408;5<08q1E5615E8GH;<065689:5 l t7678258A63768:C806?710?67C78108yw8}064L8B815A522o630
;56C3E587:C51E76878F5<0A3474584587A5220878q1E5615EP8
312E7<76808y3A6020>E8u6?71325P
!"#

$

36

CONHECIMENTOS ESPECFICOS
comando

Central de Segurana do Windows

ls

Ajude a proteger o seu PC


Recursos
Obter as iniformaes mais
recentes sobre segurana e vrus
da Microsoft

cd

Dados Bsicos de Segurana

A Central de Segurana ajuda a gerenciar as configuraes de segurana do Windows. Para ajudar a proteger seu
computador, verifique-se de que os trs elementos bsicos de segurana esto ATIVADOS. Se as configuraes de
se guran a no estiverem ATIVADAS, si ga as recomenda es. Para voltar Central de Se guran a mais tarde, abra o p ainel
de Controle.
O que h de novo no Windows para ajudar a proteger meu computador?

Procurar as atualizaes mais


recentes no Windows Update

ps

chmod



chown
copy

DESATIVADO

set

Obter suporte para problemas


relativos a segurana
Obter ajuda sobre a Central de
Segurana
Alterar o modo de alerta da
Central de Segurana

dir

Obs.: O Windows no detecta todos os firewalls.


Recomendaes...

Atualizaes automticas

attrib

VERIFIQUE AS CONFIGURAES

sistema operacional
Linux
Windows e Linux
Linux
Linux
Linux
Windows e Linux
Windows e Linux
Windows e Linux
Windows

As Atualizaes Automticas esto configuradas para somente instalar atualizaes aps sua confirmao. Clique em
Ativar Atualizaes Automticas para que o Windows automaticamente mantenha seu computador em dia com as
atualizaes mais importantes (recomendado). Como as Atualizaes Automticas ajudam a proteger meu computador?

A tivar Atualizaes Automticas

NO MONITORADO

Proteo contra vrus

Voc nos informou que est usando um programa antivrus que voc m esm o monitorar. Para ajudar a proteger seu
computador contra ameaas de segurana, certifique-se de que seu programa antivrus est ativado e atualizado. Como
programas antivrus ajudam a proteger meu computador?

Re comendaes...

Gerenciar configuraes de segurana para:


Opes da Internet

Firewall do Windows

Atualizaes Automticas

Considerando que a planilha eletrnica mostrada na figura


acima esteja sendo editada no programa Excel, julgue os
itens que se seguem.


A Microsoft tem um compromisso com a sua privacidade. Leia nossa.

Considerando a figura acima, que apresenta a janela da Central de


Segurana sendo executada em um computador com o sistema
operacional Windows XP, julgue os itens seguintes, a respeito de
conceitos de proteo e segurana.




O computador em uso no possui firewall instalado, as


atualizaes do sistema operacional Windows no esto sendo
baixadas do stio da Microsoft e no existe antivrus em
funcionamento.

O firewall do Windows um tipo de aplicativo funcionalmente


similar ao iptables do Linux, no que concerne ao monitoramento
da execuo de aplicativos no computador e filtragem de
pacotes na sada dos adaptadores de rede do computador.

Cada um dos itens de 73 a 75 contm associaes relativas a conceitos


de informtica, hardware, software e sistemas operacionais Windows
e Linux usados no mercado. Julgue se essas associaes esto corretas
com base na tecnologia atual.





tecnologia empregada
em barramento de
computadores
SATA
AGP
IDE
SCSI
PCI
USB
DDR
firewire
dispositivo
computacional
clock de processador
memria secundria
memria primria
registrador
barramento USB
barramento de memria
fast ethernet

UnB/CESPE Banco do Brasil S.A.

Cargo: Escriturrio

Se as clulas C5, C6, C7 e C8 contiverem as instrues


a seguir, ento a soma do contedo das clulas C5, C6,
C7 e C8 ser igual a 132.
em C5: =SOMA(C2:C4)/3
em C6: =MDIA(C2:C4)
em C7: =SOMASE(C2:C4;"<50")/3
em C8: =SE(C7=C6;SE(C5=C6;C6;SOMA(C2:C7)/6)



SOMA(C2:C7)/6)

Se a sequncia de operaes a seguir for realizada na


planilha mostrada, nesse caso, a soma do contedo das
clulas D2, D3 e D4 ser igual a 99.
atribuir o rtulo CLIENTE clula B2;
atribuir a instruo =SE(B2=CLIENTE;C2;0)
clula D2;
copiar, por meio da operao de Copiar e
Colar padronizada, o valor de D2 para as clulas D3
e D4.

4#5%70*1

conceito relativo
a computadores
disco rgido
placa de expanso
disco rgido
disco rgido
placa de expanso
perifrico
memria
perifrico
medida associada
2 giga-hertz
4 giga-bytes
500 giga-bytes
64 bits
500 mega-hertz
500 megabits/segundo
1 gigabit/segundo

Caderno A

37

A figura acima apresenta a configurao de um sistema


computacional em determinado instante de tempo.
No diretrio c:\dir\a\aa, encontram-se os seguintes arquivos:
a1.mp4, a2.mp3, a3.jpg, a4.gif, a5.png, a6.wav, a7.wmv e a8.xls.
Nessa situao, julgue os prximos itens.




Os arquivos contidos no diretrio c:\dir\a\aa so compatveis com


os seguintes usos, respectivamente por ordem de citao:
udio/vdeo digital; udio digital; fotografia digital; figura grfica;
figura grfica; udio digital; udio/vdeo digital; e planilha de
clculo.

Considere que o usurio tenha utilizado o console para digitar um


comando, conforme apresentado na figura a seguir. Nessa
situao, se o comando apresentado nessa figura for efetuado no
momento em que o arquivo a8.xls estiver aberto, essa ao
resultar em uma mensagem de erro e nenhum dos arquivos
contidos no diretrio de origem ser movido para o diretrio de
destino.

Julgue os itens de 80 a 85, relativos a conceitos de aplicativos de


informtica utilizados em ambiente de escritrio.






Microsoft Word e OpenOffice Writer so processadores de texto


do tipo WYSIWYG (what you see is what you get), e ambos so
capazes de associar metadados aos documentos editados por meio
deles, tais como ttulo, assunto, palavras-chave e comentrios
acerca do documento, entre outros.
Entre as funes providas pelos programas Microsoft PowerPoint
e BrOffice Impress, destacam-se a proviso de assistentes para
elaborao de apresentaes em estilos padronizados, a
exportao para formatos HTML, PDF e SVG e a insero de
objetos de vdeo digital.

Ao estabelecer conexo com servidores web, os navegadores, tais


como o Microsoft Internet Explorer e o Mozilla Firefox,
empregam com grande frequncia o protocolo HTTP. Nesse
protocolo, um pedido enviado do navegador para o servidor e,
em seguida, uma resposta enviada do servidor para o cliente.
Essa resposta, usualmente, contm no seu corpo um documento
digital.

UnB/CESPE Banco do Brasil S.A.

Cargo: Escriturrio



Entre os programas para correio eletrnico atualmente


em uso, destacam-se aqueles embasados em software
clientes, como o Microsoft Outlook e o Mozilla
Thunderbird, alm dos servios de webmail. O usurio
de um software cliente precisa conhecer um maior
nmero de detalhes tcnicos acerca da configurao de
software, em comparao aos usurios de webmail.
Esses detalhes so especialmente relativos aos
servidores de entrada e sada de e-mails. POP3 o tipo
de servidor de entrada de e-mails mais comum e possui
como caracterstica o uso frequente da porta 25 para o
provimento de servios sem segurana criptogrfica.
SMTP o tipo de servidor de sada de e-mails de uso
mais comum e possui como caracterstica o uso
frequente da porta 110 para provimento de servios
com segurana criptogrfica.



So exemplos de tecnologias empregadas nas


plataformas Windows e Linux para estabelecimento de
conexes remotas com computadores: Telnet, SSH,
VNC e WTS (Windows Terminal Services), entre
outras. A tecnologia Telnet suportada nas plataformas
Windows e Linux, enquanto a tecnologia WTS no
suportada na plataforma Linux. J a SSH no uma
ferramenta nativa para a plataforma Windows.



Comparativamente educao presencial, as


abordagens de educao a distncia exigem do aprendiz
mais autodisciplina, motivao e esforo para o preparo
dos materiais educacionais. Porm, ambas as
abordagens podem ser realizadas sem uso de
computador, so compatveis com a aprendizagem
continuada e nelas se podem adotar modelos de
conversao e tutorial, entre outros.

Julgue os itens a seguir, acerca do atendimento prioritrio


obrigatrio nas instituies financeiras.


O atendimento prioritrio garantido por lei estende-se,


entre outros, aos maiores de sessenta anos de idade, s
gestantes, aos portadores de necessidades especiais, s
pessoas com criana de colo e aos turistas estrangeiros
oriundos de pases de lngua diversa da lngua
portuguesa.



O atendimento prioritrio regulamentado por lei


compreende tratamento diferenciado e atendimento
imediato.



A permanncia de co-guia no interior de agncia


bancria pode ser licitamente impedida por funcionrio
responsvel, mesmo diante da apresentao da carteira
de vacinao atualizada do animal.
Caderno A

38

A figura acima ilustra uma planilha em elaborao em uma janela do Microsoft Office Excel 2003, relacionando os nmeros de
chamadas recebidas e realizadas por uma empresa fictcia, nos dez primeiros dias do ano de 2004, at onze horas. A respeito dessa
planilha e do Excel 2003, julgue os itens subsequentes.
21

O Excel 2003 permite o modo de exibio de diversas barras de ferramentas que contm diferentes campos e
botes. Na janela acima, os campos ou botes
;
;
e
formatao, de frmulas e padro.

fazem parte, respectivamente, das barras de

22 S possvel encontrar o valor total das chamadas recebidas e realizadas na data/hora, 05/01/2004 11:00 mediante a realizao
da seguinte sequncia de aes: selecionar a clula H6; digitar = B6 + G6; teclar x.

Considerando a figura acima, que ilustra uma janela do Microsoft Outlook 2003 sendo executada, julgue os itens seguintes.
23

Se uma pessoa quiser enviar mensagem a destinatrio especfico com cpia para outros destinatrios, deve considerar que o
Microsoft Outlook no permite que a mensagem seja enviada simultaneamente a terceiros sem que o destinatrio tenha
conhecimento. Em contrapartida, o programa permite a incluso de diversos endereos de e-mail no campo
, que
recebero uma cpia da mesma mensagem com conhecimento do destinatrio.

24

Caso um remetente, usando o Microsoft Outlook, queira enviar uma mensagem a um contato salvo em lista criada por ele, basta
clicar no cone

. A ferramenta encontrar o endereo eletrnico do contato a partir da digitao de seu nome.

UnB/CESPE ANATEL

Conhecimentos Bsicos para os cargos de nvel superior de 1 a 6 e de 11 a 15

www.pciconcursos.com.br

39
Sistema Linux j coisa de gente grande: cresce
a adoo do software nas empresas brasileiras
O Linux, principal concorrente do Microsoft
Windows, j serve de base a um mercado bilionrio no pas
e d suporte a atividades essenciais de gigantes nacionais.
O uso do Linux tranquilo, estvel e confivel.
Alm disso, permite redues de 30% a 40% nos
investimentos em equipamentos. Os terminais no tm disco
rgido e carregam os programas diretamente dos servidores.
Com essa configurao rodando Linux, as redes varejistas
podem usar computadores bem mais simples e baratos
como terminais, reduzindo os custos das mquinas e de sua
manuteno.

Julgue o item abaixo, acerca dos crimes contra a administrao


pblica.
31

Julgue os itens subsequentes, relativos a empresas pblicas e


sociedades de economia mista.
32

Empresas pblicas so pessoas jurdicas de direito privado


criadas mediante autorizao legal, integrantes da administrao
indireta do Estado.

33

Criadas mediante autorizao legal sob a forma de sociedade


annima, as sociedades de economia mista integram a
administrao indireta do Estado.

O Estado de S. Paulo, 13/4/2004 (com adaptaes).

Tendo o texto acima como referncia inicial, julgue os itens


seguintes, a respeito do sistema operacional Linux.
O sistema operacional Linux considerado um software
livre, o que significa que no propriedade exclusiva de
nenhuma empresa e que a seu usurio assegurada a
liberdade de us-lo, manipul-lo e redistribu-lo
ilimitadamente e sem restries.
26 A reduo de gastos com investimentos em
equipamentos, a que se refere o texto, pode ser
relacionada ao fato de o Linux ser um kernel modular, o
que significa que as suas funes de agendamento de
processos, gerenciamento de memria, operaes de
entrada e sada, acesso ao sistema de arquivos entre
outras, so executadas no espao kernel.
25

Com referncia ao funcionamento da Internet e das intranets,


julgue os itens a seguir.
27 O funcionamento da Internet depende de trs camadas
de protocolos base: o protocolo de Internet IP, definidor
de datagramas que carregam dados de um n a outro da
rede; os protocolos TCP, UDP e ICMP, responsveis
pela transmisso de dados; e, na camada final, os
protocolos definidores de mensagens especficas e de
formatos digitais, como os DNS, POP3 e HTTP, entre
outros.
28 Baseada nos padres de comunicao da Internet, uma
intranet pode ser caracterizada como uma rede privada
de computadores, acessvel apenas a membros de uma
mesma organizao. Mesmo assim, sua utilizao requer
componentes bsicos, como sistemas de proteo e
servidores web, sem, no entanto, ser obrigatrio o uso do
protocolo TCP/IP.
Acerca da segurana da informao, julgue os itens a seguir.
Segurana da Informao a proteo contra um grande
nmero de ameaas s informaes, de forma a
assegurar a continuidade dos negcios, minimizando
danos comerciais e maximizando o retorno de
investimentos. Ela pode ser garantida fazendo-se uso de
controles fsicos da informao, de mecanismos de
controle de acesso, como firewalls e proxies, entre
outras medidas.
30 Uma organizao, ao estabelecer seus requisitos de
segurana da informao, deve avaliar riscos, a partir da
vulnerabilidade e da probabilidade de ocorrncia de
eventos de ameaa, sempre obtidas por meio de dados
histricos de incidentes e problemas registrados nos
bancos de dados da central de servios.

29

Governador de estado que, aps responder por ao de


improbidade administrativa perante o Poder Judicirio, for
condenado nas penas de suspenso dos direitos polticos e
indisponibilidade dos bens no responder por crime no mbito
penal.

Com referncia ao processo administrativo na administrao pblica


federal, julgue o item que se segue.
34

No cabe recurso das decises administrativas proferidas pelos


servidores das agncias reguladoras, conforme preceitua a Lei n.
9.784/1999, que regula o processo administrativo no mbito da
administrao pblica federal.

Julgue o item seguinte, referente aos direitos e deveres individuais e


coletivos.
35

Qualquer cidado poder impetrar habeas data no Poder


Judicirio para assegurar o conhecimento de informaes
relativas a sua pessoa disponveis na Agncia Nacional de
Telecomunicaes (ANATEL), independentemente de ter
formulado o pedido diretamente na agncia.

Acerca da Lei Geral de Telecomunicaes (Lei n. 9.472/1997),


julgue o prximo item.
36

O peticionamento pelos usurios de servios de


telecomunicaes para reclamarem seus direitos contra
prestadores de servio perante o rgo regulador no depender
da assistncia de advogado.

Julgue o item seguinte, acerca dos bens pblicos.


37

Considerando que um governador de estado prometa a


construo de uma praa para atividades esportivas para toda a
comunidade de seu estado, correto afirmar que essa praa, to
logo seja construda, ser classificada no direito administrativo
brasileiro como bem de uso especial.

Acerca da responsabilidade civil do Estado, julgue o item que se


segue.
38

A responsabilidade civil do Estado poder ser afastada se


comprovada a culpa exclusiva da vtima, ou mitigada a reparao
na hiptese de concorrncia de culpa.

UnB/CESPE ANATEL

Conhecimentos Bsicos para os cargos de nvel superior de 1 a 6 e de 11 a 15

www.pciconcursos.com.br

40
Figura para as questes de 19 a 22

37'561

Julgue as seguintes propostas de continuidade para o texto.


Por isso, a hostilidade s formas de linguagem de grupos minoritrios
constitui uma forma de preconceito.
II Assim, qualquer verdade reprimida representa uma armadilha de
preconceitos e censuras.
III Portanto, so verdades falsas porque so invisveis.

A figura a seguir mostra uma janela do software Writer,


com um documento em processo de edio.

H continuidade gramaticalmente correta e argumentativamente coerente


para o texto apenas
A
B
C
D

no item I.
no item III.
nos itens I e II.
nos itens II e III.

Texto para as questes de 16 a 18


Considere a configurao de um microcomputador do tipo notebook
apresentada a seguir.
Intel Core Duo 1,6 GHz e 533 MHz FSB;
2 MB L2 cache;
15,4 WXGA LCD;
120 GB HDD;
DVD-RW double layer;
1 GB DDR2, 802.11 a/b/g wireless LAN.
37'561

Com base na configurao apresentada, assinale a opo correta.


A 1,6 GHz indica que o processador possui capacidade de
armazenamento de dados de 1.600 MB.
B Intel Core Duo indica a existncia de memria dupla, o que amplia
a velocidade de processamento das informaes.
C 533 MHz FSB indica a capacidade da memria RAM.
D Intel Core Duo indica que h dois processadores no mesmo chip de
silcio.
37'561

Com referncia ao microcomputador apresentado, assinale a opo


correta.
A 2 MB L2 cache indica a capacidade da memria cache, uma
memria esttica que tem por finalidade aumentar o desempenho do
processador ao realizar busca antecipada na memria RAM.
B A opo L2 significa que possvel instalar dois sistemas
operacionais, como o Linux e o Windows XP.
C A utilizao de dispositivos do tipo pen drive permite ampliar, ainda
que temporariamente, a capacidade da memria ROM do
computador.
D A capacidade do disco rgido, na referida configurao, de 1 GB.
37'561

Ainda com base na configurao apresentada, assinale a opo correta.


A DVD-RW double layer indica que o notebook possui leitora de
DVD dupla face, mas no permite gravao.
B Com a configurao de hardware apresentada, no seria possvel a
instalao do software Linux. Para essa instalao, seria necessrio
ampliar a capacidade de memria.
C O notebook com a configurao apresentada permite acesso a redes
sem fio das tecnologias 802.11 a/b/g wireless LAN.
D 15,4 WXGA LCD indica o modelo e o tamanho da placa-me da
configurao apresentada.

37'561

Com base na figura apresentada, assinale a opo correta.


A O smbolo
, no canto esquerdo do documento
em edio, indica que a imagem mostrada no
documento um hiperlink.
B Para mover a imagem mostrada no documento,
suficiente clic-la no centro e arrast-la para a
posio desejada.
C Para alterar as cores da imagem mostrada no
documento, suficiente clicar a ferramenta
e, na janela disponibilizada, escolher as cores.
D Para alterar a posio da imagem no documento,
suficiente apontar o cursor para a borda da imagem
at que ele se transforme em uma seta de dupla ponta
e arrastar a imagem para a posio desejada.
37'561

Com relao figura mostrada, assinale a opo correta.


A Considerando que o documento em edio tenha um
ttulo com a fonte em letras minsculas, para alter-lo
para letras maisculas suficiente selecion-lo; clicar
a opo Alterar Capitalizao do menu
; e,
posteriormente, na janela disponibilizada, clicar
Maiscula.
B Para criar afastamento direita da imagem em
relao ao texto, suficiente pressionar a tecla
.
C Ao pressionar a tecla

, o texto ser excludo.

D Para formatar o texto com espaamento duplo,


suficiente clicar a ferramenta

UnB/CESPE TRE/GO

Cargo 3: Analista Judicirio rea: Apoio Especializado Especialidade: Arquitetura

w ww.pciconcursos.com.br

.
Caderno D

41
37'561

37'561

Com referncia figura apresentada, assinale a opo correta.

Com base na figura apresentada, assinale a opo correta.

A
B
C
D

A Para inserir bordas duplas na planilha, a sequncia correta de


procedimentos : selecionar a planilha; clicar a opo Clulas

O estilo do texto no documento em edio padro.


O texto est formatado com fonte Arial e est centralizado.
A auto verificao ortogrfica est ativada.
O documento em edio possui duas pginas.

37'561

Considerando que o Microsoft Outlook seja o cliente de e-mail


padro, assinale a opo correspondente sequncia correta de
procedimentos para o envio do documento em edio como
anexo de um e-mail.
A clicar a opo Envelope do menu
, digitar o
endereo eletrnico do destinatrio no campo Para, clicar
Enviar

B clicar a ferramenta
, digitar o endereo eletrnico do
destinatrio no campo Para, clicar Enviar
C clicar a opo Exportar do menu
, digitar o
endereo eletrnico do destinatrio no campo Para, clicar
Enviar

D clicar a ferramenta
, abrir o Microsoft Outlook, digitar
o endereo eletrnico do destinatrio no campo Para, clicar
Enviar

Figura para as questes de 23 a 26


A figura a seguir ilustra uma janela do aplicativo Calc, com uma
planilha em processo de edio.

do menu
; clicar a guia Borda, selecionar estilo
duplo; clicar OK.
B Para alterar o tipo de letra da planilha, suficiente selecion-

la, clicar a opo Fonte do menu


, selecionar o
tipo de fonte desejado, clicar OK.
C Para autoformatar a planilha, suficiente selecion-la, clicar
a ferramenta
, na janela disponibilizada, selecionar
o modelo desejado, clicar OK.
D Para formatar os valores da coluna Valor Unitrio como
moeda, suficiente selecion-los e clicar o boto

37'561

Ainda com relao figura apresentada, assinale a opo correta.


A Para calcular o valor total a ser gasto com a aquisio dos
produtos, suficiente clicar a clula C7, clicar a ferramenta
e pressionar a tecla

B Para calcular o valor Total para o produto Micro, suficiente


clicar a clula D5, digitar a frmula =B5+C5 e pressionar a
tecla

C Para calcular o valor Total para o produto Mesa suficiente


clicar a clula D3, digitar a frmula =B3*C3 e pressionar a
tecla

D Para calcular o valor Total Geral, suficiente calcular o


somatrio da quantidade na clula B7 e multiplicar pelo
resultado do clculo do somatrio dos valores unitrios.
37'561

37'561

Com relao figura apresentada, assinale a opo correta.


A Na situao da janela mostrada, para centralizar o ttulo
Gastos com Material na planilha, suficiente clicar o
boto
.
B Para centralizar os contedos das clulas A2, B2, C2 e D2,
suficiente selecion-las e clicar a ferramenta
.
C Para mesclar as clulas A1, B1, C1 e D1, suficiente
selecion-las e clicar o boto
.
D Na situao da janela mostrada, para mesclar e centralizar o
ttulo da planilha Gastos com Material , suficiente
clicar o boto

Considerando o grfico apresentado na figura, assinale a opo


correta.
A Os valores no eixo horizontal apresentam casas decimais
porque ele foi construdo com base na coluna D.
B Para alterar o tamanho do grfico, suficiente selecion-lo,

clicar a opo Tamanho do menu


, selecionar,
na janela disponibilizada, o tamanho desejado e clicar OK.
C Para dimensionar o grfico com tamanho 50% da pgina,
suficiente clic-lo e selecionar 50 na ferramenta
.

D O grfico foi construdo com base apenas nos valores das


colunas A e B.

UnB/CESPE TRE/GO

Cargo 3: Analista Judicirio rea: Apoio Especializado Especialidade: Arquitetura

w ww.pciconcursos.com.br

Caderno D

42
Figura para as questes 27 e 28
A figura a seguir ilustra uma janela do Internet Explorer 6.0 (IE6), que est em uso para acesso a uma pgina web.

37'561

37'561

Considerando a pesquisa na Internet realizada, assinale a opo


correta.
A Se a pesquisa fosse realizada com o termo tre-go colocado
entre aspas, ento o ltimo dos resultados mostrados na figura
no seria apresentado.
B A pesquisa apresenta o resultado de 30 stios encontrados com
o tema tre-go.
C A partir da figura, correto afirmar que a notcia TRE-GO
cassa dois vereadores de Anpolis, encontra-se no stio do
TRE-GO.
D O terceiro resultado mostrado na figura apresenta a traduo
da pgina oficial do TRE-GO para o idioma ingls.
37'561

Considerando que o Microsoft Outlook seja o cliente padro,


assinale a opo correspondente sequncia correta de
procedimentos para encaminhar, por e-mail, o resultado da
pesquisa.
A clicar a opo e-mail do menu
, digitar, no campo
Para, o endereo eletrnico do destinatrio, clicar Enviar

Acerca do Internet Explorer e do sistema operacional Linux,


assinale a opo correta.
A

Para conectar Internet um microcomputador que tenha

instalado o sistema operacional Linux, necessria a

utilizao de uma placa de rede especfica.

A conexo, Internet, de um microcomputador que possui


o sistema operacional Linux instalado mais lenta quando

comparada com um que tenha instalado o Windows XP.

Se um e-mail for criado a partir de algum aplicativo do

sistema operacional Linux, ele no poder ser lido por


D

destinatrio que usa o Windows XP.

Com o Linux possvel acessar a Internet usando uma rede


sem fio (wireless).

37'561

B clicar a ferramenta
, selecionar a opo Enviar Pgina,
digitar, no campo Para, o endereo eletrnico do destinatrio,
clicar Enviar

Assinale a opo correspondente a caractersticas do sistema

C clicar a ferramenta
, selecionar a opo Enviar Pgina,
digitar, no campo Para, o endereo eletrnico do destinatrio,
clicar Enviar

D clicar o menu
, selecionar a opo e- mail,
digitar, no campo Para, o endereo eletrnico do destinatrio,
clicar Enviar

operacional Linux.

B
D

multitarefa, multiusurio, open source

monotarefa, multiusurio, open source


multitarefa, monousurio, gratuito

monotarefa, monousurio, gratuito

UnB/CESPE TRE/GO

Cargo 3: Analista Judicirio rea: Apoio Especializado Especialidade: Arquitetura

w ww.pciconcursos.com.br

Caderno D

09.09.10

GABARITO DAS PROVAS CESPE/2010

Prof. Belfort

PGINAS

Q
U
E
S
T

E
S

7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
23
24
25
26
27
28
29
30
31
32
33
34
35
36
37
38
39
40
41
42
43
44
45
46
47
48
49
50
51
52
53
54
55
56
57
58
59
60
71
72
73
74
75
76
77
78
79
80
81
82
83
84
85

1 2 3 4 5 6 7 8 9 10 11 12 13 14 15 16 17
C
C
E
X
A
B
E
D
D
D
A
B
B
C
D

18 19 20 21 22 23 24 25 26 27 28 29 30 31 32 33 34 35 36 37 38 39 40 41 42

B
D
A

C
C
E

E
E
C
E
E
C
C

E
C
C
E
E
E
C

E
E
C

C
C
E
E
E
E
E
C

C
C
E
C
E
C
E
E
C

C
E
E
E
E
E
E
C
C
X
E
X
E
E
E
C
E
E
E
A
B
D

C
C
E
E
E
C
C
E
C

C
C
E
E
C
C
E
C
E
C
C
E
C
E
C

E
E
E
C
C
C
C
E
E
C
E
X
E
C
D
A
B
D

X
C
E A X
E D D
E C E
C
A
C
C
C
C
E
X

E
C
E
C
E E
E C
C C
E
E
E
C
C
E
C
E

B
D
E
B
D
B

D
A
C
B
A
C
E
E
E
E
E
E
E
E
E

E
C
C
C
E
C
C
E
C
E

E
C
E
C
C
C
C
E
E
E
E
C
E
C
E
E
E
C
E
E

E
A
D
X

B
C
D
E
C
A

E
E
D
E
E
C
E
E
X
E
C
E
C
E
C
E
C
C

C
B
X
A
C
D
A
C
D
A

;<=
$
.
!
T
V
O
L
P
S
$"
$$
$.
$!
$T
$V
$O
$L
$P
$S
."
.$
..
.!
.T
.V
.O
.L
.P
.S
!"
!$
!.
!!
!T
!V
!O
!L
!P
!S
T"
T$
T.
15:?9
W

!"#$$#$"

T
.

.T

$"+$$
$T

>?4@A?48 *5BA?48

L
T"+T$

.S

!$+!.+!T

L!+LT

$O+$L+$P

$.

&8@8C

VS+O"

VV

."
P

P"

T"
$O
S
$!
."

."+.$

.P
$!+$T

TTUTO

!!
!T .O+.S+!"
V"
VS+O"

..U.T
!OUT"

.S+!"

!!
$!

V"

TL+TP

.VU.L
.P+!"

..

!S+T$

LO+LL
.$+..

$O
L

$L
S
."
P$

T
.

$!

$
"

.!U.O

,?9J

$.

$V

T!

$S+."
.$

L
!

$"

.L
$$

P"

T.
$V
$"
$$U$!

.!

$V

T$

$O

$!

V$

TTUTP
!!

VT

$.

H4K:84
!O+!P
!L+!P
$.

%&'()*+,-*%-+."$"
/0-*12-*+%'&+)**031'

$V

"
"

"
"

DE:84E8: *8=F4?EG? H54@+"! -IJ89+"! %%5KE:+"! H54@+"L -IJ89+"L %%5KE:+"L


!S+T"
!S+T"
!!+!T+!V

$T
$!+$V

VO
VP
TPUV"
!.+!TU!P
!$+!T
VT+VV+VO

$V
!O+!L
TS
$P+.$
!$U!V
.$U.T
!"
$O+.$ $L+$P+..
.T+.V+.S
.OU.P

$O+$P
P.+PV
.L+.P

O$
.V

$S
L$+L.
P.+P!

!V+!LUT"
!L
!!++TS TT+TOUTP TV+TS+V"
$S
$P
$$+$!

.
$

DM;48CC

VT

HKE+L

D-O

D-P
!!U!O++!P
!!+!OU!P

..
S

$S+."

.!

.$

!P+!S

TPUV"
!T+!OU!P+
.O+.S

VL

V$

HKE+N%
!L
!T+!O

.L+.P
.
$

$V

"
"

$!
$T
V.

T.+T!

!"+!.
.L+.P+!"
V$
V.
VL
VP
S

$L
T.

$S

.S
!O
$V

!$+!!+!T
!P
!VU!P
$$+$.
$.
$T
$L
L$+L.+LV
P$ LP+LS+PT

O
.

'-

"
"

.S+!"
.P
$$

.V+.O

$L
LV
PT

!P
$!+$T

."
!"
!$U!T

T$UT!
!$
.P
V!
VL

V!
VL

$$+$.

$$

RKEFI
!L

%456#+789654:

'F:955Q

$V

!O

.!+.T

..
.P
T
.