Anda di halaman 1dari 240

Lenguaje

Ernesto Antonio Esperanza


Evelyn Escobar Quijano
Jos Luis Segovia
Karla Ivonne Mndez
Sandra Micaela Hernndez
Oswaldo Efran Hernndez
Asesoras externas
Amanda de Franco
Celia Morn
Elas Antonio Saca
Presidente de la Repblica
Ana Vilma de Escobar
Vicepresidenta de la Repblica
Darlyn Xiomara Meza
Ministra de Educacin
Jos Luis Guzmn
Viceministro de Educacin
Carlos Benjamn Orozco
Viceministro de Tecnologa
372.19
E49p El Salvador. Ministerio de Educacin (MINED)
Programa de estudio cuarto grado : educacin bsica / Ministerio
de Educacin (MINED) . -- 1a. ed. -- San Salvador. El salvador. :
Ministerio de Educacin (MINED) , 2009 .
240 p. ; 28 cm.
Plan Nacional de Educacin 2021.
ISBN 978-99923-63-01-0
1. Educacin primaria-El Salvador--Programas. 2. Educacin
El Salvador. Ministerio de Educacin (MINED)
Programa de estudio cuarto grado ... 2009
primaria-Planes de estudio. 3. Curriculo. I. Ministerio de Educacin
(MINED). II. Ttulo.
BINA/jmh
Equipos tcnicos
Estudios Sociales
Carlos Benjamn Henrquez
Cristelina Henrquez de Villalta
Rene Alfredo Molina
Matemtica
Bernardo Gustavo Monterrosa
Carlos Alberto Cabrera
Gustavo Antonio Cerros
Jos Elas Coello
Silvio Hernn Benavides
Vilma Caldern Soriano
Ciencia, Salud y Medio Ambiente
Alex Wilfredo Canizlez
Ana Esperanza Elas
Cristabel Dinorah Martnez
Mario Eleazar Alvarenga
Educacin Fsica
Jorge Alberto Marinero
Asesores externos
Martha Estrada
Santos de Jess Lucero
Educacin Artstica
Asesoras externas
Ana Ruth Aragn
Martha Elena Rosales
Martha Eugenia Valle
Norma Carolina Ramrez
Directora General de Educacin
Ana Lorena de Varela
Directora Nacional de Educacin
Manuel Antonio Menjvar
Gerente de Gestin Pedaggica
Rosa Margarita Montalvo
Jefe de Unidad Acadmica
ISBN 978-99923-63-01-0
Copyright Ministerio de Educacin de El Salvador, 2008
Derechos Reservados. Prohibida su venta. Esta publicacin puede ser reproducida en todo o en parte,
reconociendo los derechos del Ministerio de Educacin.
A las maestras y los maestros
En el marco de la implementacin del Plan Nacional de Educacin 2021, tenemos el placer de entregarles
la versin actualizada del Programa de estudio de cuarto grado de Educacin Bsica. Su contenido es
coherente con nuestra orientacin curricular constructivista, humanista y socialmente comprometida; al
mismo tiempo, incorpora la visin de desarrollar competencias, concretando as los planteamientos de la
poltica del currculo al servicio del aprendizaje.
Como parte de esta poltica se ha elaborado una propuesta curricular por competencias. Tambin se han
diseado libros de texto, cuadernos de ejercicios y guas metodolgicas como ayuda a la labor de las
docentes y los docentes en su trabajo diario. Renovamos los lineamientos de evaluacin de los aprendizajes
para hacer coherente la propuesta de competencias con el tipo de evaluacin que necesitamos.
Todos estos instrumentos se entregarn junto con los programas de estudio, a fin de que cuenten con los
recursos necesarios para poner en marcha, con entusiasmo y responsabilidad, esta propuesta.
Este programa reune el aporte de expertos en educacin, especialistas de las diferentes reas y las
experiencias de las maestras y los maestros que, han desarrollado experiencias innovadoras para
mejorar los procesos de enseanza-aprendizaje en cuarto grado.
De todas las recomendaciones y planteamientos formulados enfatizamos, en esta oportunidad, en un
solo aspecto: la importancia de tener altas expectativas en las nias y los nios, comunicarles a ellas,
a ellos y a sus familias que son capaces de aprender y que, con constancia y esfuerzo, podrn alcanzar
grandes metas.
De la misma manera, externamos nuestra confianza en ustedes. Sabemos que leern y analizarn este
programa con una actitud dispuesta a aprender, tomando en cuenta su experiencia y su formacin
docente. Creemos en su compromiso con la misin que nos ha sido dada: que las nias y los nios de
cuarto grado tengan mejores logros de aprendizaje y puedan desarrollarse en forma integral.
Darlyn Xiomara Meza
Ministra de Educacin
Jos Luis Guzmn
Viceministro de Educacin
I Introduccin
Innovacin de los programas de estudio 5
Descripcin grfica del programa 10
II Plan de estudio 12
III Lenguaje
Presentacin de la asignatura 14
Enfoque de la asignatura 14
Competencias a desarrollar 15
Bloques de contenido 15
Objetivos de cuarto grado 22
Lineamientos metodolgicos 22
Lineamientos de evaluacin 25
Unidades 28
IV Matemtica
Presentacin de la asignatura 56
Enfoque de la asignatura 56
Competencias a desarrollar 56
Bloques de contenido 56
Objetivos de cuarto grado 61
Lineamientos metodolgicos 61
Lineamientos de evaluacin 64
Unidades 67
V Ciencia, Salud y Medio Ambiente
Presentacin de la asignatura 110
Enfoque de la asignatura 110
Competencias a desarrollar 110
Bloques de contenido 111
Objetivos de cuarto grado 115
Lineamientos metodolgicos 115
Lineamientos de evaluacin 117
Unidades 121
VI Estudios Sociales
Presentacin de la asignatura 148
Enfoque de la asignatura 148
Competencias a desarrollar 148
Bloques de contenido 148
Objetivos de cuarto grado 154
Lineamientos metodolgicos 154
Lineamientos de evaluacin 156
Unidades 159
VII Educacin Artstica
Presentacin de la asignatura 184
Enfoque de la asignatura 186
Competencias a desarrollar 186
Bloques de contenido 187
Objetivos de cuarto grado 189
Lineamientos metodolgicos 189
Lineamientos de evaluacin 191
Unidades 193
VIII Educacin Fsica
Presentacin de la asignatura 220
Enfoque de la asignatura 220
Competencias a desarrollar 220
Bloques de contenido 221
Objetivos de cuarto grado 224
Lineamientos metodolgicos 224
Lineamientos de evaluacin 226
Unidades 228
NDICE
5
Programa de estudio de cuarto grado
las recomendaciones generales. El programa actual no
presenta actividades sugeridas por unidad didctica.
4. La evaluacin se desarrolla por medio de sugerencias
y criterios aplicables a las funciones de la evaluacin:
diagnstica, formativa y sumativa.
Finalmente, se presentan de manera articulada los objetivos,
contenidos e indicadores de logro por unidad didctica en
cuadros similares a los formatos de planificacin de aula.
Aunque desarrolle los componentes curriculares, el
programa de estudio no resuelve situaciones particulares
de cada aula y cada estudiante, por lo tanto, se debe
desarrollar de manera flexible y contextualizada.
Para implementarlo se debern realizar adecuaciones
curriculares en funcin de las necesidades de las y los
estudiantes y las condiciones del contexto. Esta flexibilidad
es posible gracias al Proyecto Curricular de Centro (PCC)
1
,
en el que se registran los acuerdos que han tomado las y
los docentes de un centro escolar sobre los componentes
curriculares (objetivos, contenidos, metodologa, evaluacin),
a partir de los resultados acadmicos del alumnado, de la
visin, la misin y el diagnstico del centro escolar escrito
en su Proyecto Educativo Institucional (PEI).
Las y los maestros debern considerar los acuerdos
pedaggicos del PCC y la propuesta de los programas de
estudio como insumos clave para su planificacin didctica.
Ambos instrumentos son complementarios.
Innovacin de los programas de estudio
La experiencia de trabajar con los programas de estudio
de anterior vigencia es sin duda el primer referente para
implementar esta propuesta curricular. Sin embargo, es
I. Introduccin del programa de estudio
de cuarto grado
El programa de estudio de cuarto grado de Educacin
Bsica presenta una propuesta curricular que responde a
las interrogantes que las maestras y los maestros deben
responderse para poder planificar sus clases.
Estas interrogantes se contestan por medio de los
componentes curriculares:
Los programas de estudio estn diseados a partir de estos
componentes curriculares. Tienen la siguiente estructura:
1. Descripcin de las competencias y el enfoque que orienta
el desarrollo de cada asignatura.
2. Presentacin de los bloques de contenido que responden
a los objetivos de la asignatura y permiten estructurar las
unidades didcticas.
3. El componente de metodologa ofrece recomendaciones
especficas que perfilan secuencias didcticas por
asignatura. Describiendo fases o etapas en orden
lgico en funcin de aprendizajes de competencias y
1 Para mayor informacin, leer el apartado sobre Proyecto Curricular de Centro en el documento
Currculo al servicio del aprendizaje. Ministerio de Educacin, San Salvador, 2007.
INTERROGANTES COMPONENTES CURRICULARES
Competencias/Objetivos
Para qu ensear?
Contenidos
Qu deben aprender las
nias y los nios?
Orientaciones sobre metodologa Cmo ensear?
t di d ti d t
Orientaciones sobre evaluacin
Indicadores de logro
L d t di
Cmo, cundo y
qu evaluar?
6
Programa de estudio de cuarto grado
Tres tipos de contenidos:
conceptuales, procedimentales y actitudinales
La relevancia de los contenidos se debe a su contribucin
al logro de los objetivos y, por lo tanto, de las competencias.
El autor espaol Antoni Zabala
3
define los contenidos de la
siguiente manera:
Conjunto de habilidades, actitudes y conocimientos
necesarios para el desarrollo de las competencias.
Se pueden agrupar en tres grandes grupos segn estn
relacionados con el saber, saber hacer o el ser, es decir,
los contenidos conceptuales (hechos, conceptos y sistemas
conceptuales), los contenidos procedimentales (habilidades,
tcnicas, mtodos, estrategias, etc.) y los contenidos
actitudinales (actitudes, normas y valores).
Los contenidos conceptuales, procedimentales y actitudinales
tienen la misma relevancia, ya que solo integrados reflejan
la importancia y la articulacin del saber, saber hacer,
saber ser y convivir. El desafo es superar la tendencia de
ensear nicamente informacin, es decir, aprendizajes
memorsticos. Estos tienen su espacio y su importancia; sin
embargo, es necesario insistir en superar la concepcin del
aprendizaje memorstico como un sinnimo de aprendizaje
exitoso. El aprendizaje implica la articulacin de los tres
tipos de contenido.
En el cuarto grado, al igual que en los grados anteriores, se
utiliza, en algunos casos, la palabra nocin para precisar
un contenido en la categora de contenidos conceptuales.
Las nociones refieren el conocimiento de las cosas por
medio de los sentidos (la experiencia). Resultan de comparar
objetos, hechos o fenmenos para abstraer los elementos
comunes que servirn para continuar estableciendo futuras
comparaciones. Estas comparaciones son elementales, es
necesario advertir que algunos aspectos de los componentes
curriculares estn presentados de diferente manera, o
bien, orientados hacia un nfasis nuevo. A continuacin se
detallan los cambios ms importantes.
2
Objetivos
Se presentan los objetivos de grado por cada asignatura y
luego en cada unidad didctica.
Los objetivos estn estructurados en funcin del logro de
competencias, por ello se formulan con un verbo que orienta
una accin. As se introduce la expectativa o meta a partir
de procedimientos. Posteriormente se enuncian tambin
conceptos y actitudes como parte del objetivo para articular
los tres tipos de saberes. Al final se expresa el para qu o
finalidad del aprendizaje, lo que conecta los contenidos con
la vida y las necesidades del alumnado.
Contenidos
Presentacin de bloques de contenido
El programa de estudio presenta y describe los bloques
de contenido de cada asignatura. Con ello se propicia
mayor comprensin de la asignatura a partir de sus
fuentes disciplinares. El reconocimiento de la importancia
y la relacin entre los contenidos fortalece el desarrollo
curricular de las asignaturas.
En cada asignatura se ha buscado mayor integracin entre
los contenidos de los diferentes bloques, articulndolos
en funcin de las necesidades e intereses del alumnado.
Este esfuerzo ha requerido de una nueva organizacin
de las unidades didcticas, las cuales se presentan
comparativamente con relacin a las unidades didcticas
del programa de estudio anterior.
3 Marco Curricular. Antoni Zabala. Documento de referencia de consultora para el
Ministerio de Educacin, pgina 21
2 Ministerio de Educacin. (2007). Currculo al servicio del aprendizaje. San Salvador
7
Programa de estudio de cuarto grado
Por lo tanto, no debern confundirse con metodologa,
ya que aunque tienen puntos en comn, los contenidos
procedimentales se deben aprender desarrollando una
progresiva destreza en su aplicacin, y la metodologa
es la forma, el proceso para aprender cualquier tipo de
contenido.
Los contenidos actitudinales debern planificarse igual que
los otros contenidos, tienen la misma importancia que los
conceptuales y los procedimentales ya que las personas
competentes tienen conocimientos y los aplican con
determinadas actitudes y valores.
Secuenciacin de contenidos
La secuencia de contenidos presentada en los programas
de estudio es una propuesta orientadora para ordenar el
desarrollo de los contenidos, pero no es rgida. Es importante
sealar que est fundamentada a partir de los principios
de las disciplinas, principios de psicologa del desarrollo, la
secuencia de enseanza, etc. Por lo tanto su modificacin
debe ser analizada en forma cuidadosa.
Cuando se incluyan contenidos de grados superiores en
grados inferiores, o viceversa, deber haber un acuerdo
en el Proyecto Curricular de Centro que lo respalde.
Por ejemplo, si las nias y los nios de un centro escolar
llegan a quinto grado con competencias lingsticas
avanzadas en relacin a la propuesta del programa de
estudio, se deber realizar una evaluacin diagnstica y
posteriormente hacer adecuaciones a los contenidos para
atender el avance que presentan.
En algunas materias como Matemtica o Lenguaje se
suele cometer el error de adelantar contenidos de grados
superiores, considerando que es conveniente para las nias
y los nios, aunque los programas de estudio los presentan
decir, vinculadas a la percepcin (sentidos) y a la accin.
Por ejemplo: nocin de equilibrio y desequilibrio personal
(Educacin Fsica), nocin de alimento y golosina (Ciencia,
Salud y Medio Ambiente), nocin de espacio (Estudios
Sociales), nocin de peso y capacidad (Matemtica),
nocin de adverbios de tiempo o de modo (Lenguaje). Con
ello, se pretende sealar un saber menos estructurado que
un concepto.
La importancia de las nociones es que son la base para
estructurar conceptos. Al presentarse en el programa de
estudio, la docente y el docente tendr como expectativa
de logro una idea muy elemental o poco estructurada
sobre el contenido. Seguramente habr una aplicacin
importante de la nocin en los contenidos procedimentales
y actitudinales.
Tambin merecen especial mencin los contenidos
procedimentales por el riesgo de que se entiendan como
metodologa. Csar Coll los define de la siguiente manera:
4
Se trata siempre de determinadas y concretas formas de
actuar, cuya principal caracterstica es que no se realizan de
forma desordenada o arbitraria, sino de manera sistemtica
y ordenada, unos pasos despus de otros, y que dicha
actuacin se orienta hacia la consecucin de una meta.
Los contenidos procedimentales no son nuevos en el
currculo, ya que la dimensin prctica o de aplicacin
de los conceptos se ha venido potenciando desde hace
varias dcadas. Sin embargo se ha denominado tcnicas,
habilidades, estrategias, algoritmos, etc. Al darles la
categora de contenidos, los procedimientos quedan
sujetos a planificacin y control, igual como se preparan
adecuadamente las actividades para asegurar la
adquisicin de los otros tipos de contenidos
5
.
4 Coll, C. y otros. (1992). Los contenidos en la reforma; Enseanza y aprendizaje de
conceptos, procedimientos y actitudes. Editorial Santillana, Aula XXI, pg 85.
5 Ibid pag 103
8
Programa de estudio de cuarto grado
para grados superiores. Los resultados reflejan poca o difcil
comprensin (puede haber memorizacin), deficiencia en
el aprendizaje de procedimientos, sensacin de fracaso y
aversin a la asignatura por parte del alumnado.
Los programas actuales presentan una secuencia de
contenidos detallada para que las maestras y los maestros
tengan claridad y tomen las mejores decisiones para sus
alumnas y alumnos.
Organizacin de objetivos y contenidos en
unidades didcticas
Las unidades didcticas se presentan en cuadros que
permiten apreciar de manera conjunta los objetivos,
los tres tipos de contenidos y los indicadores de logro de
cada grado.
Se han organizado los contenidos en unidades didcticas
ms pequeas e interdisciplinares. Esto permite combinar
bloques de contenido y lograr mayor interdisciplinariedad.
Unidades de menor duracin contribuyen a comunicar ms
variedad de situaciones, propiciando mayor motivacin en
el aprendizaje. Adems, hay ms posibilidades de asignarle
el tiempo necesario al refuerzo acadmico, prctica que
persigue dar un tratamiento oportuno a las y los estudiantes
que no alcanzan ni el nivel bajo esperado en los logros de
cada trimestre. Con unidades ms pequeas, la tarea de
saber a quin debo dedicarle ms tiempo es posible. En
las asignaturas Educacin Fsica y Educacin Artstica, se
mantienen tres unidades debido a la cantidad de contenidos
posibles a desarrollar en las horas de que disponen en el
plan de estudio.
Lineamientos metodolgicos
En el aspecto metodolgico, se ha eliminado el apartado
con la propuesta de actividades. Esto se debe a que se han
diseado guas metodolgicas, libros de texto y cuadernos
de ejercicios completamente articulados con el currculo
actualizado. Por lo tanto, es posible prescindir de la
propuesta de actividades en los programas de estudio.
Se ha incorporado un apartado con lineamientos
metodolgicos que describe una propuesta de secuencia
didctica que responde al enfoque de cada asignatura. Esta
puede ser mejorada por las y los docentes para ofrecer a
las nias y los nios clases que faciliten el aprendizaje en
funcin de competencias.
Lineamientos de evaluacin
Una de las innovaciones ms evidentes es la inclusin
de indicadores de logro
6
. Los indicadores de logro son
evidencias del desempeo esperado en relacin con
los objetivos y contenidos de cada unidad. Su utilizacin
para la evaluacin de los aprendizajes es muy importante
debido a que sealan los desempeos que debe evidenciar
el alumnado y que deben considerarse en las actividades
de evaluacin y de refuerzo acadmico. Las unidades
didcticas se presentan en cuadros que permiten ver de
manera conjunta los objetivos, los tres tipos de contenidos y
los indicadores de logro de cada grado.
Se debe recordar que la meta que se busca est reflejada
en los objetivos; los indicadores de logro son desempeos
que demuestran su logro. Las y los docentes deben
comprender el desempeo descrito en el indicador y
hacer las adecuaciones que sean necesarias para atender
las diversas necesidades del alumnado. Sin embargo,
6 Para mayor informacin, leer el documento Evaluacin al servicio de los aprendizajes.
Ministerio de Educacin, San Salvador, 2007
9
Programa de estudio de cuarto grado
modificar un indicador implica un replanteamiento en los
contenidos (conceptuales, procedimentales y actitudinales),
por lo tanto, se recomienda discutirlo con otros colegas del
centro y la directora o el director, y acordarlo en el Proyecto
Curricular de Centro.
Se ha resaltado con letra negrita los indicadores ms
relevantes o abarcadores del trimestre. Se recomienda
tomarlos como referente importante para las actividades
de evaluacin que se reportan en los cuadros de registro y
para programar refuerzo acadmico.
El programa de estudio presenta los indicadores de
logro numerados de acuerdo a un orden correlativo por
cada unidad didctica. Por ejemplo, 2.1 indica que el
indicador 1 de la unidad 2, y que el nmero 3.5 indica que
es el quinto indicador de la unidad 3. Esta enumeracin
facilitar su referencia en el cuadro de registro de
evaluacin sumativa.
Refuerzo acadmico
Se insiste en utilizar los resultados de la evaluacin para
apoyar los aprendizajes de las nias y los nios. Por lo tanto,
los indicadores de logro debern orientar al docente para
prevenir la desercin y la repeticin:
Al describir los desempeos bsicos que se esperan lograr
en un grado especfico, los indicadores de logro permiten
reconocer la calidad de lo aprendido, el modo como se
aprendi y las dificultades que enfrentaron las estudiantes
y los estudiantes. As, se puede profundizar sobre las causas
que dificultan el aprendizaje, partiendo de que muchas
veces no es descuido o incapacidad del alumnado.
7
El seguimiento constante descrito en los indicadores
significa ofrecer refuerzo acadmico oportuno a las nias
y los nios que lo requieran, y hacer adecuaciones para
atender la diversidad.
7 Evaluacin al servicio del aprendizaje. Ministerio de Educacin, 2007
Programa de estudio de cuarto grado
10
Descripcin grfica del programa
El grado, nmero y nombre de unidad: describe los datos
generales de la unidad.
Tiempo asignado para la unidad: contiene el nmero de
horas asignadas a esa unidad.
Objetivos de unidad: lo que se espera que alcancen las
alumnas y los alumnos.
Contenidos conceptuales, procedimentales y
actitudinales: incluyen los conceptos, procedimientos y
actitudes que las nias y los nios deben adquirir como
parte del proceso de enseanza-aprendizaje.
Los indicadores de logro evidencian si el alumnado ha
alcanzado los objetivos.
Los indicadores de logro priorizados: se refieren a los
principales o ms relevantes logros que se pretende
alcanzar en las estudiantes y los estudiantes. Estn
destacados en negrita y son claves para la evaluacin
formativa y/o sumativa.
11
Programa de estudio de cuarto grado
28
Proqromo oo oslooio oo coorlo qrooo
COMCEFTUALE5 FkOCEDMEMTALE5 ACTTUDMALE5
Co|olivos
NlD/D 1
1.1 Expreso, con esmero,
diferencios entre el
lenguo[e orol y escrito.
1 Esmoro ol roconocor
los oioroncios onlro ol
lonqoo|o orol y ol oscrilo.
Dioronciocin onlro
ol lonqoo|o orol y ol
lonqoo|o oscrilo, o lrovos
ool conocimionlo oo sos
coroclorislicos rinciolos.
El lonqoo|o orol y oscrilo.
Tiomo roooolo. boros closo
(MJIVIRGMEVIPPIRKYENISVEPHIPIWGVMXSQIHMERXIPEMHIRXMJMGEGMzRHIWYWGEVEGXIVuWXMGEW
TVMRGMTEPIWPETEVXMGMTEGMzRIRHMjPSKSWSVEPIW]PEIPEFSVEGMzRHIHMjPSKSWIWGVMXSWEJMR
HIQINSVEVIPYWSHIPPIRKYENIIRPEGSQYRMGEGMzR
-HIRXMJMGEVPEWTEVXIW]IPIQIRXSWTVMRGMTEPIWHIPSWPMFVSW]HIPHMGGMSREVMSEJMRHI
LEGIVYRYWSEHIGYEHS]IJMGE^HIqWXSWEPFYWGEVMRJSVQEGMzRTEVEXEVIEWIWGSPEVIWS
VIWSPYGMzRHIHYHEWHIPEZMHEGSXMHMERE
MO5 COMUMCAMO5
COMCEFTUALE5 FkOCEDMEMTALE5 ACTTUDMALE5
COMTEMDO5 MDCADOkE5 DE LOGkO
1.2 nterviene, con
espontoneidod,
en dilogos oroles.
1.3 Roolizo, con oloncin, lo locloro
oxrosivo oo oiloqos oscrilos.
El oiloqo orol y oscrilo. lnlorvoncin on oiloqos
orolos [convorsocionos},
lonionoo on coonlo lo
corroclo rononciocin
y lo onlonocin.
Locloro oxrosivo oo
oiloqos oscrilos.
1.
1.
Esonlonoiooo ol inlorvonir
on oiloqos orolos.
/loncin ol roolizor
locloro oxrosivo oo
oiloqos oscrilos.
Objetivos de la unidad
Contenidos procedimentales
a desarrollar
Contenidos actitudinales
a desarrollar
Contenidos conceptuales
a desarrollar
Indicadores de
logro numerados
Indicadores de
logro priorizados
Tiempo probable para la unidad Ti Grado, nmero y nombre de la unidad
12
Programa de estudio de cuarto grado
II. Plan de estudio de segundo ciclo
A partir de las cuarenta semanas laborales, el plan de estudio
de cuarto grado se organiza en seis asignaturas con carga
horaria definida. El nico cambio en el plan de estudio es
el incremento de una hora en la asignatura Matemtica,
que tendr cinco horas semanales y la supresin de una
hora para el desarrollo curricular de Educacin Fsica que
contar con tres horas semanales.
La asignatura de Educacin Moral y Cvica no cuenta
con carga horaria definida, debido a la coincidencia en
contenidos y objetivos con Estudios Sociales. Se recomienda
acordar los aspectos especficos para su desarrollo
en el Proyecto Curricular de Centro, en funcin de las
necesidades del diagnstico y de la organizacin escolar.
Se recomienda buscar relaciones entre los contenidos de
todas las asignaturas para organizar procesos integrados
de aprendizaje. Los ejes transversales son contenidos
bsicos quedeben incluirse oportunamente en el desarrollo
del plan de estudio.
Contribuyen a la formacin integral del educando ya que
a travs de ellos se consolida una sociedad democrtica
impregnada de valores, de respeto a la persona y a la
naturaleza, constituyndose en orientaciones educativas
concretas a problemas y aspiraciones especficos
del pas
8
.
Los ejes transversales que el currculo salvadoreo
presenta son:
Educacin en derechos humanos
Educacin ambiental
Educacin en poblacin
Educacin preventiva integral
Educacin para la igualdad de oportunidades
Educacin para la salud
Educacin del consumidor
Educacin en valores
8 Fundamentos Curriculares de la Educacin Nacional. Ministerio de Educacin, pg.
115-116. El Salvador, 1999.

ASIGNATURA
Lenguaje
Matemtica
Ciencia Salud y Medio Ambiente
Estudios Sociales
Educacin Artstica
Educacin Fsica
Total
Grados y
horas semanales
Nmero de horas
anuales por grado
4
o
5
o
6
o
4
o
5
o
6
5

5

5
5

5

5
5

5

5
4

4

4
3

3

3
3

3

3
25

25

25
200

200

200
200

200

200
200

200

200
160

160

160
120

120

120
120

120

120
1000

1000

1000
LENGUAJE
14
Programa de estudio de cuarto grado
Esta propuesta seala el aprendizaje de la gramtica y la
ortografa desde su utilidad en la vida cotidiana. Por lo tanto,
se estudian a partir de textos producidos en situaciones de
la comunicacin oral o escrita.
Enfoque de la asignatura: comunicativo
El enfoque tiene como meta que los estudiantes aprendan a
comunicarse de forma oral y escrita con eficacia y eficiencia
en una variedad de situaciones comunicativas.
En consecuencia, la pertinencia de los contenidos
programticos se determinan desde la necesidad de
utilizarlos en la vida cotidiana.
Incluye no solo los conocimientos gramaticales, sino
tambin los que se basan en los significados y el sentido
derivado del contexto y la situacin comunicativa.
Adems, es preciso recalcar que el uso de la lengua
a un contexto determinado, una finalidad particular y a un
destinatario especfico.
Los relatos de experiencias, las cartas, las instrucciones de
juego o de uso de un aparato, las descripciones, etc., son el
punto de partida de la enseanza.
Desde el enfoque comunicativo, los objetivos de la
asignatura se orientan a que el estudiante sea capaz de
saludar, comunicarse en una tienda, de escribir una nota, dar
un recado en forma correcta, leer un anuncio y entenderlo,
etc. En otras palabras, la asignatura pretende el desarrollo
de las competencias orales y escritas de los estudiantes,
quienes utilizan el cdigo con finalidades comunicativas.
Presentacin de la asignatura
El programa de Lenguaje para cuarto grado se enfoca
en el desarrollo de las capacidades que el y la estudiante
necesitan para comunicarse. El dominio de estas
capacidades suponen aprender conceptos, dominar
procedimientos y adoptar actitudes de manera integrada.
Esta articulacin garantiza la adquisicin de las
competencias esperadas.
Para ello, se privilegian los contenidos que amplan
las habilidades de comprensin y expresin tanto oral
como escrita (leer, hablar, escuchar y escribir) que
permiten a las nias y los nios relacionarse
eficientemente con los dems.
Con este propsito, el Ministerio de Educacin ha definido
cuatro competencias bsicas para esta asignatura:
expresin oral, expresin escrita, comprensin lectora y
comprensin oral.
De aqu la necesidad de orientar los aprendizajes
hacia el logro de estas competencias. El dominio de
estashabilidades es un aprendizaje que dura toda la
vida y que implica un trabajo arduo, sostenido y gradual,
que va construyendo al utilizar el lenguaje en situaciones
reales de comunicacin.
El programa promueve el uso de la lengua para
relacionarse con las y los compaeros, los docentes, los
padres de familia, los miembros de la comunidad y otros.
En el segundo ciclo se propicia la lectura de diferentes tipos
de textos, necesarios para la comunicacin cotidiana y
literaria: textos informativos, descriptivos, narrativos, textos
de tradicin oral, textos argumentativos, textos dramticos y
poticos; textos instruccionales y textos icono-verbales.
15
Programa de estudio de cuarto grado
Bloques de contenido
Tipologa textual:
Se entiende por texto cualquier manifestacin oral o escrita con
significado, que se produzca en una comunicacin. Por tanto, son
textos los escritos de literatura, las redacciones de los alumnos,
las exposiciones del profesor de lengua y de matemticas, los
dilogos, las noticias, los afiches.
Los textos pueden ser orales o escritos, literarios o no
(Cassany, Daniel).
Es importante destacar que la intencin del bloque no es
mostrar una tipologa textual, sino enfocar el estudio de los
textos a partir de los criterios de funcin y estructura.
En el segundo ciclo se contina con los diversos tipos de
texto estudiados en el primero, sin embargo, se muestran
algunos de ellos con un mayor nivel de profundizacin:
los narrativos, incluyendo diferentes tipos de cuento y la
novela, los poticos, incorporando figuras literarias, los
textos teatrales y los textos argumentativos y explicativos o
de informacin cientfica.
Comunicacin oral y escrita:
a. Estrategias de comprensin y expresin oral
En este bloque de contenidos se agrupa una variedad de
aspectos relacionados tambin con la compleja actividad
de la comunicacin humana. Nos referimos a prcticas
discursivas orales, que contribuyen a la comprensin y a la
produccin de una variedad de textos funcionales (de uso
cotidiano, acadmico y formal).
Aqu se evidencia el uso de la lengua, es decir, se manifiestan
aquellos contenidos que promueven el desarrollo de
habilidades para una comprensin de los textos orales,
Competencias
Las competencias definidas por el MINED para la asignatura
de Lenguaje son las siguientes:
a. Comprensin oral. Es la capacidad de utilizar todo tipo
de recursos para comprender informacin oral, que
se presenta con distintos propsitos y en diferentes
situaciones comunicativas.
b. Expresin oral. Esta competencia, al igual que
la comprensin oral, se enmarca en situaciones
comunicativas, en las cuales el educando expresa de
forma oral sus deseos, intereses, experiencias, ideas,
entre otros, con un propsito determinado.
c. Compresin lectora. Esta competencia implica la
comprensin y la construccin del sentido de textos
escritos. En este proceso el lector se ve enfrentado a
una situacin comunicativa en la que pone en juego sus
conocimientos y estrategias cognitivas y metacognitivas,
pues su interlocutor no puede ser interrogado de manera
directa, sino a travs de las pistas y convenciones que
estructuran los diferentes tipos de texto.
d. Expresin escrita. Esta capacidad permite establecer
comunicacin por medio de la escritura. Al igual que
las otras competencias, implica adecuarse al contexto
comunicativo, al lector (destinatario). Escribir no
solo requiere el conocimiento del cdigo (sistema de
escritura) sino tambin del uso de estrategias, tcnicas y
principios convencionales, que implican saber planificar
un discurso, y construirlo con adecuacin, coherencia y
cohesin textual.
16
Programa de estudio de cuarto grado
d. Nivel de comprensin crtica
Se orienta para que se emitan juicios valorativos acerca
del texto a partir de la comprensin literal. En otras
palabras, se pretende que contrapongan lo expresado
en el texto con sus propios criterios.
e. Nivel de comprensin creadora
Este nivel consiste en dar sus aportaciones y hacer
propuestas a partir de lo que se lee. Las posibilidades
de creacin son infinitas y diversas: pueden ir desde
reescritura, escritura a partir de modelos o la produccin
escrita totalmente nueva.
Como segundo punto, la produccin escrita como eje
importante para el desarrollo de las competencias
comunicativas tiene gran valor en este ciclo. Por ello, se
promueve que la produccin escrita est encaminada
en dos direcciones: hacia los textos de uso cotidiano y
funcional y hacia los textos literarios, con la seguridad
de que cada uno de ellos tiene diferentes finalidades y
desarrolla diferentes habilidades.
as como la adecuacin del lenguaje, del tono de voz, del
vocabulario, etc. cuando se est en determinada situacin
comunicativa y que responde a un contexto en particular.
Se incluyen contenidos vinculados a diferentes formas de
expresin oral, como debates y exposiciones, entre otros.
b. Estrategias de comprensin y produccin de textos
Presenta el aprendizaje de tcnicas y estrategias que
ayuden al estudiante a comprender los textos que lee;
asimismo, a producir textos escritos con base en modelos
y procedimientos que ordenen el pensamiento a partir de
una situacin comunicativa.
En primera instancia, la comprensin de textos se aborda a
partir de cinco niveles de comprensin lectora:
a. Nivel de comprensin apreciativa
Consiste en expresar las impresiones personales sobre
el texto, lo cual permite saber el grado de impacto del
sentido esttico; es decir, se trata de motivar la sensibilidad
de los nios y las nias.
b. Nivel de comprensin literal
En este nivel, la persona lectora se da cuenta de las
ideas explcitas del texto. El o la docente busca verificar
que se haya comprendido el mensaje tal como se expresa
en el texto.
c. Nivel de comprensin inferencial
Se trabaja sobre lo que se encuentra implcito en el
texto para que nios o nias puedan hacer sus propias
deducciones. La construccin de sus conjeturas o
hiptesis tiene como base su propia experiencia.
Textos no literarios
Textos literarios
(Con intencin literaria)
Hacer de la escritura
un hbito.
Animar a la creacin escrita.
Alternar actividades de
lectura y escritura.
Desarrollar la imaginacin.
Experimentar con la
produccin de libros.
Comprender el lenguaje literario.
17
Programa de estudio de cuarto grado
contenido. En otras palabras, los diversos tipos de textos
literarios (cuentos, poemas, leyendas, rondas, canciones,
adivinanzas, trabalenguas y otros) se convierten en el
punto de partida para el desarrollo de las competencias
lingsticas, para el desarrollo de nociones gramaticales
y para el ejercicio de la escritura creativa, en sus
diferentes formas.
3. Conocer algunos elementos bsicos del lenguaje literario
y de la estructura textual que permiten que la lectura
sea de manera comprensiva, al mismo tiempo que
los estudiantes van desarrollando en forma gradual,
habilidades bsicas que les permitan la construccin
del sentido de lo que leen a partir de sus experiencias
personales y lectoras.
Por esta ltima razn, en este ciclo se incluye en algunas
unidades el canon literario bsico. Su inclusin obedece a
la intencin de proporcionar un canon mnimo de lecturas
completas que respondan al desarrollo formativo del
estudiante en cuanto a los saberes necesarios para el logro
de la competencia literaria.
La seleccin de las muestras responde a criterios especficos
como los siguientes:
a. Valor representativo de la poca o movimiento literario.
b. Valor representativo de los esquemas discursivos.
c. Valor representativo cultural, por cuanto modelan la
realidad en un tiempo y espacio determinados.
d. Valor esttico, vinculado con la capacidad del texto para
generar una disposicin afectiva-emotiva del alumno.
e. Valor didctico que se establece, en primer lugar, por ser
una muestra autntica de arte universal, y, en segundo
Reflexin sobre la lengua
Este bloque de contenidos est orientado al estudio de
la lengua como sistema de comunicacin. El anlisis
morfolgico, sintctico, semntico y textual, as como el
empleo de las diversas estructuras del idioma, de acuerdo
con la norma gramatical, constituyen el objeto de aprendizaje
en esta parte muy significativa del programa.
En este bloque se ha incorporado la gramtica del texto,
tambin conocida como lingstica textual, ya que es
imperioso que el alumno aprenda a generar discursos
cuidando el uso pertinente de todas sus propiedades, como
la cohesin, la coherencia, la adecuacin y la correccin.
Comunicacin literaria
Se entiende como un acercamiento vivencial a la literatura
infantil - juvenil que tiene principalmente tres propsitos:
1. Despertar el gusto esttico y la aficin por la lectura de
textos literarios. Esto se consigue con hbitos de lectura y
con el contacto continuo con diferentes textos.
2. Utilizar los textos literarios con una finalidad didctica; es
decir, aprovechar la diversidad lingstica que aparece
en ellos para relacionarlos con los otros bloques de
R fl i b l l
Desarrollar los diferentes
momentos en la produccin
de un texto: planificacin,
escritura, revisin y edicin. 3
Descubrir significados e interpretar
el sentido de los textos.
Desarrollar una forma
personal de expresin.
Relacionar textos con otros
significativos (los que el nio
conoce).
18
Programa de estudio de cuarto grado
nmero de contenidos, sino una reestructuracin alrededor
de ejes que le otorgan mayor sentido al proceso, en funcin
de criterios pedaggicos sobre la enseanza y aprendizaje
de los contenidos.
A continuacin, se presentan las razones ms relevantes
de la nueva estructuracin de unidades. Una estructura
curricular con unidades ms cortas facilita el seguimiento
del aprendizaje de los contenidos y la planificacin de
ms periodos de retroalimentacin al inicio y al final de
cada unidad.
Un mayor nmero de unidades permite definir ms
ejes temticos que articulan los contenidos a partir de
experiencias, necesidades e intereses de las nias y
los nios. As, se inicia el programa con la unidad: Nos
comunicamos, que sita los contenidos alrededor de las
experiencias comunicativas que suelen suceder al inicio
del ao escolar, incluyendo las normas de convivencia y las
frmulas sociales de tratamiento que ayudan a establecer
buenas relaciones de interaccin y de trabajo en el aula.
La segmentacin en unidades ms cortas evidencia de
mejor manera la integracin de los diferentes bloques
de contenido de forma ms ordenada y armnica.
Por ejemplo, la literatura est articulada con las
estrategias de comprensin y produccin oral y escrita,
con la reflexin sobre la lengua y los dems bloques.
lugar, por su carcter diversificado (debido a la ubicacin
espacio-temporal, la pertenencia a corrientes artsticas
diversas, y a sus diferentes grados de facilidad o dificultad
lectora).
f. Valor comunicativo, porque muestran todas las
virtualidades presentes en una situacin comunicativa
real o imaginaria.
Los textos mencionados en el programa son lecturas
obligatorias mnimas, las cuales debern ser completas
y autnticas, lo que implica no hacerlas con muestras
que hayan sido adaptadas. Los docentes de aula pueden
ampliar este canon, si cuentan con los factores favorables
para ello, introduciendo lecturas completas de otras obras
representativas, segn lo crean conveniente. Tambin
la lectura deber incluirse como parte del desarrollo de
contenidos, para ello los docentes buscarn en qu unidad
es factible la lectura y anlisis de estas obras.
a. Los libros establecidos para cuarto grado son:
1. Fbulas (Esopo, Samaniego)
2. Sol de Cario (Antologa potica Maura Echeverra)
3. El libro de la Selva (Rudyard Kipling)
4. El prncipe feliz (scar Wilde)
5. Platero y yo (Juan Ramn Jimnez)
Relacin entre bloques de contenido y las
unidades didcticas
El programa de estudio de cuarto grado se ha estructurado
en nueve unidades didcticas. Tener mayor nmero de
unidades no supone un incremento significativo en el
19
Programa de estudio de cuarto grado
En esta unidad, se estudia la estructura y
los elementosde diferentes textos narrativos
con la intencin de que las y los estudiantes
no solamente los lean, sino tambin los
produzcan. Se estudian adems aspectos
gramaticales y ortogrficos.
Unidad 3: Narremos
Comunicacin oral y escrita.
Reflexin sobre la lengua.
Tipologa textual.
Comunicacin literaria.

Se enfatiza en el desarrollo de la expresin oral de
ideas, sentimientos y acontecimientos, as como de
la escucha atenta de lo que dicen los dems, para
reforzar las habilidades comunicativas.
Unidad 1: Hablemos de lo nuestro Unidad 1: Nos comunicamos Unidad 1: Hablemos de lo nuestro U
PROGRAMA ANTERIOR
Unidad 1: Nos comunicamos U
PROGRAMA ACTUAL BLOQUES DE CONTENIDO
Establecimiento de las diferencias entre el
lenguaje oral y escrito. Se conoce adems
las partes de un libro, a partir del manejo
de libro de texto y tambin la utilidad y uso
del diccionario.
Comunicacin oral y escrita.
Reflexin sobre la lengua.
Tipologa textual.
Conocimiento y utilizacin de estrategias
de lectura y escritura para mejorar la
comprensin lectora y la produccin
de textos.
Comunicacin oral y escrita.
Tipologa textual.
Unidad 2: Recordemos
El siguiente cuadro muestra los nombres de las unidades didcticas del programa anterior y del nuevo programa de estudio
y su relacin con los bloques de contenido.
20
Programa de estudio de cuarto grado
Se leen, memorizan y declaman poemas
con la diccin y entonacin correctas y
tambin se estudia la estructura de los
mismos para conocerlos mejor y poder
escribir algunos, como parte de su propia
creacin. El conocimiento y uso de
figuras literarias y contenidos gramaticales
y ortogrficos.
Unidad 6: Disfrutemos de la poesa UU id d 6 Di f t d l U
En esta unidad se estudia la estructura
y elaboracin de textos instruccionales
diversos como: instrucciones para
experimentos e instrucciones para hacer
tareas escolares.En relacin con estos
textos, se ven contenidos gramaticales
y ortogrficos.
Comunicacin oral y escrita.
Reflexin sobre la lengua.
Tipologa textual.
Unidad 5: Sigamos instrucciones
PROGRAMA ANTERIOR PROGRAMA ACTUAL BLOQUES DE CONTENIDO
Unidad 2: Expresemos lo que pensamos Unidad 4: Describamos
U
Esta unidad se centra en los aprendizajes de
carcter instrumental, en cuanto al uso del idioma
en su forma oral y escrita; por lo que comprende
conocimientos de teora gramatical, ortografa y
aspectos prcticos relacionados con la elaboracin
de textos.
id d 5 Si i t i U
Se estudian diferentes textos descriptivos y
aspectos gramaticales y ortogrficos.
Comunicacin oral y escrita.
Reflexin sobre la lengua.
Tipologa textual.
Comunicacin oral y escrita.
Reflexin sobre la lengua.
Tipologa textual.
Comunicacin literaria.
21
Programa de estudio de cuarto grado
Con esta unidad se pretende lograr la lectura, la
comprensin, la escritura y el anlisis de diferentes
tipos de textos literarios y no literarios, aplicando
tcnicas elementales de comprensin lectora.
Unidad 3: Disfrutemos de la lectura
Unidad 7: Con imgenes y palabras
Esta unidad tiene como objetivo estudiar
y reconocer los textos icono-verbales y no
verbales, la interpretacin y produccin
de carteles, afiches y elaboracin de
historietas. As como tambin aspectos
gramaticales y ortogrficos.
Comunicacin oral y escrita.
Reflexin sobre la lengua.
Tipologa textual.
Comunicacin literaria.
Esta unidad enfatiza la comprensin y
la elaboracin de textos informativos, la
identificacin de prrafos, con su respectiva
idea principal. El estudio de algunos
conectores, y temas ortogrficos.
Comunicacin oral y escrita.
Reflexin sobre la lengua.
Tipologa textual.
Unidad 8: Nos informamos
Se aborda principalmente el texto
dramtico y algunos contenidos
ortogrficos.
Unidad 9: Dramaticemos
Comunicacin oral y escrita.
Reflexin sobre la lengua.
Tipologa textual.
Comunicacin literaria.
Unidad 3: Disfrutemos de la lectura
PROGRAMA ANTERIOR
Unidad 7: Con imgenes y palabras U
PROGRAMA ACTUAL BLOQUES DE CONTENIDO
22
Programa de estudio de cuarto grado
Objetivos de cuarto grado
1. Interactuar con las personas de su entorno, por medio
de la expresin y comprensin oral y la participacin en
dramatizaciones al expresar sus ideas, necesidades y
sentimientos, as como sus opiniones sobre los textos que
lee y escucha, hacindolo con claridad, espontaneidad y
respeto, a fin de comunicarse con armona y confianza
en su contexto escolar.
2. Experimentar de forma activa y motivadora la lectura y
escucha de cuentos, fbulas, leyendas, novelas, poemas,
historietas, textos instruccionales diversos, textos
informativos, utilizando diferentes modalidades de lectura
a fin de desarrollar la comprensin literal, inferencial,
apreciativa, crtica y creativa de los diferentes textos,
con entusiasmo e iniciativa, para acceder a informacin
escrita y compartirla con las personas de su entorno.
3. Escribir cuentos, cartas, historietas, avisos, poemas
y otros textos, a partir de un modelo e instrucciones
claras, por medio de la utilizacin de nombres propios y
comunes, sinnimos y antnimos, primitivos y derivados;
adjetivos; artculos; verbos en presente, pasado y futuro;
determinantes cardinales y ordinales; adverbios de lugar
y conectores; tambin, mediante el uso de signos de
puntuacin y entonacin adecuados, para desarrollar
su capacidad expresiva con creciente autonoma y
correccin, y compartir con las personas de su entorno
ideas, intereses, necesidades y fantasas.
Lineamientos metodolgicos
Las clases deben ofrecer una experiencia significativa para
nias y nios, que les permita practicar su comprensin
y expresin oral y escrita por medio de la participacin
en una situacin comunicativa, de la lectura de textos,
de la observacin de ilustraciones o imgenes, etc. Esta
experiencia debe estar relacionada con sus intereses,
necesidades y los contenidos a desarrollar.
Para orientar el desarrollo metodolgico de los contenidos
se propone una secuencia didctica que describe las etapas
o procesos de una clase, atendiendo a un orden lgico.
Estas etapas tienen correspondencia con las lecciones
propuestas en el libro de texto y la gua metodolgica que
el Ministerio de Educacin ha entregado para apoyar el
desarrollo curricular de cuarto grado.
La secuencia propuesta no debe concebirse como un
obstculo para la creatividad e iniciativa de los docentes; ms
bien puede mejorarse con su experiencia y adecuarse a las
condiciones especficas del aula, los recursos tecnolgicos
y otros materiales con los que cuenta la escuela.
Se proponen cinco momentos fundamentales que tienen
opciones de desarrollo con matices diferentes de acuerdo
a la competencia que prevalece o al tipo de texto que se
trabaje. La secuencia no responde a una hora clase, sino
al proceso de enseanza aprendizaje de un conjunto de
contenidos. No se espera cumplir los cinco pasos en una
hora clase; se recomiendan al menos dos horas para
completar la secuencia. Pero este tiempo puede variar
debido a la dificultad de los contenidos o a los diferentes
ritmos y necesidades de los estudiantes.
Los pasos de la secuencia son:
1. Verificacin y valoracin de los saberes previos.
Al inicio de la clase se deben valorar los saberes sobre la
lengua que ya posee el y la estudiante y que son bsicos
23
Programa de estudio de cuarto grado
c. Actividades orales o escritas para corroborar la
comprensin. Por medio de preguntas, dibujos,
comentarios, juegos, etc. En este apartado es importante
fomentar la expresin oral de las nias y los nios.
Tambin se incluyen preguntas de comprensin literal,
apreciativa e inferencial para ampliar y enriquecer la
comprensin de los textos.
3. Reflexin sobre la lengua.
En este apartado, se partir de los textos ledos y
comentados para estudiar las diferentes nociones y
conceptos gramaticales correspondientes al grado. El
alumnado realiza diversos ejercicios orales y escritos
que refuerzan el aprendizaje de palabras y oraciones
completas, descomposicin silbica, composicin de otras
palabras, ampliacin del vocabulario y anlisis de aspectos
gramaticales y ortogrficos, tales como: los sustantivos; los
adjetivos; el verbo en presente, pasado y futuro; la oracin
simple y su estructura de sujeto y predicado; las oraciones
afirmativas y negativas; el uso de cin y sin y otros.
4. Resolucin de situaciones comunicativas.
Es prioritario que se verifique que el alumnado puede integrar
sus nuevos conocimientos en las diversas situaciones
comunicativas que se le presenten y que evidencie el
dominio de los saberes adquiridos de una forma integrada.
Las situaciones comunicativas pueden ser: hacer un
comentario oral, sostener un dilogo, escribir una carta,
una receta (de acuerdo al texto estudiado), interpretar el
mensaje de una secuencia de dibujos, seguir instrucciones
para realizar una actividad, etc.
El programa de estudio presenta los contenidos sobre
el cdigo escrito, los tipos de texto, las situaciones
para el aprendizaje de los conceptos y el conocimiento de
los textos. Es importante reconocer que los nios y las nias
ya han tenido diferentes experiencias con los textos, las
cuales son importantes para la comprensin y produccin
de la comunicacin escrita.
2. Comprensin de la situacin comunicativa y/o del texto.
En esta fase se pueden identificar varios momentos:
a. Acercamiento al texto.
Escrito a travs de estrategias de comprensin, como
por ejemplo las predicciones. El docente orienta a los
y las estudiantes para que adivinen, hagan hiptesis
o predigan su contenido a partir de las ilustraciones, el
ttulo o las primeras lneas del texto.
b. Lectura por parte del docente o de los estudiantes.
Atendiendo el nivel de avance que tengan las nias
y los nios, la o el docente podr leerles en voz alta o
planificar lectura grupal o independiente. Durante la
lectura la maestra o maestro debe intercalar pausas
para que las nias y los nios comenten si acertaron en
sus predicciones y generen nuevas.
Las modalidades de lectura deben ser variadas, algunas
de estas son:
Lectura en voz alta
Lectura compartida
Lectura independiente
Lectura guiada
Lectura modelada
24
Programa de estudio de cuarto grado
El aula como situacin comunicativa
El aula de clase es el contexto adecuado para fomentar
la adquisicin de las capacidades comunicativas. Es el
contexto social por excelencia en donde el hecho de la
convivencia debe propiciar la necesidad de comunicarse.
De esta manera, el docente emplear metodologas que
favorezcan la cooperacin y la participacin de las y los
alumnos, dialogando con ellos y proponiendo actividades
en las cuales la interaccin constante sea la forma de
afianzar los aprendizajes.
El alumno como protagonista
El aprendizaje de la lengua es una actividad que involucra,
de manera especial, al alumnado. A hablar se aprende
hablando; a escribir, escribiendo. Implica la adquisicin de
las capacidades comunicativas y de la lengua en situaciones
de uso. Entonces, las actividades de aprendizaje debern
estimular la curiosidad, la reflexin y la creatividad de las
y los estudiantes para que puedan resolver las situaciones
comunicativas en forma autnoma y autodirigida.
Modelaje docente
El clima comunicativo del aula debe contar con la
participacin activa de la y la docente, en su calidad de
hablante y oyente, as como de lector y escritor de mensajes.
Por tanto su comportamiento lingstico debe ser un modelo
para sus estudiantes. Para ello, es necesario estar prevenido
en relacin con los trminos y expresiones que se dicen,
de manera que cumplan con las propiedades textuales de
correccin, coherencia, cohesin y adecuacin. Hay que
ser bastante consciente de que no se les puede pedir a los
estudiantes lo que no se les da.
comunicativas y los contenidos gramaticales, de manera
integrada en las unidades didcticas.
El trabajo docente en esta asignatura, a partir de esta
secuencia o de otra que el docente estructure, siempre
deber prestar especial atencin a los principios generales
de enseanza y aprendizaje:
Conocimientos previos
Se debe reconocer que las y los alumnos presentan
diferentes niveles en su desarrollo lingstico a partir de
sus caractersticas individuales y de las interacciones que
tienen con las personas que los rodean. Por ejemplo, el
primer hijo o hija de una familia tiene menos interacciones
comunicativas que el segundo, y por eso solemos escuchar
que el segundo hijo es ms listo que el primero. Tambin
difieren la cantidad y calidad de experiencias con textos
escritos: unos estarn familiarizados con ellos desde edades
tempranas y otros podrn carecer de estos contactos.
Atencin a la diversidad
Hay que tener en cuenta que no todos los nios aprenden de
la misma manera ni al mismo ritmo. Esto obliga al docente
a implementar diversas estrategias didcticas, con el fin de
dar una respuesta que permita atender de forma adecuada
a la diversidad.
La diversidad tambin incluye el uso diferente de la lengua.
En un aula puede haber alumnos de origen rural y urbano,
as como de diferente estrato social y econmico. En este
caso, no es recomendable que el o la docente intervenga
como un corrector del uso gramatical. Su actitud ante
hechos comunicativos en los que intervengan dos niveles de
lengua distintos ser la de usar los trminos de adecuado o
inadecuado, de acuerdo al contexto especfico de accin.
25
Programa de estudio de cuarto grado
Evaluacin diagnstica
La profesora o el profesor, por medio de diversas tcnicas
como la elaboracin de dibujos, la formulacin de preguntas
exploratorias, las lecturas de textos, las descripciones o
las explicaciones previas, valorar el conocimiento y las
habilidades que poseen los estudiantes al inicio del ao
escolar y al iniciar nuevos contenidos.
Se debe diagnosticar tambin los procedimientos que son
capaces de hacer mediante tareas especficas, por ejemplo:
clasificar correctamente algunas palabras de acuerdo a
cmo suenan al principio o al final de un poema, contar
cuentos que ha escuchado, describir personas, animales y
objetos, escribir pequeos textos, etc.
La evaluacin diagnstica debe permitir planificar y
adecuar la clase en funcin de las necesidades y los logros
de las y los nios.
Evaluacin formativa
La finalidad de la evaluacin formativa es conocer los logros
y dificultades de aprendizaje de los y las estudiantes para
facilitarles ayuda adecuada y oportuna. Por ejemplo, si el o
la estudiante no logra identificar las slabas que constituyen
una palabra, la o el docente debe indagar el porqu del
fallo e intervenir proponiendo actividades especficas que
refuercen este conocimiento y destreza.
La evaluacin formativa se apoya en la observacin
sistemtica durante la clase para detectar las necesidades,
habilidades y dificultades de cada uno de sus alumnos y
alumnas; tambin son muy tiles las preguntas orales ya
que permiten conocer lo que un estudiante piensa sobre el
contenido o sobre la actividad. Al indagar las razones de
Desarrollo de ejes transversales
El Currculo Nacional establece ocho ejes transversales
que deben desarrollarse dentro de las asignaturas. En el
caso de Lenguaje, estos temas se pueden abordar por el
uso de diversos textos, como recursos didcticos y como
objetos de estudio. Para ello, el docente ha de estar alerta
ante la posibilidad de seleccionar estos textos; por ejemplo:
en el mes de enero se pueden aprovechar los textos que se
publican en los diarios antes, durante o despus del da 16,
para reflexionar sobre la importancia de la paz, los valores
cvicos o los derechos humanos. O sobre temas de medio
ambiente, equidad de gnero, etc.
Lineamientos de evaluacin
En cuanto a la evaluacin, debe abandonarse la idea de
que el maestro o la maestra es el juez de los resultados
obtenidos por las y los alumnos, y la nica autoridad en
el saber. Por el contrario, la y el docente debe pensarse a
s mismo como creador de situaciones de aprendizaje, un
profesional capaz de criticar su propia prctica en el aula
y, sobre todo, de ser respetuoso del proceso de aprendizaje
de cada nia y nio.
La evaluacin ya no se concibe como el resultado de un juicio
unilateral de resultados que decide quin aprueba y quin
no. La evaluacin al servicio del aprendizaje debe mostrar
los aciertos y desaciertos en el proceso de enseanza para
tomar decisiones: cambiar mtodos, buscar ms recursos,
disear planes de refuerzo acadmico, etc.
Para que la evaluacin sea integral, flexible y til deber
cumplir, al menos algunas de las siguientes funciones:
26
Programa de estudio de cuarto grado
competencia e indicador de logro.
Actividades de aplicacin, por ejemplo, la produccin
y el envo de una tarjeta de invitacin al director o la
directora para que participe en una clase, la realizacin
del peridico mural, etc.
Actividades de investigacin: recopilar leyendas de
la tradicin oral de la regin, chistes, adivinanzas, etc.
Exposiciones orales sobre experiencias, textos creados
o memorizados, como cuentos, poemas, fbulas,
rimas, etc.
Tambin se recomienda incluir la autoevaluacin para
asignar notas. Esto supone orientaciones precisas y
acompaamiento a las y los docentes para que los y las
nias la realicen responsablemente.
Criterios de evaluacin
Es sumamente importante clarificar con las y los estudiantes
los elementos que se tomarn en cuenta para la evaluacin
formativa y sumativa:
Debe pedirse a las alumnas y los alumnos aspectos
como pronunciacin clara y correcta, orden y aseo en los
cuadernos, limpieza en la produccin de trabajo, siempre y
cuando sean trabajados y aprendidos durante las clases.
Respecto a la limpieza de los textos presentados, es
importante que las y los docentes no esperen que las
alumnas y los alumnos que estn en su proceso de
formacin presenten de una vez los textos en versin final.
Todo escritor o toda escritora competente escribe antes
un borrador para corregir y precisar mejoras a sus textos.
En este sentido, las y los docentes deben orientar a los
su conducta se puede identificar el tipo de ayuda o medida
que necesita para mejorar su aprendizaje.
La autoevaluacin y coevaluacin posibilita a las y los
estudiantes exponer, compartir resultados y procedimientos
realizados, valorar el trabajo en equipo, expresando cmo
se sintieron, qu hicieron bien y qu cosas deben mejorar
en actividades futuras.
Este tipo de evaluacin tambin propicia la observacin y el
registro de actitudes referidas a la seguridad, la autonoma,
el inters, el respeto, la participacin, el trabajo en equipo,
etc., para fortalecer su vivencia y desarrollo.
Evaluacin sumativa
La evaluacin sumativa certifica y asigna una nota a la
calidad del desempeo de una actuacin del estudiante.
Se deben seleccionar actividades de evaluacin similares
a las realizadas en clase para determinar la adquisicin
y comprensin de conceptos, procedimientos y actitudes
en relacin al dominio en el uso del idioma oral y escrito.
La prueba objetiva slo es una actividad entre otras. Lo
recomendable es exponer a los y las estudiantes tambin a
situaciones problema que impliquen resolucin por medio
de una actividad concreta: identificar, analizar, explicar,
representar, argumentar, predecir, inventar, escribir, etc.
As, las y los nios pueden aplicar su aprendizaje a nuevas
situaciones comunicativas reales.
Ejemplos de posibles actividades de evaluacin:
Las pruebas. Deben ser integrales y equilibradas
para evaluar, al menos, contenidos conceptuales
y procedimentales de maneras independientes o
integradas; no necesitan ser exhaustivas ni con
muchas preguntas, sino diseadas de acuerdo a la
27
Programa de estudio de cuarto grado
nios a que la produccin de textos es un proceso que va
paso a paso.
Adems de los criterios sobre la forma, el orden, la limpieza
y aspectos como la puntualidad, se recomienda considerar
criterios fundamentales para el logro de las competencias.
Por ejemplo:
Dominio de la voz: incluye la claridad, la vocalizacin,
la resonancia y el uso del volumen adecuado en una
determinada situacin; la utilizacin de pausas.
Comportamiento ante una audiencia: el dominio del cuerpo,
la situacin delante de la audiencia: mirar a las y los
oyentes, no taparse la boca al hablar, estar en una actitud
de interaccin con los dems.
Utilizacin de apoyos no verbales: es importante en la
comunicacin el apoyo de aspectos no verbales como
ademanes, gestos y movimientos para reafirmar o enfatizar
lo hablado, narrado, recitado, etc.
Coherencia: presenta la mayora de las ideas completas,
relacionadas entre s y con secuencia.
Correccin: trazo adecuado de las letras, uso correcto de
las palabras.
Auto-correccin de sus escritos, etc.
Adecuacin: en la mayora de veces hace uso adecuado del
lenguaje, tomando en cuenta la situacin comunicativa.
28
Programa de estudio de cuarto grado
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Objetivos
UNIDAD 1
1.1 Expresa, con esmero,
diferencias entre el
lenguaje oral y escrito.
Esmero al reconocer
las diferencias entre el
lenguaje oral y el escrito.
Diferenciacin entre
el lenguaje oral y el
lenguaje escrito, a travs
del conocimiento de sus
caractersticas principales.
El lenguaje oral y escrito.
Tiempo probable: 9 horas clase
Diferenciar el lenguaje oral del escrito, mediante la identificacin de sus caractersticas
principales, la participacin en dilogos orales y la elaboracin de dilogos escritos, a fin
de mejorar el uso del lenguaje en la comunicacin.
Identificar las partes y elementos principales de los libros y del diccionario, a fin de
hacer un uso adecuado y eficaz de stos, al buscar informacin para tareas escolares o
resolucin de dudas de la vida cotidiana.
NOS COMUNICAMOS
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
CONTENIDOS INDICADORES DE LOGRO
1.2 Interviene, con
espontaneidad,
en dilogos orales.
1.3 Realiza, con atencin, la lectura
expresiva de dilogos escritos.
El dilogo oral y escrito. Intervencin en dilogos
orales (conversaciones),
teniendo en cuenta la
correcta pronunciacin
y la entonacin.
Lectura expresiva de
dilogos escritos.
1
1
Espontaneidad al intervenir
en dilogos orales.

Atencin al realizar
lectura expresiva de
dilogos escritos.
Programa de estudio de cuarto grado
29
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
1.5 Identifica, con inters, las
partes y elementos importantes
de los libros.
Inters al identificar
las partes y elementos
importantes de los libros.
Identificacin de las
partes y elementos
importantes de los libros:
portada, contraportada,
ndice, nombre del libro,
autor(es), editorial, pas
o ciudad.
Partes y elementos
importantes de los libros.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
CONTENIDOS INDICADORES DE LOGRO
1.4 Utiliza correctamente, la raya
y los signos de interrogacin y
admiracin, al escribir dilogos.
La raya o guin largo y
los signos de interrogacin
y admiracin en los
dilogos escritos.
Utilizacin de la raya y los
signos, de interrogacin
y admiracin, al
escribir dilogos.
1
Autocorreccin al utilizar
la raya y los signos, de
interrogacin y admiracin
en dilogos que escribe.
1.6 Utiliza, con atencin, el
diccionario, siguiendo el
orden alfabtico y la
palabra gua.
El diccionario. El
orden alfabtico y la
palabra gua.
Utilizacin del
diccionario, siguiendo
el orden alfabtico y la
palabra gua.
Atencin al utilizar
el diccionario.
Programa de estudio de cuarto grado
30
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Objetivos
2.1 Utiliza, con inters, estrategias
de lectura como la prediccin y
la interrogacin para interpretar
el contenido de textos.
Inters al utilizar
estrategias de lectura.
Utilizacin de estrategias
de lectura para la
interpretacin del
contenido de textos.
Estrategias de lectura:
prediccin, interrogacin
del texto antes, durante
y despus.
Tiempo probable: 11 horas clase
UNIDAD 2
RECORDEMOS
Aplicar estrategias de lectura, como la prediccin y la interrogacin, mostrando inters
y motivacin por la lectura e interpretacin de diferentes textos, a fin de autoformarse
como lector.
Aplicar estrategias de escritura, como la planificacin, elaboracin, revisin y edicin
del texto, atendiendo a la correccin, cohesin y coherencia, a fin de lograr una mejor
expresin escrita, as como desarrollar el gusto por la produccin de sus propios textos.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
CONTENIDOS INDICADORES DE LOGRO
2.2 Utiliza modelos al escribir sus
propios textos.
2.3 Planifica y elabora con
esmero, textos escritos,
atendiendo al contenido,
al formato y al destinatario.
Estrategias de escritura:
planificacin, elaboracin,
revisin y edicin.
Utilizacin de modelos
para la produccin escrita
de sus propios textos.
Planificacin y elaboracin
del escrito, atendiendo al
contenido, al formato y al
destinatario del texto.
Disposicin al utilizar
modelos para la
produccin escrita.
Esmero al planificar y
elaborar escritos.
Programa de estudio de cuarto grado
31
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
2.4 Revisa, con esmero, el contenido
de su escrito, atendiendo a
la legibilidad, correccin,
coherencia y cohesin del texto.



2.5 Presenta con satisfaccin sus
propios textos escritos.
Autoexigencia en la
revisin y edicin de sus
propios textos.




Satisfaccin al presentar
sus propios textos.
Revisin y edicin del
escrito, atendiendo a la
legibilidad, la correccin
(ortogrfica y gramatical),
la cohesin (el uso
de conectores para la
relacin de las ideas) y
la coherencia (el orden
de las ideas).
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
CONTENIDOS INDICADORES DE LOGRO
Programa de estudio de cuarto grado
32
Objetivos UNIDAD 3
NARREMOS
Leer y escribir textos narrativos como cuentos, fbulas, leyendas y diarios personales,
atendiendo a su estructura y elementos particulares de cada uno, con la intencin de
desarrollar el gusto por la lectura y el disfrute por la produccin escrita.
Aplicar conocimientos gramaticales y ortogrficos como los sustantivos comunes y propios,
simples y compuestos, los determinantes indefinidos, el punto y el uso de la en la formacin
del plural, en la produccin de textos narrativos, con la finalidad de hacer uso correcto
del idioma.
ACTITUDINALES PROCEDIMENTALES CONCEPTUALES
3.1 Narra con entusiasmo
sucesos y experiencias
reales o ficticias,
en forma oral.
Entusiasmo al narrar
sucesos y experiencias
reales o ficticias.
Narracin de sucesos
y experiencias reales o
ficticias, en forma oral.
La narracin.

Tiempo probable: 38 horas clase
ACTITUDINALES PROCEDIMENTALES CONCEPTUALES
CONTENIDOS INDICADORES DE LOGRO
3.3 Identifica con inters los
elementos de la narracin:
lugar, tiempo y personajes.
Elementos de la
narracin: el lugar,
los personajes y
el tiempo.
Identificacin de los
elementos de la narracin.
3 Inters por identificar los
elementos de la narracin.
3.2 Reconoce el inicio, desarrollo
y final de una narracin.
Estructura del texto
narrativo: inicio,
desarrollo y final.
Reconocimiento de
la estructura de
textos narrativos.
Atencin al reconocer
la estructura de
textos narrativos.
Programa de estudio de cuarto grado
33
CONCEPTUALES
3.4 Identifica sustantivos comunes
y propios en narraciones.
CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES
Los sustantivos comunes
y propios.
Identificacin de
sustantivos comunes y
propios en narraciones.
Atencin al identificar
sustantivos comunes
y propios.
3.5 Lee cuentos, con entusiasmo
y de forma expresiva.
3.6 Identifica con inters la
estructura y elementos
del cuento.
3.7 Escribe cuentos atendiendo
a su estructura (inicio,
desarrollo y final) y sus
elementos (lugar, tiempo y
personajes).
El cuento: estructura
y elementos.
Lectura expresiva
de cuentos.
Identificacin de la
estructura y elementos
del cuento.
Produccin escrita de
cuentos, atendiendo
a su estructura (inicio,
desarrollo y final) y sus
elementos (lugar, tiempo
y personajes).
3
3
3
Entusiasmo al leer cuentos.
Inters al identificar la
estructura y elementos
del cuento.
Esmero al escribir cuentos.
3.8 Lee fbulas, con entusiasmo
y en forma expresiva.
3.9 Identifica con inters la
estructura y elementos
de la fbula.
La fbula: estructura
y elementos.
Lectura expresiva
de fbulas.
Identificacin de la
estructura y elementos
de la fbula.
3
3
Entusiasmo al leer fbulas.

Inters al identificar la
estructura y elementos
de la fbula.
34
Programa de estudio de cuarto grado
3.10 Interpreta con esmero,
la enseanza o moraleja
de fbulas.
3.11 Escribe fbulas atendiendo a
su estructura (inicio, desarrollo
y final) y sus elementos (lugar,
tiempo y personajes).
INDICADORES DE LOGRO CONTENIDOS
3.12 Utiliza correctamente el
punto y seguido, el punto
y aparte y el punto final, al
escribir textos narrativos.
El punto y seguido,
el punto y aparte y
punto final.
Utilizacin del punto
y seguido, del punto y
aparte y del punto final, al
escribir textos narrativos.
Autocorreccin al utilizar
el punto y seguido, el
punto y aparte y el
punto final, al escribir
textos narrativos.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
l d l d l
Interpretacin de la
enseanza o moraleja
de fbulas.
Produccin escrita de
fbulas, atendiendo a
su estructura (inicio,
desarrollo y final) y sus
elementos (lugar, tiempo
y personajes).
3
3
A l l
Esmero al interpretar
fbulas.

Disfrute al escribir fbulas.
3.13 Lee leyendas con entusiasmo y
de forma expresiva.
3.14 Identifica con inters, la
estructura y elementos de
la leyenda.
3.15 Escribe con motivacin,
leyendas de la tradicin
oral de la comunidad.
La leyenda: estructura
y elementos.
Lectura expresiva
de leyendas.
Identificacin de la
estructura y elementos
de la leyenda.
Escritura de leyendas
propias de la tradicin
oral de la comunidad.
Entusiasmo al realizar
lectura expresiva de
leyendas.
Inters al identificar la
estructura y elementos
de la leyenda.
Motivacin al
escribir leyendas de
su comunidad.
Programa de estudio de cuarto grado
35
3.16 Identifica, con inters, los
determinantes indefinidos en
textos narrativos que lee.
3.17 Utiliza los determinantes
indefinidos en textos narrativos
que escribe.
INDICADORES DE LOGRO CONTENIDOS
Los determinantes
indefinidos.
Identificacin y uso de los
determinantes indefinidos
en textos narrativos que
lee y escribe.
Inters al identificar y
utilizar los determinantes
indefinidos.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
3.20 Menciona refranes y
sabe interpretarlos.
Los refranes. Interpretacin y
memorizacin de refranes.
Inters al interpretar y
memorizar refranes.
3.18 Reconoce con inters las
caractersticas, el uso y
propsito del diario personal.

3.19 Escribe diariamente
los acontecimientos o
ancdotas ms importantes
experimentados, resaltando
sus opiniones y reflexiones
de carcter personal.
El diario personal:
caractersticas, uso
y propsito.
Reconocimiento de las
caractersticas, el uso
y propsito del diario
personal.
Elaboracin de diarios
personales.
Inters al reconocer el
diario personal.


Motivacin por escribir
su diario personal.
3.21 Escribe correctamente los
plurales de las palabras
terminadas en z.
Plural de los sustantivos
terminados en z (luz-
luces; nariz-narices).
Aplicacin de la regla
sobre los sustantivos que
terminan en z y hacen el
plural cambiando la z en
c y agregando es.
3 Autocorrreccin al escribir
plurales de palabras que
terminan en z.
Programa de estudio de cuarto grado
36
4.1 Expresa de manera oral y
escrita retratos y topografas
de su entorno.
La descripcin: el retrato y
la topografa.
Expresin oral y escrita de
caractersticas de personas
(retratos) y de lugares
(topografas).
Inters al expresar
oralmente y por escrito
retratos y topografas.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
UNIDAD 4
DESCRIBAMOS
Tiempo probable: 15 horas clase
Objetivos
Expresar en forma oral y escrita las caractersticas de personas (retrato), as como
de lugares (topografa), utilizando adjetivos calificativos, palabras antnimas y
sinnimas, y determinantes demostrativos; con propsito de desarrollar la observacin
y enriquecer el vocabulario.
Escribir textos, utilizando el sujeto simple y compuesto y aplicando, de manera correcta,
la concordancia entre sustantivo y adjetivo, a fin de mejorar la comunicacin escrita.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
4.2 Escribe retratos y topografas
aplicando la concordancia de
gnero y nmero entre
sustantivos y adjetivos.
La concordancia entre el
sustantivo y el adjetivo.
Escritura de retratos y
topografas aplicando la
concordancia de gnero y
nmero entre sustantivos
y adjetivos.
Atencin al aplicar la
concordancia entre
sustantivos y adjetivos.
4.3 Utiliza, con esmero, diversos
adjetivos calificativos al
describir personas y lugares
de su entorno.
Los adjetivos calificativos. Utilizacin de adjetivos
calificativos al realizar
descripciones de personas
y lugares.
Esmero al utilizar diversos
adjetivos calificativos
para describir personas
y lugares.
Programa de estudio de cuarto grado
37
Los determinantes
demostrativos.
Identificacin y uso
de los determinantes
demostrativos en textos
descriptivos que lee
y escribe.
Inters al identificar y
usar los determinantes
demostrativos.
4.4 Identifica y utiliza, con inters,
los determinantes demostrativos
en textos descriptivos que lee
y escribe.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
4.7 Escribe, con esmero, oraciones
ubicando el sujeto en posicin
inicial, intermedia y final.
4.8 Identifica y utiliza sujeto
simple y compuesto al leer
y escribir oraciones.
Sujeto simple y compuesto. Ejercitacin de oraciones
ubicando el sujeto en
posicin inicial,
intermedia y final.
Identificacin y uso del
sujeto simple y compuesto,
a travs de lectura y
escritura de oraciones.
4
4
Esmero al escribir
oraciones ubicando
el sujeto en
diferente posicin.
Atencin al identificar el
sujeto simple y compuesto.
4.5 Utiliza sinnimos y antnimos
sustantivos y adjetivos, en textos
descriptivos que lee y escribe.
Los sinnimos y los
antnimos (sustantivos
y adjetivos).
Identificacin y uso de
sinnimos y antnimos
sustantivos y adjetivos en
textos descriptivos que lee
y escribe.
Esmero al identificar
y utilizar los sinnimos y
antnimos adjetivos
y sustantivos.
4.6 Identifica el sujeto y el
predicado en oraciones de
textos que lee y escribe.
La oracin. Sujeto
y predicado.
Identificacin de las partes
de la oracin (sujeto y
predicado), as como de
las distintas posiciones
del sujeto, por medio
de diversos ejemplos de
oraciones de textos que
lee y escribe.
Atencin al identificar
las partes de la oracin.
38
Programa de estudio de cuarto grado
Los textos instruccionales:
estructura y funcin.
Reconocimiento de la
estructura de los textos
instruccionales (ttulo,
materiales, procedimiento
o pasos a seguir)
y su funcin.
Inters al reconocer la
estructura y funcin de
los textos instruccionales.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
CONTENIDOS
Objetivos
Leer y utilizar textos instruccionales al realizar experimentos, as como resolver
tareas escolares y exmenes, atendiendo a su estructura y funcin, y siguiendo de
manera ordenada los pasos, a fin de obtener los resultados esperados en actividades
de la vida diaria.
Escribir textos instruccionales sobre experimentos realizados, registrando en orden los
pasos, a fin de compartirlos y disponer del texto para experiencias posteriores.
5.1 Identifica, con inters, la
estructura y funcin de los
textos instruccionales.
UNIDAD 5
SIGAMOS
INSTRUCCIONES
Tiempo probable: 15 horas clase
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
CONTENIDOS INDICADORES DE LOGRO CONTENIDOS
5.2 Lee y sigue instrucciones escritas
al realizar experimentos.

5.3 Escribe, con esmero,
textos instruccionales de
experimentos realizados.
Texto instruccional:
Instrucciones para
experimentos.
Lectura y seguimiento de
instrucciones escritas para
realizar experimentos.
Elaboracin de textos
instruccionales despus
de realizar experimentos.
Atencin al seguir
instrucciones para
experimentos.
Esmero al escribir
textos instruccionales
relacionados con
experimentos realizados.
Programa de estudio de cuarto grado
39
5.4 Sigue, con esmero, instrucciones
orales y escritas al resolver
tareas escolares y exmenes.
INDICADORES DE LOGRO CONTENIDOS
Instrucciones para
resolver tareas y
exmenes escolares.

Lectura y seguimiento
de instrucciones orales
y escritas para resolver
tareas escolares
y exmenes.
Atencin y esmero al
seguir instrucciones para
resolver tareas escolares
y exmenes.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
5.5 Escribe textos y oraciones
aplicando la concordancia
de nmero entre el sujeto y
el verbo de la oracin.
La concordancia de
nmero entre el sujeto
y el verbo.
Escritura de textos y
oraciones aplicando la
concordancia
de nmero (singular/
plural) entre el sujeto y el
verbo de la oracin.
Atencin al aplicar la
concordancia de nmero
entre el sujeto y el verbo.
Programa de estudio de cuarto grado
40
6.1 Lee con esmero y en voz
alta, poemas atendiendo a la
pronunciacin y entonacin
adecuadas.
6.2 Identifica con inters, el tema
que trata en poemas que lee.
El poema. El tema. Lectura de poemas en
voz alta, aplicando la
entonacin y el ritmo
adecuados.
Identificacin del tema
que trata el poema.
Esmero al leer poemas.


Inters al identificar el
tema en poemas.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
UNIDAD 6
DISFRUTEMOS
DE LA POESA
Tiempo probable: 27 horas clase
Objetivos
Leer y recitar textos poticos con entonacin y ritmo adecuados, atendiendo
a las estrofas, los versos y la rima a fin de desarrollar el gusto esttico por la
poesa.
Escribir poemas cortos, teniendo en cuenta su estructura, para plasmar su
imaginacin creadora y sus aptitudes artstico- literarias.
Escribir diferentes textos haciendo uso correcto del sujeto y predicado, as como
de la divisin silbica y tildacin a fin de mejorar la comunicacin escrita.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
6.3 Identifica con esmero,
la estructura de poemas,
atendiendo al nmero
de estrofas y de versos.
6.4 Seala y menciona las
palabras que riman en
los versos.
Estructura del poema:
estrofa, verso y rima.
Identificacin de las
estrofas, los versos y
la rima que componen
un poema.
Esmero al identificar la
estructura de poemas.
41
Programa de estudio de cuarto grado
6.5 Escribe poemas de una o dos
estrofas, eligiendo de manera
libre el tema y el nmero de
versos por estrofa.
INDICADORES DE LOGRO CONTENIDOS
Escritura de poemas
de una o dos estrofas,
utilizando los elementos
principales del poema:
estrofa, verso y rima.
6.
Disfrute al escribir poemas.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
6.10 Clasifica, con esmero, las
palabras segn el acento.
El acento en las
palabras agudas, graves
y esdrjulas.
Clasificacin de palabras
en agudas, graves y
esdrjulas, segn el
acento o slaba tnica.
Esmero al clasificar
palabras segn el acento.
6.9 Divide las palabras en sus
slabas constitutivas.
La divisin silbica. Divisin silbica de
palabras monoslabas,
bislabas, trislabas y
polislabas.
Empeo en realizar
correctamente la
divisin silbica.
6.6 Identifica e interpreta metforas
en poemas.

6.7 Escribe metforas a partir de
modelos.
6.8 Identifica, con esmero, la
personificacin en poemas.
Figuras literarias:
la metfora, la
personificacin.
Identificacin e
interpretacin de
metforas en poemas.
Escritura de metforas a
partir de modelos.
Identificacin de
la personificacin
en poemas.
Atencin al interpretar
metforas en poemas
que lee.
Motivacin al escribir
metforas.
Esmero al identificar la
personificacin
en poemas.
Programa de estudio de cuarto grado
42
6.11 Tilda las palabras esdrjulas,
graves y agudas, segn la
regla ortogrfica.
INDICADORES DE LOGRO CONTENIDOS
La tildacin de las
palabras esdrjulas,
agudas y graves.
Tildacin de palabras
esdrjulas, graves y
agudas, segn la
regla ortogrfica.
Atencin en la tildacin
correcta de palabras.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
6.14 Identifica el ncleo del
sujeto y ncleo del
predicado en oraciones.
Ncleo del sujeto y ncleo
del predicado.
Identificacin del ncleo
del sujeto y del predicado
en oraciones.
Atencin al identificar
el ncleo del sujeto y
el ncleo del predicado
en oraciones.
6.13 Usa el sujeto tcito de
forma correcta en textos
que escribe.
Sujeto tcito. Uso del sujeto tcito
en composiciones que
produce de forma oral
y escrita.
Esmero al utilizar
correctamente el
sujeto tcito en textos
que escribe.
6.12 Usa diferentes tonos de voz
segn la situacin comunicativa.
El tono de la voz. Uso de diferentes tonos
de voz, segn la intencin
comunicativa.
Esmero al usar diferentes
tonos de voz segn la
situacin comunicativa.
Programa de estudio de cuarto grado
43
7.1 Lee mapas de ubicacin,
relacionando la simbologa
utilizada con su significado.
7.2 Lee textos cono-verbales de
manera correcta.
CONCEPTUALES PROCEDIMENTALES
Textos cono-verbales:
mapas de ubicacin.
Lectura de mapas de
ubicacin, relacionando
la simbologa utilizada con
su respectivo significado.
Lectura de carteles cono-
verbales identificando el
emisor, el destinatario y el
propsito de stos.
Atencin al leer mapas
de ubicacin.


Atencin al leer textos
cono-verbales.
ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
UNIDAD 7
CON IMGENES
Y PALABRAS
Tiempo probable: 23 horas clase
Objetivos
Interpretar el contenido de los textos cono-verbales como: mapas de ubicacin, carteles
e historietas, con el fin de conocer su funcin orientadora, informativa, divertida y crtica,
segn el caso, y para valorar su importancia en la vida diaria.
Producir textos icono-verbales como: mapas, carteles e historietas, tomando en cuenta
los aspectos caractersticos de cada uno de ellos, as como los aspectos gramaticales y
ortogrficos, a fin de comunicar ideas al realizar trabajos o exposiciones en el aula.
7.3 Elabora carteles icono-
verbales, tomando en
cuenta sus partes,
elementos y caractersticas.
Carteles para exposicin:
partes, elementos
(grficos y textuales) y
caractersticas.
Elaboracin de historietas
cono-verbales, sobre temas
de cualquier clase, tomando
en cuenta sus partes,
elementos y caractersticas.
Inters en elaborar
carteles icono- verbales.
7.4 Identifica los elementos
caractersticos de las historietas.
Historieta: elementos
(personajes, vietas,
globos, onomatopeyas)
y caractersticas.
Reconocimiento de los
elementos y caractersticas
de las historietas.
7 Inters al identificar los
elementos y caractersticas
de las historietas.
44
Programa de estudio de cuarto grado
7.5 Elabora historietas de
cuatro vietas, tomando
en cuenta sus elementos y
caractersticas.
INDICADORES DE LOGRO CONTENIDOS
Elaboracin de historietas,
tomando en cuenta
los elementos y las
caractersticas que
las constituyen.
Entusiasmo por
elaborar historietas.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
7.6 Identifica y escribe oraciones
interrogativas y exclamativas,
utilizando correctamente los
signos de puntuacin.
Oraciones interrogativas y
exclamativas.
Identificacin y uso de las
oraciones interrogativas
y exclamativas, utilizando
correctamente los signos
de puntuacin.
Esmero en diferenciar
claramente las
oraciones interrogativas
de las exclamativas.
7.7 Utiliza, con atencin y de
manera correcta los pronombres
personales y las variantes
pronominales de primera
persona del singular al escribir
historietas y otros textos.
Pronombres personales
y variantes pronominales
de primera persona del
singular
(yo, mi, me, conmigo).
Uso de los pronombres
personales y de las
variantes pronominales
de primera persona en
historietas y variados
ejercicios de escritura.
Atencin al utilizar
correctamente los
pronombres personales.
7.8 Lee y escribe determinantes
cardinales hasta el cuarenta
y determinantes ordinales hasta
el vigsimo.
Determinantes cardinales
y determinantes ordinales.
Lectura y escritura de
determinantes cardinales
hasta el cuarenta.Y
determinantes ordinales.
hasta el vigsimo.
Esmero al leer y
escribir determinantes
cardinales y ordinales
en diversos textos.
7.9 Lee y escribe textos diversos
utilizando los determinantes
cardinales y ordinales.
7.10 Usa correctamente los
determinantes posesivos al
escribir textos diversos.
Determinantes posesivos. Lectura y escritura de
textos diversos utilizando
los determinantes
cardinales y ordinales.
Uso correcto de
determinantes posesivos
en textos que escribe.
Inters al utilizar de
manera correcta los
determinantes posesivos
en textos que escribe.
Programa de estudio de cuarto grado
45
UNIDAD 8
NOS INFORMAMOS
Objetivos
Leer y conocer los textos informativos y su divisin en prrafos, para detectar las ideas
principales y mejorar la comprensin lectora de los mismos, fijndose en los conectores
entre prrafos, para asegurar la coherencia entre los mismos.
Producir textos informativos como noticias y cartas, tomando en cuenta su estructura
particular y su divisin en prrafos; utilizando adems, de manera correcta, los tiempos
simples del Modo Indicativo y aplicando la regla de los verbos que hacen el pretrito
utilizando la terminacin aba.
Utilizar organizadores grficos como la red de palabras y el diagrama de Venn para
ordenar informacin extrada de textos a fin de facilitar la lectura de libros y el estudio de
contenidos de diferentes asignaturas del currculo escolar.
8.1 Identifica, con esmero, la
informacin explcita en las
noticias: qu sucedi, cmo,
dnde y cundo.

8.2 Nombra las partes principales
de una noticia.
La noticia: estructura. Comprensin de la
informacin explcita en
las noticias a partir de las
preguntas: qu, cmo,
dnde y cundo.
Identificacin de las partes
principales de una noticia.
Esmero en la
comprensin de la
informacin de noticias.


Atencin al identificar
las partes principales
en noticias.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Tiempo probable: 46 horas clase
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
Programa de estudio de cuarto grado
46
8.3 Reconoce el tema de varias
noticias, de manera acertada,
despus de leer solamente el
ttulo, o toda la noticia.

8.4 Escribe noticias, tomando en
cuenta las partes principales de
stas y eligiendo un tema.
8.6 Conjuga correctamente
los verbos en los tiempos
simples del modo indicativo
y en las diferentes personas
gramaticales, en textos
informativos que escribe.
INDICADORES DE LOGRO CONTENIDOS
La conjugacin verbal en
los tiempos simples del
modo Indicativo (presente,
pretrito, copretrito,
futuro y condicional).
Conjugacin de los
tiempos verbales simples
del Modo Indicativo.
Inters al conjugar
verbos en los diferentes
tiempos verbales de
Modo Indicativo.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Temas de las noticias. Identificacin de los
diferentes temas de
la noticia: deportivos,
sociales, cientficos,
culturales, econmicos.
Produccin de noticias
escritas sobre lo que
sucede en la escuela,
en la comunidad, o el
pas, eligiendo los temas
de inters.
Valoracin de la
informacin variada que
presentan las noticias.


Esmero al escribir
noticias de distintos
temas de inters.
8.5 Nombra verbos y los agrupa
segn las terminaciones
ar, er, ir.
El verbo. Reconocimiento del verbo
como palabra que indican
accin y agrupacin
de los mismos por sus
terminaciones en
ar, er, ir.
8 Inters en el conocimiento
de los verbos, como una
clase de palabras que
indica accin.
Programa de estudio de cuarto grado
47
8.7 Utiliza los tiempos verbales
simples del Modo Indicativo
de los verbos terminados en
ar, er, ir en las diferentes
personas gramaticales al
escribir textos informativos.
INDICADORES DE LOGRO CONTENIDOS
Utilizacin de los tiempos
verbales simples del Modo
Indicativo de los verbos
terminados en ar, er, ir
en las diferentes personas
gramaticales al escribir
textos informativos.
Esmero al escribir textos
utilizando los tiempos
verbales simples del
Modo Indicativo.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
8.10 Escribe cartas comerciales
teniendo en cuenta el
propsito y todos los
elementos que intervienen
en su estructura.
La carta comercial:
propsito y estructura.
Elaboracin de cartas
comerciales que expresan
diferentes situaciones,
teniendo en cuenta su
propsito y estructura.
Esmero en la elaboracin
de cartas comerciales.
8.9 Utiliza correctamente b en la
terminacin aba del pretrito
de los verbos terminadas en ar
al escribir palabras o textos.
Uso de b en la
terminacin aba del
pretrito de los verbos
terminados en ar.
(Saltaba, compraba,
jugaba, paseaba).
Identificacin y uso de
la b en la terminacin
aba del pretrito de
los verbos terminados
en ar, al escribir
palabras y textos.
8 Empeo por utilizar b
en la terminacin aba
del pretrito de los verbos.
8.8 Usa las diferentes personas
gramaticales en la elaboracin
de noticias.
Las personas gramaticales:
primera, segunda y tercera
del singular y del plural.
Uso correcto de las
personas gramaticales en
la conjugacin verbal, al
escribir noticias.
Atencin al utilizar
adecuadamente las
diferentes personas
gramaticales.
48
Programa de estudio de cuarto grado
8.11 Escribe dos puntos despus
del saludo, en las cartas,
y antes de hacer una
enumeracin.
INDICADORES DE LOGRO CONTENIDOS
Uso de los dos puntos:
despus del saludo en las
cartas y en enumeracin
anunciada.
Utilizacin de los dos
puntos despus del saludo
de las cartas y antes de
hacer enumeraciones.
Atencin al usar los
dos puntos en textos
que escribe.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
8.14 Identifica correctamente el
nmero de prrafos de un
texto informativo.

8.15 Identifica la idea principal
de cada prrafo de un
texto informativo de tres
prrafos cortos.
Divisin del texto en
prrafos. Ideas principales.
Identificacin del
nmero de prrafos
de los diferentes textos
informativos.
Deteccin de la idea o
ideas principales de
cada prrafo.
Inters por identificar los
prrafos de un texto.


Esmero en identificar la(s)
idea(s) principa(les) de
cada prrafo.
8.13 Lee y explica con sus propias
palabras lo que entiende
acerca de textos de informacin
cientfica que lee.
d l
El texto de informacin
cientfica.(Texto expositivo)

d f d l
Lectura y comprensin
de textos de informacin
cientfica relacionados
con las otras asignaturas
del currculo.
d f l
Inters por la lectura de
textos informativos.
8.12 Identifica y utiliza adverbios
de tiempo, lugar y
cantidad en oraciones y
pequeos textos.
Los adverbios de tiempo,
lugar y cantidad.
Identificacin y uso de
adverbios de tiempo,
lugar y cantidad, en
oraciones y textos cortos.
8 Inters en la utilizacin
de adverbios en oraciones
y textos como cartas
y noticias.
Programa de estudio de cuarto grado
49
8.16 Utiliza conectores textuales para
dar coherencia a los prrafos de
textos que escribe.
INDICADORES DE LOGRO CONTENIDOS
Conectores textuales entre
prrafos: (despus de,
entonces, tambin, para
finalizar, en resumen).
Utilizacin de los
conectores textuales entre
prrafos para guardar la
coherencia del texto.
Empeo en utilizar los
conectores textuales y
su utilidad.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
8.17 Lee e interpreta redes de
palabras, relacionadas con
textos informativos sencillos.




8.18 Elabora redes de palabras a
partir de textos que lee.

8.19 Lee e interpreta la
informacin presentada en
los diagramas de Venn.


8.20 Elabora diagramas de Venn con
textos informativos sencillos y de
inters personal.
Organizadores grficos
de la informacin: red de
palabras, cuadros de
doble entrada y el
diagrama de Venn.
Lectura e interpretacin
de informacin
presentada a travs
de redes de palabras.



Elaboracin de redes de
palabras, a partir de la
lectura de diferentes textos.
Lectura e interpretacin de
la informacin presentada
en los diagramas de Venn.

Elaboracin de diagramas
de Venn, a partir de textos
informativos de inters para
los estudiantes.
8
8
8
8
Atencin e inters por
interpretar informacin
contenida en redes de
palabras.



Empeo en elaborar
redes de palabras.


Curiosidad por
comprender la informacin
contenida en los
diagramas de Venn.
Inters y esmero por
elaborar diagramas
de Venn.
Programa de estudio de cuarto grado
50
8.21 Utiliza cuadros de doble entrada
para resumir informacin.
8.22 Identifica los principales
tipos de textos que presentan
los peridicos.
INDICADORES DE LOGRO CONTENIDOS
El peridico: textos
informativos y
partes principales.
Uso y lectura de cuadros
de doble entrada para
resumir informacin.
Identificacin de textos
informativos en el
peridico: noticias,
opiniones, anuncios,
avisos, cartas, historietas,
esquelas mortuorias,
cartelera televisiva y
cinematogrfica, etc.
Inters por identificar
los diferentes tipos de
textos que presentan los
peridicos.
Inters por conocer las
diferentes secciones de
un peridico.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
8.23 Seala las diferentes
secciones que componen
un peridico.



8.24 Elabora fichas bibliogrficas
sobre el contenido de textos
ledos o temas investigados.
La ficha bibliogrfica
de contenido.
Reconocimiento de las
diferentes secciones que
presenta un peridico:
noticias nacionales e
internacionales, editoriales,
social, deportiva, etc.
Elaboracin de fichas
bibliogrficas de
contenido, con las
ideas principales sobre
un texto ledo o un
tema investigado.
Inters elaborar una
ficha de contenido
y bibliogrficas.
Programa de estudio de cuarto grado
51
8.25 Escribe g en dictados de
palabras o en textos cuyas
palabras llevan g.
Uso de la g y sus
diferentes reglas
ortogrficas.
Identificacin y uso de g
en diferentes situaciones
comunicativas.
Atencin al escribir
correctamente palabras
que inician con g.
CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO
8.28 Escribe correctamente el
palabras que terminan en
ducir y su pasado se
modifica con g o j.
Palabras que terminan
con ducir y su
respectivo pasado.
Identificacin y uso de
palabras que terminan
con ducir y su
modificacin en el
pasado, ya sea con
j y g.
8 Empeo en usar
correctamente g j en
palabras que terminan en
ducir y se modifican en
su pasado.
8.27 Escribe correctamente
palabras que internamente
llevan cc y sc.
Palabras con cc y sc. Identificacin y uso
de palabras que se
escriben con cc y sc
internamente.
Inters por comprender
y usar palabras que
internamente se escriben
con cc y sc.
8.26 Escribe v en dictados de
palabras o textos cuyas
palabras, siendo adjetivos
terminan en avo, ave,
eva,eve,evo, ivo.
Uso de la v en las
terminaciones avo,
ave, eva, eve,
evo,ivo de adjetivos y
sus excepciones.
Identificacin y uso de
muchos adjetivos que
terminan en avo, ave,
eva, eve, evo, ivo
en textos que escribe.
8 Inters en identificar y
escribir v en muchos
adjetivos que lo requieren.
Programa de estudio de cuarto grado
52
9.1 Participa en dramatizaciones
de su inters acompaando su
expresin oral con la expresin
corporal adecuada.
La dramatizacin:
expresin oral y corporal.
Participacin en
dramatizaciones de
situaciones reales o
imaginarias en la que
se ponga de manifiesto
la expresin oral y la
expresin corporal
Inters al participar en
dramatizaciones de
diverso tipo.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
UNIDAD 9
DRAMATICEMOS
Tiempo probable: 16 horas clase
Objetivos
Participar en dramatizaciones utilizando la expresin y lenguaje corporal as como la
creatividad e imaginacin a fin de favorecer una mejor comunicacin en el aula y la
escuela y fomentar el gusto por las representaciones teatrales.
Leer y escribir textos dramticos a partir del conocimiento de la estructura de los mismos,
con la finalidad de disfrutarlos y comprenderlos mejor.
Leer guas telefnicas y revistas a fin de obtener informacin necesaria para resolver
dudas, ampliar informacin u obtener datos telefnicos importantes.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
9.2 Lee textos dramticos en voz
alta, con una buena diccin
y entonacin.
Textos dramticos. Lectura en voz alta
de textos dramticos,
utilizando una diccin
y entonacin correctas,
adecuando la voz, lo
mejor posible, a los
personajes representados.
Esmero en leer textos
dramticos en voz alta,
con la diccin y
entonacin correctas.
Programa de estudio de cuarto grado
53
9.3 Identifica los elementos del
texto dramtico: lugar,
tiempo y personajes.
INDICADORES DE LOGRO CONTENIDOS
Los elementos principales
de los textos dramticos:
personajes, lugar y tiempo.
Identificacin de los
elementos de los textos
dramticos.
Esmero al identificar los
elementos principales de
textos dramticos.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
9.7 Utiliza la gua telefnica para
obtener informacin de
telfonos y direcciones.
La gua telefnica. Utilizacin de la gua
telefnica para obtener
informacin de telfonos
y direcciones.
Inters en el uso de la
gua telefnica.
9 7 Utili l t l f i
9.6 Identifica y usa los puntos
suspensivos en oraciones y
textos dramticos.
L t l f i
Uso de los puntos
suspensivos.
Utili i d l
Identificacin y uso de
puntos suspensivos en
textos dramticos.
I t l d l
Atencin en el uso de los
puntos suspensivos en
textos dramticos.
9.4 Identifica la estructura formal
de un texto dramtico y
su recurso ms importante:
el dilogo.

9.5 Escribe textos dramticos
utilizando la estructura y
el dilogo.
Estructura del texto
dramtico. Dilogos
y escenas.
Identificacin de la
estructura de los textos
dramticos, para una
mejor comprensin de
los mismos.
Escritura de textos
dramticos utilizando la
estructura y el dilogo.
9
9
Inters por el conocimiento
de la estructura y de los
textos dramticos.

Motivacin por escribir
textos dramticos.
Programa de estudio de cuarto grado
54
9.8 Escribe b correctamente
en palabras que llevan las
combinaciones silbicas
br, bl.
INDICADORES DE LOGRO CONTENIDOS
Uso de la b, br, bl. Utilizacin de la b al
escribir palabras con las
combinaciones silbicas
br, bl.
9 Atencin al escribir de
manera correcta palabras
con las combinaciones
silbicas br, bl.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
9.10 Utiliza h en palabras que
inician con hie y hue en
textos que escribe.
Palabras que se escriben
con hie y hue.
Identificacin y uso de la
h en palabras que
inician con hie y hue
en oraciones y textos que
lee y escribe.
9 Inters y esmero en utilizar
h en palabras que
inician con hie y hue.
9.9 Identifica la informacin que
contienen diferentes revistas.
La revista. Identificacin de la
informacin de revistas.
Inters al identificar
informacin de revistas.
MATEMTICA
56
Programa de estudio de cuarto grado
Estos procedimientos permiten estructurar el pensamiento
matemtico en los educandos; superando la prctica
tradicional de partir de una definicin matemtica y no del
descubrimiento del principio o proceso que le da sentido.
Comunicacin con lenguaje matemtico
Los smbolos y notaciones matemticas tienen un significado
preciso, distinto al existente desde el lenguaje natural.
Esta competencia desarrolla habilidades, conocimientos
y actitudes que promueven la descripcin, el anlisis, la
argumentacin y la interpretacin en las y los estudiantes
utilizando el lenguaje matemtico, desde sus contextos, sin
olvidar que el lenguaje natural es la base para interpretar
el lenguaje simblico.
Aplicacin de la matemtica al entorno
Es la capacidad de interactuar con el entorno y en
l, apoyndose en sus conocimientos y habilidades
matemticas. Se caracteriza tambin por la actitud
de proponer soluciones a diferentes situaciones de la
vida cotidiana. Su desarrollo implica el fomento de la
creatividad, evitando as el uso excesivo de mtodos
basados en la repeticin.
Bloques de contenido
El programa de estudios est estructurado de acuerdo con
cuatro bloques de contenidos:
1. Aritmtica
Se utiliza la numeracin hasta 1
1
000,000, lo que implica
lectura, escritura y orden de dichos nmeros, su
composicin y descomposicin. Las operaciones de
adicin llevando y sustraccin prestando con nmeros
Presentacin de la asignatura
La asignatura de matemtica permite el desarrollo de
diversas habilidades intelectuales: el razonamiento lgico
y flexible, la imaginacin, la ubicacin espacial, el clculo
mental, la creatividad, etc. Estas capacidades tienen una
aplicacin prctica en la resolucin de problemas de
la vida cotidiana y en la formacin integral de las nias y
los nios.
Enfoque de la asignatura:
resolucin de problemas
Este enfoque responde a la naturaleza de la matemtica:
resolver problemas en los mbitos cientfico, tcnico,
artstico y en la vida cotidiana. En la enseanza matemtica
se parte de que en la solucin de todo problema hay
cierto descubrimiento que puede utilizarse siempre; como
las palabras asociadas a cada operacin aritmtica, los
razonamientos asociados al proceso de resolucin y la
existencia de diversas formas para resolverlo. En este
sentido, los aprendizajes se fijan para la vida no para pasar
una evaluacin. En trminos de enseanza, la y el docente
deben generar situaciones en las que las y los estudiantes
exploren, apliquen, argumenten y analicen los conceptos,
procedimientos, algoritmos u otros tpicos matemticos
acerca de los cuales deben aprender.
Competencias a desarrollar
Razonamiento lgico matemtico
Esta competencia promueve que las y los estudiantes
identifiquen, nombren, interpreten informacin, comprendan
procedimientos, utilicen algoritmos y relacionen conceptos.
57
Programa de estudio de cuarto grado
Se profundiza el concepto de capacidad utilizando
unidades tradicionales de medicin como la taza,
botella y galn. El clculo de volmenes de prismas en
unidades cbicas. Se introducen las medidas agrarias
de peso como la libra, la arroba, el quintal y la tonelada
y la conversin entre ellas. Se establece la relacin entre
capacidad y volumen.
El clculo del tiempo en horas, minutos y segundos.
Se incluye el uso del calendario y los mltiplos del
ao. Por ltimo se hace una revisin de la elaboracin
de presupuestos.
4. Estadstica
En este se ve la representacin de datos en tablas y su
representacin en grficas de barras y pictogramas.
Se inicia el estudio de la media aritmtica de datos no
agrupados.
Relacin entre los bloques de contenido y
las unidades didcticas
Esta propuesta est organizada en unidades ms pequeas
en relacin a las del programa de estudio anterior. Esto
no significa un aumento en el nmero de contenidos. La
intencin es didctica y obedece a las siguientes razones:
El programa anterior, concentraba los contenidos de
aritmtica en la unidad 2. Estos contenidos (nmeros,
suma, resta, multiplicacin y divisin), pueden
ofrecer cierta dificultad para algunos estudiantes,
desmotivndolos. En la propuesta actual los contenidos
de aritmtica se desarrollan alternndolos con otro tipo
de contenidos (por ejemplo, geometra) para intercalar
otra experiencia de aprendizaje, que disminuye la tensin
en el alumnado y lo mantiene siempre en contacto con
aprendizajes matemticos.
de hasta 6 cifras, la multiplicacin de nmeros naturales
con productos menores que 1
1
000,000, y la divisin con
nmeros de hasta 4 cifras en el dividendo y 2 en el divisor.
Tambin se realizan operaciones combinadas con y
sin el uso de los parntesis. En el estudio de los
nmeros naturales se incluyen los mltiplos y divisores
de un nmero.
Se ampla el estudio de fracciones, su representacin
y ubicacin en la recta numrica y las operaciones
de adicin y sustraccin de fracciones homogneas,
incluyendo nmeros mixtos.
Se inicia el estudio de los nmeros decimales hasta con
milsimas, su relacin con las fracciones decimales,
orden y ubicacin en la recta, y las operaciones de
adicin y sustraccin entre ellos.
2. Geometra
Se incluyen en este bloque las lneas poligonales abiertas
y cerradas. Se profundiza el concepto de polgonos y sus
componentes, en especial la clasificacin de tringulos
(como acutngulos, rectngulos y obtusngulos) y
cuadrilteros (paralelogramos, rombo, romboide,
trapecio y trapezoide).
Tambin se hace el estudio de los cuerpos geomtricos,
con especial atencin en los prismas rectangulares y
cubos, as como sus elementos.
3. Medidas
Comprende la medicin de ngulos en grados
utilizando el transportador. Los mltiplos y submltiplos
del metro, su conversin y representacin decimal. El
clculo de permetros y de superficies de tringulos
utilizando frmulas.
58
Programa de estudio de cuarto grado
PROGRAMA ANTERIOR
Unidad 1: Organicemos los datos
Unidad 2: Operemos con los nmeros
Unidad 1: Utilicemos ms nmeros y sus operaciones
PROGRAMA ACTUAL
Unidad 9: Interpretemos datos
Organizacin de datos en tablas, grficos de barras,
combinaciones y arreglos de hasta tres elementos.
Construccin e interpretacin de tablas, grficas de barras verticales y
horizontales, pictogramas, clculo y aplicacin de la media aritmtica.
Los contenidos de medidas, aritmtica, geometra, se
utilizan de manera integrada. Al alternarse, se facilita
aplicar aprendizajes de aritmtica con los otros bloques
de contenido. Esta integracin refuerza su aplicacin y
propicia aprendizajes significativos.
La falta de precisin en la secuencia de la enseanza de
los contenidos matemticos puede propiciar exigir a la
nia o el nio ciertos aprendizajes sin haber garantizado
los prerrequisitos. El programa actual presenta las
unidades didcticas estableciendo una secuencia de
enseanza progresiva de los nmeros y las operaciones,
as como otros conceptos, de modo que se garantice que
los estudiantes han visto los prerrequisitos necesarios
para abordar los nuevos conceptos.
Esta estructura adems de aclarar la secuencia de
enseanza, favorece la planificacin de la evaluacin
formativa (posiblemente al inicio y finalizacin de cada
unidad didctica) y as brindar refuerzo acadmico en
forma oportuna.
A continuacin se presenta la reorganizacin de los contenidos del programa actual con relacin al programa anterior.
Nmeros naturales hasta 1
1
000,000 lectura,
escritura, descomposicin y ordenamiento. Algoritmo
de la adicin, sustraccin y multiplicacin. Divisin
con divisores hasta de dos cifras. Mltiplos de un
nmero. Comparacin y equivalencia de fracciones.
Nmeros decimales y fracciones decimales.
Nmeros naturales hasta 1
1
000,000. Lectura y escritura, descomposicin
y ordenamiento. Valor posicional. Redondeo a la unidad de millar, decena
de millar o centena de millar. Problemas de suma y resta sin exceder de
1
1
000,000.
59
Programa de estudio de cuarto grado
Fracciones propias e impropias, equivalencia de fracciones mixtas e
impropias, amplificacin y simplificacin de fracciones, comparacin de
fracciones, adicin y sustraccin de fracciones homogneas.
Unidad 7: Operaciones con fracciones
PROGRAMA ANTERIOR PROGRAMA ACTUAL
Unidad 5: Aprendamos nmeros decimales
Nmeros decimales hasta las milsimas, suma y resta.
Conversin de fracciones decimales a nmeros decimales.
Longitudes en metros, decmetros y centmetros.
Unidad 4: Construyamos cuadrilteros
Identificacin y construccin de cuadrilteros (rombo, romboide, trapecio,
trapezoide) altura y base de cuadrilteros, resolucin de ejercicios y problemas
sobre cuadrilteros.
UUUU Unidad 3: Estudiemos geometra
Tablas de doble entrada. Rectas paralelas y
perpendiculares, clases de ngulos por su abertura,
opuestos por el vrtice, adyacentes. Congruencia
de tringulos y cuadrilteros. Clasificacin
de cuadrilteros. Polgonos y sus elementos.
Crculo, circunferencia y sus elementos. Cuerpos
geomtricos: cubo, paraleleppedo, esfera, cono,
cilindro y pirmide. Simetra de figuras.
Unidad 2: Encontremos el rea de los tringulos
Medida de ngulos, uso del transportador, construccin de ngulos
segn sus aberturas.
Construccin de tringulos, clculo de rea de tringulos, igualdad de rea
de tringulos cuando los tringulos tienen la misma longitud de base y altura.
Resolucin de ejercicios y problemas.
Unidad 3: Multipliquemos y dividamos
U id d 7 O i f i U
Multiplicacin cuyo producto sea menor que 1
1
000,000; sin llevar y llevando
en todos los casos.
Divisin cuyo dividendo sea menor que 1
1
000,000; sin residuo y con residuo.
Mltiplos y divisores de un nmero.
Operaciones combinadas. Orden de clculo segn las operaciones.
Uso de parntesis.
UUUU
UU

60
Programa de estudio de cuarto grado
PROGRAMA ANTERIOR PROGRAMA ACTUAL
Unidad 10: Apliquemos medidas del entorno
Quintal, libra y arroba; equivalencias y conversiones.
Tonelada y quintal; equivalencias y conversiones.
Sumas de peso en unidades no decimales.
Medicin de tiempos y presupuestos.
Relacin de bloques de contenido y unidades didcticas
PROGRAMA ACTUAL
BLOQUES
Unidad 1: Utilicemos ms nmeros y sus operaciones
Unidad 2: Encontremos el rea de los tringulos
Unidad 3: Multipliquemos y dividamos
Unidad 4: Construyamos cuadrilteros
Unidad 5: Aprendamos nmeros decimales
Unidad 6: Relacionemos capacidad y volumen
Unidad 7: Operemos con fracciones
Unidad 8: Identifiquemos otras figuras
Unidad 9: Interpretemos datos
Unidad 10: Apliquemos medidas del entorno
Aritmtica
Geometra y medidas
Aritmtica
Geometra
Aritmtica
Medidas
Aritmtica
Geometra
Estadstica
Medidas
R l i d bl
Permetros de polgonos, rea de tringulos y
paralelogramos, volumen de paraleleppedos.
Peso en arrobas y quintales. Uso del reloj y del
calendario. Presupuestos.
Unidad 4: Utilicemos medidas Unidad 6: Relacionemos capacidad y volumen
Prismas rectangulares, cubo, elementos de prismas cuadrangulares.
Conversin de galones a botellas y viceversa.
Clculo de volumen del prisma cuadrangular y rectangular.
Ejercicios y problemas sobre el prisma.
Unidad 8: Identifiquemos otras figuras
U id d 10 A li did d l t
Reconocimiento de polgonos identificacin de diagonales, clasificacin de
polgonos, polgonos cncavos y convexos.
Resolucin de ejercicios.
61
Programa de estudio de cuarto grado
Lineamientos metodolgicos
El proceso de enseanza aprendizaje de la matemtica
requiere de metodologas participativas que generen la
bsqueda de respuestas en el estudiante, promoviendo su
iniciativa y participacin en un clima de confianza que les
permita equivocarse sin temor, desarrollar su razonamiento
lgico y comunicar sus ideas para solucionar problemas
del entorno. Se deben hacer esfuerzos para evitar
explicaciones largas de parte de la o el docente y procurar
que las nias y los nios disfruten la clase de matemtica,
la encuentren interesante y til porque construyen nuevos
aprendizajes matemticos.
En el cuarto grado se ampla el conjunto de los naturales
hasta un milln, no slo para continuar con su lectura y
escritura sino para componer y descomponer cantidades
usando el valor posicional de sus cifras. Los conceptos
de mltiplos y divisores son necesarios para la posterior
comprensin de otros algoritmos como la adicin de
fracciones no homogneas que se ver en quinto grado.
Los algoritmos de adicin, sustraccin y multiplicacin deben
ser practicados y comprendidos a cabalidad y su relacin
con el valor posicional, en especial cuando se utilizan ceros
en algunas cifras. Los estudiantes deben ser capaces de
plantear y realizar estas operaciones y comprobarlas o
completarlas en caso de ser necesario.
La profundizacin de la divisin como operacin inversa a
la multiplicacin y utilizando divisores de dos cifras requiere
especial cuidado. Debe enfatizarse en la comprensin de lo
que significa el resto en una divisin inexacta, como antesala
al concepto de decimal que se emplear ms ampliamente
en otros grados.
Objetivos de cuarto grado
1. Utilizar las adiciones, sustracciones, multiplicaciones
y divisiones con los nmeros naturales hasta 1
1
000,000;
realizando la lectura, escritura, composicin y
descomposicin de estos, as como la aplicacin
de algoritmos al resolver con seguridad situaciones
problemticas del entorno.
2. Aplicar la adicin y sustraccin de nmeros decimales
hasta con milsimas, utilizando la lectura, escritura y la
descomposicin, para resolver con precisin problemas
de su cotidianidad.
3. Interpretar la cantidad representada por los nmeros
fraccionarios, su relacin con los nmeros decimales,
aplicando con seguridad los algoritmos de la suma y la
resta al proponer soluciones a diversos problemas.
4. Utilizar los mltiplos y submltiplos del metro, al
determinar el permetro y el rea de tringulos, y
volmenes de prismas triangulares y cuadrangulares,
as como en la construccin de polgonos cncavos y
convexos, al resolver situaciones de su entorno.
5. Utilizar las unidades de medida para capacidad y tiempo,
realizando las conversiones necesarias a fin de resolver
problemticas de su realidad.
6. Interpretar y construir grficas de barras, pictogramas y
tablas estadsticas, a partir de la informacin recolectada
por medio de encuestas; aplicando la media aritmtica,
para la investigacin de fenmenos sociales de
su inters.
62
Programa de estudio de cuarto grado
procedimiento desarrollado en las lecciones del Libro de
texto y la Gua metodolgica. Debe concebirse como un
modelo, puede adecuarse y enriquecerse con la experiencia
docente, el conocimiento del alumnado y los recursos con
los que cuenta la escuela.
Paso 1. Lectura y comprensin de la situacin problemtica.
El alumnado observa una situacin directamente de la
vida real o ilustrada en el Libro de texto y expresa sus
conocimientos sobre la situacin o el contenido a partir de
preguntas generadoras, as se despierta su inters y se
contextualiza el contenido cientfico en una situacin real.
En este paso, las y los nios deben saber cules son los
datos que se dan, qu es lo que queremos averiguar, cules
son las condiciones y si esas condiciones son suficientes
para resolver el problema.
La o el docente presenta la situacin o ilustracin, lee las
preguntas y escucha las respuestas sin corregir a las y los
nios en ese momento.
Paso 2. Escritura del PO.
Las y los estudiantes escriben en notacin matemtica, la
operacin tentativa que los llevar a la solucin.
En este paso, se analiza y reflexiona sobre la conveniencia
de hacer la propuesta de solucin, las conexiones que
existen entre los datos y lo que queremos encontrar. Al final
de este paso, ya se tiene un plan tentativo de solucin.
Paso 3. Ejecucin del PO.
En este paso se realizan los clculos y operaciones necesarias
para aplicar los procedimientos y estrategias elegidas o
incluidas en el PO. Se examina sobre la marcha si cada
uno de los pasos es correcto. Si se tiene dificultad, no hay
El uso del concepto de fraccin y de nmero decimal
debe hacerse utilizando diversas representaciones. Las
operaciones entre estos nmeros son introducidas para
que se relacionen con los nmeros naturales. Es muy
importante que los estudiantes puedan nombrar con
claridad estos nmeros cuando se realicen operaciones
entre ellos.
En geometra la clasificacin de tringulos y cuadrilteros
requiere del dominio de conceptos vistos en grados anteriores
como el paralelismo y la perpendicularidad. Al concepto
de ngulo y su medicin debe drsele especial nfasis, as
como al uso del transportador. El manejo espacial es de
suma importancia por lo que la representacin de las partes
de los cuerpos geomtricos debe estar acompaada de la
construccin de slidos utilizando patrones. Debe hacerse
nfasis en el uso del lenguaje matemtico para nombrar las
partes de figuras y cuerpos geomtricos.
La representacin grfica de datos o la interpretacin de
los mismos es clave para la comprensin de fenmenos
sociales. Se introduce el concepto de media aritmtica, que
se utilizar en muchas situaciones de la vida diaria y de la
misma matemtica.
En todos las procesos de aprendizaje deben plantearse
situaciones que reten a las y los nios, permitan comprobar
resultados; sean atractivos para ellas y ellos; vayan
de lo fcil a lo difcil; obliguen a utilizar conocimientos
previos para resolverlos. Debe usarse y promoverse
el uso de lenguaje matemtico para mejorar la fijacin
de conceptos.
A fin de orientar la metodologa de la asignatura, se proponen
6 pasos que siguen un orden lgico para el desarrollo de
un contenido. Esta secuencia didctica corresponde al
63
Programa de estudio de cuarto grado
Hay dos tipos de clases:
a) La que introduce un nuevo conocimiento.
b) La que fija conocimientos.
Sugerencias para una clase de introduccin de
conocimientos.
1. Iniciar con una pregunta o un problema, acorde al
indicador de logro.
2. Permitir que las nias y los nios resuelvan el problema.
3. Propiciar que las nias y los nios presenten sus ideas.
4. Orientar a las nias y los nios en la discusin sobre las
ideas presentadas.
5. Concluir la discusin y presentar la forma de resolver
el problema.
6. Resolver el problema y evaluar el nivel de comprensin.
Sugerencias para una clase de fijacin de conocimientos.
1. Si los ejercicios que se utilizan contienen algo nuevo
en la forma de calcular, resolverlos con el Libro de
texto cerrado.
2. Despus de que las y los nios han entendido
cmo se resuelven los ejercicios, darles otros
para que los resuelvan de manera individual y
recorrer el aula para detectar las dificultades en las
y los alumnos.
3. Cuando la mayora ha terminado, enviar a la pizarra
en forma simultnea a varias nias y nios, para que
escriban cmo lo hicieron.
4. Las y los alumnos revisan los procedimientos que se han
escrito en la pizarra. Las respuestas equivocadas no
que desistir, hasta que se vea con claridad que el plan no es
vlido; y en este caso, se debe ser flexible; abandonndolo
y volviendo al paso anterior de la bsqueda.
Paso 4. Revisin de la resolucin.
En este paso, se examina el camino seguido; se
comprueban los clculos, y se localizan rutinas para ver si
los procedimientos se pueden generalizar.
Paso 5. Aplicacin del procedimiento a otros similares.
En este paso, se plantean en el Libro de texto, ejercicios
similares al trabajado con anterioridad; y se manda
a las y los nios al cuaderno de apuntes a que
los resuelvan.
Paso 6. Refuerzo.
En este paso, las y los estudiantes, son remitidos al Cuaderno
de ejercicios, donde se encuentran problemas relacionados
con el contenido desarrollado en la clase.
Es muy importante distinguir entre ejercicio y problema.
Un ejercicio es aquella situacin en la que, una vez
identificada la tcnica que precisa, hay que aplicarla en
forma correcta.
Un problema es una situacin cuyos trminos y propsitos
son globalmente comprensibles por la alumna o el alumno,
pero no sabe, de momento, como abordarlos.
Recomendaciones previas para el desarrollo de una clase.
1. Haga una lectura del Libro de texto y la
Gua metodolgica.
2. Verifique los materiales a utilizar.
64
Programa de estudio de cuarto grado
Es importante detectar necesidades de aprendizaje as
como cualidades y habilidades de las y los estudiantes para
fomentar su desarrollo. De esta manera se puede mejorar
la planificacin de la prctica docente de acuerdo a la
realidad del grupo. La evaluacin diagnstica se realiza al
comienzo de un perodo de aprendizaje, no slo al inicio del
ao escolar.
En algunas unidades de Libro de texto Matemtica 4,
se encuentra un apartado llamado Recordemos con
ejercicios que son la base para el desarrollo de la unidad.
Formativa
La evaluacin formativa se tiene que hacer en forma
continua, y el desarrollo de la clase se presta para ir sobre
la marcha controlando el logro de los indicadores de la
leccin. La observacin durante el anlisis, planteamiento y
desarrollo de situaciones problemas durante la clase, sirve
para comprobar y determinar el nivel de aprendizaje de las
nias y los nios para retroalimentar a los que lo necesitan
y lograr la competencia.
La evaluacin formativa ser el principal referente para
ofrecer refuerzo acadmico, este debe llevarse a cabo
antes de aplicar evaluaciones sumativas, es decir, antes de
asignar calificaciones.
Es importante evaluar aprovechando los momentos que sean
pertinentes para determinar lo que las nias y los nios han
aprendido, por ejemplo, al interpretar el problema y tratar
de resolverlo de manera individual, cuando participan en
la discusin de los planteamientos operativos y los clculos
realizados al resolver el problema, en la resolucin de los
ejercicios de leccin, etc.
deben borrarse si no corregirse con otras nias y nios,
valorando el esfuerzo y reconociendo el razonamiento de
la nia o el nio.
Los errores en matemtica no deben considerarse como
algo negativo, sino una etapa normal del proceso. A partir
de los errores, se puede iniciar con mayor reflexin el
proceso de descubrimiento, discusin y construccin que
permite que las nias y los nios aprendan. No hay que
perder de vista, que se aprende matemtica haciendo
matemtica; para conseguirlo, hay que utilizar distintos
tipos de actividades que permitan a las y los nios elaborar
sus propios resultados, y esto conlleva equivocarse; por lo
que deben aprender tambin a evaluar sus resultados. Esta
propuesta metodolgica propicia que las y los nios ejerzan
su protagonismo y autonoma, y que aprendan matemtica
de una manera divertida. As se fortalece la adquisicin y
desarrollo de conocimientos, habilidades y actitudes que le
servirn para seguir estudios y prepararse para la vida.
Lineamientos de evaluacin
Diagnstica
En cuarto grado, la o el docente debe valerse de la
observacin, entrevistas y ejercicios escritos para
diagnosticar los aprendizajes con los que sus estudiantes
inician el ao escolar.
Es necesario conocer los pre saberes con los que inician
el ao escolar, y para ello, es importante enfrentar a las y
los nios, a situaciones donde apliquen los conocimientos
ya adquiridos y evidencien las habilidades bsicas para
enfrentarse a los nuevos conocimientos.
65
Programa de estudio de cuarto grado
Algunas veces las y los estudiantes tendrn dificultades
en un indicador de logro, porque no se asegur el
aprendizaje referido en un indicador previo, que constituye
un prerrequisito. Por ejemplo es necesario reconocer
los nmeros decimales para expresar con precisin los
submltiplos del metro.
La evaluacin formativa es determinante. Se reitera: se debe
monitorear los avances y cumplimientos de las actividades,
prestando atencin individual a las y los nios que ms
necesiten apoyo.
Sumativa
La evaluacin sumativa se planificar a partir de indicadores
de logro y criterios de evaluacin correspondientes a las
competencias. Se deber incluir actividades de evaluacin
integradoras, que constituyan situaciones de resolucin
de problemas cercanos a la realidad y aplicacin de los
tres tipos de contenidos (conceptuales, procedimentales y
actitudinales) de forma interrelacionada.
Las pruebas escritas como instrumentos de evaluacin
sumativa deben considerar los indicadores de logro
priorizados y en ningn momento sern el nico instrumento
para la asignacin de notas.
En los casos de estudiantes con necesidades
educativas especiales se deber incluir actividades de
evaluacin individualizadas que les permitan demostrar
sus competencias.
Criterios de evaluacin
Los criterios que se establezcan para adjudicar la nota,
deben considerar aspectos representativos del aprendizaje.
Si se valora el cuaderno del estudiante, para efectos de
La Gua metodolgica de Matemtica 4, sugiere
constantemente la observacin del desempeo del
alumnado como parte de la evaluacin formativa con frases
como: Que comprueben que..., Que las nias y los nios
descubran que..., Que reconozcan el concepto de...,
Que observen que..., etc.
La evaluacin formativa, requiere que la y el docente
utilice los errores del alumnado para comprender su
razonamiento. Por lo tanto, no se deben corregir los errores
en forma inmediata, sino preguntarles como pensaron
para poder apoyarles en la reflexin y la bsqueda de la
respuesta correcta con la participacin de sus compaeras
y compaeros.
Al revisar los cuadernos debe tomarse en cuenta que
las correcciones tengan una intencin formativa: valorar
el esfuerzo realizado y brindar recomendaciones para
asegurar el aprendizaje. Por ejemplo, al inicio de un
contenido casi siempre se presenta un problema o situacin,
por lo que, al revisar el cuaderno de la nia o del nio
debe tenerse en cuenta el planteamiento del razonamiento
de la situacin, el planteamiento de la operacin (PO),
y la respuesta.
Estas acciones deben ser parte de la prctica de la y el
docente con el propsito de detectar avances, posibilidades,
limitaciones y reorientar el proceso de enseanza
aprendizaje si es necesario, de esta forma la evaluacin
estar al servicio de los aprendizajes.
La evaluacin formativa valora los aprendizajes alcanzados
por cada nia o nio tomando en cuenta los indicadores de
logros, definidos en cada unidad didctica. Se han resaltado
indicadores prioritarios que son claves en la unidad.
1 Ver ejemplo en el documento Evaluacin al Servicio del aprendizaje. MINED, 2007.
66
Programa de estudio de cuarto grado
El indicador de logro se considera como el desempeo
mximo esperado, a partir de ste se deducen desempeos
de menor complejidad y se establecen rangos numricos
de los cuales se obtiene la nota. Ver ejemplo en Evaluacin
al servicio de los aprendizajes.
Para pruebas escritas se recomienda entre otros criterios
los siguientes:
El razonamiento lgico.
Capacidad de comprensin.
Aplicacin de algoritmos.
Coherencia y otros.
calificacin, se recomienda valorar criterios como los
siguientes:
Utilizacin de un proceso lgico: planteamiento de la
situacin, planteamiento de la operacin (PO), validez de
las operaciones y la presentacin de la respuesta a la
situacin problema,
Seguimiento de indicaciones.
Correccin errores, etc.
Para la actividad de integracin se recomienda utilizar la
rbrica (Cuadro, donde se relacionan criterios e indicadores
para evaluar la actividad de integracin)
1
67
Programa de estudio de cuarto grado
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
UNIDAD 1
Objetivos
Nmeros hasta
1
1
000,000.

Decena de millar.


Centena de millar.
Milln.
Formacin de la decena
de millar, centena de
millar y millon.

Lectura y escritura de
cantidades hasta seis
cifras, sin cero, utilizando
numerales y palabras.


Seguridad y confianza en
reconocimiento de los
valores DM, CM y milln.


Atencin al escribir
las cifras en su
correspondiente lugar.


1.1 Reconoce el valor posicional
de las cifras hasta 1
1
000,000,
con seguridad y confianza.
1.2 Cuenta a partir de cualquier
nmero comprendido entre
9,000 y 999,999, con
seguridad y confianza.
1.3 Lee y escribe correctamente
cantidades de seis cifras sin
cero utilizando, con confianza,
numerales y palabra
s.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
Tiempo probable: 15 horas clase
UTILICEMOS
MS NMEROS
Y SUS OPERACIONES
Comparar nmeros naturales menores o iguales que un milln, utilizando los valores
posicionales de sus cifras o la ubicacin en la recta numrica, para interpretar con
inters informaciones numricas del entorno y de los medios de comunicacin.
Utilizar la adicin y la sustraccin de nmeros naturales con totales o minuendos hasta
un milln, en forma vertical, al resolver con seguridad situaciones problemticas de la
vida cotidiana relacionadas con estas operaciones.
Programa de estudio de cuarto grado
68
1.4 Lee y escribe correctamente
cantidades de seis cifras que
contienen cero utilizando,
con confianza, numerales y
palabras.
INDICADORES DE LOGRO CONTENIDOS
Lectura y escritura de
cantidades de seis cifras
que contienen, cero,
utilizando numerales y
palabras.
Seguimiento de las
instrucciones para
formar nmeros hasta
1
1
000,000.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
1.5 Compone y descompone
nmeros hasta 100,000,
en sus valores posicionales
con seguridad.
1.6 Identifica el valor relativo de las
cifras en nmeros de seis cifras,
con seguridad.
1.7 Compone y descompone
nmeros hasta 1
1
000,000,
en sus valores posicionales
con seguridad.
1.8 Escribe con los nmeros
de seis cifras en forma
desarrollada, con seguridad.
Nmeros de seis cifras.
Composicin.


Descomposicin.
Valor posicional.


Seguridad al escribir
nmeros de seis cifras en
forma desarrollada.
Composicin y
descomposicin
de nmeros hasta
100,000 en sus valores
posicionales.
Identificacin del valor
relativo de las cifras en
nmeros de seis cifras.
Composicin y
descomposicin de
nmeros hasta 1
1
000,000
en sus valores posicionales.
Escritura de nmeros
de seis cifras en
forma desarrollada.
1.9 Ubica con precisin nmeros
naturales hasta seis cifras en
la recta numrica.
1.10 Ordena nmeros de seis
cifras y los representa en la
recta numrica con claridad
y seguridad.
Recta numrica. Precisin al ubicar
nmeros naturales hasta
de seis cifras en la recta
numrica.
Seguridad al ordenar
nmeros de seis cifras
y representarlos en la
recta numrica.
Representacin de
nmeros de seis cifras en
la recta numrica.
Ubicacin de nmeros
hasta de seis cifras en la
recta numrica.
Programa de estudio de cuarto grado
69
1.11 Establece las relaciones de
orden entre dos cantidades,
menores a 1
1
000,000 ,
utilizando con seguridad los
signos <, >, =.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
CONTENIDOS INDICADORES DE LOGRO
Comparacin de nmeros
hasta de seis cifras.
1. Seguridad al usar los
signos, <, >, = para
establecer relaciones de
orden entre dos cantidades.
Utilizacin de los signos,
<, >, = para establecer
relaciones de orden entre
dos cantidades.
Reglas de redondeo. Utilizacin de las reglas
de redondeo de nmeros
naturales hasta un milln.
Valoracin de la
utilidad de las reglas de
aproximacin de nmeros
naturales hasta un milln.
1.12 Redondea a la unidad de
millar, decena de millar y
centena de millar prxima,
valorando las reglas.
1.13 Suma verticalmente cantidades
hasta de seis cifras, con totales
hasta de 1
1
000,000 sin llevar.
CMDMUMCDU +
CMDMUMCDU;
CMDMUMCDU + DMUMCDU;
CMDMUMCDU + UMCDU;
CMDMUMCDU + CDU;
CMDMUMCDU + DU;
CMDMUMCDU + U, de forma
ordenada y con esmero.
1.14 Suma verticalmente, de forma
ordenada y con esmero,
cantidades hasta de seis cifras,
con totales hasta de 1
1
000,000
llevando hasta tres veces.
Suma de cantidades
hasta de seis cifras, con
totales menores o iguales
a1
1
000,000 sin llevar.
CMDMUMCDU +
CMDMUMCDU
CMDMUMCDU + DMUMCDU
CMDMUMCDU + UMCDU
CMDMUMCDU + CDU
CMDMUMCDU + DU
CMDMUMCDU + U
Suma de cantidades
hasta de seis cifras, con
totales menores o iguales
1
1
000,000 llevando:
a) Una vez
b) Dos veces
c) Tres veces
d) Cuatro veces
e) Cinco veces
Clculo vertical de suma
con cantidades hasta de
seis cifras, con totales
hasta de 1
1
000,000 sin
llevar
CMDMUMCDU +
CMDMUMCDU;
CMDMUMCDU + DMUMCDU;
CMDMUMCDU + UMCDU;
CMDMUMCDU + CDU;
CMDMUMCDU + DU;
CMDMUMCDU + U.
Clculo vertical de suma
con cantidades hasta de
seis cifras, con totales
hasta de 1
1
000,000
llevando hasta tres veces.
Orden y esmero al
resolver sumas con
cantidades hasta de
seis cifras.
Programa de estudio de cuarto grado
70
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES





1.15 Suma verticalmente cantidades
hasta de seis cifras, con totales
hasta de 1
1
000,000.
CMDMUMCDU +
CMDMUMCDU;
CMDMUMCDU + DMUMCDU;
CMDMUMCDU + UMCDU;
CMDMUMCDU + CDU;
CMDMUMCDU + DU;
CMDMUMCDU + U, llevando
hasta cinco veces.

1.16 Resuelve problemas de la
vida cotidiana utilizando el
clculo vertical de la adicin
sin llevar y llevando con
totales de hasta 1
1
000,000,
con inters.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
Para todos los casos:
CMDMUMCDU +
CMDMUMCDU
CMDMUMCDU + DMUMCDU
CMDMUMCDU + UMCDU
CMDMUMCDU + CDU
CMDMUMCDU + DU
CMDMUMCDU + U






Inters en la solucin
de problemas de la vida
cotidiana, utilizando el
clculo vertical de la
adicin con totales hasta
de 1
1
000,000.
CMDMUMCDU +
CMDMUMCDU;
CMDMUMCDU + DMUMCDU;
CMDMUMCDU + UMCDU;
CMDMUMCDU + CDU;
CMDMUMCDU + DU;
CMDMUMCDU + U.


Clculo vertical de sumas
con cantidades hasta de
seis cifras, con totales
hasta de 1
1
000,000
llevando hasta cinco veces
CMDMUMCDU +
CMDMUMCDU;
CMDMUMCDU + DMUMCDU;
CMDMUMCDU + UMCDU;
CMDMUMCDU + CDU;
CMDMUMCDU + DU;
CMDMUMCDU + U.
Resolucin de problemas
utilizando sumas llevando
y sin llevar con totales
hasta de 1
1
000,000.
Programa de estudio de cuarto grado
71

1.17 Resta verticalmente cantidades
hasta de seis cifras, con
minuendos menores de
1
1
000,000 sin prestar
CMDMUMCDU - CMDMUMCDU;
CMDMUMCDU - DMUMCDU;
CMDMUMCDU - UMCDU;
CMDMUMCDU - CDU;
CMDMUMCDU - DU;
CMDMUMCDU - U de forma
ordenada y con esmero.

1.18 Resta verticalmente cantidades
hasta de seis cifras, con
minuendos menores de
1
1
000,000 prestando hasta
tres veces.
CMDMUMCDU - CMDMUMCDU;
CMDMUMCDU - DMUMCDU;
CMDMUMCDU - UMCDU;
CMDMUMCDU - CDU;
CMDMUMCDU - DU;
CMDMUMCDU U, de forma
ordenada y con esmero.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
Sustraccin de cantidades
hasta de seis cifras, con
minuendos menores que
1
1
000,000 sin prestar.
CMDMUMCDU -
CMDMUMCDU
CMDMUMCDU -
DMUMCDU
CMDMUMCDU - UMCDU
CMDMUMCDU - CDU
CMDMUMCDU - DU
CMDMUMCDU - U
Sustraccin de cantidades
hasta de seis cifras, con
minuendos menores que
1
1
000,000 prestando.
a. Una vez
b. Dos veces
c. Tres veces
d. Cuatro veces
e. Cinco veces
Clculo vertical de resta
de cantidades hasta de
seis cifras, con minuendos
menores de 1
1
000,000
sin prestar
CMDMUMCDU -
CMDMUMCDU;
CMDMUMCDU - DMUMCDU;
CMDMUMCDU - UMCDU;
CMDMUMCDU - CDU;
CMDMUMCDU - DU;
CMDMUMCDU - U.
Clculo vertical de resta
de cantidades hasta de
seis cifras, con minuendos
menores de 1
1
000,000
prestando hasta tres veces
CMDMUMCDU -
CMDMUMCDU;
CMDMUMCDU -
DMUMCDU;
CMDMUMCDU - UMCDU;
CMDMUMCDU - CDU;
CMDMUMCDU - DU;
CMDMUMCDU - U.
1
1
Orden y esmero al resolver
restas con cantidades de
seis cifras.
Programa de estudio de cuarto grado
72
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES

1.19 Resta verticalmente,
cantidades hasta de seis
cifras, con minuendo
menores de 1
1
000,000
prestando hasta cinco veces
CMDMUMCDU - CMDMUMCDU;
CMDMUMCDU - DMUMCDU;
CMDMUMCDU - UMCDU;
CMDMUMCDU - CDU;
CMDMUMCDU - DU;
CMDMUMCDU U, de forma
ordenada y con esmero.



1.20 Resuelve problemas de la
vida cotidiana con inters,
utilizando el clculo vertical
de la sustraccin, prestando
y sin prestar con minuendos
menores de 1
1
000,000.
Para todos los casos:
CMDMUMCDU -
CMDMUMCDU
CMDMUMCDU - DMUMCDU
CMDMUMCDU - UMCDU
CMDMUMCDU - CDU
CMDMUMCDU - DU
CMDMUMCDU - U
1
1


Inters en la solucin
de problemas de la vida
cotidiana, utilizando el
clculo vertical de la
sustraccin con minuendos
menores de 1
1
000,000.
Clculo vertical de resta
de cantidades hasta de
seis cifras, con minuendos
menores de 1
1
000,000
prestando hasta cinco
veces
CMDMUMCDU -
CMDMUMCDU;
CMDMUMCDU -
DMUMCDU;
CMDMUMCDU - UMCDU;
CMDMUMCDU - CDU;
CMDMUMCDU - DU;
CMDMUMCDU - U.
Resolucin de problemas
aplicando restas sin prestar
y prestando con minuendos
menores de 1
1
000,000.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
73
Programa de estudio de cuarto grado
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Objetivos
ngulos.
Medida en grados.
ngulo llano.
Transportador.

Escuadras de 30,
60 45.
Identificacin y utilizacin
del grado como unidad de
medida de ngulos.
Utilizacin del
transportador para
medir ngulos menores y
mayores que 180.
Identificacin y
clasificacin de ngulos
utilizando instrumentos
de geometra.
Construccin de ngulos
utilizando transportador.
Inters por identificar la
relacin que existe entre la
abertura de un ngulo y el
grado.
Valora el uso del
transportador.
Seguridad e inters
al utilizar escuadras y
el transportador para
identificar y clasificar
ngulos.
Seguimiento de
instrucciones en la
construccin de ngulos.
2.1 Identifica y utiliza el grado como
unidad de medida de ngulos
con inters.
2.2 Utiliza y valora el uso del
transportador para medir
ngulos menores y mayores
que 180.
2.3 Identifica y clasifica los ngulos
con seguridad e inters utilizando
escuadras y el transportador.
2.4 Construye, siguiendo
instrucciones, ngulos de
diferentes medidas utilizando
el transportador.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
Tiempo probable: 16 horas clase
UNIDAD 2
ENCONTREMOS EL REA
DE LOS TRINGULOS
Trazar con precisin ngulos agudos, rectos y obtusos utilizando regla y transportador, y
aplicar el trazo en la construccin de figuras que se encuentran en el entorno.
Encontrar con seguridad el rea de tringulos, utilizando diferentes procedimientos,
incluyendo la identificacin de la base y la altura al aplicar la frmula para dar solucin a
situaciones del entorno que implican la medicin de superficies.
2.5 Identifica los tringulos segn
sus ngulos y los clasifica en:
acutngulos, rectngulos y
obtusngulos; con seguridad.
Tringulo:
Acutngulo.
Rectngulo.
Obtusngulo.
Identificacin y
clasificacin de tringulos
segn sus ngulos internos
acutngulos, rectngulos y
obtusngulos.
2 Seguridad en la
clasificacin de tringulos.
Programa de estudio de cuarto grado
74
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
2.6 Construye tringulos
acutngulos, rectngulos y
obtusngulos utilizando los
instrumentos de geometra
con inters y precisin.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
Construccin de tringulos
acutngulos, rectngulos
y obtusngulos.
2
Inters por construir
tringulos utilizando con
precisin los instrumentos
de geometra.
Precisin en el uso de
instrumentos de geometra,
para construir tringulos.
2.7 Calcula con constancia el rea
de tringulos rectngulos sin
utilizar frmulas.
2.8 Calcula el rea de
tringulos, siguiendo
diferentes procedimientos.
2.9 Deduce, construye y utiliza la
frmula para calcular el rea
de tringulos, con inters.
2.10 Identifica y traza la altura en un
tringulo y encuentra el rea
utilizando la frmula,
con seguridad.
2.11 Demuestra que el rea de dos
tringulos es igual cuando sus
bases son iguales y sus alturas
son iguales, con seguridad.
2.12 Resuelve problemas aplicando
la medicin y/o el clculo
del rea de tringulos con
dedicacin.
rea de tringulos
Base
Altura
Frmula A =
2
2
2
2
2
2
Constancia en el clculo
del rea de tringulos.

Inters en la deduccin de
la frmula para el clculo
del rea de tringulos.
Seguridad al identificar
la base y la altura
de tringulos.
Seguridad en la
demostracin de la
igualdad de las reas de
dos tringulos cuando
tienen la base y la altura
de la misma longitud.
Dedicacin en la
resolucin de problemas
de medicin y/o el clculo
del rea de tringulos.
Clculo del rea
de tringulos con
procedimientos grficos.
Deduccin, construccin
y utilizacin de la frmula
del rea de tringulos.
Identificacin y trazo de
la altura de tringulos
para la aplicacin de
la frmula.
Demostracin de la
igualdad de las reas de
dos tringulos cuando
tienen la base y la altura
de la misma longitud.
Resolucin de problemas
aplicando medicin y/o
el clculo del rea de
tringulos.
2
bxa
Programa de estudio de cuarto grado
75
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Objetivos
Multiplicacin.
Multiplicacin UMCDUxU
y DMUMCDUxU sin
llevar y llevando, todos
los casos.


Propiedad asociativa.
axbxc = (axb)xc = ax(bxc)
Multiplicacin de la forma
UMCDU x U y
DMUMCDU x U llevando
1, 2, 3 y 4 veces, como
continuidad de la regla del
producto CDU x U.

Identificacin y uso de
la propiedad asociativa
del producto.
Confianza al realizar la
multiplicacin por U, sin
llevar y llevando.




Seguridad al usar la
propiedad asociativa
en multiplicaciones de
varios factores.
3.1 Resuelve productos de
la forma UMCDU x U y
DMUMCDU x U llevando
1, 2, 3 y 4 veces, como
continuidad de la regla
del producto CDU x U,
con confianza.
3.2 Multiplica siguiendo la
prioridad que indica propiedad
asociativa de la multiplicacin,
con seguridad.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
Tiempo probable: 35 horas clase
UNIDAD 3
MULTIPLIQUEMOS
Y DIVIDAMOS
Aplicar multiplicacin y divisin de nmeros naturales hasta un milln con multiplicador
o divisor de una y dos cifras, al proponer con confianza soluciones a problemticas del
entorno, valorando la opinin de los dems.
Encontrar los mltiplos y divisores de un nmero utilizando la relacin axb=c para la
resolucin de situaciones del entorno que impliquen correspondencia entre ambos.
Programa de estudio de cuarto grado
76
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
3.3 Deduce con inters el proceso
para multiplicar por D0 y C00.
3.4 Calcula multiplicaciones DU x
D0 y CDU x D0 multiplicado
slo la decena del multiplicador
y agregando cero.
3.5 Aplica y explica el proceso de
multiplicar por D0 y C00, con
claridad y seguridad.
3.6 Resuelve problemas aplicando
el proceso de multiplicar por D0
y C00, con inters.
Multiplicacin por
D0 y C00.
3
3
3
3
Inters en deducir la regla
para multiplicar por
D0 y C00.
Claridad y seguridad al
explicar en forma oral la
regla de la multiplicacin
por D0 y C00.
Inters en resolver
problemas aplicando el
proceso de multiplicar
por D0 y C00.
Deduccin de la regla
para multiplicar por
D0 y C00.
Aplicacin y explicacin de
la regla para multiplicar
por D0 y C00.
Resolucin de problemas
aplicando el proceso de
multiplicar por D0 y C00.
3.7 Resuelve multiplicaciones del
tipo UxDU; DUxDU; CDUxDU;
UMCDUxDU; DMUMCDUxDU
descomponiendo el
multiplicador, valorando la
importancia del valor posicional.

3.8 Calcula multiplicaciones
CDU x DU y UMCDU x DU
en la forma vertical.
Multiplicacin por DU
U x DU
DU x DU
CDU x DU
UMCDU x DU
DMUMCDU x DU
Sin llevar y llevando,
todos los casos.
Multiplicacin U x DU
DU x DU;
CDU x DU;
UMCDU x DU;
DMUMCDU x DU sin llevar
y llevando, todos los casos.
Multiplicacin CDU x DU
y UMCDU x DU en la
forma vertical y con cero
en el multiplicando.
Valoracin de la
importancia del uso
del valor posicional en
las multiplicaciones.
Programa de estudio de cuarto grado
77
3.9 Deduce y explica la propiedad
conmutativa, con inters.

3.10 Efecta multiplicaciones
cambiando el orden de los
factores.
3.11 Aplica la propiedad
conmutativa con confianza en
multiplicaciones
U x DU, U x CDU y DU x CDU.
3.12 Resuelve problemas
aplicando la propiedad
conmutativa, con inters.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Propiedad conmutativa. Deduccin y explicacin de
la propiedad conmutativa.

Cambio de orden
de factores en
multiplicaciones U x DU,
U x CDU y DU x CDU.

Resolucin de problemas
utilizando la propiedad
conmutativa.
Confianza al usar la
propiedad conmutativa.
Inters en la propiedad
conmutativa.

Inters en resolver
problemas aplicando la
propiedad conmutativa.
3.13 Resuelve divisiones del tipo
UMCDU U con residuo,
mostrando confianza.
Divisin entre U.
UMCDU U con residuo.
Confianza al calcular
divisiones UMCDU U
con residuo.
Clculo de la divisin
UMCDU U con residuo.
3.14 Resuelve divisiones del tipo
DU D0 con o sin residuo,
reconociendo la importancia
el valor posicional.

3.15 Divide DU DU aproximando
el divisor a la decena prxima
para encontrar el cociente,
con precisin.
Divisin entre DU.
D0D0; DUDU;
CDUDU UMCDUDU,
CMUMCDUDU; con y
sin residuo.
Clculo de la divisin
DU D0 = U con y sin
residuo.


Clculo de la divisin
DU DU aproximando
el divisor a la decena
prxima con y sin residuo.
3
3
Reconocimiento de la
importancia del uso
del valor posicional en
las divisiones.

Precisin en el clculo de
la divisin.
Programa de estudio de cuarto grado
78
3.16 Resuelve divisiones del tipo
CDU DU = U con y sin
residuo, con seguridad.
3.17 Efecta con seguridad divisiones
del tipo CDU DU = DU con
y sin residuo.
3.18 Efecta con seguridad divisiones
del tipo UMCDU DU = CDU,
CDU DU = C0U y
UMCDU DU = DU
con residuo.
3.19 Resuelve con inters problemas
aplicando la divisin.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
Clculo de
CDU DU = U
con y sin residuo.
Clculo de
CDU DU = DU
con y sin residuo.
Clculo de
UMCDU DU = CDU,
CDU DU = C0U y
UMCDU DU = DU.
Resolucin de problemas
aplicando la divisin.


Seguridad en el clculo
de divisiones.



Inters en resolver
problemas aplicando la
divisin.
3.20 Aplica la forma abreviada
al dividir entre D0 y C00
eliminando ceros del dividiendo
y el divisor, antes de efectuar la
divisin, con seguridad.
3.21 Resuelve problemas en equipo
aplicando el mtodo abreviado
de la divisin entre D0 y C00.
Divisin abreviada
CMDMUMCDOC00
CMDMUMCDOD0
Clculo abreviado de la
divisin con cero en las
unidades y decenas del
dividendo y del divisor.
Resolucin de problemas
utilizando el mtodo
abreviado de la divisin
entre D0 y C00.
Seguridad al calcular
divisiones abreviadas.


Trabajo en equipo en la
solucin de divisiones.
Programa de estudio de cuarto grado
79
3.22 Encuentra el mltiplo de
un nmero, multiplicndolo
por otro nmero natural,
participando activamente
en ello.
3.23 Identifica entre un grupo de
nmeros cul es mltiplo de
ciertos nmeros.
3.24 Demuestra que la suma o
resta de dos mltiplos de un
nmero tambin es mltiplo
de dicho nmero.
3.25 Prueba que el mltiplo del
mltiplo de un nmero tambin
es mltiplo de ese nmero.
3.26 Encuentra los divisores de un
nmero formando parejas al
dividir, con inters.
3.27 Explica la diferencia entre los
mltiplos de un nmero y
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Mltiplos y divisores de un
nmero.
3
3
3
3
3
3
Participacin activa en la
bsqueda de mltiplos de
un nmero.


Inters en la bsqueda de
divisores de un nmero.

Seguridad al explicar la
diferencia entre mltiplo
y divisor.

Inters en resolver
problemas que involucran
mltiplos y divisores.
Clculo de los mltiplos de
un nmero.


Clculo de los divisores
de un nmero.
Explicacin de la
diferencia entre mltiplo
y divisor.

Resolucin de problemas
que involucran mltiplos
y divisores.
Programa de estudio de cuarto grado
80
3.29 Resuelve ejercicios y
problemas que combinan
dos o tres operaciones
aritmticas de suma, resta,
multiplicacin y divisin,
con parntesis mostrando
confianza.
3.30 Sigue el orden de prioridad
al realizar operaciones
combinadas de suma,
resta, multiplicacin y
divisin, con precisin.

3.31 Resuelve problemas aplicando
las operaciones combinadas
con inters.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
Operaciones combinadas. Clculo de operaciones
combinadas de suma,
resta, multiplicacin
y divisin, usando
parntesis.

Clculo de las
operaciones combinadas
utilizando la jerarqua de
la operaciones.
Resolucin de problemas
aplicando las operaciones
combinadas.
3
3
3
Confianza en el uso de las
operaciones combinadas
de suma, resta,
multiplicacin y divisin.


Precisin en la aplicacin
de la jerarqua en
operaciones combinadas.

Inters en resolver
problemas aplicando las
operaciones combinadas.
Programa de estudio de cuarto grado
81
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Objetivo
Cuadrilteros.
Paralelogramos.

Romboides.
Construccin de
cuadrilteros en el
geoplano (paralelogramo,
rombo, romboide,
trapezoide y trapecios).

Clasificacin de
cuadrilteros por el
paralelismo de sus lados.

Identificacin y
construccin de
romboides, utilizando
instrumentos de geometra.
Inters al construir
cuadrilteros en el
geoplano.
Inters en clasificar
cuadrilteros por el
paralelismo entre sus
lados.

Seguridad en el uso de
instrumentos de geometra.
4.1 Construye cuadrilteros
utilizando el geoplano,
con inters.




4.2 Clasifica los cuadrilteros por
el paralelismo de sus lados,
con inters.


4.3 Identifica y construye romboides,
utilizando con seguridad
transportador, comps
y escuadras.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
UNIDAD 4
Tiempo probable: 10 horas clase
CONSTRUYAMOS
CUADRILTEROS
Clasificar los cuadrilteros atendiendo al paralelismo de sus lados y la abertura de sus
ngulos, utilizando instrumentos geomtricos para la construccin de formas geomtricas y
figuras, con creatividad.
Programa de estudio de cuarto grado
82
4.4 Identifica y construye
rombos, utilizando
transportador, escuadras y
comps, con seguridad.
4.5 Identifica trapecios y
trapezoides, y construye
trapecios, utilizando
escuadras y transportador,
con inters.
Rombos.




Trapecios.
Trapezoides.
Identificacin y
construccin de rombos
utilizando transportador,
escuadras y comps.

Identificacin y
construccin de trapecios
y trapezoides.
Seguridad en la
identificacin y
construccin de rombos,
utilizando transportador,
escuadras y comps.
Inters en identificar
trapezoides.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
Programa de estudio de cuarto grado
83
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Objetivos
Nmeros decimales.
Dcimas.
Centsimas.
Milsimas.

Medidas en metros
y centmetros.
Reconocimiento de los
nmeros decimales.
Utilizacin de nmeros
decimales hasta dcimas,
para expresar medidas
en metros.
Utilizacin de nmeros
decimales hasta las
dcimas para expresar
una medida en
centmetros.
Inters en los nmeros
decimales.
Precisin al utilizar
nmeros decimales
para expresar medidas
en metros.
Seguridad al utilizar
nmeros decimales
hasta las dcimas para
expresar una medida
en centmetros.
5.1 Reconoce con inters nmeros
decimales.
5.2 Utiliza nmeros decimales hasta
dcimas, para expresar con
precisin medidas en metros.

5.3 Utiliza nmeros decimales
hasta las dcimas para expresar
una medida en centmetro,
con seguridad.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
UNIDAD 5
Tiempo probable: 40 horas clase
APRENDAMOS
NMEROS DECIMALES
Aplicar con seguridad los nmeros decimales reconociendo el valor posicional de los
dgitos que lo forman para representar valores menores que la unidad, asociados a
mediciones del entorno.
Calcular adiciones y sustracciones de nmeros decimales en forma vertical, ubicando
correctamente las cantidades de acuerdo al valor posicional para resolver con exactitud
problemas de la vida cotidiana.
Programa de estudio de cuarto grado
84
5.4 Representa los nmeros
decimales, hasta las dcimas en
la recta numrica, con precisin.
5.5 Compara nmeros decimales,
utilizando los signos <, >, =;
con seguridad.
5.6 Reconoce con seguridad,
medidas de 0.01 m en su
representacin grfica.
5.7 Reconoce con seguridad,
medidas de 0.001 m en su
representacin grfica.
5.8 Divide las dcimas en
centsimas, con seguridad.
5.9 Divide las centsimas en
milsimas, con seguridad.

5.10 Reconoce medidas de dcimas
y centsimas de metro en
su representacin grfica,
con seguridad.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
Representacin grfica. Representacin de
decimales hasta las
dcimas en la recta
numrica.
Comparacin de decimales
usando <, >, =.

Reconocimiento de
medidas de 0.01 m en
su representacin grfica.
Reconocimiento de
medidas de 0.001 m en
su representacin grfica.
Divisin de las dcimas
en centsimas.
Divisin de las centsimas
en milsimas.
Reconocimiento de
medidas en dcimas y
centsimas de metro en su
representacin grfica.
5
5
5
5
5
5
5
Precisin al representar
decimales hasta las
dcimas en la recta
numrica.
Seguridad en la
comparacin de decimales
usando <, >, =.
Seguridad en el
reconocimiento
de medidas en su
representacin grfica.

Seguridad en la divisin de
las dcimas en centsimas.
Seguridad en la
divisin de las
centsimas en milsimas.
Seguridad al reconocer
medidas de dcimas y
centsimas de metro en
su representacin grfica.
Programa de estudio de cuarto grado
85
5.11 Representa con seguridad los
nmeros decimales en la tabla
de valores posicionales.


5.12 Descompone nmeros
decimales hasta las dcimas,
utilizando la tabla de valores,
con inters.
5.13 Descompone con inters
nmeros decimales hasta las
centsimas, utilizando la tabla
de valores.







5.14 Compone nmeros decimales
hasta las dcimas, utilizando la
tabla de valores, con inters.
INDICADORES DE LOGRO CONTENIDOS
Valores relativo de
nmeros decimales.



Tabla de valores.

Descomposicin.
Representacin de los
nmeros decimales
en la tabla de valores
posicionales.

Descomposicin de
nmeros decimales, hasta
las dcimas.

Descomposicin de
nmeros decimales, hasta
las centsimas.
Descomposicin de
nmeros decimales, hasta
las milsimas.


Composicin de nmeros
decimales, hasta las
dcimas.
Seguridad al representar
nmeros decimales
en la tabla de valores
posicionales.

Inters en la composicin
y descomposicin de
nmeros decimales.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Programa de estudio de cuarto grado
86
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
5.15 Compone nmeros decimales
hasta las centsimas, utilizando
la tabla de valores, con inters.
5.16 Compone con inters nmeros
decimales hasta las milsimas,
utilizando la tabla de valores.
Composicin de
nmeros decimales,
hasta las centsimas.
Composicin de
nmeros decimales,
hasta las milsimas.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
5.17 Lee, reconoce y determina
el valor relativo de las cifras
decimales, con seguridad.
5.18 Encuentra el producto y la
divisin de un nmero
decimal por 10, 100 y 1,000,
con seguridad.
5.19 Compara nmeros decimales
en la recta numrica y por valor
posicional, con seguridad.


5.20 Resuelve problemas que
involucran multiplicacin y
divisin de un nmero
decimal por U, D0 y C0,
trabajando en equipo.
Comparacin de nmeros
decimales.

Multiplicacin y divisin
de un nmero decimal
por U, DO y CO.
Lectura, reconocimiento y
determinacin de valores
relativos de las cifras
decimales.
Multiplicacin y divisin
de un nmero decimal por
10, 100 y 1,000.
Comparacin de nmeros
decimales en la recta
numrica y por valor
posicional.

Resolucin de problemas
que involucran
multiplicacin y divisin
de un nmero decimal por
U, D0 y C0.
5
5
5
5
Seguridad para determinar
valores relativos.

Seguridad al multiplicar y
dividir un nmero decimal
por 10, 100 y 1,000.
Seguridad al comparar
nmeros decimales en
la recta numrica y por
valor posicional.

Trabajo en equipo en la
resolucin de problemas.
Programa de estudio de cuarto grado
87
5.21 Suma nmeros decimales
hasta las dcimas sin llevar,
con inters.
5.22 Suma nmeros decimales
llevando de las dcimas a
las unidades.
5.23 Suma con inters nmeros
decimales hasta con centsimas
sin llevar.
5.24 Suma con inters nmeros
decimales hasta con
centsimas, llevando.
5.25 Suma con inters nmeros
decimales hasta con
centsimas, llevando.
5.26 Suma nmeros decimales
hasta las centsimas, cuyo
resultado contiene cero en
las centsimas.
5.27 Suma nmeros decimales hasta
las milsimas con diferentes
nmeros de cifras en la parte
decimal, con dedicacin.
5.28 Resuelve problemas que
involucran adicin de nmeros
decimales, cooperando en ello.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
Adicin de nmeros
decimales.
U.d + U. d
U.d + 0. d
0.d + 0.d
0.d + U
U.dc + U.dc
U.dc + 0.dc
Sin llevar y llevando.
U.dcm + U.dcm
U.dcm +0.dcm
U.dcm +0.0cm
U.dcm + 0.00m
U.d + U.dc
U.d + U.dcm
U.dc + U.dcm
Sin llevar y llevando.
5
5
5
5
5
5
5
5
Inters en la adicin de
los nmeros decimales.








Dedicacin en la adicin
de nmeros decimales
con diferencia nmero de
cifra decimales.






Cooperacin en la
resolucin de problemas.
Adicin de nmeros
decimales hasta con
centsimas (U.d +0.d;
Udc +0.dc) sin llevar.
Adicin de nmeros
decimales hasta con
centsimas (U.d +0.d;
U.dc +0.dc) llevando.



Adicin de nmeros
decimales hasta con
milsimas
(U.dcm + U.dcm;
U.dcm + 0.dcm,
U.dcm +0.0cm;
U.dcm + 0.00m) llevando.
Adicin de nmeros
decimales con diferente
nmero de cifra decimales.


Resolucin de problemas
que involucran adicin de
nmeros decimales.
Programa de estudio de cuarto grado
88
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
5.29 Resta con seguridad nmeros
decimales hasta con dcimas
sin prestar.
5.30 Resta con inters nmeros
decimales hasta con dcimas
prestando en las unidades.
5.31 Resta nmeros decimales hasta
con centsimas, sin prestar.
5.32 Resta nmeros decimales hasta
con centsimas, prestando
una vez.
5.33 Resta nmeros decimales hasta
con centsimas, prestando
dos veces.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
Sustraccin de nmeros
decimales.
U.d - U.d
U.d - 0.dc
U - U.d
U.dc - U.dc
sin prestar y prestando.
5
5
5
5
5
Seguridad al sustraer
nmeros decimales hasta
con dcimas sin prestar.
Seguridad al sustraer
nmeros decimales hasta
con dcimas prestando.
Seguridad al sustraer
nmeros decimales hasta
con centsimas sin prestar.
Seguridad al sustraer
nmeros decimales hasta
con centsimas prestando
una vez.
Sustraccin de nmeros
decimales hasta con
dcimas sin prestar.
Sustraccin de nmeros
decimales hasta con
dcimas prestando.
Sustraccin de nmeros
decimales hasta con
centsimas sin prestar.
Sustraccin de nmeros
decimales hasta con
centsimas prestando
una vez.
Sustraccin de nmeros
decimales hasta con
centsimas prestando
dos veces.
5.34 Resta nmeros decimales donde
el minuendo tiene ms cifras
decimales, con inters.
5.35 Resuelve problemas
aplicando la sustraccin
de nmeros decimales,
con seguridad.
Sustraccin de nmeros
decimales donde el
minuendo tiene ms cifras
que el sustraendo.
Sustraccin donde el
minuendo tiene ms cifras
decimales.
Resolucin de problemas
aplicando la sustraccin
de nmeros decimales.
5
5
Inters al efectuar restas
donde el minuendo tiene
ms cifras decimales.
Seguridad en el redondeo
de los nmeros decimales
hasta las centsimas.
Programa de estudio de cuarto grado
89
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Redondeo de nmeros
decimales.
Redondeo de los
nmeros decimales
hasta las centsimas.
Redondeo de los
nmeros decimales
hasta las dcimas.
Resolucin de problemas
aplicando el redondeo
de nmeros decimales.
Seguridad en el redondeo
de los nmeros decimales
hasta las dcimas.
Trabajo en equipo en la
resolucin de problemas.
5.36 Redondea a las centsimas
los nmeros decimales,
con seguridad.
5.37 Redondea a las dcimas
los nmeros decimales,
con seguridad.
5.38 Resuelve problemas
aplicando el redondeo
de nmeros decimales,
trabajando en equipo.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
5.39 Relaciona los nmeros
decimales y las fracciones
decimales, con seguridad.
5.40 Convierte con precisin
nmeros decimales sin
parte entera a
fracciones decimales.
5.41 Convierte con precisin
nmeros decimales con
centsimas y milsimas
sin parte entera a
fracciones decimales.
5.42 Resuelve problemas utilizando
la conversin de fracciones
decimales a nmeros decimales,
con inters.
Nmeros decimales y
fracciones.
Seguridad al relacionar
los nmeros decimales y
las fracciones decimales.



Precisin al convertir
nmeros decimales a
fracciones y viceversa.
Inters en la resolucin
de problemas.
Relacin de los nmeros
decimales con las
fracciones decimales.
Conversin de nmeros
decimales sin parte entera
a fracciones decimales.

Conversin de nmeros
decimales con
centsimas y milsimas
sin parte entera a
fracciones decimales.
Resolucin de problemas
utilizando la conversin
de fracciones decimales a
nmeros decimales.
Programa de estudio de cuarto grado
90
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Longitud
Instrumentos para medir
Tabla de valores
posicionales de mltiplos
y submltiplos del metro
.
Mltiplos del metro:
1 dam = 10 m
1 hm = 100m
Submltiplos del metro:
1 dm = 0.1 m
1 cm = 0.01 m
1 mm = 0.001 m
1 m = 10 dm
1 m = 100 cm
1 m = 1,000 mm
Medicin de longitudes
de objetos y distancias
entre dos puntos utilizando
instrumentos para medir.
Utilizacin de la tabla de
valores posicionales con
las unidades del metro.
Identificacin y utilizacin
de mltiplos del metro.
1 dam = 10 m
1 hm = 100m
Identificacin y utilizacin
de submltiplos del metro.
1 dm = 0.1 m
1 cm = 0.01 m
1 mm = 0.001 m
Equivalencias y
conversiones de unidades
de longitud dentro del
sistema mtrico decimal.
Resolucin de problemas
utilizando mltiplos y
submltiplos del metro.
Precisin en la medicin
de longitudes de
objetos y distancias
entre dos puntos.
Seguridad en el uso
de la tabla de valores
posicionales con las
unidades del metro.
Seguridad en la
identificacin de mltiplos
del metro.
Seguridad en la
identificacin de
submltiplos del metro.
Precisin en el uso de
equivalencias de unidades
de longitud del sistema
mtrico decimal.
Confianza en la resolucin
de problemas que
involucran mltiplos y
submltiplos del metro.
5.43 Mide con precisin la distancia
entre dos puntos, utilizando
instrumentos para medir.
5.44 Encuentra la distancia entre dos
puntos de una regla, mediante
el clculo.
5.45 Utiliza con seguridad la tabla
de valores posicionales con las
unidades del metro.
5.46 Identifica y utiliza con seguridad
las unidades oficiales hm y dam.

5.47 Identifica y utiliza con seguridad
las unidades oficiales dm, cm
y mm.
5.48 Convierte con precisin
unidades del sistema mtrico
decimal, usando la tabla de
valores posicionales con las
unidades del metro.
5.49 Resuelve problemas utilizando
mltiplos y submltiplos del
metro, con confianza.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
91
Programa de estudio de cuarto grado
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Objetivos
Slidos geomtricos.
Prismas rectangulares y
cuadrangulares.
Prismas triangulares.
Clasificacin de prismas
rectangulares y cubos.


Reconocimiento
de elementos de
prismas cuadrangulares.
Reconocimiento
de elementos de
prismas triangulares.
Identificacin y
diferenciacin de prismas
cuadrangulares
y triangulares.
Inters y seguridad en la
clasificacin de prismas
rectangulares y cubos.

Seguridad al reconocer
elementos de prismas
cuadrangulares.
Seguridad al reconocer
elementos de prismas
triangulares.
Seguridad al identificar
y diferenciar prismas
cuadrangulares y
triangulares.
6.1 Identifica con inters prismas
rectangulares en un grupo de
slidos geomtricos.
6.2 Clasifica los prismas en cubos
y prismas rectangulares,
con seguridad.
6.3 Reconoce y seala con
seguridad las bases y la altura
en un prisma cuadrangular.
6.4 Nombra y enumera los vrtices
y las aristas en un prisma
cuadrangular.
6.5 Nombra y enumera los vrtices
y las aristas en un prisma
triangular.
6.6 Identifica y diferencia prismas
cuadrangulares y triangulares,
con seguridad.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
d f
INDICADORES DE LOGRO CONTENIDOS
UNIDAD 6
Tiempo probable: 18 horas clase
RELACIONEMOS
CAPACIDAD Y VOLUMEN
Identificar con inters prismas rectangulares y triangulares, en un grupo de slidos
geomtricos, verificando el paralelismo de caras laterales y la forma de sus bases para
resolver, aplicando la frmula, problemas de clculo de volumen en centmetros cbicos.
Utilizar galones, botellas y tazas realizando con perseverancia conversiones entre ellas al
medir capacidades en situaciones de la vida cotidiana.
Programa de estudio de cuarto grado
92
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Capacidad.
Unidades de medida.
Galn = 5 botellas
1 botella = 3 tazas
Conversin de botellas a
galn y viceversa.
Conversin de botellas a
galn y viceversa.
Conversin de tazas a
botellas y viceversa.


Resolucin de problemas
que involucran medidas
de capacidad.
Perseverancia en la
conversin de unidades.
Seguridad al convertir
de tazas a botellas
y viceversa.

Trabajo en equipo al
resolver problemas
que involucran medidas
de capacidad.
6.7 Convierte galones a botellas y
botellas a galones, utilizando
la equivalencia entre ellos,
con perseverancia.
6.8 Convierte tazas a botellas y
botellas a tazas, utilizando la
equivalencia entre las unidades,
con seguridad.
6.9 Resuelve problemas que
involucran medidas de
capacidad, en equipo.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
6.10 Construye y explica el
significado del volumen,
con inters.
6.11 Relaciona el concepto
de volumen y capacidad,
con inters.
6.12 Compara volmenes en
forma directa e indirecta,
utilizando unidades cbicas,
con seguridad.
6.13 Calcula el volumen del
prisma cuadrangular
contando unidades cbicas,
con confianza.

6.14 Deduce, construye y utiliza
la frmula del volumen del
cubo, con perseverancia.
Volumen.
Relacin entre capacidad
y volumen.
Unidades de volumen
cm
3.
Frmula del volumen
del cubo.
lado x lado x lado.
6
6
6
6
6
Inters en la construccin
del concepto del volumen.
Inters en relacionar el
concepto de volumen y
el de capacidad.
Seguridad al comparar
volmenes directa e
indirectamente.
Confianza en el clculo
del volumen del prisma
cuadrangular contando
unidades cbicas.
Perseverancia al deducir,
construir y utilizar la
frmula del volumen
del cubo.
Construccin y explicacin
del concepto del volumen.
Relacin entre el concepto
del volumen y de
capacidad.
Comparacin de volumen
directa e indirectamente.
Determinacin del
volumen usando cm
3.

Deduccin, construccin
y utilizacin de la frmula
del volumen del cubo.
Programa de estudio de cuarto grado
93
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Resolucin de problemas
que involucran medidas
de volumen.
Constancia al resolver
problemas que involucran
medidas de volumen.
6.15 Resuelve problemas que
involucran medidas de
volumen, con constancia.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
6.16 Calcula el volumen del prisma
rectangular utilizando el cm
3
,
con inters.
6.17 Calcula el volumen del prisma
multiplicando el largo, ancho
y alto y los representa en cm
3

con seguridad.

6.18 Encuentra el volumen del
prisma rectangular utilizando
la frmula con precisin.
6.19 Encuentra el volumen de
prismas cuadrangulares
utilizando la frmula,
con confianza.
6.20 Resuelve problemas que
involucran volumen de
prismas, con dedicacin.
Volumen de prismas.
Frmula del volumen del
prisma:
largo x ancho x altura.
6
6
6
6
6
Inters en calcular
el volumen del prisma
rectangular utilizando
el cm
3.





Seguridad en el uso de la
frmula del volumen en
prismas rectangulares.

Confianza en la utilidad
de la frmula para
calcular volmenes de
prismas cuadrangulares.
Dedicacin al resolver
problemas que involucran
volumen de prismas.
Clculo del volumen
del prisma rectangular
utilizando el cm
3
.

Deduccin de la frmula
y clculo del volumen de
prismas cuadrangulares.

Resolucin de problemas
que involucran volumen
de prismas.
94
Programa de estudio de cuarto grado
Fracciones.
Propias.
Impropias.
Mixtas.
Lectura y escritura de
fracciones propias,
impropias y mixtas.

Representacin grfica
de fracciones propias,
impropias y mixtas.
Identificacin de fraccin
mixta y fraccin propia.
Conversiones entre
fraccin mixta y
fraccin impropia.
Seguridad en la lectura
y escritura de fracciones
propias, impropias
y mixtas.
Precisin al representar
grficamente fracciones
propias, impropias
y mixtas.
Inters en identificar
fraccin mixta y
fraccin propia.
Cuidado en la conversin
de fracciones.
Objetivos
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
7.1 Escribe y lee con seguridad
fracciones propias, impropias
y mixtas.

7.2 Representa en forma grfica las
fracciones propias y mixtas, con
precisin.
7.3 Identifica fraccin mixta y
fraccin propia, con inters.
7.4 Realiza conversiones entre
fraccin mixta y fraccin
impropia, prestando cuidado.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
Tiempo probable: 20 horas clase
UNIDAD 7
OPEREMOS
CON FRACCIONES
Asignar una fraccin propia, impropia o mixta a cantidades representadas grficamente,
reconociendo su utilidad para expresar cantidades que representan una divisin equitativa.
Utilizar la adicin y sustraccin de fracciones de igual denominador, para dar soluciones a
problemas de la vida diaria.
Programa de estudio de cuarto grado
95
Representacin de
nmeros naturales como
fraccin impropia.
Convierte fracciones
impropias en
fracciones mixtas o
en nmeros naturales.
Precisin en la
representacin de nmeros
naturales como fraccin
impropia.
Seguridad en la
conversin de
fracciones impropias en
fracciones mixtas o en
nmeros naturales.
7.5 Representa nmeros
naturales como fraccin
impropia, con precisin.
7.6 Convierte fracciones
impropias en fracciones
mixtas o en nmeros naturales,
con seguridad.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
Representacin de
fracciones impropias
o propias de igual
denominador en la
recta nmerica.
Comparacin de
fracciones con el mismo
denominador o con
el mismo numerador,
utilizando los signos
<, >, =.
Resolucin de problemas
utilizando la conversin
de fracciones.
Inters por el uso de los
signos <, >, =.




Seguridad al resolver
problemas que involucran
conversin de fracciones.
7.7 Representa las fracciones
impropias o propias de
igual denominador en la
recta numrica.
7.8 Compara fracciones con el
mismo denominador o con
el mismo numerador,
utilizando signos de relacin
(>, <, =), con inters.

7.9 Resuelve problemas
utilizando la conversin de
fracciones, con seguridad.
Programa de estudio de cuarto grado
96
7.10 Halla fracciones equivalentes a
una fraccin propia, utilizando
la multiplicacin o la divisin,
con inters.
7.11 Encuentra fracciones
equivalentes simplificando a
su mnima expresin,
demostrando constancia.
7.12 Explica la manera de comparar
dos fracciones convirtindolas
en fracciones del mismo
denominador, con inters.
Fracciones equivalentes.
7
7
7
Inters en encontrar
fracciones equivalentes
a una fraccin propia,
utilizando la multiplicacin
o la divisin.
Constancia en
la simplificacin
de fracciones.
Inters en comparar
fracciones de diferentes
denominadores.
Clculo de fracciones
equivalentes a una fraccin
propia, utilizando la
multiplicacin o la divisin.
Reduccin de fracciones
simplificando a la mnima
expresin.
Comparacin y
explicacin de
fracciones de diferentes
denominadores.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS

7.13 Efecta sumas de
f.p. + f.p. = f.p. Sin simplificar
ni llevar, con esmero.
7.14 Efecta sumas de
f.p. + f.p. = f.p. Simplificando
sin llevar, con esmero.
7.15 Efecta sumas de
f.p. + f.p. = f.m. Sin simplificar
y llevando.
Adicin de fracciones
homogneas.
f.p. + f.p. = f.p.
Sin simplificar ni llevar.
f.p. + f.p. = f.p.
Simplificando sin llevar.

f.p. + f.p. = f.m.
Sin simplificar y llevando.
Clculo de
f.p. + f.p. = f.p. Sin
simplificar ni llevar.
Clculo de
f.p. + f.p. = f.p.
Simplificando sin llevar.
Clculo de
f.p. + f.p. = f.m. Sin
simplificar y llevando.
Esmero en la aplicacin
del procedimiento
para sumar fracciones
homogneas propias,
impropias o mixtas.
Programa de estudio de cuarto grado
97
f.p. + f.p. = f.m.
Simplificando y llevando.
f.m. + f.p. = f.m.
f.p. + f.m. = f.m.
Sin simplificar ni llevar.
f.m. + f.p. = f.m.
f.p. + f.m. = f.m.
Sin simplificar y llevando.
f.m. + f.p. = f.m.
f.p. + f.m. = f.m.
Simplificando y llevando.
f.m. + f.p. = n.n.
f.p. + f.m. = n.n.
Simplificando y llevando.
Clculo de
f.p. + f.p. = f.m.
Simplificando y llevando.
Clculo de
f.m. + f.p. = f.m.
f.p. + f.m. = f.m.
Sin simplificar ni llevar.

Clculo de
f.m. + f.p. = f.m.
f.p. + f.m. = f.m.
Sin simplificar y llevando.
Clculo de
f.m. + f.p. = f.m.,
f.p. + f.m. = f.m.
Simplificando y llevando.


Confianza al resolver
sumas de fracciones
homogneas propias,
impropias o mixtas.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
7.16 Efecta sumas de
f.p. + f.p. = f.m. Simplificando
y llevando, con esmero.
7.17 Efecta sumas de
f.m. + f.p. = f.m.
f.p. + f.m. = f.m. Sin simplificar
ni llevar, con confianza.
7.18 Efecta sumas de
f.m. + f.p. = f.m.
f.p. + f.m. = f.m. Sin simplificar
y llevando, con confianza.

7.19 Efecta sumas de
f.m. + f.p. = f.m., f.p. + f.m. = f.m.
Simplificando y llevando,
con confianza.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
Programa de estudio de cuarto grado
98
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Clculo de
f.m. + f.p. = n.n.,
f.p. + f.m. = n.n.
Simplificando y llevando.
Resolucin de problemas
aplicando la adicin de
fracciones homogneas.



Seguridad al resolver
problemas que involucran
adicin de fracciones
homogneas.
7.20 Efecta sumas de
f.m. + f.p. = n.n., f.p. + f.m. = n.n.
Simplificando y llevando,
con confianza.
7.21 Resuelve problemas
aplicando la adicin de
fracciones homogneas,
con seguridad.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
7.22 Efecta restas de
f.p. - f.p. = f.p. Sin simplificar
ni llevar, con esmero.

7.23 Efecta restas de
f.p. - f.p. = f.p. Simplificando
sin llevar, con esmero.
Sustraccin de fracciones
homogneas.
f.p. - f.p. = f.p.
Sin simplificar ni llevar.
f.p. - f.p. = f.p.
Simplificando sin llevar.
Clculo de f.p. - f.p. = f.p.
Sin simplificar ni llevar.
Clculo de f.p. - f.p. = f.p.
Simplificando sin llevar.
Esmero en el
procedimiento para
restar fracciones
homogneas propias,
impropias o mixtas.

Programa de estudio de cuarto grado
99
7.24 Efecta restas de
f.m. - f.p. = f.m. sin simplificar
ni llevar, con confianza.

7.25 Efecta restas de
f.m. - f.p. = f.m. sin simplificar
y llevando, con confianza.

7.26 Efecta restas de
f.m. - f.p. = f.m. simplificando
y llevando, con confianza.

7.27 Efecta restas de
f.m. - f.p. = n.n. simplificando
y llevando, con confianza.


7.28 Resuelve problemas que
involucran sustraccin de
fracciones homogneas,
contribuyendo con el equipo.
INDICADORES DE LOGRO CONTENIDOS
f.m. - f.p. = f.m.
Sin simplificar ni llevar.

f.m. - f.p. = f.m.
Sin simplificar y llevando.
f.m. - f.p. = f.m.
Simplificando y llevando.


f.m. - f.p. = n.n.
Simplificando y llevando.
Clculo de
f.m. - f.p. = f.m.
Sin simplificar ni llevar.

Clculo de
f.m. - f.p. = f.m.
Sin simplificar y llevando.

Clculo de
f.m. - f.p. = f.m.
Simplificando y llevando.

Clculo de
f.m. - f.p. = n.n.
Simplificando y llevando.


Resolucin de problemas
que involucran
sustraccin de fracciones
homogneas.
Confianza al efectuar
restas de fracciones
homogneas propias,
impropias o mixtas.







Contribucin en la
resolucin de problemas
que involucran
sustraccin de fracciones
homogneas.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
100
Programa de estudio de cuarto grado
INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Objetivo
Polgonos.
Lneas poligonales
abiertas, cerradas.
Polgonos.
Elementos del polgono:
Borde
Interior
Exterior
Construccin de lneas
poligonales abiertas
y cerradas.
Reconocimiento
y explicacin de
polgonos.

Identificacin del
borde, interior y exterior
de un polgono.

Precisin al construir
diferentes tipos de lneas
poligonales.
Inters en reconocer y
explicar polgonos.


Seguridad al identificar
los elementos de
un polgono.
8.1 Construye con precisin lneas
poligonales abiertas y cerradas.

8.2 Reconoce y explica polgonos,
con inters.



8.3 Identifica el borde, interior
y exterior de un polgono,
con seguridad.
INDICADORES DE LOGRO
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
CONTENIDOS
Tiempo probable: 10 horas clase
Clasificar los polgonos en cncavos y convexos al observar la abertura de
sus ngulos interiores y nombrarlos con seguridad por el nmero de lados, al
reconocerlos en un grupo de figuras.
IDENTIFIQUEMOS
OTRAS FIGURAS
UNIDAD 8
Programa de estudio de cuarto grado
101
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Lados
Diagonales
Vrtices
ngulos internos
Identificacin de los
lados, diagonales,
vrtices y ngulos
internos de un polgono.
Seguridad al identificar
los elementos de
un polgono.
8.4 Identifica los lados, diagonales,
vrtices y ngulos internos de
un polgono, con seguridad.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
8.5 Clasifica los polgonos
segn el nmero de lados,
con inters.
8.6 Nombra los polgonos de
acuerdo al nmero de lados,
con seguridad.

8.7 Reconoce y seala con
inters los polgonos
cncavos y convexos.
Polgonos por el nmero
de lados.
Tringulo
Cuadriltero
Pentgono
Hexgono
Heptgono
Octgono
Enegono
Decgono

Polgonos cncavos y
convexos.
Inters en la clasificacin
de polgonos por el
nmero de lados.
Seguridad al nombrar
los polgonos.



Inters en reconocer de
polgonos cncavos y
convexos.
Clasificacin de polgonos
por el nmero de lados.








Reconocimiento y
sealizacin de polgonos
cncavos y convexos.
102
Programa de estudio de cuarto grado
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Objetivos
Anlisis de datos.
Tabla de doble entrada.
Elaboracin de tablas de
doble entrada.
Lectura e interpretacin de
tablas de doble entrada.
Inters en la elaboracin
de tablas de doble
entrada.
Coopera con el equipo en
la interpretacin de tablas
de doble entrada.
9.1 Elabora tablas de doble
entrada, con inters.
9.2 Lee e interpreta los datos
contenidos en una tabla de
doble entrada, cooperando
en ello con el equipo.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
UNIDAD 9
Tiempo probable: 20 horas clase
INTERPRETEMOS DATOS
Construir e interpretar grficos de barras, a partir de la informacin recolectada en
encuestas.
Elaborar, leer e interpretar con criticidad, pictogramas, al proponer soluciones a
problemticas sociales.
Aplicar la media aritmtica, utilizando con seguridad la frmula hasta con diez datos,
a fin de resolver situaciones de la vida cotidiana.
9.3 Lee e interpreta grficas de
barras verticales con un valor
de 1 2 en las graduaciones,
con seguridad.
9.4 Lee e interpreta grficas de
barras horizontales con un
valor de 5 en la graduacin,
con seguridad.
Grficas de barras. Seguridad al leer grficas
de barras.
Lectura e interpretacin de
grficas de barras en las
que la cantidad se indica
en el eje horizontal, con
graduacin de 1 2.
Lectura e interpretacin
de grficas de barras
verticales y horizontales
con diferentes escalas, con
graduacin mnima de 5.
Programa de estudio de cuarto grado
103
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES


Elaboracin de grficas
de barras.
Recoleccin y clasificacin
de datos, aplicando
encuestas.

Representacin de los
datos obtenidos por
las encuestas en grficas
de barras.
Resolucin de
problemas elaborando e
interpretando grficos
de barras.



Aseo en la elaboracin de
grficas de barras.
Inters en utilizar encuestas
y graficar los resultados.


Inters en representar los
datos obtenidos por
las encuestas en grficas
de barras.

Seguridad al resolver
problemas elaborando
e interpretando grficos
de barras.
9.5 Lee e interpreta grficas de
barras horizontales o verticales
con diferentes graduaciones,
con seguridad.
9.6 Elabora grficas de barras,
con aseo.
9.7 Recolecta datos, aplicando
encuestas sencillas, con inters.
9.8 Recolecta datos y clasifica la
informacin, con inters.
9.9 Representa los datos
obtenidos por las encuestas
en grficas de barras, con
inters.
9.10 Resuelve problemas elaborando
e interpretando grficos de
barras, con seguridad.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
9.11 Interpreta los datos presentados
en un pictograma de figuras
completas, con inters.
9.12 Compara datos utilizando
pictogramas con seguridad
.
Pictogramas. Inters en interpretar
datos presentados en
el pictograma.
Seguridad al comparar
datos utilizando
pictogramas.

Interpretacin de
datos presentados en
el pictograma.
Comparacin de datos
utilizando pictogramas.
Programa de estudio de cuarto grado
104
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Lectura de pictogramas
con figuras completas.
Lectura de pictogramas
aproximando datos de las
figuras incompletas.
Elaboracin de
pictograma.
Interpretacin de la
informacin presentada
en un pictograma.
Seguridad al leer
pictogramas.

Seguridad al elaborar
pictogramas.
Formacin de juicios
sobre la informacin
representada en los
pictogramas.
9.13 Lee con seguridad
pictogramas que presentan
figuras completas, haciendo
aproximaciones.
9.14 Lee con seguridad
pictogramas que presentan
figuras incompletas,
haciendo aproximaciones.
9.15 Elabora pictogramas,
con seguridad.
9.16 Interpreta y juzga la
informacin presentada
en un pictograma.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
9.17 Calcula con seguridad la media
aritmtica a partir de
la grfica de barras.
9.18 Identifica con inters la
frmula para calcular la
media aritmtica.
9.19 Encuentra la media
aritmtica para
comparar datos.
9.20 Resuelve problemas
que involucran el clculo
de la media aritmtica,
con constancia.
Medida aritmtica Seguridad al calcular la
media aritmtica a partir
de la grfica de barras.
Inters al identificar de la
frmula para calcular la
media aritmtica.



Constancia en la
resolucin de problemas
que involucran el clculo
de la media aritmtica.
Clculo de la media
aritmtica a partir de la
grfica de barras.
Identificacin de la
frmula para calcular la
media aritmtica.
Comparacin de datos
a partir de la media
aritmtica.
Resolucin de problemas
que involucran el clculo
de la media aritmtica.
X =
n
x
105
Programa de estudio de cuarto grado
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Nivelacin de cantidades
discontinuas para obtener
la media aritmtica.

Comparacin de
dos grupos de datos
encontrando sus
medias aritmticas.
Inters en nivelar
cantidades discontinuas.


Seguridad al comparar
dos grupos de datos
encontrando sus
medias aritmticas.
9.21 Nivela cantidades discontinuas
para obtener la media
aritmtica, con inters.

9.22 Compara dos grupos de datos
encontrando sus medias
aritmticas, con seguridad.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
Programa de estudio de cuarto grado
106
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Objetivos
Unidades de peso:
La arroba (@)
El quintal (qq)
La tonelada (ton)

Adicin y sustraccin.
Equivalencias.
Arrobas y libras
1 @ = 25 lb
Quintales y arrobas
1 qq = 4 @
Quintales y libras
1 qq = 100 lb
Toneladas y quintales
1 ton = 10 qq
Toneladas y libras
1 ton = 1,000 lb
Reconocimiento de la
arroba, el quintal y sus
equivalencias.



Aplicacin de la suma
y la resta con unidades
de peso.
Conversin de unidades
entre la arroba y el
quintal en su equivalencia
en libras.
Resolucin de problemas
aplicando la conversin
de arrobas a quintales y
viceversa.
Conversin de unidades
entre la tonelada y el
quintal y viceversa.
Inters en reconocer la
arroba, el quintal y sus
equivalencias.

Precisin al calcular la
suma y diferencia de
unidades de peso.
Precisin al convertir
unidades entre la arroba y
el quintal su equivalencia
en libras
.
Inters al resolver
problemas aplicando
conversin de arrobas a
quintales y viceversa.
10.1 Reconoce la arroba, el quintal y
sus equivalencias con inters.
10.2 Convierte arrobas a quintales
y viceversa, encontrando su
equivalencia en libras con
precisin.
10.3 Aplica con precisin la suma y
la resta con unidades de peso.
10.4 Resuelve problemas
aplicando la conversin de
unidades: arrobas, quintales
y libras, con inters.
10.5 Convierte toneladas a quintales
y viceversa, con precisin.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
UNIDAD 10
Tiempo probable: 16 horas clase
APLIQUEMOS MEDIDAS
DEL ENTORNO
Medir pesos de objetos conocidos en: arrobas, quintales y/o toneladas, aplicando con
seguridad las equivalencias entre estas unidades para solucionar problemas de la vida
cotidiana que impliquen conversiones.
Utilizar con seguridad horas, minutos, segundos, das, semanas, meses y aos al calcular el
tiempo transcurrido en el desarrollo de eventos en los que participa.
Elaborar presupuestos de compra de dos o ms unidades por artculo, de acuerdo con cierta
cantidad de dinero, aplicndolo con autonoma al estimar y priorizar las compras.
Programa de estudio de cuarto grado
107
Resolucin de problemas
utilizando la conversin de
toneladas a quintales
y viceversa.
Inters al resolver
problemas utilizando la
conversin de toneladas
a quintales y viceversa.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
10.6 Resuelve problemas, aplicando
la conversin de toneladas
a quintales y viceversa, con
inters.
10.7 Representa con seguridad partes
de la hora y del ao usando
adecuadamente las fracciones.
10.8 Interpreta con seguridad tablas
y horarios.
10.9 Planifica diversas
actividades utilizando
la hora e intervalos de
tiempo, con inters.


10.10 Encuentra unidades de tiempo
en el calendario y establece
relacin entre ellas, valorando
el buen uso del tiempo.
10.11 Encuentra el tiempo entre
fechas usando el calendario
y tomando en cuenta dnde
empieza y dnde termina.
10.12 Resuelve problemas aplicando
los intervalos de tiempo.
Hora y tiempo
Tiempo con fracciones.
Tablas y horarios.
Clculo del tiempo en
horas, minutos y segundos.
1 h = 60 min
1 min = 60 s



Calendario.
Representacin de
partes de la hora y del
ao en fracciones.
Lectura de tablas y
horarios.
Planificacin de diversas
actividades utilizando
la hora e intervalos
de tiempo.





Aplicacin del calendario
y clculo de las unidades
de tiempo (das, semanas,
meses y aos).
Resolucin de problemas
aplicando los intervalos
de tiempo.
Seguridad al usar
fracciones de hora.
Seguridad en el uso
de tablas y horarios.
Inters en la planificacin
de diversas actividades
utilizando la hora e
intervalos de tiempo.

Valoracin por el buen
uso del tiempo en su
vida cotidiana.
Programa de estudio de cuarto grado
108
10.13 Calcula el costo de
tres o cuatro productos,
con seguridad.
10.14 Determina la inversin,
dada una cantidad de dinero
y una cantidad de productos.

10.15 Elabora un presupuesto,
de acuerdo con un monto
dado, con creatividad.
10.16 Resuelve problemas utilizando
presupuestos creativamente
INDICADORES DE LOGRO CONTENIDOS
Presupuestos. Aplicacin del clculo
del costo de tres o
cuatro productos.
Determinacin de la
inversin dada una
cantidad de dinero y una
cantidad de productos.
Elaboracin de
presupuestos de acuerdo
con un monto dado.
Resolucin de problemas
utilizando presupuestos.
Seguridad al calcular
el costo de tres o
cuatro productos.
Inters en determinar
la inversin, dada una
cantidad de dinero y una
cantidad de productos.
Creatividad en la
elaboracin de
presupuestos de acuerdo
con un monto dado.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
CIENCIA, SALUD Y
MEDIO AMBIENTE
110
Programa de estudio de cuarto grado
Presentacin de la asignatura
La asignatura Ciencia, Salud y Medio Ambiente propicia
la aplicacin de procedimientos y actitudes cientficas como
la observacin, clasificacin de objetos y fenmenos, el
reconocimiento de problemas, representacin, formulacin
de supuestos y experimentacin, entre otros. Orienta
la aplicacin de la tecnologa y la comprensin de las
leyes de la naturaleza, aplicadas a su realidad personal,
familiar, comunitaria, y al medio natural. Se pretende
que el alumnado tome conciencia de las alteraciones del
medio natural producidas por la actividad humana, para
prevenir el agotamiento de los recursos naturales, as como
concientizarse de la importancia de la ciencia, la higiene y
la prevencin para mejorar las condiciones de vida.
Enfoque de la asignatura
Investigativo para la resolucin de problemas
Este enfoque orienta la construccin del conocimiento
al aplicar procedimientos cientficos en la resolucin de
situaciones de la vida cotidiana, la ciencia y la tecnologa.
Potencia la interdisciplinariedad y la formacin integral
de la persona mediante actividades de investigacin,
desarrollando proyectos adecuados a la edad y a la
madurez psicolgica de las y los estudiantes, en los cuales
aprendan haciendo, apliquen el conocimiento, razonen
cientficamente, comuniquen, argumenten y representen
sus ideas.
Competencias a desarrollar
Comunicacin de la informacin con lenguaje cientfico
Esta competencia consolida la comunicacin efectiva
mediante el uso apropiado del lenguaje cientfico y la
interpretacin de diferentes tipos de textos, promoviendo
el anlisis crtico-reflexivo en un ambiente de libertad,
responsabilidad y respeto. El lenguaje y la comunicacin
son parte esencial del trabajo cientfico, ya que permiten
adquirir y producir informacin, representndola a travs de
tablas, grficos, modelos simblicos y verbales que le dan
neutralidad, precisin, universalidad y sentido al lenguaje
comn.
Aplicacin de procedimientos cientficos
Esta competencia implica la utilizacin de procedimientos de
investigacin para resolver problemas de la vida cotidiana,
cientficos y tecnolgicos. Facilita al estudiante una mejor
comprensin de la naturaleza de la ciencia y la actividad
cientfica como una accin humana. En este contexto, la
resolucin de problemas forma parte de la construccin del
conocimiento cientfico, generando en las y los estudiantes
aprendizajes permanentes que apliquen en situaciones de
la vida para actuar eficazmente en el mbito individual,
profesional y otros.
Razonamiento e interpretacin cientfica
Esta competencia propicia el razonamiento crtico,
reflexivo e inventivo, desarrollando una valoracin tica
de las aplicaciones cientfico-tecnolgicas en la vida de
los seres humanos. Cultiva el inters y el respeto por las
iniciativas cientficas, la comprensin de los fenmenos de
111
Programa de estudio de cuarto grado
importancia del agua necesaria para la salud.
4. Ecologa y medio ambiente. Se estudian las acciones
del ser humano sobre los recursos naturales: suelo,
agua y comunidades biticas que se ven afectados
directamente por la contaminacin, la caza, pesca y
tala indiscriminada. Adems se orienta el tratamiento
adecuado de la basura.
Se construye la nocin de poblacin, comunidad bitica
y los factores ecolgicos que las delimitan; en ese
contexto se indagan algunos fenmenos como taxismos
en los animales y tropismos en las plantas. Por otra parte,
se investigan las causas de las erupciones volcnicas,
desbordamientos, inundaciones e incendios forestales
con el fin de realizar y divulgar acciones de preparacin
y prevencin para proteger la vida y la de los dems.
5. Fsica y qumica. Se estudian las primeras nociones de
materia y fuerza de gravedad, algunas magnitudes y
unidades fsicas como rea, volumen y masa. Adems
se inicia al estudiante en los cambios reversibles e
irreversibles de la materia, la composicin y
descomposicin de la luz, los efectos del calor en los
materiales, la construccin de un circuito elctrico, las
palancas y poleas; todos estos conceptos bsicos de
la fsica y la qumica contribuyen a la comprensin de
algunos fenmenos naturales y la actividad cientfica.
6. Geologa y astronoma. Se estudian algunos fenmenos
atmosfricos y las causas de la poca seca y lluviosa en
El Salvador. Por otra parte, en la astronoma se abordan
la identificacin y representacin de las fases de la Luna
y el eje de inclinacin de la Tierra y los polos terrestres.
la naturaleza, el anlisis e interpretacin de datos para una
mejor toma de decisiones.
Bloques de contenido
Los bloques de contenido en los cuales se ha organizado la
asignatura de Ciencia, Salud y Medio Ambiente responden
a las diferentes reas disciplinares de las Ciencias
Naturales:
1. Anatoma y fisiologa animal y vegetal. Comprende el
estudio de la nutricin y alimentacin en los seres vivos,
destacando la estructura y funcin de la raz en las
plantas. As mismo la comparacin entre la nutricin y
alimentacin en animales, plantas y el ser humano.
2. Anatoma y fisiologa humana. Comprende la estructura
y el funcionamiento del sistema esqueltico, el sistema
excretor, el corazn, el sentido del gusto y del olfato
en el cuerpo humano. Tambin se estudian las
transformaciones de los alimentos con el fin de
promover medidas y hbitos adecuados para mantener
la salud. De manera especial se enfatiza en el inicio de
los cambios biolgicos, afectivos y sociales en la pubertad
del ser humano.
3. Salud alimentaria y profilaxis. Se estudian los grupos de
alimentos tales como cereales, leguminosas, hortalizas
y frutas, identificando los nutrientes y minerales que
contienen, as mismo las medidas para conservarlos
en buen estado. Se analizan las ventajas de los
huertos escolares como una estrategia alimentaria.
En la educacin en salud se indagan algunas causas
y medidas para prevenir el clera, el dengue, el VIH-
SIDA, el alcoholismo y otras drogas. Tambin se valora la
112
Programa de estudio de cuarto grado
Relacin de unidades didcticas y bloques de contenido
del programa anterior y programa actual de cuarto grado
Unidad 1: Asi somos los seres vivos Unidad 1: Asi somos los seres vivos
PROGRAMA ANTERIOR PROGRAMA ACTUAL
Unidad 1: Sostn y algunos movimientos en la naturaleza
Unidad 2: Vivamos sanos y felices
Unidad 3: Los seres vivos y su medio ambiente
Unidad 2: El mundo fsico que nos rodea
Unidad 3: Nutricin y alimentacin de los seres vivos
Unidad 4: Previniendo riesgos y accidentes
Unidad 5: Cmo cambia nuestro cuerpo?
Unidad 6: Previniendo enfermedades
Unidad 7: Nuestra amiga el agua
Unidad 8: La Tierra, nuestro gran hogar
U id d 2 Vi
Anatoma y fisiologa
animal y vegetal
f li
Anatoma y fisiologa
humana
Salud alimentaria
y profilaxis
Unidad 2: El mundo f U
Anatoma y fisiologa
humana
sico que nos ro sico
Profilaxis
odea od
Fsica Anatoma y fisiologa
animal y vegetal
Unidad 3: Los seres vivos y su m
Salud alimentaria y profilaxis
medio ambiente med
Ecologa y medio ambiente
Ecologa y medio ambiente Fsica
Unidad 3: Nutricin y alimentacin de los seres vivos
Fsica y qumica
Unidad 4 Previniendo
Anatoma y fisiologa
animal y vegetal
riesgos y accidentes rie
Anatoma y fisiologa
humana
Salud
alimentaria
Profilaxis
U id d 5 C bi t
Geologa
?
Ecologa y medio ambiente
Unidad 6: Previniendo enfermedades
Anatoma y fisiologa humana
s
Profilaxis
Unidad 7: Nuestra amiga el agua
Anatoma y fisiologa humana Profilaxis
Unidad 8 La Tierra
Anatoma y fisiologa
humana
nuestro gran ho nue
Profilaxis
ogar oga
Ecologa y medio
ambiente
Geologa
Ecologa y medio
ambiente
Astronoma Fsica Geologa
113
Programa de estudio de cuarto grado
Relacin de bloques de contenido y unidades didcticas
Los bloques de contenido del programa actual se han
distribuido y organizado en ocho unidades de aprendizaje,
integrando diferentes situaciones del mundo natural a la
vida del estudiante. El incremento en el nmero de unidades
y contenidos obedece a las siguientes razones:
Una estructura curricular con unidades ms cortas
clarifica la secuencia de la enseanza de los contenidos
y favorece la planificacin de ms perodos de
retroalimentacin al inicio y finalizacin de cada unidad
didctica.
Las unidades didcticas se organizan en el contexto de
las situaciones de la vida cotidiana del estudiante. Dichas
unidades integran los diferentes bloques y contenidos;
por ejemplo, el estudio de las enfermedades es la
situacin oportuna para introducir aspectos anatmicos,
fisiolgicos y hbitos.
La necesidad de incorporar contenidos de Ciencias
Naturales en el currculo nacional en reas como
la astronoma, la fsica y la qumica obedece a las
sugerencias realizadas por estudios nacionales e
internacionales: pruebas TIMSS (Pruebas de tendencias
internacionales de ciencias y matemtica) o Pisa
(Programa para la evaluacin internacional de los
alumnos), debido a que dichas reas incluan pocos
contenidos.
Las unidades cortas con un enfoque sistmico e integral
permiten un mejor aprendizaje vivencial o experimental
alrededor de un eje o hilo conductor que le da un sentido
ms especfico a los contenidos o temticas, como se
sugiere en este nivel de educacin bsica.
PROGRAMA ANTERIOR PROGRAMA ACTUAL
Unidad 1: As somos los seres vivos Unidad 1: Sostn y algunos movimientos en la naturaleza
Unidad 2: El mundo fsico que nos rodea
El siguiente cuadro muestra los nombres y una breve descripcin de las unidades didcticas en cuarto grado:
Los animales de acuerdo al tipo de
alimentos que consumen; los rganos de
las plantas y sus funciones; proteccin
y conservacin de las plantas; hbitos
alimentarios y de higiene personal;
importancia de los ejercicios fsicos;
funcionamiento del sistema locomotor,
digestivo, genitourinario y dependencia de
los sentidos del sistema nervioso.
U id d 2 El d f i d
Principales partes del esqueleto humano: crneo, columna vertebral y caja torcica; hbitos posturales
al levantar objetos; uso de las mquinas simples; races tpicas, tuberosas y fibrosas; funciones de la raz;
taxismos en animales y tropismos en plantas: hidrotaxismo e hidrotropismo; geotaxismo y geotropismo;
nocin de fuerza de gravedad.
Nocin de materia; algunas magnitudes fsicas y unidades para medir y expresar rea, volumen y
masa; efectos del calor y la temperatura en los seres vivos y algunos materiales; cambios reversibles e
irreversibles en slidos y lquidos; circuito elctrico.
114
Programa de estudio de cuarto grado
Unidad 2: Vivamos sanos
y felices
Unidad 3: Los seres vivos y
su medio ambiente
Unidad 3: Nutricin y alimentacin de los seres vivos
Unidad 4: Previniendo accidentes y riesgos
Unidad 5: Cmo cambia nuestro cuerpo?
Unidad 6: Previniendo enfermedades
Unidad 7: Nuestra amiga el agua
Unidad 8: La Tierra, nuestro gran hogar
y
U id d 3 L i
Clasificacin de los alimentos
por su origen y nutrientes;
hbitos higinicos para
prevenir enfermedades
bucodentales; partes, clases
y funciones de los dientes;
medidas preventivas para
evitar algunas enfermedades
infectocontagiosas, parasitarias
y por deficiencias vitamnicas o
nutricionales; huertos escolares,
abono orgnico; primeros
auxilios y problemas de riesgo
en la comunidad.
Importancia de la luz solar
para los seres vivos; flora,
fauna y suelo como recursos
naturales; tipos de poblaciones,
comunidades biticas y la
influencia del ser humano
sobre ellas; caractersticas
ambientales de la comunidad
urbana y rural; funcionamiento
de algunas mquinas simples.
id d C bi ?
Estructura general de un volcn; sismo causado por la erupcin volcnica; mapa de riesgo y recursos de la
escuela; amenazas y vulnerabilidades; simulacros de evacuacin; acciones preventivas para evitar accidentes
en caso de desbordamientos e inundaciones; causas, consecuencias y prevencin de los incendios forestales.
U id d 6 P i i d f d d
Estructura y funcionamiento del sistema excretor; hbitos higinicos para limpiar las excreciones del cuerpo
humano; rganos reproductores masculinos y femeninos; cambios biolgicos, afectivos y sociales que se
presentan en la etapa de la pubertad; el VIH-SIDA como una pandemia del planeta.
U id d 4 P i i d id i
Nutricin y alimentacin en los animales, las plantas y el ser humano; animales herbvoros, carnvoros y
omnvoros; proceso de transformacin de los alimentos; clasificacin, funcin y cuidados de los dientes; cultivo
y consumo de hortalizas; tipos de vegetales como cereales, leguminosas, hortalizas y frutales; alimentos que
contienen vitaminas y minerales y sus funciones en el organismo; medidas adecuadas para conservar los
alimentos tales como conservas, ahumados, salados y refrigerados.
Unidad 7 Nuestra amiga el agua
Partes principales de la lengua; medidas para proteger el sentido del gusto; anatoma, fisiologa y cuidado de
los rganos del sentido del olfato; signos vitales; ubicacin y forma del corazn; importancia de la sangre;
acciones para proteger el corazn; el clera; agente transmisor del dengue y medidas para evitarlo; el
alcoholismo y la frmaco dependencia (toxicomana).
U id d 8 L Ti h
Causas de la poca seca y lluviosa en El Salvador; medicin de algunos fenmenos atmosfricos; cantidad de
agua necesaria para la salud; formas de contaminacin del agua; enfermedades producidas por el contacto
de agua contaminada.
Nocin de poblacin y comunidad bitica; factores que limitan el crecimiento poblacional en los ecosistemas;
acciones del ser humano sobre poblaciones y comunidades biticas; uso racional del suelo; tratamiento de la
basura en la escuela y el hogar para prevenir la contaminacin; reciclaje de objetos y materiales desechables;
el arcoris, composicin y descomposicin de la luz; fases de la Luna; eje de inclinacin de la Tierra y los polos
terrestres; importancia de la atmsfera para la vida en el planeta Tierra.
115
Programa de estudio de cuarto grado
Objetivos de cuarto grado
1. Representar y describir con iniciativa la anatoma y
fisiologa de algunos rganos vegetales y animales,
indagando, colectando y clasificando races con el fin de
valorar el proceso de la nutricin y alimentacin en los
seres vivos.
2. Indagar y representar con respeto la estructura y fisiologa
de algunos sistemas y rganos del cuerpo humano,
construyendo modelos, con el propsito de practicar y
promover medidas adecuadas para mantener la salud.
3. Indagar y divulgar con inters los nutrientes de algunos
alimentos identificando y describiendo las causas de
algunas enfermedades, construyendo huertos escolares
y practicando medidas preventivas para conservar
la salud.
4. Investigar y analizar con responsabilidad las acciones
del ser humano sobre los ecosistemas, identificando
y describiendo las distintas formas de contaminacin
y destruccin de los recursos naturales con el fin de
protegerlos y conservarlos.
5. Investigar y representar con inters algunos eventos
adversos, indagando y describiendo sus causas, con
el fin de realizar y divulgar acciones de preparacin y
prevencin para proteger la vida y la de los dems.
6. Indagar y explicar con curiosidad algunas propiedades
de la materia, analizando su composicin y
transformaciones para la comprensin de algunos
fenmenos fsico-qumicos.
7. Indagar y analizar con inters algunos fenmenos
atmosfricos y astronmicos, representando y
describiendo algunas propiedades y relaciones de la
Tierra y la Luna para poder explicar las causas de la
poca seca y lluviosa en El Salvador.
Lineamientos metodolgicos
El proceso de enseanza aprendizaje de las Ciencias
Naturales demanda utilizar metodologas participativas
como la investigacin experimental, documental y de campo,
que promuevan la creatividad e invencin del estudiantado,
en un clima de libertad y confianza en el aula y la escuela.
Para desarrollar este proceso de enseanza aprendizaje se
establece una secuencia didctica que incluye una serie de
fases con un orden lgico, las cuales se desarrollan en cada
leccin del Libro de texto; dicha secuencia puede mejorarse
con la experiencia docente, los recursos tecnolgicos y
materiales con los que cuenta la escuela.
Fase 1. Exploracin de conocimientos y destrezas
Al inicio de cada leccin en el Libro de texto, la y el estudiante
observan una situacin de la vida real, ilustrada o descrita,
para responder preguntas generadoras con el objetivo de
despertar el inters y contextualizar el contenido cientfico a
una situacin cotidiana.
La o el docente presenta la situacin o ilustracin, lee
las preguntas a las y los estudiantes, escucha y copia en
la pizarra las respuestas, permitindoles expresarlas,
independientemente de que sean correctas o incorrectas.
Fase 2. Comprensin del problema
Se recomienda que en equipo, las y los estudiantes escuchen
o lean una pregunta de investigacin, como por ejemplo:
Desde qu altura se puede lanzar una bolita para que
caiga dentro de un vaso? Esta pregunta de investigacin
se caracteriza por ser un problema, no tener una solucin
inmediata, ser significativa y de relevancia cientfica. Las
y los estudiantes necesitan buscar informacin en libros o
116
Programa de estudio de cuarto grado
La o el docente facilita la discusin de los resultados
obtenidos entre los equipos de estudiantes, apoya la
construccin de la informacin y valora la certeza de las
hiptesis o supuestos elaborados.
Fase 5. Contrastacin cientfica
La y el estudiante compara e interpreta los resultados
obtenidos con la informacin establecida por la
comunidad cientfica, de esta manera contrastan sus
ideas y conclusiones.
La o el docente invita al alumnado a leer un texto relacionado
con el problema, de forma que reflexionen sobre los datos
obtenidos, identifiquen equivocaciones o certezas y nuevas
preguntas de investigacin. Debe enfatizarse en que la
actividad cientfica es un modelaje aproximado de una
parte de la realidad y no una respuesta a toda ocurrencia.
Fase 6. Consolidacin del aprendizaje
La y el estudiante elabora dibujos o secuencias de dibujos,
informes sencillos u otros que ayuden a la sistematizacin y
comprensin cientfica de los contenidos.
La o el docente explica y ejercita formas de elaborar un
informe o representar las ideas cientficas estudiadas,
orienta la utilizacin del Cuaderno de ejercicios para realizar
otras actividades de aprendizaje que ayuden a consolidar y
profundizar el conocimiento.
Es importante que la metodologa guarde la integridad
de la naturaleza del planeta, asegure la sostenibilidad,
concretando leyes nacionales e internacionales tales como
la ley de proteccin de los animales, la declaracin universal
sobre el bienestar animal aprobada por la UNESCO y
la ONU, la carta de la Tierra y la Ley de proteccin del
Internet, hacer nuevas preguntas, conversar las posibles
respuestas de forma interactiva.
El Libro de texto y el Cuaderno de ejercicios son materiales
de apoyo que contienen secciones de lectura, historias de la
ciencia, inventos y hechos curiosos en la naturaleza, con el
fin de brindar herramientas y conocimientos que posibiliten
al alumnado plantear sus hiptesis.
La y el docente presenta la pregunta de investigacin,
propicia la discusin entre los estudiantes, orienta la lectura
y facilita herramientas para la investigacin.
Fase 3. Representacin y explicacin
En esta fase la y el estudiante elaboran narraciones,
descripciones y representaciones sencillas (dibujos o
esquemas) en su cuaderno de Ciencias, estableciendo
relaciones y explicaciones tentativas de causa-efecto, que
en los procesos de investigacin se denominan hiptesis
o supuestos, lo cual le permite predecir resultados lgicos
con relacin al problema.
La y el docente apoya a las y los estudiantes haciendo
nuevas preguntas relacionadas con las explicaciones
o hiptesis, a fin de visualizar las evidencias
de razonamiento.
Fase 4. Comprobacin
La y el estudiante realizan experimentos, observaciones
de campo, buscan informacin bibliogrfica, indagan con
lderes de la comunidad u otros; de esta manera, prueban
sus hiptesis o supuestos antes elaborados. Comparten
y comparan sus resultados obtenidos respondiendo a las
preguntas: Sabes qu sucedi? Por qu?
117
Programa de estudio de cuarto grado
necesitar aplicar en las clases. Por ejemplo: la manipulacin
de una balanza, una lupa, una regla, un termmetro o la
aplicacin de destrezas intelectuales como la observacin,
la descripcin, la clasificacin y el anlisis, entre otras. Se
puede diagnosticar cuando las y los estudiantes realizan
una tarea especfica, por ejemplo, expresar sus ideas con
espontaneidad, clasificar correctamente a los seres vivos
en animales o plantas, manipular adecuadamente una
cuchara con cubitos de hielo exponindolos a una llama
de calor para comprobar los cambios de los estados fsicos
del agua, etc.
Asimismo, es fundamental obtener informacin sobre los
conocimientos y las actitudes de los estudiantes. Por ejemplo:
curiosidad por explorar el entorno, seguridad para expresar
sus ideas, inters en formular preguntas, entre otros.
De manera general, se recomienda retomar los contenidos
e indicadores de logro del grado o nivel anterior, o de
unidades didcticas previas, poniendo especial atencin
en los indicadores priorizados que aparecen resaltados en
negrita en el programa de estudio.
No debe olvidarse que la finalidad de la evaluacin
diagnstica es adecuar la planificacin y aplicar estrategias
para nivelar al alumnado en el grado que cursa, de manera
que tenga las condiciones de xito para su aprendizaje.
Evaluacin formativa
La finalidad de la evaluacin formativa es conocer los logros
y dificultades de aprendizaje de las y los estudiantes para
facilitarles ayuda adecuada y oportuna en la adquisicin
de las competencias. Por ejemplo, si la o el estudiante no
logra identificar y clasificar los materiales conductores y no
conductores de calor, la o el docente debe indagar las causas
del error. Conocer el nivel de razonamiento del alumnado
medio ambiente salvadoreo para evitar destruir los
recursos naturales y las especies vegetales y animales
innecesariamente, al realizar actividades cientficas a
nivel escolar.
La metodologa debe garantizar que las tareas realizadas
por las y los estudiantes sean pertinentes con la edad,
el desarrollo psicomotriz y los recursos disponibles del
alumnado, es decir, trascender a la significatividad de
cada actividad en la vida del estudiante, y anticiparse a la
pregunta para qu le servir?
Lineamientos de evaluacin
La asignatura de Ciencia, Salud y Medio Ambiente evala
el progreso del alumnado mediante la demostracin de una
conducta o actuacin esperada, por ejemplo: identifica el
problema, aplica procedimientos de investigacin, entre
otros. Tambin, es importante evaluar la comprensin de
conceptos mediante representaciones grficas, la expresin
oral, la aplicacin de los procedimientos de experimentacin
o la comprobacin.
Para que la evaluacin sea integral, flexible y significativa
deber retomar los principales tipos de evaluacin y
sus actores.
Evaluacin diagnstica
Por medio de la observacin directa, la revisin de dibujos,
las respuestas a preguntas exploratorias, descripciones
o explicaciones previas, la o el docente puede obtener
informacin sobre las habilidades que poseen las y los
estudiantes antes de iniciar nuevos contenidos.
Se debe hacer una evaluacin inicial para conocer el grado
de dominio de algunos procedimientos que el alumnado
118
Programa de estudio de cuarto grado
actividades de evaluacin: pruebas escritas, cerradas
o de tems abiertos, revisin de cuadernos, trabajos
grupales, investigaciones y otros. Permite evaluar el nivel
de adquisicin y comprensin de hechos, conceptos y
principios cientficos.
De acuerdo con la naturaleza de la adquisicin de las
competencias, la prueba objetiva slo es una actividad
entre otras. Se debe disear de manera que evale
contenidos conceptuales y procedimentales independientes
o integrados; no necesita ser exhaustiva y con muchas
preguntas, sino diseada de acuerdo a los indicadores
de logro.
Se recomienda incluir actividades que evalen los
aprendizajes de las y los estudiantes enfrentndolos a una
situacin problema que se resuelva con la aplicacin de
procedimientos: identificar, clasificar, analizar, explicar,
representar, argumentar, predecir, inventar; y la aplicacin
de conocimientos con determinadas actitudes.
Este tipo de actividades permiten a las y los estudiantes
aplicar el conocimiento y los procedimientos a nuevas
situaciones de la vida real.
Recomendaciones generales segn el tipo de contenido
referido en los indicadores de logro
La evaluacin de contenidos conceptuales debe reconocer
grados o niveles de profundizacin y comprensin, as como
la capacidad para utilizar convenientemente los conceptos
aprendidos. Se recomienda verificar el uso que cada
estudiante hace de los conceptos en diversas situaciones,
individuales o en equipo; la resolucin de conflictos o
problemas a partir del uso de los conceptos; las pruebas
objetivas que requieran relacionar y utilizar los conceptos
permite comprender las causas de sus dudas o errores y
da la posibilidad de intervenir, proponiendo actividades
especficas y oportunas que refuercen su aprendizaje.
Merecen especial atencin los conocimientos equivocados
o acientficos de las y los estudiantes. Estos deben ser
escuchados y comprendidos sin la inmediata correccin.
Las competencias de esta asignatura demandan el
descubrimiento, abrir espacios para el ensayo o error y la
comprobacin de supuestos, por lo tanto, se debe preguntar
primero: por qu piensas as?, y explorar el razonamiento
del estudiante, antes de corregir o, lo que es peor, juzgar
negativamente su opinin.
Esta actitud es fundamental al evaluar formativamente a las
nias y los nios, porque permite detectar las causas de sus
errores o confusiones para ayudarles a superarlos antes de
adjudicar una calificacin.
La evaluacin formativa se apoya en la autoevaluacin,
heteroevaluacin y coevaluacin. Por lo tanto, se debe
permitir a las y los estudiantes exponer, compartir resultados
y procedimientos realizados, valorar el trabajo en equipo,
expresando cmo se sintieron, qu hicieron bien y qu
cosas deben mejorar en actividades futuras. Una pregunta
especfica permite conocer el grado de competencia del
alumnado e identificar el tipo de ayuda o medida que
necesita para mejorar su nota y nivel de competencia.
Este tipo de evaluacin debe incluir la observacin y el
registro de actitudes referidas a la participacin, el trabajo
en equipo y los procedimientos seguidos.
Evaluacin sumativa
La evaluacin sumativa certifica y asigna una calificacin
al desempeo del estudiante, por medio de diversas
119
Programa de estudio de cuarto grado
en unas situaciones determinadas. El dilogo, el debate y
la conversacin pueden tener un enorme potencial para
saber lo que el estudiantado conoce.
Las actividades de evaluacin para conocer el nivel de
comprensin conceptual son todas aquellas en las que la
o el estudiante puede comunicarse verbalmente y/o aplicar
el conocimiento en una nueva situacin, por ejemplo, al
definir un concepto es capaz de enunciarlo y explicarlo en
un momento determinado.
Los contenidos procedimentales implican saber hacer y
se pueden evidenciar en situaciones de aplicacin. La
observacin sistemtica de cada una de las y los alumnos
en situaciones en que se utilicen dichos contenidos
procedimentales; las actividades abiertas, hechas en clase,
permiten comprender cmo las y los alumnos desarrollan
habilidades y destrezas entre ellas: identificar, clasificar,
analizar, explicar, representar, argumentar y predecir,
entre otras.
Una forma de evaluar la aplicacin de procedimientos
cientficos en las y los estudiantes es presentndoles una
situacin experimental, de campo o documental, similar a
las desarrolladas en el aula, en la cual la y el estudiante
puede ordenar los pasos y explicar cmo la resuelve.
La evaluacin de los contenidos actitudinales en las y los
estudiantes demanda la observacin y la utilizacin de una
lista de cotejo, estableciendo criterios claros que evidencien
la prctica de principios y valores en el trabajo individual y
de equipo.
Estos son algunos ejemplos que la o el docente puede
aplicar como actividades de evaluacin para el logro de las
competencias, tomando en cuenta los indicadores de logro
el nivel alcanzado por la y el estudiante.
Importancia de los criterios para ponderar las actividades
de evaluacin
La o el docente tienen la oportunidad de establecer criterios
en el proceso de evaluacin, estos son aplicables a los
indicadores de logro, algunos ejemplos de criterios de
evaluacin en Ciencias son los siguientes:
Coherencia: escribe la mayora de las ideas con
orden lgico.
Exactitud: uso del lenguaje cientfico de acuerdo a la
edad cronolgica de las y los estudiantes y el contexto.
Creatividad: seleccin y uso de diferentes materiales para
representar modelos, maquetas, simuladores y otros, al
ser elaborados por las y los estudiantes.
Disposicin para cumplir indicaciones.
Aplicacin del conocimiento cientfico a diferentes
situaciones para resolver problemas de la vida cotidiana
y otros.
Pertinencia en el establecimiento de supuestos como
probables respuestas a una situacin problema.
Claridad en la formulacin de preguntas a s mismo
y a los dems acerca de los problemas del entorno
relacionados con la salud, medio ambiente, fenmenos
naturales, entre otros.
Prctica de hbitos higinicos, posturales y medidas que
conserven el buen estado de la salud.
Curiosidad e inters cuando se realizan procesos de
investigacin.
120
Programa de estudio de cuarto grado
Precisin de sus ideas al razonar cientficamente sobre
causas y efectos de los fenmenos naturales, mediciones,
registro de datos y otros.
La revisin de cuadernos suele ser una de las actividades
de evaluacin para asignar calificaciones a las y los
nios. El cuaderno es un reflejo de la manera en que las y
los docentes desarrollan sus clases, as como del trabajo
del alumnado. Es un recurso potente para reflejar la
aplicacin de procedimientos y el grado de comprensin
de los contenidos. De ah la importancia de definir criterios
pertinentes para la evaluacin del cuaderno.
121
Programa de estudio de cuarto grado
CONCEPTUALES PROCEDIMENTALES
1.1 Ubica y representa, con
seguridad, las partes principales
del esqueleto humano: crneo,
columna vertebral y caja
torcica.
1.2 Explica y discute de manera
asertiva acerca de la funcin
que desempean: el crneo,
la columna vertebral y la caja
torcica en el cuerpo humano.
Principales partes del
esqueleto humano:
crneo, columna vertebral
y caja torcica.
Representacin y
ubicacin de algunas
partes principales del
esqueleto humano:
crneo, columna vertebral
y caja torcica.
Explicacin y discusin
sobre la funcin que
desempean el crneo,
la columna vertebral y
la caja torcica en el
cuerpo humano.
1
1
Seguridad en la ubicacin
y representacin de
algunas de las partes
principales del esqueleto
humano: crneo, columna
vertebral y caja torcica.
Valoracin por la
proteccin que le brinda
su crneo, caja torcica
y columna vertebral.
ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
UNIDAD 1
SOSTN Y ALGUNOS
MOVIMIENTOS EN LA
NATURALEZA
Tiempo probable: 22 horas clase
Objetivos
Representar y describir de forma correcta las principales partes del esqueleto humano,
explicando sus caractersticas principales y su importancia en la proteccin de los rganos
internos a fin de practicar hbitos que propicien una postura corporal correcta y promover
el uso de mquinas simples que faciliten el trabajo.
Diferenciar y representar con inters algunas caractersticas de los seres vivos, clasificando
las distintas formas de races de las plantas y comparando los movimientos de plantas y
animales en la naturaleza, algunos de ellos influenciados por la fuerza de la gravedad, a
fin de valorar su utilidad.
1.3 Practica hbitos posturales
y explica con claridad, la
importancia de mantener
una buena postura, al
levantar objetos pesados y
estar sentado o de pie.
Hbitos posturales al
levantar objetos pesados.
Prctica de hbitos
y explicacin de la
importancia de mantener
una buena postura al
levantar objetos pesados, y
al estar sentado o de pie.
Inters por identificar y
practicar buenas porturas
al levantar objetos
pesados y estar sentado
o de pie.
Programa de estudio de cuarto grado
122
Uso de las mquinas
simples: palancas y
poleas.
Identificacin y descripcin
de los elementos de una
mquina simple.
Clasificacin y
representacin de ejemplos
de mquinas simples,
destacando su utilidad en
la vida cotidiana.
Inters en la clasificacin
y representacin de
mquinas simples.
1.4 Describe, clasifica y representa
con inters, diversos ejemplos
de mquinas simples,
destacando su utilidad en la
vida cotidiana.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
1.5 Identifica, investiga y
describe en forma asertiva
sobre la utilidad alimentaria
o medicinal de algunas races
del entorno.


1.6 Observa, representa y clasifica
con curiosidad, races de
plantas del entorno en tpicas,
tuberosas y fibrosas.
Tipos de raz: tpicas,
tuberosas y fibrosas.
Observacin, representacin
y clasificacin de
distintos tipos de races
en el entorno.
Descripcin de las
caractersticas de las
races tpicas, tuberosas
y fibrosas.
Investigacin,
identificacin y
descripcin de algunas
races utilizadas por la
comunidad para uso
alimentario y medicinal.
Inters por observar,
ilustrar, comparar y
clasificar los diferentes
tipos de races.



Valoracin de la
importancia que tienen
las distintas races, en
la medicina y en la
alimentacin.
1.7 Explica, con claridad, la
funcin de la raz en la planta:
fijacin y absorcin.
Funcin de la raz
en la planta: fijacin
y absorcin.
Explicacin de la funcin
de la raz en una planta:
fijacin y absorcin.
1
Curiosidad e inters por
explicar la funcin de la
raz en una planta: fijacin
y absorcin.
Programa de estudio de cuarto grado
123
1.8 Describe, explica y representa
con curiosidad los taxismos y
los tropismos en los animales
y las plantas: hidrotaxismo,
hidrotropismo, geotaxismo
y geotropismo.
Los taxismos en los
animales y tropismos en
las plantas: hidrotaxismo,
hidrotropismo, geotaxismo
y geotropismo.
Descripcin, explicacin
y representacin de los
taxismos y tropismos
en los animales y las
plantas: hidrotaxismo,
hidrotropismo, geotaxismo
y geotropismo.
1 Inters por explicar y
representar los taxismos y
tropismos en los animales
y las plantas.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
1.9 Experimenta, explica y
representa con disposicin
la fuerza de gravedad para
reconocer la influencia de
esta en las situaciones de
la vida cotidiana.
Nocin de fuerza
de gravedad.
Indagacin y explicacin
de la importancia de la
fuerza de gravedad en
situaciones de la vida
cotidiana.
Experimentacin,
explicacin y
representacin de la
fuerza de gravedad.
1 Disposicin por
experimentar y representar
la fuerza de gravedad.
124
Programa de estudio de cuarto grado

2.1 Experimenta, representa y
explica con inters, la nocin de
materia en el mundo fsico que
le rodea.
Nocin de materia. Experimentacin, represen-
tacin y explicacin de la
nocin de materia en el
mundo fsico que le rodea.
Inters por experimentar,
representar y explicar la
nocin de materia.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
UNIDAD 2
EL MUNDO FSICO
QUE NOS RODEA
Tiempo probable: 18 horas clase
Objetivos
Explicar con claridad la nocin de materia y los cambios de los
cuerpos por efecto del calor y la temperatura, a travs de la observacin y
experimentacin, clasificando dichos cambios en reversibles e irreversibles para
aprovecharlos en la vida cotidiana.
Construir con iniciativa un circuito elctrico y utilizar algunas unidades e instrumentos
de medida calculando el rea, la masa y el volumen en slidos y lquidos, para resolver
algunas situaciones problemticas del entorno.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
2.2 Experimenta, identifica y
describe con seguridad, las
magnitudes fsicas: rea,
volumen y masa en objetos
y materiales que le rodean.
Algunas magnitudes
fsicas: rea, volumen
y masa.
Experimentacin,
identificacin y descripcin
de magnitudes fsicas: rea,
volumen y masa en objetos
y materiales que le rodean.
Disposicin por
experimentar, identificar
y describir algunas
magnitudes fsicas: rea,
volumen y masa.
2.3 Explica en forma correcta cules
son algunas unidades para
medir: el rea, el volumen
y la masa.
Algunas unidades para
expresar: rea, volumen
y masa.
Descripcin y explicacin
de cmo se expresan las
propiedades de la materia:
rea (cm
2
y m
2
), volumen
(cm
3
, m
3
, l y ml) y masa
(kg y gr ).
Seguridad al explicar
cmo se expresan en
forma correcta algunas
magnitudes fsicas.
Programa de estudio de cuarto grado
125
2.4 Resuelve con iniciativa
ejercicios, utilizando algunas
unidades para expresar rea,
volumen y masa.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Resolucin de ejercicios
utilizando algunas
unidades para expresar
rea, volumen y masa.
2 Certeza al resolver
ejercicios utilizando algunas
unidades que expresen
rea, volumen y masa.
2.5 Formula, pregunta y explica
con claridad la diferencia
entre calor y temperatura.

2.6 Experimenta y explica en
forma correcta algunos
fenmenos producidos por
efecto del calor en algunos
materiales.
2.7 Explica con objetividad cmo
la temperatura influye en la
distribucin de las especies
en el planeta.

2.8 Clasifica en forma correcta
los animales en exotrmicos
y endotrmios.
Efectos del calor y la
temperatura en los
seres vivos y algunos
materiales.
Formulacin de preguntas
y explicaciones acerca de
la diferencia entre calor y
temperatura.
Experimentacin y
explicacin de algunos
fenmenos producidos
por efecto del calor en
algunos materiales.
Anlisis de cmo la
temperatura es un
factor que influye en la
distribucin de las
especies en el planeta.
Clasificacin de los
animales, segn el
mecanismo por el cual
regulan su temperatura,
en exotrmicos y
endotrmicos.
Asertividad en la
formulacin de preguntas
y explicacin acerca de
la diferencia entre calor
y temperatura.
Inters por experimentar
y explicar los fenmenos
producidos por efecto
del calor en algunos
materiales.
Valoracin de la
temperatura como un
factor determinante en
la distribucin de las
diferentes especies en
el planeta.
Inters al clasificar los
animales en exotrmicos
y endotrmicos.
Programa de estudio de cuarto grado
126
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
2.9 Formula preguntas y
explicaciones coherentes
acerca de los cambios
reversibles e irreversibles
en slidos y lquidos.
2.10 Experimenta con precaucin
algunos cambios reversibles
e irreversibles en slidos y
lquidos del entorno.
Cambios reversibles e
irreversibles en slidos
y lquidos.
Formulacin de preguntas
y explicaciones acerca de
los cambios reversibles e
irreversibles en slidos
y lquidos.
Experimentacin y
descripcin de algunos
cambios reversibles e
irreversibles en slidos y
lquidos del entorno.
Inters y entusiasmo por
formular preguntas y
explicaciones acerca de
los cambios reversibles
e irreversibles en slidos
y lquidos.
Inters por experimentar
algunos cambios
reversibles e irreversibles,
tanto en slidos como
en lquidos.
2.11 Describe, explica y
representa de manera
correcta los elementos
de un circuito elctrico:
alambre conductor,
resistencia, fuente de
energa e interruptor.
Circuito elctrico. Descripcin, construccin
y representacin de los
elementos de un circuito
elctrico: alambre
conductor, resistencia,
fuente de energa
e interruptor.
Inters por construir,
describir e ilustrar los
elementos de un
circuito elctrico.
127
Programa de estudio de cuarto grado
3.1 Discute de manera asertiva
acerca de la importancia de
la nutricin adecuada, en el
ser humano, los animales
y las plantas.
3.2 Comprueba y explica con
inters, la absorcin y
circulacin de nutrientes
en las plantas por medio
de experimentos.
3.3 Explica y clasifica en forma
correcta a las plantas y
los animales en auttrofos
y hetertrofos.
Nutricin y alimentacin
en los animales, las
plantas y el ser humano.
CONCEPTUALES
Discusin sobre la
importancia de la
alimentacin y la nutricin
en el ser humano, los
animales y las plantas.
Indagacin,
experimentacin y
explicacin sobre la
absorcin y circulacin
de nutrientes a travs de
las plantas.
Explicacin y clasificacin
de las plantas y
animales en: auttrofos
y hetertrofos, en
forma respectiva.
PROCEDIMENTALES
3
3
3
Valoracin de la
importancia de la
alimentacin y la nutricin,
en el ser humano, los
animales y las plantas.
Curiosidad por
comprobar en forma
experimental la absorcin
y circulacin de nutrientes
en las plantas.
Inters por comprender
por qu las plantas
se clasifican en
auttrofas y los animales
en hetertrofos.
ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
UNIDAD 3
NUTRICIN Y
ALIMENTACIN DE
LOS SERES VIVOS
Tiempo probable: 34 horas clase
Objetivos
Clasificar con inters a los seres vivos por su forma de alimentacin y nutricin,
describiendo a los seres auttrofos y hetertrofos para valorar el proceso de transformacin
de los alimentos en el ser humano.
Clasificar con certeza los diferentes tipos de alimentos, formulando preguntas y
explicaciones acerca de sus funciones e importancia nutritiva en el organismo,
investigando las clases de vitaminas que poseen y los procesos empleados para la
conservacin de los alimentos y su cultivo.
Programa de estudio de cuarto grado
128
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
3.4 Clasifica, con seguridad, a los
animales de acuerdo a su tipo
de alimentacin en herbvoros,
carnvoros y omnvoros.
Animales herbvoros,
carnvoros y omnvoros.
Investigacin, clasificacin
y representacin de los
animales de acuerdo a
su tipo de alimentacin:
herbvoros, carnvoros
y omnvoros.
3
Curiosidad por clasificar
los animales de acuerdo
a su tipo de alimentacin:
herbvoros, carnvoros
y omnvoros.
Valoracin y respeto por
los animales del entorno.
3.5 Explica y relaciona de manera
correcta el proceso de
transformacin de los
alimentos con los rganos
del sistema digestivo.

3.6 Formula preguntas y explica
con inters el proceso
de transformacin de los
alimentos en el cuerpo humano.
Proceso de transformacin
de los alimentos.
Identificacin y relacin
de los rganos del sistema
digestivo que participan
en las diferentes etapas del
proceso de transformacin
de los alimentos en el
ser humano.
Formulacin de preguntas
y explicaciones acerca del
proceso de transformacin
de los alimentos durante
la digestin.
3
3
Inters por conocer el
proceso de transformacin
de los alimentos.

Iniciativa por formular
preguntas y explicaciones
acerca del proceso
de digestin.
3.7 Identifica y clasifica con
iniciativa los dientes y la
funcin que realizan en el
proceso de la digestin.
Clasificacin y funcin de
los dientes.
Identificacin y
clasificacin de los
dientes y la funcin que
realizan en el proceso
de la digestin.
Representacin y
descripcin de la primera
y segunda denticin.
Disposicin por clasificar
los dientes y la funcin
que realizan en el
proceso de la digestin.
Disposicin por
representar la primera y
segunda denticin.
Programa de estudio de cuarto grado
129
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
3.8 Indaga y describe con inters el
proceso del cepillado de dientes
y muelas en forma correcta.

3.9 Practica el lavado correcto
de dientes y muelas para
una denticin saludable.
Cuidados para una
denticin saludable.
Indagacin y descripcin
sobre cmo cepillarse
los dientes y muelas en
forma correcta para una
buena limpieza.
Prctica del lavado
correcto de dientes y
muelas para una
denticin saludable.
Indagacin y relacin de
la importancia de aplicar
flor oral para
una denticin saludable.
3
3
Curiosidad por describir
cmo se cepillan en
forma correcta los
dientes y las muelas.
Valoracin de la prctica
del lavado correcto de
dientes y muelas para una
denticin saludable.
3.10 Formula preguntas y explica con
claridad, sobre la importancia
del cultivo y consumo de
hortalizas para la salud.
3.11 Investiga con inters las ventajas
y desventajas de los cultivos
hidropnicos.
Cultivo y consumo de
hortalizas.
Formulacin de preguntas
y explicaciones sobre la
importancia del cultivo
y consumo de hortalizas
para la salud.
Investigacin y realizacin
de cultivos hidropnicos.
3
3
Valoracin de la
importancia del cultivo de
hortalizas y disposicin
a consumirlas en la
alimentacin diaria.
Disposicin para
investigar y realizar
cultivos hidropnicos.
3.12 Explica con autonoma, las
ventajas de consumir productos
naturales de un huerto.
Ventajas de la siembra
de huertos.
Indagacin y explicacin
de las ventajas para la
salud y la economa
familiar al cultivar y
consumir productos
naturales de un huerto.
Inters por indagar y
explicar las ventajas para
la salud y la economa
familiar al cultivar y
consumir los productos
naturales de un huerto.
Programa de estudio de cuarto grado
130
Descripcin y explicacin
sobre los cuidados
necesarios para el buen
funcionamiento del huerto.
Curiosidad e inters por
explicar los cuidados
necesarios para el buen
funcionamiento del huerto.
3.13 Describe con seguridad, los
cuidados necesarios para el
buen funcionamiento del huerto.
3.14 Identifica y clasifica con
inters los tipos de vegetales:
cereales, leguminosas,
hortalizas y frutales, que
deben incluirse en la
alimentacin para tener una
buena salud.
3.15 Formula preguntas y explica
con claridad acerca de la
importancia de consumir
diferentes tipos de vegetales en
la alimentacin diaria.
Tipos de vegetales:
cereales, leguminosas,
hortalizas y frutales.
Identificacin, clasificacin
e ilustracin de los tipos
de vegetales: cereales,
leguminosas, hortalizas y
frutales, utilizados en la
alimentacin.
Formulacin de preguntas
y explicaciones acerca
de la importancia de
incluir los diferentes
tipos de vegetales en la
alimentacin diaria.
Disposicin por clasificar
los tipos de vegetales:
cereales, leguminosas,
hortalizas y frutales.
3.16 Indaga con inters sobre el
contenido de vitaminas y
minerales de mayor consumo
en la comunidad.
3.17 Identifica, clasifica y representa
correctamente los alimentos que
contienen vitaminas y minerales.
Alimentos que contienen
vitaminas y minerales.
Indagacin sobre los
alimentos de mayor
consumo en la comunidad
y su contenido de
vitaminas y minerales.
Identificacin, clasificacin
e ilustracin de alimentos
que contienen vitaminas
y minerales.
3
3
Valoracin de la
importancia del consumo
de alimentos ricos en
vitaminas y minerales.
Inters por identificar
los alimentos de mayor
consumo en la comunidad
y su contenido de
vitaminas y minerales.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Programa de estudio de cuarto grado
131
3.18 Indaga y explica con
entusiasmo, la funcin e
importancia que desempean
las vitaminas y minerales en el
organismo.
INDICADORES DE LOGRO CONTENIDOS
Las funciones de las
vitaminas y minerales
en el organismo.
Indagacin y explicacin
de las funciones e
importancia de las
vitaminas y los minerales
en el organismo.
3 Curiosidad por indagar
y explicar las funciones
e importancia que las
vitaminas y los minerales
cumplen en el organismo.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
3.19 Indaga y describe con claridad,
las distintas formas para
conservar los alimentos en el
hogar: conservas, ahumados,
salados y refrigerados.
Medidas adecuadas para
conservar los alimentos:
conservas, ahumados,
salados y refrigerados.
Indagacin, descripcin
y prctica de medidas
adecuadas para conservar
los alimentos en el hogar:
conservas, ahumados,
salados, enlatados,
encurtidos y refrigerados.
Inters por describir
medidas adecuadas
para conservar los
alimentos en su hogar:
conservas, ahumados,
salados y refrigerados.
Programa de estudio de cuarto grado
132
4.1 Explica y representa de forma
correcta la estructura general
de un volcn: crter, cono
y chimenea.
4.2 Describe con inters los
peligros que para las personas
y la comunidad tienen
las erupciones.
Estructura general de un
volcn: crter, cono y
chimenea.
Explicacin, identificacin
y representacin de la
estructura general de un
volcn: crter, cono y
chimenea.
Descripcin de los tipos
de erupcin y los
peligros para las personas
y la comunidad.
4
4
Inters por identificar y
representar la estructura
general de un volcn:
crter, cono y chimenea.
Disposicin para
conocer sobre los peligros
que para las personas
y la comunidad tienen
las erupciones.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
UNIDAD 4
PREVINIENDO RIESGOS
Y ACCIDENTES
Tiempo probable: 22 horas clase
Objetivos
Explicar y reconocer con iniciativa algunas situaciones de riesgo, describriendo
cmo se originan las erupciones volcnicas, inundaciones e incendios
forestales, a fin de identificar zonas seguras y practicar medidas de prevencin
y preparacin en caso de ocurrencia de sismos u otras emergencias.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
4.3 Discute y analiza con
objetividad los efectos de una
erupcin volcnica sobre el
relieve y los seres vivos.
Sismo causado por una
erupcin volcnica.
Discusin y anlisis
sobre los efectos de una
erupcin volcnica sobre
el relieve y los seres vivos.
4 Claridad y objetividad
al discutir y analizar
los efectos que puede
ocasionar una erupcin
volcnica sobre el relieve
y los seres vivos.
Programa de estudio de cuarto grado
133
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
4.4 Formula preguntas con
claridad y explica algunas
medidas preventivas en caso
de sismo causado por una
erupcin volcnica.
Formulacin de preguntas
y explicaciones acerca de
las medidas preventivas en
caso de sismo causado por
una erupcin volcnica.
Relacin de la actividad
volcnica con la
ocurrencia de un sismo.
4 Disposicin para formular
preguntas y explicaciones
acerca de las medidas
preventivas en caso de
sismo causado por una
erupcin volcnica.
4.5 Elabora con creatividad el
mapa de riesgo y recursos de
la escuela: amenazas
y vulnerabilidades.
Mapa de riesgo y recursos
de la escuela: amenazas y
vulnerabilidades.
Elaboracin del mapa
de riesgo y evaluacin
de los recursos de la
escuela: amenazas
y vulnerabilidades.
Sealizacin y
reconocimiento de las
zonas seguras y peligrosas
en el mapa de riesgo de
la escuela.
Colaboracin en la
elaboracin del mapa de
riesgo y evaluacin de los
recursos de la escuela.
4.6 Practica con responsabilidad
simulacros de evacuacin en
la escuela en caso de sismos.
Simulacros de evacuacin
en la escuela en caso
de sismos.
Prctica de simulacros de
evacuacin en la escuela
en caso de sismos.
Reflexin y anlisis de
la importancia de los
simulacros en la casa y
la escuela.
4 Responsabilidad en la
prctica de simulacros de
evacuacin en la escuela
en caso de sismos.
134
Programa de estudio de cuarto grado
Acciones preventivas para
evitar accidentes en caso
de desbordamientos
e inundaciones.
Identificacin y anlisis de
sitios en la comunidad con
riesgo de desbordamientos
o inundaciones.
Discusin, explicacin
y divulgacin de acciones
preventivas para evitar
accidentes en caso
de desbordamientos
e inundaciones.
Inters por identificar sitios
en la comunidad con
riesgo de desbordamientos
o inundaciones.
Disposicin para la
discusin y divulgacin
de las acciones
preventivas a fin de evitar
accidentes en caso de
desbordamientos
e inundaciones.
4.7 Identifica y analiza con inters
sitios en la comunidad con
riesgo de desbordamientos
o inundaciones.
4.8 Discute, analiza y divulga
con inters acciones
preventivas para evitar
accidentes en caso de
desbordamientos e
inundaciones.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
4.9 Indaga, diferencia y explica
con inters las causas y
consecuencias de los
incendios forestales.
Causas y consecuencias
de los incendios forestales.
Indagacin, diferenciacin
y explicacin, de las
causas y consecuencias
naturales y antrpicas de
los incendios forestales.
Disposicin para indagar
y explicar las causas y
consecuencias de los
incendios forestales.
4.10 Discute, representa y divulga
con responsabilidad acciones
para evitar y prevenir incendios
forestales: apagar brasas,
cenizas o brotes de llamas.
Acciones para evitar
y prevenir incendios
forestales: apagar cenizas,
brasas o brotes de llamas.
Discusin, representacin
y divulgacin de acciones
para evitar y prevenir
incendios forestales:
apagar brasas, cenizas o
brotes de llamas.
Disposicin y creatividad
para la discusin,
representacin y
divulgacin de algunas
acciones que eviten
y prevengan
incendios forestales.
Programa de estudio de cuarto grado
135
CONCEPTUALES PROCEDIMENTALES
5.1 Ubica y representa con inters
los rganos que se utilizan para
realizar el proceso de excrecin
de la orina.

5.2 Describe con claridad las
caractersticas de los rganos
del sistema excretor.
Estructura del sistema
excretor.
Identificacin y
representacin de los
rganos que se utilizan
para realizar el proceso
de excrecin de la orina.
Descripcin de las
caractersticas de
los rganos del
sistema excretor.
5
5
Inters por participar en
la identificacin e
ilustracin de los rganos
que se utilizan para
realizar el proceso de
excrecin de la orina.
Inters por describir
las caractersticas de
los rganos del
sistema excretor.
ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
UNIDAD 5
CMO CAMBIA
NUESTRO CUERPO?
Tiempo probable: 21 horas clase
Objetivos
Describir y representar los principales rganos que forman el sistema excretor, reconociendo su
ubicacin, anatoma y fisiologa para valorar su importancia e incentivar a la prctica de hbitos
que permitan su cuido y buen funcionamiento.
Analizar y explicar las caractersticas y funciones de los rganos reproductores del ser humano
relacionndolos con los cambios fsicos y psicolgicos que se experimentan en la pubertad, para
valorar la importancia de su cuido y proteccin ante riesgos y enfermedades.
5.3 Explica con claridad el
funcionamiento del
sistema excretor.
Funcionamiento del
sistema excretor.
Explicacin del
funcionamiento del
sistema excretor.
5 Inters y respeto por
explicar el funcionamiento
del sistema excretor.
Programa de estudio de cuarto grado
136
INDICADORES DE LOGRO CONTENIDOS
5.4 Indaga y explica con
responsabilidad, las causas
de algunas enfermedades
comunes que afectan el
sistema excretor.
Indagacin y explicacin
de las causas de algunas
enfermedades comunes
que afectan el sistema
excretor.
Inters por indagar y
explicar las causas de
algunas enfermedades
comunes que afectan el
sistema excretor.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
5.5 Identifica y explica con
respeto, las excreciones
del cuerpo humano.
5.6 Explica en forma asertiva
las caractersticas y el
origen de: la orina, el sudor
y otras excreciones del
cuerpo humano.
Las excreciones del
organismo humano.
Identificacin y explicacin
de las diferentes
excreciones del cuerpo
humano.
Indagacin acerca de las
caractersticas y origen
de: la orina, el sudor
y otras excreciones del
cuerpo humano.
Respeto al identificar y
explicar las excreciones
del cuerpo humano.
Inters por conocer las
caractersticas y origen
de: la orina, el sudor
y otras excreciones del
cuerpo humano.
5.7 Describe y propone con
claridad hbitos higinicos
que deben practicarse para
limpiar las excreciones del
cuerpo humano.
5.8 Discute y analiza con
inters las implicaciones
de contaminar el medio
ambiente con las
excretas humanas.
Hbitos higinicos para
limpiar las excreciones
del cuerpo humano.
Descripcin y proposicin
de los hbitos higinicos
que deben practicarse
para limpiar las
excreciones del cuerpo
humano.
Discusin y anlisis de
las implicaciones de
contaminar con excretas
humanas el medio
ambiente: agua,
aire y suelo.
Disposicin para
practicar hbitos
higinicos relacionados
con la limpieza de
las excreciones del
cuerpo humano.
Valoracin sobre las
implicaciones de la
contaminacin del medio
ambiente por medio de
las excretas humanas.
Programa de estudio de cuarto grado
137
5.9 Explica de manera correcta la
estructura y funcionamiento
de los rganos reproductores
masculinos y femeninos.
5.10 Indaga y practica con inters
hbitos higinicos para el
cuidado y proteccin de los
rganos genitales.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
rganos reproductores
masculinos y femeninos.
Explicacin de la estructura
y funcionamiento de los
rganos reproductores
masculinos y femeninos.
Indagacin y prctica de
hbitos higinicos para el
cuidado y proteccin de
los rganos genitales.
5
5
Respeto al explicar,
la estructura y
funcionamiento de los
sistemas reproductores
masculinos y femeninos.
Inters por indagar
y practicar hbitos
higinicos para el cuidado
y proteccin de los
rganos genitales.
5.11 Describe, representa y analiza
con objetividad, los principales
cambios biolgicos, afectivos
y sociales en la etapa de
la pubertad.
Cambios biolgicos,
afectivos y sociales en la
etapa de la pubertad.
Identificacin, descripcin
y representacin de los
cambios fsicos en las
nias y los nios, en la
etapa de la pubertad.
Anlisis y discusin de
los cambios biolgicos,
afectivos y sociales en la
etapa de la pubertad.
5 Aceptacin con
naturalidad de los
cambios en la etapa de
la pubertad.
Respeto por las ideas y
opiniones de los dems,
respecto a sus inquietudes
sobre los cambios
biolgicos, afectivos y
sociales en la etapa
de la pubertad.
5.12 Formula preguntas, indaga y
explica acerca del VIH-SIDA
como una pandemia que afecta
la poblacin salvadorea.
5.13 Describe y representa con
respeto e inters medidas
preventivas para evitar
el VIH-SIDA.
El VIH-SIDA como una
pandemia en el planeta.
Formulacin de preguntas,
indagacin y explicaciones
acerca del VIH-SIDA
como una pandemia.
Descripcin y representacin
de medidas preventivas
para evitar el VIH-SIDA.
5
5
Valoracin y reflexin ante
el VIH-SIDA como
pandemia.
Respeto al describir y
representar las medidas
preventivas para evitar
el VIH-SIDA.
Programa de estudio de cuarto grado
138
CONCEPTUALES PROCEDIMENTALES
6.1 Describe y representa con
creatividad, las partes
principales de la lengua.
6.2 Explica, con objetividad,
las funciones principales de
la lengua y su interrelacin
con el proceso digestivo.
Partes principales
de la lengua.
Descripcin y
representacin de las
partes principales de
la lengua.
Explicacin de la funcin
de las partes principales
de la lengua e
interrelacin con otros
procesos de la digestin.
6
6
Creatividad al representar
las partes de la lengua.

Valoracin y
reconocimiento de la
funcin que realiza la
lengua en el proceso
digestivo.
ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
UNIDAD 6
PREVINIENDO
ENFERMEDADES
Tiempo probable: 37 horas clase
Objetivos
Representar y describir las principales partes y funciones del sentido del gusto, el olfato y el
sistema circulatorio del ser humano, investigando, formulando preguntas y explicaciones
para valorar su importancia y practicar medidas de proteccin.
Investigar y explicar las causas y consecuencias de algunas enfermedades epidmicas,
alcoholismo y frmaco dependencia, identificando y describiendo situaciones que
las propician para implementar medidas preventivas y de divulgacin que ayuden a
minimizar sus efectos en la salud humana.
6.3 Describe y representa con
inters algunas medidas para
proteger el sentido del gusto.
6.4 Propone, practica y divulga
con iniciativa medidas para la
proteccin del sentido del gusto.
Medidas para proteger
el sentido del gusto.
Descripcin y
representacin de algunas
medidas para cuidar el
sentido del gusto.
Proposicin, prctica y
divulgacin de medidas
para proteger el sentido
del gusto.
6.
6.
Valoracin y disposicin
para practicar buenos
hbitos higinicos a fin de
proteger el sentido del gusto.
Disposicin para practicar
y divulgar medidas que
protegen el sentido del
gusto.
139
Programa de estudio de cuarto grado
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
6.5 Describe en forma correcta,
los rganos del sentido del
olfato y su funcionamiento.
Anatoma y fisiologa de
los rganos del sentido
del olfato.
Descripcin de la
anatoma y fisiologa de
los rganos del sentido
del olfato.
Inters por conocer el
funcionamiento de los
rganos del sentido
del olfato.
6.6 Describe con claridad y
practica medidas para
la proteccin del sentido
del olfato.
Medidas para proteger el
sentido del olfato.
Descripcin y anlisis de
medidas para proteger el
sentido del olfato.
Prctica de hbitos
higinicos para cuidar
el sentido del olfato.
6 Disposicin para practicar
medidas para proteger el
sentido del olfato.
6.7 Identifica y describe con inters
la importancia de los signos
vitales en el ser humano.
Signos vitales: respiracin,
pulsaciones y temperatura.
Identificacin y
descripcin de los signos
vitales: respiracin,
pulsacin y temperatura
en el ser humano.
6 Valoracin de la
importancia que tienen los
signos vitales: respiracin,
pulsacin y temperatura
en el ser humano.
6.8 Ubica en forma correcta, la
posicin del corazn en el
cuerpo humano, utilizando
ilustraciones.
6.9 Identifica e ilustra el corazn
en forma correcta y explica su
funcin en el cuerpo humano.
6.10 Explica con inters la importancia
del corazn para el transporte de
la sangre al cuerpo humano.
Ubicacin, forma y
funcin del corazn.
Ubicacin del corazn,
en el cuerpo por medio
de sus latidos.
Identificacin e ilustracin
del corazn y explicacin
de su funcin en el cuerpo
humano.
Explicacin de la
importancia del corazn
para el transporte de la
sangre a todas las partes
del cuerpo humano.
6
6
6
Inters por ubicar el
corazn del ser humano,
a travs de ilustraciones.
Disposicin por ilustrar
con creatividad el corazn
y explicar su funcin en
el cuerpo humano.
Inters por explicar la
importancia del corazn
para el transporte de la
sangre al cuerpo humano.
Programa de estudio de cuarto grado
140
6.11 Indaga y explica con claridad,
la importancia y funcin de la
sangre en el organismo.
6.12 Identifica, investiga y describe
con certeza los componentes
de la sangre: plaquetas,
glbulos rojos y blancos.
Importancia de la sangre. Indagacin y explicacin
sobre la importancia y
funcin de la sangre.
Identificacin,
investigacin y descripcin
de los componentes de
la sangre: plaquetas,
glbulos rojos y blancos.
6
6
Valoracin de la
importancia y funcin de
la sangre en el organismo.
Inters por investigar
los componentes de
la sangre.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
6.13 Formula preguntas y explica
con inters las actividades
que se deben realizar para
proteger el corazn: deportes,
alimentacin balanceada,
controles de salud peridica,
entre otros.
Acciones para proteger
el corazn.
Formulacin de preguntas
y explicaciones acerca
de las actividades que
se deben realizar para
proteger el corazn:
deportes, alimentacin
balanceada, controles de
salud peridica, etc.
Inters por aportar ideas
de cmo mantener
saludable el corazn.
6.14 Indaga y explica con iniciativa
las diferentes formas en las
que se puede adquirir el
clera como enfermedad
epidmica y practica las
medidas de prevencin
para evitar el contagio.
6.15 Formula preguntas y explica
con claridad las causas y
consecuencias del clera como
enfermedad epidmica.
El clera como
enfermedad epidmica.
Indagacin y explicacin
del clera como
enfermedad epidmica y
prctica de las medidas
de prevencin para evitar
el contagio.
Formula preguntas y
explicaciones de las
causas y consecuencias
del clera como
enfermedad epidmica.
Disposicin por practicar
hbitos higinicos y
alimentarios como
medida para prevenir
el clera.
Valoracin e inters
por formular preguntas
y explicar las causas
y consecuencias del
clera como enfermedad
epidmica.
Programa de estudio de cuarto grado
141
Identificacin e ilustracin
del agente transmisor
del clera.
Inters por ilustrar el
agente transmisor
del clera.
6.16 Identifica e ilustra con
creatividad el agente transmisor
del clera.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
6.17 Identifica, ilustra y describe
con claridad al agente
transmisor del dengue.
Agente transmisor del
dengue: zancudo.
Identificacin, descripcin
e ilustracin del agente
transmisor del dengue.
6 Actitud crtica y propositiva
en la identificacin del
agente transmisor del
dengue.
6.18 Describe, ilustra y divulga de
forma correcta las medidas
preventivas para evitar
el dengue en el hogar, la
escuela y la comunidad.
Medidas para evitar
el dengue.
Descripcin, ilustracin y
divulgacin de medidas
preventivas para evitar el
dengue en el hogar, la
escuela y la comunidad.
Identificacin de focos
de infeccin en el hogar y
la escuela para evitar
el dengue.
6
Disposicin por identificar
y aplicar las medidas
preventivas para evitar el
dengue en el hogar, la
escuela y la comunidad.
6.19 Investiga y analiza con inters
las causas y consecuencias
del alcoholismo y la frmaco
dependencia.
6.20 Formula preguntas, explica,
discute y analiza con
responsabilidad casos sobre
el alcoholismo y la frmaco
dependencia.
El alcoholismo y la
frmaco dependencia
(toxicomana).
Investigacin y anlisis de
las causas y consecuencias
del alcoholismo y la
frmaco dependencia.
Formulacin de preguntas,
explicaciones, discusin y
anlisis de casos sobre el
alcoholismo y la frmaco
dependencia.
6
6
Disposicin por conocer
las causas del alcoholismo
y la frmaco dependencia.
Disposicin por analizar
casos sobre el alcoholismo
y la frmaco dependencia.
142
Programa de estudio de cuarto grado
UNIDAD 7
NUESTRA AMIGA
EL AGUA
Objetivos
Causas de la poca seca
y lluviosa en El Salvador.
Indagacin y explicacin
de las causas de la poca
seca y lluviosa en
El Salvador.
Investigacin y
representacin de los
fenmenos
meteorolgicos que
provocan lluvia o
sequa en El Salvador.
Disposicin por indagar
las causas de la poca
seca y lluviosa en
El Salvador.
Curiosidad por investigar
y representar los
fenmenos
meteorolgicos que
provocan lluvias o
sequas en El Salvador.

7.1 Indaga y explica con certeza
las causas de la poca seca
y lluviosa en El Salvador.
7.2 Investiga y representa
con inters los fenmenos
meteorolgicos causantes
de las sequas o lluvias en
El Salvador.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
Tiempo probable: 15 horas clase
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
Indagar y construir con creatividad instrumentos meteorolgicos, observando,
midiendo y registrando fenmenos atmosfricos para explicar las variaciones
climticas en el pas.
Explicar distintas formas de contaminar el agua, practicando y promoviendo
con responsabilidad medidas preventivas con el fin de evitar algunas
enfermedades y mantener la salud.
7.3 Describe con claridad, algunos
fenmenos atmosfricos:
cantidad de lluvia, direccin
del viento, humedad y
temperatura.
Medicin de algunos
fenmenos atmosfricos:
cantidad de lluvia,
direccin del viento,
humedad y temperatura.
Descripcin de algunos
fenmenos atmosfricos:
cantidad de lluvia,
direccin del viento,
humedad y temperatura.
7 Curiosidad por describir
algunos fenmenos
atmosfricos: cantidad de
lluvia, direccin del viento,
humedad y temperatura.
Programa de estudio de cuarto grado
143
7.4 Disea y construye, en forma
creativa, un pluvimetro y
una veleta y los utiliza de
manera correcta.
Diseo, elaboracin y
utilizacin de un
pluvimetro y una veleta,
para medir la cantidad
de lluvia y determinar la
direccin del viento.
Creatividad en el diseo
y elaboracin de un
pluvimetro y una veleta.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
7.5 Explica con inters la
importancia de consumir
al menos ocho vasos de
agua al da para
mantenerse saludable.
Cantidad de agua
necesaria para la salud.
Descripcin y explicacin
de la importancia de
consumir al menos ocho
vasos de agua al da para
mantenerse saludable.
7 Aceptacin responsable
de la recomendacin de
beber suficiente agua para
mantenerse saludable.
7.6 Explica y analiza de manera
crtica las formas de
contaminacin del agua: aguas
servidas y desechos slidos.
Formas de contaminacin
del agua: aguas servidas
y desechos slidos.
Explicacin y anlisis
acerca de las formas de
contaminacin del agua:
aguas servidas y
desechos slidos.
Responsabilidad e inters
por explicar y analizar
algunas formas de
contaminacin del agua.
7.7 Formula preguntas, indaga
y explica correctamente
acerca de enfermedades
producidas por el contacto
con agua contaminada.
Enfermedades producidas
por el contacto con agua
contaminada.
Formulacin de
preguntas, indagacin
y explicaciones acerca
de las enfermedades
producidas por el
contacto con agua
contaminada.
7
Inters por indagar las
enfermedades producidas
por el contacto con agua
contaminada.
Programa de estudio de cuarto grado
144
UNIDAD 8
LA TIERRA,
NUESTRO GRAN HOGAR
Objetivos
Comparar y representar con inters las comunidades biticas, analizando sus componentes y
las acciones humanas que afectan el medio ambiente, para practicar medidas de proteccin
de los ecosistemas y recursos naturales.
Describir y representar las caractersticas de la Luna y la inclinacin de la Tierra, indagando
sobre su forma, tipos de movimiento y duracin que expliquen el origen de las fases de la
Luna y la relacin con las zonas polares, para reconocer su influencia sobre los seres vivos.
Tiempo probable: 31 horas clase
8.1 Describe y explica con certeza
la nocin de poblacin y
comunidad bitica.
8.2 Compara y representa con
creatividad los componentes
de una poblacin y de una
comunidad bitica.
Nocin de poblacin y
comunidad bitica.
Descripcin y explicacin
de la nocin de poblacin
y de comunidad bitica.

Comparacin y
representacin de los
componentes de una
poblacin y de una
comunidad bitica.
8.
8.
Inters por describir y
explicar la nocin de
poblacin y comunidad
bitica.

Disposicin para comparar
los componentes de
una poblacin y de una
comunidad bitica.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
8.3 Indaga, interpreta y explica
con claridad, los hallazgos
recopilados de los factores
que limitan el crecimiento
poblacional en los ecosistemas:
temperatura, humedad y luz.
Factores que limitan el
crecimiento poblacional
en los ecosistemas:
temperatura, humedad
y luz.
Indagacin, interpretacin
y explicacin de los factores
que limitan el crecimiento
poblacional en los
ecosistemas: temperatura,
humedad y luz.
8 Responsabilidad en la
indagacin cientfica acerca
de los factores que limitan
el crecimiento poblacional:
temperatura, humedad y luz.
8.4 Explica y representa con
inters las principales
acciones del ser humano
sobre las poblaciones y
comunidades biticas: caza,
pesca, tala y contaminacin.
Acciones del ser humano
sobre poblaciones y
comunidades biticas:
caza, pesca, tala y
contaminacin.
Indagacin, explicacin
y representacin de las
acciones del ser humano
sobre las poblaciones y
comunidades biticas:
caza, pesca, tala y
contaminacin.
Emisin de juicio crtico
acerca de las acciones
que realizan los seres
humanos sobre los
recursos naturales y el
ambiente.
Programa de estudio de cuarto grado
145
8.5 Explica y representa con
creatividad el uso racional del
suelo: rotacin de cultivos para
mantener su fertilidad.
Uso racional del suelo:
rotacin de cultivos.
Discusin, explicacin y
representacin del uso
racional del suelo:
rotacin de cultivos, para
mantener su fertilidad.
Inters por explicar y
representar el uso
racional del suelo:
rotacin de cultivos.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
8.6 Formula preguntas y explica
con iniciativa acerca del
tratamiento de la basura en
la escuela y el hogar para
reducir la contaminacin.
Tratamiento de la basura
en la escuela y el hogar
para reducir
la contaminacin.
Formulacin de preguntas
y explicaciones acerca
del tratamiento de la
basura en la escuela y
el hogar para reducir
la contaminacin.
8 Valoracin de la
importancia del
tratamiento de basura en
la escuela y el hogar para
reducir la contaminacin.
8.7 Describe y explica con
objetividad formas de reciclar
objetos y materiales
desechables en el hogar y la
escuela, para reducir
la contaminacin.
Reciclaje de objetos y
materiales desechables en
el hogar y la escuela.
Descripcin y explicacin
de formas de reciclar
objetos y materiales
desechables en el hogar y
la escuela para reducir la
contaminacin.
Descripcin y explicacin
de la regla de las tres erres
(reusar, reciclar y reducir).
Valoracin y prctica de
las formas de reciclar
objetos y materiales.
8.8 Experimenta y explica
con certeza la dispersin
y composicin de la luz
proveniente del Sol por
medio un prisma.
El arcoris, composicin y
descomposicin de la luz.
Experimentacin y
explicacin de la dispersin
y composicin de la luz
proveniente del Sol por
medio de un prisma.
Curiosidad por
comprobar la
descomposicin de la luz
proveniente del Sol
al atravesar un prisma.
Programa de estudio de cuarto grado
146
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
8.9 Identifica, describe y representa
con creatividad las fases de la
Luna como consecuencia del
movimiento de traslacin.
8.10 Observa y estima con
objetividad la periodicidad de
las fases de la Luna y su
relacin con el calendario.
8.11 Explica con inters la
influencia de los
movimientos de la Luna
en las mareas.
Fases de la Luna. Identificacin, descripcin
y representacin de
las fases de la Luna
como consecuencia del
movimiento de traslacin.
Observacin y estimacin
de la periodicidad de
las fases de la Luna y su
relacin con el calendario.
Indagacin y explicacin
de la influencia de los
movimientos de la Luna
con las mareas.
Inters por identificar,
describir y representar
las fases de la Luna y los
cambios que provoca en
la Tierra.
Iniciativa por estimar la
periodicidad de la fases
de la Luna.
Objetividad al indagar y
explicar la influencia de
los movimientos de la
Luna con las mareas.
8.12 Identifica y representa con
creatividad el eje de inclinacin
de la Tierra y la duracin
del da y la noche en los
polos terrestres.
8.13 Describe y explica con claridad
las caractersticas climticas de
los polos terrestres.
El eje de inclinacin
de la Tierra y los
polos terrestres.
Identificacin e ilustracin
del eje de inclinacin de la
Tierra y la duracin del da
y la noche en los
polos terrestres.
Descripcin y explicacin
de las caractersticas
climticas de los
polos terrestres.
Curiosidad por ilustrar el
efecto de la inclinacin
terrestre en la duracin
del da y de la noche en
los polos terrestres.
Iniciativa por buscar
informacin que explique
las caractersticas
climticas de los
polos terrestres.
8.14 Describe en forma correcta la
importancia de la atmsfera
para la vida en el planeta Tierra.
8.15 Investiga y analiza con
inters la importancia de la
capa de ozono y las medidas
de proteccin contra los
rayos ultravioleta.
Importancia de la
atmsfera para la vida en
el planeta Tierra.
Descripcin de la
importancia de la
atmsfera para la vida en
el planeta Tierra.
Investigacin y anlisis de
la importancia de la capa
de ozono y de las medidas
de proteccin contra los
rayos ultravioleta.
8
8
Reconocimiento de la
atmsfera para la existencia
de vida en el planeta.
Reconocimiento de
la importancia de la
atmsfera en la proteccin
de la Tierra contra los rayos
ultravioleta provenientes
del Sol.
ESTUDIOS
SOCIALES
148
Programa de estudio cuarto grado
Presentacin de la asignatura
Los Estudios Sociales son uno de los pilares fundamentales
para propiciar y fomentar la formacin y consolidacin
de valores morales y cvicos de ah que esta asignatura
capacite al alumnado para interpretar las relaciones
sociedad-naturaleza en las dimensiones geogrfica,
histrica, poltica y econmica; y fortalezca el conocimiento
y la convivencia en la escuela, el hogar, la localidad, el pas,
la regin y el mundo, a fin de insertarse de manera efectiva
en la sociedad.
En este sentido se propone la formacin de una salvadorea
y de un salvadoreo con la capacidad de construir
socialmente su escala de valores para que, a partir de ella,
construyan criterios para el anlisis, la intervencin y la
transformacin de la realidad.
Enfoque de la asignatura: integrador de la
realidad y de participacin social
El enfoque de la asignatura retoma los contenidos de las
diferentes disciplinas de las Ciencias Sociales con la finalidad
de formar estudiantes capaces de ejercer ciudadana
responsable y crtica, y que contribuyan al desarrollo de una
sociedad democrtica. Los conocimientos se organizan en
funcin de las necesidades de los educandos, sin dejar a un
lado la rigurosidad y coherencia conceptual para construir
una escala de valores que les permita comprender, analizar
y transformar la realidad. Tambin incluye habilidades
y actitudes en el mbito familiar, escolar, comunitario,
nacional y mundial.
Competencias
Anlisis de la problemtica social: pretende crear conciencia
y compromiso en el educando a partir de la reflexin crtica
de los problemas polticos, econmicos, sociales, ecolgicos
y culturales presentes en la sociedad.
Investigacin de la realidad social e histrica: promueve en
el alumnado la observacin y la comprensin del porqu
y cmo ocurren los hechos, y encontrar las razones de los
mismos, realizar predicciones y sugerir soluciones.
Participacin crtica y responsable en la sociedad: es decir,
que el alumnado comprenda claramente su contexto y
su cultura, y participe en ellos de forma crtica, creativa
y responsable, promoviendo situaciones morales y ticas
frente al anlisis de los problemas del pas y de la regin
para que rechace toda forma de falsedad y que adopte
una posicin comprometida en la construccin de la
democracia y la paz, adems de expresar su afecto y vivir
relaciones basadas en el reconocimiento del otro y en el
respeto a su identidad.
Bloques de contenido
Los bloques de contenido que integran la asignatura de
Estudios Sociales para el segundo ciclo de Educacin
Bsica son. Bloque N 1: El medio geogrfico y la realidad
salvadorea. Bloque N 2: El medio socio-cultural de El
Salvador. Bloque N 3: Desarrollo histrico de El Salvador,.
Bloque N 1: El medio geogrfico y la realidad salvadorea.
Al tratar este bloque se le da nfasis al medio fsico
geogrfico como los espacios en que vivimos para
establecer los lmites dnde habitar y a quin le pertenecen
149
Programa de estudio cuarto grado
Relacin de los bloques de contenido con las
unidades didcticas
Desde el punto de vista de las disciplinas que fundamentan
las Ciencias Sociales se considera iniciar el programa
de estudio con el bloque de contenido sobre el medio
geogrfico y la realidad salvadorea, haciendo nfasis en
el medio fsico-geogrfico como el espacio en que vivimos:
el pas. Este bloque est relacionado con las unidades
uno y dos: El pas donde vivimos y Recursos naturales:
nuestro tesoro en cuarto grado; La regin donde vivimos
y Recursos naturales: tesoro que compartimos, en quinto
grado; El continente donde vivimos y Recursos naturales
y humanos: tesoro americano, en sexto grado. En este
bloque se hace nfasis en el conocimiento del espacio
porque es el escenario donde se dan los intercambios de
los diversos fenmenos e influencias recprocas entre ellos.
Por otra parte, sabemos que la actividad transformadora
del ser humano es capaz de construir paisajes culturales
y organizar econmica, poltica y administrativamente los
diversos espacios: de EL Salvador.
Hoy en da, los educandos necesitan conocer cual es
el impacto de su presencia en el mundo y como estn
vinculados a un espacio geogrfico para que busquen el
desarrollo, el bienestar econmico, social y ambiental; por lo
que el segundo bloque de contenidos se refiere a El medio
socio-cultural en El Salvador; que da respuesta a las
unidades didcticas tres y cuatro: As vivimos las
salvadoreas y los salvadoreos y Problemas, realidades
y esperanzas en cuarto grado; As vivimos los de Amrica
Central, y Amrica Central: realidades, desafos y
esperanzas en quinto grado; As vivimos las americanas
y los americanos, y Amrica: problemas, realidades y
esperanzas en sexto grado.
y a introducir al alumnado en la comprensin de la realidad
social salvadorea. Se fomenta en los educandos la
capacidad de observar, imaginar, interpretar y explicar el
medio geogrfico en su interaccin recproca con el espacio
cultural de El Salvador.
Bloque N 2: El medio socio-cultural en El Salvador.
Al incorporar este bloque se le da relevancia al medio socio-
cultural para entender la realidad social y cultural.
Se trata de que el alumnado adquiera aprendizajes
significativos que le permitan comprender la realidad en
la cual estn inmersos, autorealizarse y transformarla si es
necesario, continuando as el desarrollo de su proceso de
socializacin. Se trata de colocar al alumnado en contacto
significativo con la realidad socio-cultural que le rodea, a
fin de que valore y aprecie con una actitud crtica, cvica y
participativa que le ha de permitir acciones responsables
dentro de una sociedad democrtica.
Bloque N 3: Desarrollo histrico de El Salvador.
Comprende la vida del pasado de El Salvador, para
introducir al alumnado en la nocin de tiempo y espacio
donde se desarrollaron los hechos y de sus anlisis
histricos. Los momentos histricos que se analizan son
un hilo conductor hacia la comprensin de los mismos
para que los retomen y les permitan conocer, analizar
problemas y participar en la solucin de los mismos.
Adems, comprende inferir la interdependencia entre los
hechos histricos y percibir la realidad como una totalidad.
Se trata de debatir los cambios del presente teniendo
como punto de partida los del pasado inmediato y lejano, a
nivel de la totalidad histrica del continente y de la historia
particular de cada pas.
150
Programa de estudio cuarto grado
travs de la realidad histrica y Continuidad y cambios
entre las sociedades pasadas y presentes en Amrica en
Sexto grado.
El programa de estudio muestra claramente el carcter
interdisciplinario de la asignatura: Geografa, Sociologa,
Historia, Demografa, Economa, Antropologa, Psicologa
social, Filosofa, Poltica, Derecho, Ecologa. Adems, su
relacin con las Ciencias Naturales, Lenguaje, Matemtica,
Educacin Fsica, Educacin Artstica, por medio de los ejes
transversales: Educacin en valores, Educacin ambiental,
Educacin en Derechos Humanos, Educacin para la
equidad de gnero, Educacin moral y cvica, Educacin
para el consumidor, Educacin para la salud, Educacin en
poblacin, Educacin para la paz.
El tercer bloque, se refiere al Desarrollo histrico de
El Salvador, Amrica Central y Amrica. El estudio de la
historia es un proceso dinmico donde el educando se
encuentra a s mismo, su origen y realidad. El proceso se
inicia con la idea del pasado que le permita una identidad
presente, quin es y de dnde viene. Sin embargo no termina
ah, contina con el encuentro de otras realidades mejores
que se desean alcanzar.
Comprende dos unidades didcticas en cada grado: La
identidad nacional a travs de la realidad histrica y
Continuidad y cambio entre las sociedades pasadas y
presentes en cuarto grado; La identidad de Amrica
Central a travs de la realidad histrica y Continuidad y
cambio de las sociedades pasadas y presentes en Amrica
Central en quinto grado; La identidad americana a
151
Programa de estudio cuarto grado
Se caracteriza la hidrografa, los tipos de
suelo, las prcticas personales, hogareas,
industriales que contaminan las aguas del
pas. Propuestas de solucin para su cuido
y aprovechamiento responsable; las leyes y
convenios que los protegen.
Unidad 2: Recursos naturales: Nuestro tesoro
El Medio Geogrfico y la
realidad salvadorea.

U
En la que se analiza la interrelacin de los
factores fsicos, humanos y econmicos que
caracterizan a la regin geogrfica de El
Salvador.
E
r
En la que se aplican conceptos geogrficos y
astronmicos para posicionar a El Salvador;
su orografa, climatologa y la orientacin
espacial, los efectos del calentamiento global;
la sismicidad y propuestas prcticas preventivas.
BLOQUES DE CONTENIDO
Unidad 1: El lugar donde vivimos Unidad 1: El Pas donde vivimos
Bloque 1
Unidad 1: El Pas donde vivimos
B
PROGRAMA ACTUAL
Unidad 1: El lugar donde vivimos U
PROGRAMA ANTERIOR
Comparacin de las unidades didcticas de los programas
anteriores y los actuales
152
Programa de estudio cuarto grado
El medio socio-cultural en
El Salvador.
Se interpreta dentro del principio de
casualidad, los hechos econmicos, sociales
y culturales que caracterizan la vida actual
del pas y se infieren las caractersticas del
futuro de la vida nacional.
E
E
Se analizan los sectores econmicos del pas,
los medios de transporte y de comunicacin
social, las relaciones con las rutas tursticas y
comerciales, el alumno observa y explica las
actividades y productos de cada sector, as como
las formas de transportarlos. Se valora la funcin
del trabajo, sus tipos y el trabajo dentro del
marco legal salvadoreo.
Se analiza la estructura y composicin de
la poblacin salvadorea, las causas y
consecuencias del crecimiento poblacional, los
derechos de las poblaciones vulnerables para
una convivencia democrtica y se planifica las
metas personales a corto y mediano plazo.
Unidad 3: As vivimos las salvadoreas
y los salvadoreos
Bloque 2
Unidad 4: Problemas, realidades
y esperanzas
Unidad 2: La nacin que formamos Bloque 2
BLOQUES DE CONTENIDO
Unidad 3: As vivimos las salvadoreas
PROGRAMA ACTUAL
Unidad 2: La nacin que formamos
U
PROGRAMA ANTERIOR
153
Programa de estudio cuarto grado
Unidad 6: Continuidad y cambio entre las
sociedades pasadas y presentes
Se analizan los hechos econmicos, polticos y
sociales ocurridos en El Salvador y personajes
involucrados entre 1932 hasta la actualidad
y la relacin e influencia en la vida cultural,
econmica y poltica en El Salvador. Los
beneficios o dificultades de las TIC. Se identifca
el papel que desempean y se reconoce
comportamientos sociales y econmicos de la
poblacin el inicio del siglo XXI.
En sta se investiga la herencia cultural
prehispnica y colonial, as como los hechos
y personajes histricos ms relevantes de la
independencia de El Salvador hasta 1931,
organizando y analizando la informacin,
comprensin y divulgacin de valores,
caractersticas y prcticas que definen la
identidad cultural de las salvadoreas y los
salvadoreos.
U
S
s
i
y
e
b
e
c
p
E
p
y
i
o
c
c
i
s
sta pretende la compresin de los
antecedentes histricos de la vida nacional
para enlazar los hechos sociales, polticos,
econmicos y jurdicos que han conformado
la sociedad actual desde una perspectiva
temporal y espacial.
Unidad 3: Una cultura en el tiempo
Desarrollo histrico de El Salvador.
Bloque 3
Unidad 5: La identidad a travs de la
realidad histrica
Bloque 3
BLOQUES DE CONTENIDO
Unidad 5: La identidad a travs de la
PROGRAMA ACTUAL
Unidad 3: Una cultura en el tiempo
U
PROGRAMA ANTERIOR
154
Programa de estudio cuarto grado
Objetivos de cuarto grado
1. Analizar la interrelacin de los factores fsicos
y socioculturales de El Salvador, utilizando este
conocimiento para valorar el medio natural y la relacin
de este con el desarrollo humano.
2. Analizar la vida histrica de El Salvador, mediante
la identificacin de los procesos y hechos histricos
nacionales para valorar la importancia de los procesos
de socializacin en la integracin sociocultural.
3. Investigar el impacto del rpido crecimiento poblacional
en el desarrollo econmico, social y cultural de El Salvador
mediante el anlisis de variables demogrficas a fin de
valorar los recursos y la incidencia en las condiciones de
vida de la poblacin.
4. Analizar la dinmica actual de la sociedad salvadorea,
mediante los aspectos econmicos, polticos, sociales
y culturales para identificar los valores y la perspectiva
de su futuro.
Lineamientos metodolgicos
En Estudios Sociales, al igual que en las otras asignaturas,
el papel del docente es orientar a los educandos para
que descubran y construyan sus conocimientos. Esto
implica planificar una metodologa que priorice que
los y las estudiantes observen, descubran y deduzcan
conclusiones.
A fin de orientar la metodologa de la asignatura se propone
una secuencia didctica estructurada en seis fases que
siguen un orden lgico para el desarrollo de cada contenido.
Esta secuencia debe concebirse como un modelo, por lo
tanto puede adecuarse y enriquecerse con la experiencia
docente, el conocimiento del alumnado, los recursos
tecnolgicos y los materiales con que cuenta la escuela.
La secuencia didctica propuesta en este programa de
estudio es coherente con la desarrollada en los materiales
de apoyo que entregar el Ministerio de Educacin: libro
de texto, gua metodolgica y cuaderno de ejercicios. Por
tanto se recomienda apoyarse durante la clase en dichos
materiales, adaptando su uso a las necesidades de las
nias y los nios. Al familiarizarse con estos materiales ser
ms fcil enriquecerlos con otras experiencias en el aula o
fuera de ella.
Fase 1. Actividad motivadora y de exploracin de
conocimientos previos
Esta fase debe promover que las nias y los nios expresen
sus concepciones y percepciones de los contenidos
que sern abordados. Es importante que experimenten
que la realidad tiene distintas facetas o caractersticas,
dependiendo de quien la mira y bajo que circunstancias.
Debe potenciarse la curiosidad por explorar, orientando
tambin a examinar la forma en que las cosas cambian
constantemente. Ejemplo de actividades: Lea, observe,
reflexione, analice, opine, localice, ubique, concluya, entre
otras.
Se espera que el alumno-alumna analice situaciones de
su entorno por medio de ilustraciones, fotografas, mapas,
lectura de textos, estudio de casos, entre otras. Luego
responde a preguntas para evidenciar sus conocimientos y
despertar su inters por los contenidos que se estudiarn.
El o la docente debe motivar para que sus estudiantes
comenten sus propias conclusiones y le encuentren
sentido al fenmeno estudiado. Para ello puede preguntar
155
Programa de estudio cuarto grado
Fase 3. Construccin del conocimiento sobre el tema
transversal
A partir de los conceptos descubiertos se identifican algunos
problemas que generan la bsqueda de soluciones. As
se invita a los estudiantes a trascender a una reflexin, un
cambio de actitud o un compromiso sobre problemticas de
su entorno cercano o lejano. Ejemplo: los nios y las nias
observan la realidad del entorno (aire, agua, suelos, cerro,
volcn) y el deterioro ambiental y reflexiona sobre como
solucionar el problema.
La maestra o el maestro solicitan al alumnado que opine
sobre el problema provocado al no cuidar los rboles, el
agua, el aire, el suelo del medio y proporciona indicaciones
sobre los diversos cuidados que se necesitan.
Fase 4. Actividades de representacin y divulgacin del
conocimiento
Fieles a la competencia participacin crtica y responsable,
se recomienda destinar tiempo para efectuar actividades
que activen y estimulen la imaginacin, la expresividad, el
razonamiento y la motricidad, entre otras, de manera que se
sienta inters y compromiso al buscar, descubrir y compartir
el conocimiento que ofrecen los Estudios Sociales. Esta
etapa se relaciona con el proyecto o taller de experiencias
y las actividades propuestas en el cuaderno de ejercicios.
Las actividades son sencillas pero deben motivar e interesar
a las nias y los nios.
sobre el caso estudiado, por ejemplo: Qu elementos son
proporcionados por la naturaleza? Qu nombre reciben?
Qu elementos son elaborados por el ser humano?
Expliquen la diferencia entre los elementos proporcionados
por la naturaleza y los elaborados por el ser humano?
En el libro de texto que apoya el desarrollo curricular de
la asignatura se proponen ilustraciones, fotografas, textos,
mapas o casos de situaciones o ambientes de su realidad.
Fase 2. Construccin del conocimiento
A partir de la realidad observada, los nios y las nias
descubren relaciones particulares que generalizan a
situaciones ms amplias o al resto del mundo. Por lo
tanto, aprenden inductivamente. Tambin se proponen
procedimientos como la comparacin para establecer
similitudes y diferencias entre los fenmenos y de
ello sacar conclusiones que permitan la comprensin de
los contenidos.
El alumnado entra en contacto con la informacin de
las disciplinas de manera que pueda leerla, experimentarla
e interpretarla sin necesidad del docente. Se recomienda
utilizar aproximaciones al contenido al menos de
dos maneras:
texto + imagen
texto + imagen + preguntas
A partir de la lectura, la reflexin y discusin de la
informacin, el alumnado formular conclusiones. El
o la docente propiciar la reflexin, el trabajo grupal y
enriquecer las conclusiones de los nios y las nias,
aclarando o ampliando los contenidos.
156
Programa de estudio cuarto grado
interrelacin de los conceptos, principios o fases de cada
contenido.
La alumna o el alumno lee e interpreta las ideas principales
que se han trabajado en la leccin y observa los dibujos que
le ayudan a comprender el significado del contenido que
ha sido tratado. La maestra o el maestro debern aplicar
la tcnica del resumen para lograr el desarrollo de esta
habilidad de sintetizar.
Resumen
Los recursos naturales le sirven al ser humano para
satisfacer sus necesidades de alimentacin, vestido,
vivienda, aire, agua y electricidad.
Estos recursos se obtienen directamente de la naturaleza
y pueden ser transformados para crear ms cosas.
Se clasifican en dos tipos: renovables y no renovables.
Los recursos renovables son inagotables porque siempre
se regeneran, por ejemplo, el agua y el aire. Pero
tambin es importante cuidarlos, de lo contrario pueden
contaminarse y agotarse.
Los recursos no renovables son aquellos que slo existen
en una determinada porcin y una vez se terminan, no
hay ms.
Lineamientos de evaluacin
Evaluacin diagnstica
En Estudios Sociales, como en otras reas, es recomendable
y oportuno que siempre se haga una evaluacin de inicio
cuando a las nias y los nios se les est enfrentando
a un nuevo contenido o rea temtica, ya que comprendern
Ejemplo:
Los y las estudiantes contestan interrogantes, ubican un
lugar en el espacio de acuerdo a los puntos cardinales y
coordenadas geogrficas, localizan un lugar en un mapa,
etc., y descubren y aplican conceptos claves. Luego
comparten con sus compaeras, compaeros, familiares o
con su localidad. La o el docente orienta el trabajo del libro
y el cuaderno de ejercicios, y facilita las condiciones, los
recursos y apoyos para que las nias y los nios puedan
aprender de una manera activa e interesante y compartir
con otros sus hallazgos y propuestas.
Fase 5. Actividad de retroalimentacin
Como parte de la evaluacin formativa se deber
confirmar la comprensin de los conceptos clave o de los
procedimientos esperados.
Las nias y los nios solucionan problemas, llevan a
cabo actividades o contestan preguntas que les permitan
reafirmar su aprendizaje.
Ejemplo:
Observa cada dibujo y explica qu tipo de recursos son:
una gota de agua, una camisa, una estacin de gasolina.
Cmo debe ser el agua para que el ser humano pueda
consumirla? La o el docente orienta a la elaboracin de
cada actividad para que el o la estudiante solucione los
problemas, y observa su desempeo y valora la pertinencia
de ofrecer refuerzo.
Fase 6. Consolidacin del conocimiento
Esta etapa requiere la comprensin del contenido, de
manera que se pueda explicar en forma resumida la
157
Programa de estudio cuarto grado
La coevaluacin y la autoevaluacin contribuyen a que las
nias y los nios tomen conciencia de sus progresos y de
sus dificultades, de sus capacidades y de sus limitaciones.
Dems est decir que observando los progresos y las
dificultades de sus estudiantes, la o el docente se puede
evaluar a s mismo. Como resultado, frecuentemente
deber mejorar el desarrollo planificado para algunos
temas, acelerar en otros o cambiar totalmente de estrategia
metodolgica.
La coevaluacin
Es muy importante ya que propicia que las nias y los nios
evalen su comportamiento y participacin en actividades
grupales (aprendizaje colaborativo). De esa manera el
alumnado puede comparar la valoracin de su desempeo
con la opinin de sus compaeras y compaeros para
reflexionar sobre su aprendizaje. La o el docente debe
orientar los aspectos que se valorarn en la coevaluacin,
por ejemplo:
Aport ideas para realizar la actividad (s - no)
Manifest entusiasmo para trabajar en equipo (s - no)
Fue responsable en las tareas que se le asignaron en el
equipo (s - no)
Trat con respeto y amabilidad a sus compaeras
y compaeros (s - no)
Evaluacin sumativa
Es la que se hace para registrar logros al finalizar una etapa
de trabajo (trimestre) y al final del ao lectivo. Su nombre
indica que se evala sumando logros y objetivos cumplidos o
todo el producto del proceso educativo. Para ello se analizan
conceptos, procedimientos y actitudes y valores de
forma integrada.
Al inicio del ao escolar es muy conveniente orientar la
evaluacin inicial en funcin de diagnosticar actitudes hacia
s mismo y hacia los dems, y las destrezas de ubicacin
espacial. Estas son fundamentales para su interaccin y
movilizacin en la vida cotidiana. La evaluacin diagnstica
de las siguientes unidades del programa deber partir del
anlisis de indicadores de logro de unidades anteriores o
de grados previos al que estn cursando los estudiantes.
Evaluacin formativa
Evaluar los avances o progresos de la nia y del nio en
el desarrollo de manejo de conceptos, procedimientos,
actitudes y valores ha de ser un proceso sistemtico y
riguroso, que permita conocer oportunamente la informacin
requerida sobre el que aprende, el que ensea y el proceso
de enseanza, a fin de que todos y todas se esfuercen en
una mejora permanente.
La evaluacin formativa constituye un seguimiento que se
realiza a lo largo de ese proceso y que le proporcionar
informacin sobre los progresos y las dificultades de
las alumnas y los alumnos en el proceso de enseanza
aprendizaje. La razn de este seguimiento es entender sus
necesidades, darles nimo, orientacin y apoyo oportuno.
La observacin directa del desempeo y la entrevista
personal permiten detectar dificultades oportunamente, as
como valorar las actitudes y las habilidades que las nias
y los nios estn desarrollando. Por ejemplo, al observar
cmo expone un tema se puede detectar la manera en que
una alumna o un alumno organiza sus ideas y las expresa.
158
Programa de estudio cuarto grado
y ponderan los resultados obtenidos de las actividades de
evaluacin que reflejan el grado de aprendizaje respecto a
los objetivos planteados al comienzo del proceso o perodo.
Los indicadores de logro que presenta el programa de
estudio son un referente importante para planificar las
actividades de evaluacin, puesto que sealan evidencias
del aprendizaje expresado en los objetivos.
Algunos de estos instrumentos que suelen utilizarse son:
La observacin sistemtica. Deber realizarse a lo largo
del perodo y materializarla en un registro. La tcnica de la
observacin puede aplicarla en situaciones muy diversas,
como:
El proceso seguido para elaborar un trabajo (evaluando
las tres fases: preparacin, realizacin y aplicacin
posterior). Es importante observar actitudes de
responsabilidad y respeto, entre otras.
Las actividades de simulacin (dramatizaciones
y juegos).
Las actividades experimentales, muy propias para
evaluar procedimientos: elaboracin de representaciones
grficas, exposiciones, etc.
La revisin de los trabajos. El cuaderno de clases con las
actividades diarias, trabajos de indagacin, actividades
del cuaderno de ejercicios, etc.
Pruebas especficas. Pueden ser orales y escritas.
En Estudios Sociales se debe insistir en evaluar, ms
que en memorizar la utilizacin correcta de trminos y el
reconocimiento y la aplicacin de conceptos. Tambin se
debe evaluar procedimientos, presentando al alumnado un
material informativo nuevo para que apliquen conceptos y
procedimientos aprendidos anteriormente.
Conviene valorar dentro de la evaluacin sumativa los
resultados de la autoevaluacin, para lo cual se debe
brindar orientaciones precisas sobre los aspectos a evaluar,
de manera que el alumnado reflexione y tome conciencia
de sus progresos y dificultades. Esto fomenta la motivacin
y la autoestima.
El programa de estudio presenta indicadores de logro
que sirven de gua para determinar las evidencias de
aprendizajes esperados. Potenciar competencias o logros
por medio de Estudios Sociales supone una reflexin y
revisin de los criterios que se utilizan para ponderar y valorar
las actividades y los productos de las y los estudiantes.
Por ejemplo, si se pide que las y los estudiantes representen
espacios mediante planos o mapas para orientarse y
desplazarse en lugares especficos, los criterios deben
atender tanto a los elementos formales como los de
contenido. Por ejemplo:
Funcionalidad: ubicacin de un lugar especfico, real.
Estructura: presenta los referentes bsicos para
ubicacin.
Claridad: representacin de objetos o lugares de
manera comprensible.
Correccin: aplicacin adecuada de relaciones
especiales.
Limpieza, orden y otros.
159
Programa de estudio cuarto grado
UNIDAD 1
EL PAS
DONDE VIVIMOS
Objetivos
Aplicar conceptos bsicos geogrficos para posicionar geogrfica y astronmicamente
El Salvador en Amrica Central, a fin de fortalecer la capacidad de orientacin espacial y
determinar sus ventajas y desventajas.
Ilustrar en forma responsable las diversas formas del relieve, el tiempo atmosfrico, el
clima y las fronteras naturales y administrativas de El Salvador, identificando en un mapa
los lmites geogrficos y polticos, explicando su importancia, as como los agentes y
factores que los modifican y elementos que los determinan a fin de construir propuestas
para disminuir el cambio climtico, efecto del calentamiento global.
Practicar medidas de prevencin ante eventos ssmicos a partir de planes de proteccin
escolar y simulacros de evacuacin en caso de sismos a fin de preservar la vida.
1.1 Identifica y explica con
seguridad la posicin
geogrfica y astronmica
de El Salvador en Amrica
Central, en el globo
terrqueo y en el planisferio,
y las ventajas y desventajas
de la misma.
Lneas imaginarias
convencionales,
coordenadas geogrficas
y puntos cardinales.

Posicin geogrfica
y astronmica de El
Salvador en Amrica
Central. Ventajas y
desventajas.
CONCEPTUALES
Identificacin y explicacin
de la posicin geogrfica
y astronmica de
El Salvador en Amrica
Central en el globo
terrqueo y en el
planisferio y sus
ventajas y desventajas.
PROCEDIMENTALES
1 Seguridad al ubicar en
el globo terrqueo y en
el planisferio la posicin
geogrfica y astronmica
de El Salvador en Amrica
Central y en el mundo.
ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
Tiempo probable: 27 horas clase
Programa de estudio de cuarto grado
160
Fronteras naturales y
administrativas de El
Salvador en la actualidad



Origen de la
demarcacin territorial
CONCEPTUALES

1.2 Observa y localiza con
autonoma y confianza en un
mapa geogrfico y poltico
las fronteras naturales y
administrativas de El Salvador.

1.3 Investiga y explica con inters
el origen de la demarcacin
territorial.
CONCEPTUALES
INDICADORES DE LOGRO CONTENIDOS
Observacin y localizacin
en un mapa geogrfico
y poltico de El Salvador
las fronteras naturales
y administrativas en la
actualidad.
Investigacin y explicacin
sobre el origen de la
demarcacin territorial de
El Salvador.
1
1
Confianza y autonoma
al observar y localizar
en un mapa geogrfico
y poltico, las fronteras
naturales y administrativas
de El Salvador.
Inters por investigar el
origen de la demarcacin
territorial de El Salvador.
PROCEDIMENTALES ACTITUDINALES
Relieve de El Salvador,
diferentes formas, su
importancia y agentes que
la modifican (erupciones
volcnicas, terremotos,
erosin, rotura de las
rocas, el ser humano,
entre otros).
1.4 Observa e identifica con
autonoma y seguridad las
diversas formas del relieve de
El Salvador y explica su
importancia y las formas en
que los agentes lo modifican.


1.5 Expresa con apoyos grficos
la importancia de las formas
de relieve en El Salvador a
fin de sensibilizar sobre su
conservacin.
Observacin e
identificacin en un mapa
orogrfico de las diversas
formas del relieve de El
Salvador y explicacin de
su importancia y de los
agentes que lo modifican.


Investigacin sobre
la importancia de las
diferentes formas del
relieve en El Salvador
(valles, mesetas, volcanes
y cordilleras)
Autonoma y seguridad
al observar e identificar
las diversas formas que
presenta el relieve de
El Salvador.

Aprecio y conservacin
de las formas del relieve
salvadoreo
161
Programa de estudio de cuarto grado
INDICADORES DE LOGRO CONTENIDOS
1.9 Localiza con inters y precisin
en un mapa la distribucin de
la poblacin salvadorea.

1.10 Explica con claridad los
efectos que producen las
actividades humanas que
modifican el relieve, el clima,
la flora y la fauna de El
Salvador y propone acciones
para minimizarlos.
Distribucin de la
poblacin en El Salvador y
actividades humanas que
modifican el relieve, el
clima, la flora y la fauna.
Localizacin en un mapa
de la distribucin de la
poblacin en El Salvador.

Discusin de los efectos
que producen las
actividades humanas sobre
el relieve, el clima, la flora
y la fauna de El Salvador.
1
1
Inters y precisin al
localizar la distribucin de
la poblacin en
El Salvador.
Responsabilidad al
proponer acciones que
minimicen los efectos que
producen las actividades
humanas en el relieve, el
clima, la flora y la fauna
del pas.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
1.6 Caracteriza y diferencia
con claridad el tiempo
atmosfrico y el clima.
1.7 Comenta con inters
informacin sobre el tiempo
atmosfrico y el clima que
lee, observa o escucha en
los medios de comunicacin.
1.8 Describe con precisin los
elementos que determinan y
los factores que modifican
el clima en El Salvador.
Tiempo atmosfrico y
clima de El Salvador.
Caracterizacin y
diferenciacin entre tiempo
atmosfrico y clima.
Comprensin de
informacin sobre el
tiempo atmosfrico y el
clima en los medios de
comunicacin.
Descripcin de los
factores que determinan
el clima y los elementos
que lo modifican.
Inters por informarse
sobre el tiempo
atmosfrico y el clima de
El Salvador.
Programa de estudio de cuarto grado
162
1.11 Investiga y explica con
seguridad las causas
y consecuencias del
calentamiento global,
participa con responsabilidad
en el planeamiento de
proyectos y contribuye a
su reduccin.
El calentamiento global,
efectos en la regin de
Amrica Central.
Indagacin y explicacin
de las causas y
consecuencias del
calentamiento global y
medidas para evitar su
aumento.
Participacin responsable
en la elaboracin de
proyectos en el hogar
y la comunidad para
contribuir a la reduccin
del calentamiento global.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
1.12 Investiga con inters la
sismicidad del territorio
salvadoreo y elabora una
lnea de tiempo de los eventos
ssmicos ms relevantes
ocurridos en El Salvador.
1.13 Elabora y participa con
inters en la elaboracin
del plan de proteccin y
ejecucin de simulacros
de evacuacin y explica
las medidas de proteccin
y prevencin.
Sismicidad del territorio
salvadoreo y medidas
de prevencin de riesgos
ante desastres.
Investigacin y
elaboracin de una lnea
de tiempo de los eventos
ssmicos ms relevantes en
el territorio salvadoreo.
Inters por la historia
ssmica de El Salvador.
Planes de proteccin
escolar y simulaciones
de evacuacin en caso
de sismos.
Elaboracin de un plan
de proteccin y ejecucin
de simulacros de
evacuacin y medidas de
proteccin y prevencin
de riesgo ante desastres.
Responsabilidad para
asumir acciones de
prevencin en
situaciones de riesgo.
Programa de estudio de cuarto grado
163
Recursos naturales
de El Salvador y su
aprovechamiento.
Identificacin de los
recursos naturales de
El Salvador, investigacin
explicacin e ilustracin
de su cuido y
aprovechamiento.
Inters por investigar el
cuido y aprovechamiento
de los recursos naturales
de El Salvador.
2.1 Identifica con seguridad en
inters los recursos naturales
de El Salvador, e investiga,
explica e ilustra el cuido y
aprovechamiento que se
hace de ellos.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
UNIDAD 2
RECURSOS NATURALES:
NUESTRO TESORO
Tiempo probable: 21 horas clase
Objetivos
Describir con claridad las caractersticas de la hidrografa y los tipos de suelo del territorio
salvadoreo, as como las prcticas personales, hogareas, industriales y sociales que
generan residuos que contaminan los ros, lagos y lagunas del pas y que empobrecen
sus suelos, para tomar conciencia de los efectos que produce la demanda de la poblacin,
segn su tamao.
Proponer y asumir soluciones sencillas y tiles para el cuido y aprovechamiento
responsable de los recursos naturales y que minimicen los efectos de su mal uso, en el
marco del respeto a las leyes y convenios que los protegen.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
2.2 Construye con inters un
mapa de El Salvador con
sus cuencas hidrogrfica y
los principales ros, lagos
y lagunas y sus beneficios
para la vida y la actividad
humana.
Hidrografa de
El Salvador, beneficios
para la vida y para la
actividad humana.
Construccin de un
mapa con las cuencas
hidrogrficas y los
principales ros, lagos y
lagunas del pas.
Explicacin de los
beneficios del agua
para la vida y la
actividad humana.
Participacin activa
y responsable en la
construccin de un
mapa hidrogrfico de
El Salvador.
Programa de estudio de cuarto grado
164
2.3 Observa y/o describe con
autonoma y responsabilidad
las formas de contaminacin
de las aguas en El Salvador.

2.4 Explica con seguridad la
importancia del cuido y uso
responsable de los recursos
hdricos del pas.
INDICADORES DE LOGRO CONTENIDOS
Contaminacin de los ros,
los lagos y las lagunas de
El Salvador y las medidas
que lo contrarrestan.
Observacin y/o
descripcin de las formas
de contaminacin de
los ros, los lagos, y las
lagunas de El Salvador
y explicacin medidas
para su cuido.
Autonoma y
responsabilidad al
explicar y/o aplicar
medidas que
contrarrestan la
contaminacin de los
ros, los lagos y las
lagunas de El Salvador.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
2.5 Explica con claridad y
seguridad los tipo de suelos
en El Salvador, as como su
uso e importancia para la
agricultura, urbanizacin y
otras actividades econmicas.
El suelo de El Salvador:
importancia y uso
en la agricultura, la
urbanizacin y otras
actividades econmicas
Identificacin y
clasificacin de los tipos
de suelos en
El Salvador.

Identificacin de la
importancia del uso del
suelo en la agricultura y
en la urbanizacin.
Inters por investigar y
explicar la importancia
del uso de suelos
frtiles en la agricultura,
urbanizacin y dems
actividades econmicas
en El Salvador.
2.6 Investiga y explica las
causas y los efectos
de las inundaciones y
deslizamientos, adoptando
una actitud solidaria ante los
daos que stas causan.
Las inundaciones, los
deslizamientos y los
daos que provocan a
la actividad econmica
salvadorea.
Investigacin y explicacin
sobre el origen y los daos
que las inundaciones y
los deslizamientos
provocan a la actividad
econmica salvadorea.
2 Solidaridad en la
adopcin de medidas que
contrarresten o mitiguen
los efectos de
las inundaciones
y deslizamientos.
Programa de estudio de cuarto grado
165
2.7 Observa, explica, ilustra y
reflexiona con inters sobre
las demandas que
la poblacin salvadorea
le hace al medio ambiente
y sus efectos.
INDICADORES DE LOGRO CONTENIDOS
Poblacin y demandas
al medio ambiente
salvadoreo.
Observacin y/o
identificacin de las
diversas demandas que
la poblacin salvadorea,
segn su tamao, hace
al medio ambiente:
agua, alimentos, energa,
espacio para
la construccin de
viviendas y tierras de
cultivo e industria.
Reflexin crtica al ilustrar
y explicar las demandas
de la poblacin, segn
su tamao, al medio
ambiente salvadoreo
y sus efectos.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
2.8 Nombra las leyes y algunos
artculos que conforman el
marco legal de proteccin
del medio ambiente y los
explica con juicio crtico.
Marco legal nacional
e internacional para la
proteccin del medio
ambiente: Ley de Medio
Ambiente de El Salvador
del Convenio de las
Naciones Unidas sobre
el Cambio Climtico y
el Protocolo de Kyoto,
entre otros.
Investigacin y anlisis
de los artculos ms
representativos de la Ley
de Medio Ambiente de
El Salvador; del Convenio
de las Naciones Unidas
sobre el Cambio Climtico
y el Protocolo de Kyoto y
sus implicaciones en la
vida cotidiana.
Reconocimiento de la
necesidad de cumplir
con la aplicacin
prctica del marco
legal de proteccin del
medio ambiente.
Programa de estudio de cuarto grado
166
UNIDAD 3
AS VIVIMOS
LAS SALVADOREAS
Y LOS SALVADOREOS
3.1 Investiga, ilustra, se interesa
y explica con respeto el papel
de la economa y sectores
econmicos que potencia
El Salvador.
CONCEPTUALES PROCEDIMENTALES
Economa y sectores
econmicos en
El Salvador: primario,
secundario y terciario.
Investigacin y explicacin
del papel de la economa
y de los sectores
econmicos: primario,
secundario y terceario.
Ilustracin de los sectores
de la economa que
potencia El Salvador.
Inters por investigar el
papel de la economa y
explicar con respeto las
actividades que realiza
cada sector econmico.
ACTITUDINALES
CONCEPTUALES PROCEDIMENTALES
ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
Tiempo probable: 23 horas clase
Objetivos
Investigar y analizar con inters los sectores de la economa salvadorea, las redes viales,
los medios de transporte y de comunicacin social y su relacin con las rutas tursticas y
comerciales, observando y explicando las actividades y productos de cada sector, as como
las formas de transportarlos, a fin de contribuir al desarrollo socio-econmico de
El Salvador.
Valorar positivamente la funcin del trabajo, sus tipos y el marco legal salvadoreo a fin de
tomar conciencia de sus beneficios y consecuencias en la economa familiar y nacional.
3.2 Nombra, representa y valora
las principales redes viales
de El Salvador y los medios
de transporte.
Redes viales de
El Salvador, medios de
transporte y actividades
econmicas.
Representacin en un
mapa de las principales
redes viales del pas.
3 Valoracin de la
importancia de las
principales redes viales
y su relacin con los
diferentes medios de
transporte, tanto de
personas como de
mercancas en la actividad
econmica del pas.
167
Programa de estudio de cuarto grado
3.3 Se interesa, investiga y
explica con claridad y
detalle acerca de la
importancia de la relacin
entre redes viales, medios
de transporte y actividades
econmicas en El Salvador.
INDICADORES DE LOGRO CONTENIDOS
Descripcin, observacin
y/o construccin de los
medios de transporte de
personas y de mercancas.
Investigacin y explicacin
de la relacin entre redes
viales, los medios de
transporte y actividades
econmicas del pas.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
3.4 Elabora y reconoce con
precisin en el mapa de
El Salvador las rutas tursticas
y comerciales de El Salvador.
3.5 Reflexiona con criticidad
sobre la importancia
de las rutas tursticas y
comerciales de El Salvador
y las promueve entre los
miembros de su grupo
familiar y comunidad.
Rutas tursticas y
comerciales de
El Salvador. Su
importancia en el
desarrollo econmico.
Elaboracin de un
mapa de El Salvador y
reconocimiento de las
rutas tursticas (de las
flores, maya, de la paz,
etc.) y las de carcter
comercial (como la de
la caa de azcar, la
del aeropuerto, la de los
puertos) y explicacin
de su importancia en el
desarrollo econmico de
El Salvador.
3
3
Reflexin crtica acerca de
la importancia de las rutas
tursticas y comerciales de
El Salvador.
Programa de estudio de cuarto grado
168
Medios de comunicacin
social: ventajas y
desventajas y su influencia
en la opinin pblica y la
libertad de expresin.
Investigacin y explicacin
de las ventajas y
desventajas de los medios
de comunicacin social,
audiovisuales e impresos.
Investigacin y definicin
de la influencia
de los medios de
comunicacin en la
opinin pblica y libertad
de expresin. Artculo 6
de la Constitucin de la
Repblica de El Salvador.
Reflexin crtica sobre las
ventajas y desventajas
de los medios de
comunicacin social.
Cuidado ante la influencia
de los medios de
comunicacin social en
la opinin pblica y la
libertad de expresin. Art.
6 de la Constitucin de la
Repblica de El Salvador.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
3.8 Identifica sitios educativos e
informativos en Internet que
contribuyen a su formacin
personal y como miembro de
la comunidad.
Internet: medio de
comunicacin digital y
de intercambio comercial.
Descripcin de las nuevas
relaciones comerciales,
interpersonales, nacionales
e internacionales y socio-
culturales generadas por
la red (Internet).
Se compromete a hacer
uso adecuado de la red
en beneficio de su
educacin.
3.9 Aplica medidas de
prevencin, utiliza tcnicas
defensivas y respeta con
aceptacin las normas de
circulacin peatonal en
carreteras y se comporta
en forma adecuada como
peatn, viajero y conductor
en el uso de las vas pblicas
de la localidad, municipio,
departamento y pas.
Seguridad vial
(prevencin de accidentes).
Aplicacin de medidas
de prevencin y utilizacin
de tcnicas defensivas
para evitar los accidentes
de trfico en los peatones,
viajeros y conductores
de nuestra localidad,
municipio, departamento
y pas.
Respeto por las normas
de circulacin peatonal
en carretera y tiene un
comportamiento
adecuado como peatn
viajero y conductor en
el uso de las vas
pblicas para una
convivencia ciudadana.
3.6 Investiga, explica y reflexiona
con claridad las ventajas y
desventajas de los medios de
comunicacin social.
3.7 Investiga, define y se
cuida con estima de la
influencia de los medios de
comunicacin social en su
libertad de expresin.
Programa de estudio de cuarto grado
169
3.10 Investiga y describe en forma
correcta el trabajo como
actividad humana y prctica
social (individual y grupal).
El trabajo como actividad
humana y prctica social.
Art. 37 de la Constitucin
de la Repblica de
El Salvador
Investigacin del
trabajo como una
actividad humana: social
e individual.
Respeto por el trabajo
como actividad humana
y como prctica social.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
3.11 Ilustra, describe situaciones
laborales; respeta y aprecia
con estima el trabajo como
prctica social.
3.12 Se interesa y analiza con
claridad y detalle el artculo
37 de la Constitucin de
la Repblica.
Ilustracin y descripcin
de situaciones laborales
que identifican el trabajo
como prctica social.
Utilizacin de la
Constitucin de la
Repblica para el anlisis
del artculo 37.
Inters por analizar
el artculo 37 de la
Constitucin de la
Repblica de El Salvador.
3.13 Ilustra, describe y explica con
claridad y responsabilidad el
uso de las herramientas y el
equipo de trabajo, segn las
ocupaciones, para prevenir
accidentes.
3.14 Observa y explica con claridad
y respeto las formas de prevenir
accidentes laborales.
Uso de herramientas y
equipo de trabajo y la
prevencin de
accidentes laborales.
Ilustracin y descripcin
de las herramientas y el
equipo de trabajo segn
las ocupaciones.

Observacin y explicacin
de situaciones que pueden
provocar accidentes
laborales y sus formas
de prevenirlos.
3
3
Responsabilidad al utilizar
las herramientas y equipo
de trabajo, segn las
ocupaciones.

Seguridad al explicar las
situaciones que pueden
provocar accidentes
laborales y las formas
de provenirlos.
170
Programa de estudio de cuarto grado
4.1 Organiza informacin sobre
la composicin, estructura,
actividad o inactividad de
la poblacin salvadorea,
detalla su ingreso promedio
en una pirmide poblacional,
expresa y valora el trabajo
de sus paisanos.


4.2 Explica la relacin entre la
estructura y composicin de
la poblacin salvadorea y
las condiciones de vida
familiar y nacional.
Estructura y composicin
de la poblacin
salvadorea por edad
y sexo.
CONCEPTUALES
Organizacin de datos en
una pirmide poblacional
que refleje la estructura
y composicin de la
poblacin salvadorea
y distinga la poblacin
econmicamente activa
e inactiva, y el ingreso
promedio.
Relacin entre la
estructura y composicin
de la poblacin
salvadorea y las
condiciones de vida
familiar y nacional.
PROCEDIMENTALES
Respeto y valoracin por
el trabajo que realiza la
poblacin de su pas.
ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
UNIDAD 4
PROBLEMAS,
REALIDADES Y
ESPERANZAS
Tiempo probable: 22 horas clase
Objetivo
Analizar y presentar de manera respetuosa y por diversos medios, la estructura y
composicin de la poblacin salvadorea, las causas y consecuencias del crecimiento
poblacional y los derechos de poblaciones vulnerables a fin de promover la convivencia
democrtica y la planificacin y realizacin responsable de metas personales a corto y
mediano plazo.
Programa de estudio de cuarto grado
171
4.3 Representa grficamente
datos estadsticos sobre el
ritmo del crecimiento de la
poblacin en El Salvador
en las ltimas tres dcadas
y expresa con claridad sus
causas y consecuencias
respetando puntos de vista
diferentes.
INDICADORES DE LOGRO CONTENIDOS
Causas y consecuencias
del ritmo de crecimiento
de la poblacin de
El Salvador en las ltimas
tres dcadas.
Representacin grfica
de datos estadsticos
sobre el crecimiento de la
poblacin y anlisis de las
causas y consecuencias
del ritmo con el que ha
crecido la poblacin
salvadorea en las ltimas
tres dcadas.
Respeto por puntos de
vista diferentes sobre las
causas y consecuencias
del crecimiento de la
poblacin salvadorea.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Movimientos migratorios
en El Salvador. Causas
y efectos econmicos,
sociales, culturales y
ambientales.
4.4 Investiga y distingue los tipos
de movimientos migratorios
en El Salvador e identifica
crticamente sus causas y
consecuencias econmicas,
sociales, culturales y
ambientales.
4.5 Comenta datos estadsticos
sobre la migracin de
salvadoreas y salvadoreos
entre 1980 y 2000, y manifiesta
respeto e inters por los
compatriotas que migran.
4.6 Expresa su opinin y llega a
conclusiones, con iniciativa
y respeto, sobre las causas
y consecuencias de la
migracin en la economa
y en la familia salvadorea
a partir de lecturas y
discusiones grupales.
Investigacin, y distincin
de los diferentes tipos de
movimientos migratorios
en El Salvador, sus causas
y consecuencias.
Anlisis de datos
estadsticos de la
migracin de
salvadoreas y
salvadoreos entre
1980-2000.
Formulacin y discusin
de causas y consecuencias
de la migracin
de salvadoreas y
salvadoreos en la
economa y la familia
salvadorea.
4
4
4
Criticidad al identificar las
causas y consecuencias
de los diferentes
movimientos migratorios
en El Salvador.
Respeto e inters por los
compatriotas que migran
y las consecuencias de
dicho fenmeno
en la economa
familiar salvadorea.
Iniciativa y respeto
al expresar su opinin
y llegar a conclusiones
grupales.
Programa de estudio de cuarto grado
172
INDICADORES DE LOGRO CONTENIDOS
4.7 Caracteriza situaciones
que evidencian explotacin
y abuso hacia poblaciones
vulnerables: la niez, adulto
mayor, la mujer y personas
discapacitadas y propone
medidas para prevenirlos
manifestando inters
y lidaridad.
Explotacin y abuso que
sufren las poblaciones
vulnerables: la niez,
el adulto mayor, la
mujer y las personas
discapacitadas. Medidas y
base legal
para prevenirlos.
Caracterizacin de
situaciones que
evidencian abuso y
explotacin a poblaciones
vulnerables: la niez, el
adulto mayor y la mujer
en el hogar, la escuela y
la sociedad y proposicin
de medidas de prevencin.
Solidaridad hacia
poblaciones vulnerables:
la niez, el adulto
mayor, la mujer y
personas discapacitadas.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
4.8 Expresa comentarios orales y
escritos sobre el contenido de
artculos de la Constitucin
de la Repblica de
El Salvador que se refieren
a los derechos de la niez
y de la mujer y formula
recomendaciones para su
cumplimiento.
Derechos humanos
de la niez y la mujer
contemplados en la
Constitucin de la
Repblica de El Salvador.
Anlisis y divulgacin de
los derechos humanos
de la niez y la mujer
contemplados en la
Constitucin de Repblica
de El Salvador
Respeto por los derechos
de la niez y la mujer.
4.9 Ejemplifica situaciones que
manifiestan el ejercicio
o cumplimiento de los
derechos y deberes de la
familia contemplados en la
Constitucin de la Repblica
de El Salvador y el Cdigo
de Familia.
Derechos y deberes
de la familia segn
la Constitucin de la
Repblica de El Salvador
y el Cdigo de Familia.
Anlisis y divulgacin de
los artculos sobre los
derechos y deberes de la
familia contemplados en
la Constitucin de
la Repblica y Cdigo
de Familia.
Respeto y valoracin
de la legislacin sobre
la familia.
4.10 Explica con confianza y
compromiso metas personales
a corto y mediano plazo
que ha definido libremente
como parte de su futuro
proyecto de vida.
Metas en el proyecto
de vida.
Definicin y explicacin
de metas a corto y
mediano plazo, para
esbozar su proyecto
de vida.
Confianza y compromiso
con las metas que
se propone.
Programa de estudio de cuarto grado
173

5.1 Ubica con precisin en el
tiempo y en un mapa de El
Salvador los asentamientos
prehispnicos.
5.2 Elabora con inters un
cuadro comparativo de
la organizacin poltica,
social, econmica, ciencia,
tcnica, religin y cultura de
los pueblos prehispnicos,
valorando su importancia.
Pueblos prehispnicos en
El Salvador: autctonos,
proto-nahoas, maya-
quich y aztecas pipiles.
Su ubicacin en el
Occidente, Centro y
Oriente del pas.
Ubicacin en el tiempo
y en un mapa de El
Salvador los asentamientos
prehispnicos del pas.
Comparacin de la
organizacin poltica,
social, econmica,
ciencia, tcnica, religin
y cultura de los pueblos
prehispnicos en
El Salvador.
5
5
Inters y valoracin por
los pueblos prehispnicos
asentados en El Salvador.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
UNIDAD 5
LA IDENTIDAD NACIONAL
A TRAVS DE
LA REALIDAD HISTRICA
Tiempo probable: 30 horas clase
Objetivos
Investigar con inters y agrado la herencia cultural de los pueblos prehispnicos
y de la poca colonial, as como los hechos y personajes histricos ms
relevantes desde la independencia de El Salvador hasta el ao 1931,
organizando y analizando la informacin a fin de comprender y divulgar los
valores, rasgos y prcticas que definen la identidad cultural de las salvadoreas
y los salvadoreos.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
5.3 Investiga y presenta evidencias
de la herencia cultural de los
grupos tnicos (pipiles, lencas,
chortes, pokomames y otros)
en la sociedad salvadorea,
manifestando creatividad,
respeto y valoracin.
Herencia cultural de los
grupos tnicos (Nahua-
Pipiles, Lencas, Chorties,
Pokomames, Kakawiras
y otros) en la sociedad
salvadorea.
Investigacin y
representacin creativa
de la presencia de
la herencia cultural
de los grupos tnicos
(pipiles, lencas, chortes,
pokomames y otros) en
la sociedad salvadorea.
5
Reconocimiento y respeto
por la herencia cultural
de los grupos tnicos
(pipiles, lencas, chortes,
pokomames y otros) en la
sociedad salvadorea.
174
Programa de estudio de cuarto grado
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
5.4 Investiga y divulga, con
esmero y respeto, formas de
conservacin del patrimonio
cultural prehispnico y colonial.
Patrimonio cultural
prehispnico y colonial
en El Salvador: arte,
literatura, tradiciones,
edificaciones, entre otros.
Investigacin y
conservacin del
patrimonio cultural de
la poca prehispnica
y colonial.
Cuido y respeto del
patrimonio cultural
prehispnico y colonial.
5.5 Ejemplifica aspectos que
reflejan la identidad
salvadorea explicando su
importancia y su relacin
con el patrimonio cultural
prehispnico y colonial.
Identidad nacional:
Smbolos Patrios, y
Naturales, Gastronoma,
Territorio, Idioma, Religin,
Msica, Danza.
Anlisis y comentario de la
identidad nacional y
su relacin con el
patrimonio cultural
prehispnico y colonial.
Aceptacin y agrado
por los smbolos de
identidad salvadorea.
5.6 Investiga y explica en
forma activa las causas,
consecuencias y participacin
de personajes histricos del
descubrimiento y conquista
de El Salvador.
5.7 Ubica con precisin y
autonoma en el mapa
de El Salvador los
principales lugares en los
que se desarrollaron los
procesos de descubrimiento
y conquista.
Descubrimiento y
conquista de El Salvador:
causas, consecuencias y
personajes histricos.
Investigacin y anlisis
de las causas y
consecuencias del
descubrimiento y
conquista de El Salvador
y de los personajes que
participaron en ella.
Localizacin en un mapa
de El Salvador con los
principales lugares en
los que se desarrollaron
los procesos de
descubrimiento
y conquista.
Participacin activa en la
investigacin de las
causas y consecuencias
del descubrimiento y
conquista de El Salvador.

Autonoma y precisin
al localizar en un mapa
de El Salvador con los
principales lugares en
los que se desarrollaron
los procesos de
descubrimiento
y conquista.

Programa de estudio de cuarto grado
175
La colonia en El Salvador
y su papel en la formacin
de ciudades.
Investigacin y anlisis
de los principales rasgos
polticos, culturales y
sociales durante la
colonia en El Salvador
(1525 - 1821) y su papel
en la formacin
de las ciudades.
Inters por las
caractersticas culturales
de la colonia en
El Salvador.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
5.8 Investiga y comenta con
inters los principales
rasgos polticos, culturales,
sociales de la colonia en
El Salvador (1525 - 1821) y
su papel en la formacin
de las ciudades.
5.9 Investiga y elabora un cuadro
cronolgico de los principales
hechos ocurridos durante el
movimiento independentista
en El Salvador entre 1811 y
1821 y enumera con
inters las razones que los
provocaron y los personajes
involucrados.
5.10 Investiga y analizalas
las consecuencias de la
independencia en
El Salvador, y manifiesta
su valoracin por
los movimientos
independentistas.
Movimientos
independentistas en
El Salvador
(1811 - 1821). Causas
y consecuencias.
Investigacin, elaboracin
de un cuadro cronolgico
de los movimientos
independentistas en
El Salvador ocurridos
entre 1811 y 1821;
razones que los
provocaron y
personajes involucrados.
Investigacin y anlisis
de consecuencias de
la independencia en la
formacin de los Estados.
Respeto e inters por las
razones que provocaron
los movimientos
independentistas en
El Salvador.
Valoracin de
los movimientos
independentistas en
El Salvador.
176
Programa de estudio de cuarto grado
5.11 Investiga y explica las
razones de la conformacin
de la Federacin
Centroamericana
(1821-1841) y manifiesta
aprecio y conviccin por los
valores que provocaron y su
posterior separacin.
5.12 Elabora y explica con claridad
un cuadro cronolgico de los
gobiernos y gobernantes de la
Federacin Centroamericana.
La Federacin
Centroamericana:
conformacin y separacin
(1821-1841).
Investigacin y
anlisis de las razones
que permitieron la
conformacin y separacin
de la Federacin
Centroamericana
(1821-1841).
Elaboracin y explicacin
de un cuadro cronolgico
de los gobiernos y
gobernantes durante la
existencia de la Federacin
Centroamericana.
Aprecio y conviccin
por los valores que
provocaron la formacin
de la Federacin
Centroamericana
(1821-1841).
l l
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
5.13 Caracteriza con inters
la economa cafetalera
adoptada por
El Salvador como
repblica independiente
y el trato a la propiedad
de la tierra.
Economa cafetalera
adoptada por
El Salvador como
repblica independiente.
Caracterizacin y anlisis
de la economa cafetalera
adoptada por
El Salvador como
repblica independiente
y del trato a la propiedad
de la tierra.
Inters sobre la economa
cafetalera adoptada por
El Salvador como
repblica independiente.
5.14 Investiga y elabora con
empeo y entusiasmo una
cronologa de los hechos
relevantes ocurridos en el
perodo de 1841 a 1931
e identifica los personajes
que los protagonizaron.
Hechos relevantes
ocurridos en el perodo de
1841a1931 y personajes
que los protagonizaron.
Investigacin y elaboracin
de un cuadro cronolgico
de los hechos relevantes
ocurridos en el perodo
de 1841 a 1931 e
identificacin de los
personajes que los
protagonizaron.
5 Empeo y entusiasmo
en la investigacin y
elaboracin del cuadro
cronolgico de los hechos
relevantes ocurridos en el
perodo de 1841a1931 y
de los personajes que
los protagonizaron.
177
Programa de estudio de cuarto grado
6.1 Investiga y elabora una lnea
de tiempo sobre los hechos
econmicos, sociales y polticos
relevantes ocurridos en El
Salvador entre 1932 y 1960 y
manifiesta aprecio por la verdad
histrica y la tolerancia ante
posiciones divergentes.
Hechos econmicos,
sociales y polticos
relevantes ocurridos en
El Salvador entre
1932 y1960, personajes
que los protagonizaron.
Investigacin y elaboracin
de una lnea del tiempo de
los hechos econmicos,
sociales y polticos
relevantes ocurridos en
El Salvador entre
1932 y 1960.
6
Veracidad y tolerancia
ante puntos de vista
diferentes en relacin a los
hechos histricos ocurridos
en el perodo de
1932 a 1960.
UNIDAD 6
CONTINUIDAD Y CAMBIO
ENTRE LAS SOCIEDADES
PASADAS Y PRESENTES
Tiempo probable: 24 horas clase
Objetivos
Analizar de manera detallada los principales hechos econmicos, polticos y sociales
ocurridos en El Salvador y personajes involucrados durante el periodo comprendido entre
1932 hasta la actualidad aplicando cronologas y lneas del tiempo para comprender su
relacin e influencia en la vida cultural, econmica y poltica de El Salvador.
Argumentar en forma respetuosa los beneficios o dificultades que pueden generar las
nuevas tecnologas, la comunicacin, informacin y diversin identificando el papel que
desempean para reconocer algunos comportamientos sociales y econmicos de la
poblacin salvadorea desde inicios del siglo XXI.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
6 1 I ti l b l
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
6.2 Identifica con inters los
elementos que definen
la diversificacin de la
economa de El Salvador,
despus de la Segunda
Guerra Mundial.
Diversificacin de la
economa de El Salvador,
despus de la Segunda
Guerra Mundial.
Identificacin de los
elementos que definen
la diversificacin de la
economa de El Salvador,
despus de la Segunda
Guerra Mundial.
Inters por la
diversificacin de la
economa de El Salvador
despus de la Segunda
Guerra Mundial.
177
6.3 Explica las principales
condiciones econmicas en
que se desarroll el Mercado
Comn Centroamericano, sus
causas y consecuencias y valora
los esfuerzos de integracin de
la regin.
El Mercado Comn
Centroamericano. Causas
y consecuencias.
Explicacin de las
principales condiciones
econmicas en que se
desarroll el Mercado
Comn Centroamericano,
sus causas y consecuencias.
Valoracin de los
esfuerzos de integracin
centroamericana.
178
Programa de estudio de cuarto grado
Hechos relevantes,
personajes y gobiernos
de El Salvador durante
1970 y 1992.
Los Acuerdos de Paz en
El Salvador, firmados
en 1992.
Elaboracin de un cuadro
cronolgico de los hechos
relevantes, personajes y
gobiernos de El Salvador
durante 1970 y 1992.
Compromiso por
fortalecer la convivencia
pacfica en el pas.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
6.4 Elabora un cuadro cronolgico
sobre los hechos ms relevantes,
personajes y gobiernos de
El Salvador durante 1970 y
1992 y propone actitudes
ciudadanas que fortalezcan la
convivencia pacfica.
6.5 Describe e ilustra las nuevas
tecnologas de informacin
y de las comunicaciones,
comentando con inters y
criticidad su papel e impacto
en la sociedad salvadorea.
Tecnologas de la
informacin y de las
comunicaciones.
Impacto en la sociedad
salvadorea.
Descripcin e ilustracin
de los usos e impacto
de las tecnologas de
la informacin y de
las comunicaciones en
sociedad salvadorea.
Inters y criticidad al
utilizar las tecnologas de
la informacin y
las comunicaciones.
6.6 Organiza en esquemas o
grficos informacin relevante
sobre los acuerdos comerciales
entre El Salvador y los pases
de Amrica del Norte,
Amrica Central y Sur Amrica
y opina con criticidad sobre
los beneficios o dificultades
que puedan generar a la
economa salvadorea.
Acuerdos comerciales
entre El Salvador y los
pases de Norte Amrica,
Amrica Central y
Sur Amrica.
Organizacin de
esquemas o grficos de
los acuerdos comerciales
entre El Salvador y los
pases de Norte Amrica,
Amrica Central y Sur
Amrica y anlisis de
sus beneficios en la
economa salvadorea.
Criticidad antes los
beneficios o dficultades
que pueden generar los
acuerdos comerciales
entre El Salvador y
otros pases.
6.7 Investiga, ejemplifica
y describe con
respeto y criticidad los
comportamientos sociales y
econmicos de la poblacin
salvadorea desde inicios del
siglo XXI.
Comportamiento social
y econmico de la
poblacin salvadorea
en el siglo XXI.
Investigacin,
ejemplificacin y
descripcin de las
caractersticas del
comportamiento social
y econmico de la
poblacin salvadorea
en el siglo XXI.
Respeto y criticidad ante
comportamientos sociales
y econmicos de la
poblacin salvadorea.
179
Programa de estudio de cuarto grado
GLOSARIO
Agricultura: la prctica de cultivar el suelo y producir cosechas.
Agroexportacion: actividad econmica que utiliza productos agrcolas para
la exportacin.
Altitud: altura de un lugar de la Tierra sobre el nivel medio del mar, que es
considerado cero. La altitud es uno de los principales factores modificadores
del clima.
Amrica Central: regin conformada por siete pases: Guatemala, Honduras,
El Salvador, Nicaragua, Costa Rica y Belice (1981) y Panam (1903), tambin
como nuevas repblicas, pese a estar vinculadas histricamente con Inglaterra
y Amrica del Sur y el Caribe respectivamente quedaron geopolticamente
insertas en territorio centroamericano.
Centro Amrica: regin formada por cinco pases: Guatemala, Honduras,
El Salvador, Nicaragua y Costa Rica, repblicas vinculadas histrica y
culturalmente.
Barmetro: instrumento para medir la presin atmosfrica.
Calor: forma de energa debida al rpido movimiento de las molculas.
Calentamiento global: es el fenmeno observado en las medidas de la
temperatura que muestra un promedio de temperatura de la atmsfera
terrestre y de los ocanos en las ltimas dos dcadas.
Clima: condicin promedio de la atmsfera de un punto o una regin de la
superficie terrestre
Cambio climtico antropognico: fenmeno ambiental cuyo efecto principal
es el recalentamiento de la superficie terrestre y sus causas se relacionan con
actividades humanas que estn alterando la composicin de la atmsfera
al aumentar la concentracin de los gases que producen el efecto de
invernadero.
Cambio climtico o variabilidad natural del clima: es la modificacin del
clima con respecto al historial climtico a una escala global o regional. Tales
cambios se producen a muy diversas escalas de tiempo y sobre todos los
parmetros climticos: temperatura, precipitaciones, nubosidad, etc., son
debidos a causas naturales.
Cartografa: conjunto de estudios y operaciones cientficas, artsticas y
tcnicas para la elaboracin de mapas y planos.
Comunicacin: transmisin de ideas, pensamientos y opiniones de una
persona a otra a travs de la palabra hablada, la pgina impresa u otros
medios directos e indirectos incluyendo los medios elctricos y electrnicos.
Conquista: proceso violento, desarrollado en perodos, cuyo objetivo era la
dominacin de los pueblos nativos de Amrica por parte de los europeos.
Continente: una de las grandes masas de tierras ininterrumpidas en que
pueden ser divididas las tierras emergidas.
Coordenadas geogrficas: formadas por los paralelos y meridianos, permiten
ubicar con precisin la ubicacin de un punto cualquiera de la superficie
terrestre.
Cuenca: cualquier depresin de la litosfera, est cubierta o no de agua. La
cuenca de un ro es toda el rea drenada del ro y sus dependientes. Se llama
cuenca de un lago a la depresin ocupada por las aguas del lago.
180
Programa de estudio cuarto grado
Cultura: es el conjunto de manifestaciones y expresiones intelectuales y
artsticas de una sociedad determinada. Incluye costumbres, prcticas,
cdigos, normas y reglas de la manera de ser, vestimenta, religin, rituales,
pautas de comportamiento y sistemas de creencias.
Democracia: sistema de gobierno que se fundamenta en el funcionamiento
de un Estado de Derecho. En l rige el imperio de la ley, misma que acatan
sus gobernantes y gobernados. En el sistema democrtico el pueblo es el que
ejerce la soberana eligiendo a sus autoridades.
Derechos humanos: toda persona tiene un valor y por el hecho de su condicin
humana lo hace digna para que ese valor sea plenamente respetado,
se requieren ciertas condiciones de vida que le permitan desenvolverse
en la sociedad, satisfacer sus necesidades bsicas y desarrollar sus
capacidades.
Deslizamiento: movimiento o corrimiento de masa de tierra cuando est muy
hmeda.
Economa: analiza los procesos de produccin, intercambio, distribucin y
consumo de bienes y servicios, entendidos estos como medios de satisfaccin
de necesidades humanas y resultado individual y colectivo de la sociedad.
Emigracin: abandono de su propio pas o regin para establecerse en otro.
Erosin: proceso de remocin y transporte de las rocas y del suelo por el
agua, el viento, los glaciares y las olas.
Escala de Richter: es utilizada por los sismlogos para medir la intensidad de
los sismos. Tambin utilizan la escala de Mercalli.
Espacio geogrfico: es agregado de elementos fsicos y elementos humanos.
Es un producto social. Organizado que responde a unos intereses y valores.
Refleja las contradicciones internas de la sociedad.
Estaciones: cambio del estado del tiempo que se sucede cada trimestre en
las latitudes medias, y que se debe a la inclinacin del eje terrestre y a la
migracin de los rayos verticales del sol mientras la Tierra recorre su rbita.
Exportacin: conjunto de productos enviados a otras partes del mundo, con
propsitos comerciales.
Fauna: la vida animal de una regin o de un periodo geolgico.
Flora: la vida vegetal de una regin o de un periodo geolgico.
Hecho: cuanto acontece o sucede en la naturaleza y sociedad.
Hidrografa: parte de la geografa fsica que describe los mares, ros y lagos.
Humus: elemento del suelo formado por la descomposicin de materias de
origen vegetal y animal.
Iceberg: masa de hielo flotante desprendida de los glaciares.
Identidad nacional: sentimiento de pertenencia a una nacin que tienen las
personas .
Independencia: es la situacin de un pas que no est sometido a la autoridad
de otro.
Inmigracin: es la entrada a un pas de personas que nacieron o proceden
de otro lugar.
Inundacin: abundancia excesiva de agua que por desbordamientos de ros
o por subida de la marea sobre zonas libres de sta, por encima del nivel
habitual o por tsunamis.
Importacin: es la introduccin de mercancas al pas procedentes de otros
con fines comerciales.
Insurreccin: Sublevacin. Rebelin.
Istmo: lengua de tierra que une dos continentes: una pennsula con un
continente; o una pennsula con una isla.
Lago: gran masa de agua permanente que ocupa una depresin de la
litosfera.
Latitud: distancia medida en grados, minutos y segundos, entre cualquier
punto de la superficie terrestre y el ecuador. Puede ser latitud norte o sur,
segn el punto est situado en el hemisferio septentrional o meridional.
Mercado comn centroamericano: proyecto de integracin de los mercados
centroamericanos que se intent implantar en la dcada de los sesentas del
siglo xx.
Meridianos: lneas imaginarias trazadas sobre la esfera que unen ambos
polos de la Tierra.
Meridiano cero o primer meridiano: el meridiano que pasa a travs de
Greenwich, ciudad de Gran Bretaa, y al cual se le asignado el valor de 0
de longitud.
181
Programa de estudio cuarto grado
Migrar: trasladarse de una regin o de un pas a otro. El que abandona su pas
nativo emigra; inmigrante es el extranjero que llega a un pas para radicar en
l.
Migraciones: fenmeno demogrfico consistente en el desplazamiento
individual o colectivo de personas de un lugar a otro.
Ocano: el grande y dilatado mar que cubre la mayor parte de la superficie
terrestre; tambin se da el nombre de ocano a cada uno de sus cuatro
grandes divisiones: Atlntico, Pacfico, ndico y rtico.
Orografa: parte de la geografa fsica que trata de la descripcin de las
montaas.
Paralelo: cada uno de los crculos de la superficie terrestre cuyos planos son
paralelos al ecuador.
Paisaje geogrfico: es el resultado de las interrelaciones de fenmenos fsicos
y biolgicos que se producen en un lugar o espacio de la Tierra.
Patrimonio cultural: son todos los bienes muebles o inmuebles debido a la
obra del ser humano que representa inters desde el punto de vista histrico,
antropolgico, arqueolgico y artstico.
Poblacin: grupos de personas que viven en un rea geogrfica. Su nmero
se determina por un censo de poblacin.
Posicin astronmica: es dada por una coordenada, proveniente de los
meridianos y paralelos. Los meridianos se cuentan a partir de Greenwich, y
dan un total de 360 grados; a estas se les llama longitudes, en tanto que los
paralelos se les llama latitudes y se dividen a partir del ecuador en hemisferio
norte y hemisferio sur.
Posicin geogrfica: cuando se habla del pas o ciudad en relacin a sus
vecinos, con quien limita al norte, al sur, este, oeste, tambin se refiere a donde
est localizado, por ejemplo en la regin septentrional (norte) del continente.
Precipitacin: la cada de lluvia, nieve, granizo o aguanieve sobre las
superficies de las tierras y los mares.
Presin atmosfrica: presin ejercida por la atmsfera no solo hacia abajo,
sino en todas direcciones; la presin ejercida sobre un cuerpo por el aire
equivale a 14.7 libras por pulgada cuadrada, al nivel del mar.
Proceso de industrializacin: proceso de desarrollo de la actividad industrial
en la estructura econmica de un pas.
Redes viales: son el conjunto de vas de un pas o regin; incluyen ferrocarriles,
carreteras, puertos areos, martimos y fluviales. Son el sistema circulatorio
por el que transitan bienes y servicios (el transporte es un servicio y lleva
bienes). Las importaciones y exportaciones dependen de esas redes.
Reforestacin: accin de plantar bosques de nuevo en reas de donde haban
sido removidos anteriormente.
Regin geogrfica: es una porcin de espacio terrestre cuya individualizacin
obedece a la combinacin muy estrecha de las caractersticas fsicas, de los
de la historia, y de las actividades de las sociedades que la ocupan.
Rosa de los vientos: crculo que representa el horizonte en el cual estn
marcados treinta y dos rumbos magnticos. Cada rumbo mide 11 15,
completando las 32 los 360 de la circunferencia.
Rumbo: cada uno de los treinta y dos radios sealados en la Rosa Nutica o
de los Vientos.
Sector econmico: conjunto de actividades econmicas que producen
alimentos, carros, computadoras, recoleccin de basura, repartimiento
de mensajera y prestacin de servicios plomera, pueden ser primarios,
secundarios y terciarios, lo realizan mujeres y hombres para satisfacer las
necesidades bsicas de la poblacin.
Sector informal o economa informal: sector econmico no regulado.
Ejemplos de subempleo son los vendedores de dulces, flores, alimentos, etc.,
en las calles.
Seguridad social: se refiere principalmente al bienestar social relacionado
con la salud, pobreza, vejez, discapacidades, desempleo, entre otros.
Sismo: sacudida de la corteza terrestre.
Sismgrafo: instrumento registrador de los sismos.
Social: se refiere a lo relacionado con los seres humanos que viven en
asociacin unos con otros.
Suelo: mezcla de minerales, materia orgnica, aire y agua, donde crecen las
plantas. El suelo forma la capa superior de la litosfera.
Sustentabilidad: mantener los recursos naturales y econmicos en beneficio
de generaciones futuras.
Trabajo: es una de las principales actividades humanas y sociales.
182
Programa de estudio cuarto grado
Urbanizacin: accin de urbanizar. Est relacionada con el crecimiento de
las ciudades y con el abandono de las reas rurales por la poblacin.
Urbano: lo que pertenece a una ciudad.
Volcn: abertura de la superficie terrestre a travs de la cual brotan rocas en
estado de fusin (lava), cenizas, polvo volcnico, vapor de agua y gases.
Vertiente: declive de la superficie terrestre por donde corren o pueden correr
las aguas.
Termmetro: instrumento para medir la temperatura.
Temperatura: grado de calor de un cuerpo.
Tratado de libre comercio: asociacin comercial entre Mxico, Estados Unidos
y Canad.
Tiempo atmosfrico: es la variacin de fenmenos que suceden en la
atmsfera de la tierra.
Tsunami: grandes olas producidas por los movimientos ssmicos en el mar o
en la costa.
EDUCACIN
ARTSTICA
184
Programa de estudio de cuarto grado
Al mismo tiempo, se exploran las nuevas tecnologas
aplicadas al arte y el acercamiento a los lenguajes artsticos
contemporneos; se promueve una aproximacin ms
analtica al entorno de los nios y las nias a travs de
las experiencias de enseanza y aprendizaje, los crculos
de opinin y anlisis, las visitas de campo, la revisin y
valoracin histrica y patrimonial, y finalmente el
descubrimiento del papel de las artes en la vida cotidiana.
Relacin de la Educacin Artstica con otras asignaturas
Esta asignatura permite fortalecer habilidades importantes
para el aprendizaje de contenidos de Lenguaje, Matemtica,
Ciencia, Salud y Medio Ambiente, Estudios Sociales y
Educacin Fsica. De ah la importancia de integrar o
correlacionar contenidos de las diferentes asignaturas. A
continuacin, se mencionan algunos ejemplos de contenidos
y habilidades afines:
Lenguaje
Los contenidos de Educacin Artstica desarrollan conceptos
y procedimientos que se corresponden con la asignatura
de Lenguaje como las relaciones existentes entre la msica
y el teatro con el lenguaje oral y escrito; el tono y registro
de la voz, el uso de pausas, la articulacin y vocalizacin
de sonidos y su correspondencia con vocales, consonantes
y slabas; la aplicacin de la respiracin diafragmtica
para modular el canto y la expresin oral. Adems existen
diferentes aplicaciones de la msica, el teatro y las artes
plsticas en la ilustracin, musicalizacin y dramatizacin
de textos literarios; en la caracterizacin fsica y sicolgica
de personajes, la adopcin de estrategias de lectura, de la
fotografa en el contexto de las noticias y de la fotografa
familiar como recurso autobiogrfico lo cual se relaciona
con el diario personal, etc.
Presentacin de la asignatura
La Educacin Artstica pone en contacto a los nios y a
las nias con lenguajes artsticos fundamentales para
la expresin creadora y la comprensin de su cultura y
sociedad. Los fundamentos curriculares de la Educacin
Bsica han planteado la importancia de esta asignatura de
la siguiente manera:
Desarrolla habilidades artsticas que enriquecen sus
aptitudes, no solo para apreciar el arte, sino tambin
para practicarlo, vivenciarlo y conservarlo mediante una
variedad de tcnicas. Se presenta en forma integrada,
relacionando las reas de expresin artstica: la msica, la
danza, las artes escnicas y las artes plsticas.
Se organiza en torno a dos ejes fundamentales:
La percepcin y el desarrollo de habilidades en actividades
musicales, plsticas y dramticas.
La expresin personal gratificante de sentimientos e
ideas mediante el desarrollo de las diferentes formas de
manifestacin artstica
1
.
En este sentido, se espera que los y las estudiantes sean
receptores activos ante representaciones plsticas,
musicales y dramticas, y que al mismo tiempo puedan
expresar su pensamiento, experiencia y fantasas a travs
de estos mismos medios.
En segundo ciclo, esta asignatura profundiza en la
espontaneidad expresiva, el conocimiento progresivo y la
utilizacin de recursos y tcnicas artsticas a partir de las
bases construidas en primer ciclo. Se da continuidad al
desarrollo de la sensibilidad, imaginacin y percepcin de
la sociedad y la cultura a travs de los lenguajes y cdigos
artsticos.
La particularidad de los programas de Educacin Artstica
en segundo ciclo es potenciar las capacidades analticas de
las y los estudiantes a travs de actividades de investigacin
terica, histrica y cultural y su relacin con las artes.
1
Ministerio de Educacin. (1999). Fundamentos curriculares de la Educacin Bsica, pg. 58.
185
Programa de estudio de cuarto grado
Matemtica
Las disciplinas de la Educacin Artstica propician
relaciones con contenidos de Matemtica en la observacin
y reconocimiento de figuras y formas del entorno que
desarrolla el rea de teatro y artes plsticas. Tambin se
pueden establecer correspondencias entre la estructura
del comps de 4/4 y el estudio de las fracciones; as como en
la concepcin del tiempo a partir de la subdivisin rtmica
de la msica. Los contenidos que abordan el trazo de la
figura y construccin de los slidos geomtricos y el anlisis
del volumen, se relacionan con la concepcin y consecucin
de la composicin bidimensional y tridimensional en las
artes plsticas.
Ciencia, Salud y Medio Ambiente
Educacin Artstica desarrolla temas que consideran el
conocimiento y reconocimiento del cuerpo, sus posibilidades
expresivas y comunicativas, lo cual se relaciona con los
contenidos de reconocimiento del esquema corporal a partir
de su propia corporeidad y la de los dems que aparecen
en Ciencia, Salud y Medio Ambiente. Otros contenidos
artsticos que pueden relacionarse con el uso de la caja
torcica para proyectar la voz en el canto, as como las
tcnicas de representacin de animales y de la naturaleza.
Estudios Sociales
Se relacionan con Estudios Sociales, los contenidos
del programa de Educacin Artstica que propician
la observacin y anlisis de los fenmenos culturales,
sociales e histricos; por ejemplo, el reconocimiento
de situaciones o problemas en su comunidad y el uso
de herramientas para su representacin con tcnicas
escnicas, musicales o plsticas. Asimismo, promueve
el conocimiento del patrimonio cultural como las artes
populares y manifestaciones del folclore para su recreacin
y apreciacin lo cual apoya el aprendizaje de las culturas
prehispnicas y los consecuentes cambios e influencias en
distintos momentos de la historia salvadorea.
Educacin Fsica
Los contenidos reflejados tanto en la educacin Fsica como
en la Educacin artstica se basan fundamentalmente en
la actividad motriz. Coinciden por ello las temticas sobre
el cuerpo, su expresin y su comunicacin. Aunque con
procesos y objetivos diferentes, hay afinidad en aspectos
como el autoconocimiento y control corporal, los hbitos
de posturas, la relajacin, la respiracin y el valor del
tiempo. Ambas materias ponderan el ritmo, la duracin y la
secuencia en el tratamiento de sus tcnicas.
Por lo tanto, no es aceptable ni correcto suprimir parcial o
totalmente el desarrollo curricular de Educacin Artstica
por cumplir con objetivos de otras asignaturas, ya que con
ello se priva a las nias y los nios de un aprendizaje integral
que fortalece habilidades y destrezas transversales y que
aporta experiencias motivadoras y edificantes.
Enfoque de la asignatura:
artstico-comunicativo
Enfatiza en el componente comunicativo de toda expresin
artstica con la intencin de fortalecer y potenciar los
conocimientos, las habilidades y las actitudes que se ponen
en juego al percibir (observar, escuchar), comprender y
apreciar una obra artstica como receptor de un mensaje,
o bien al expresar ideas o sentimientos por medio de los
recursos y las tcnicas propias del arte.
Competencias a desarrollar
Percepcin esttica
Desarrolla la capacidad de observacin de las
representaciones plsticas, musicales y escnicas, adems
de promover la interpretacin, indagacin y anlisis del
186
Programa de estudio de cuarto grado
Implica el desarrollo del pensamiento convergente y
divergente, adems de sensibilizar sobre las modas, gustos,
tendencias del arte y la cultura del pasado y del presente.
Genera espacios y alternativas para el disfrute y el ocio.
Permite la reflexin sobre las agresiones que deterioran
la calidad de vida, ayudando a los nios y nias a tomar
conciencia de la importancia de contribuir a preservar un
entorno fsico y social agradable y saludable.
Contribuye al desarrollo de la conciencia ciudadana a travs
del trabajo en equipo en el que se requiere cooperacin,
seguimiento de normas, respeto a las jerarquas, cuidado
responsable de los espacios y recursos, adems de
proporcionar la satisfaccin del fruto de un trabajo
colectivo.
Incluye contenidos que permiten conocer, valorar y disfrutar
expresiones artsticas y culturales nacionales y de otros
pueblos, desarrollando sensibilidad hacia la diversidad
cultural. Adems, fortalece los vnculos con el patrimonio
cultural y artstico favoreciendo la construccin de la
identidad cultural.
Bloques de contenido
La naturaleza de los contenidos de esta asignatura
comprende bsicamente tres formas artsticas: la msica,
las artes plsticas y las artes escnicas. Estas reas y
el componente sociocultural constituyen los bloques de
contenidos que estructuran la propuesta curricular de la
Educacin Artstica.
1. Educacin musical
Comprende la percepcin, expresin vocal e instrumental,
el lenguaje y apreciacin de la msica en el entorno
urbano, natural, domstico, artstico y cultural; as como en
la audicin musical de distintos gneros, pocas y estilos.
Facilita herramientas para el desarrollo de la inteligencia
entorno natural y la actividad y creacin humana (los objetos
y la creacin artstica) Supone la capacidad de conocer,
analizar, reflexionar y disfrutar las producciones artsticas
por medio de la observacin activa de los elementos del
mundo visual, la audicin compresiva de los componentes
de la msica de varios gneros y el hallazgo de los
elementos gestuales, orales y dramticos ms significativos.
Tambin implica el reconocimiento y disfrute del patrimonio
artstico local y obras emblemticas de la humanidad; el
reconocimiento y diferenciacin de los lenguajes artsticos
y elementos que los caracterizan.
Expresin esttica
Promueve la iniciativa, la imaginacin, la creatividad y la
espontaneidad, al mismo tiempo que ensea a valorar otras
formas de expresin. Favorece la exploracin de los lenguajes
artsticos: sonidos, texturas, formas, espacios, el tiempo y
la imagen. Implica la experimentacin, manipulacin y
tratamiento de los recursos por medio del desarrollo de las
habilidades tcnicas de cada disciplina artstica. Facilita
que los nios y nias aprendan a interpretar su entorno y
comunicar sus ideas y sentimientos de manera creativa.
Requiere de una planificacin previa y revisin de cada
etapa del proceso de creacin, creatividad e iniciativa para
encontrar soluciones diversas a los problemas y esfuerzo
constante por alcanzar resultados originales con calidad.
Valora la importancia de la flexibilidad y el respeto en los
procesos colectivos de creacin.
Interpretacin de la cultura y el mundo natural
Contribuye al enriquecimiento de los marcos de referencia,
a partir de la interpretacin de manifestaciones del arte y
la cultura local o de otros pueblos. Dota a los alumnos de
instrumentos para hacer valoraciones y construir criterios
vlidos de apreciacin del patrimonio artstico y cultural.
187
Programa de estudio de cuarto grado
auditiva, la coordinacin motora y la proyeccin de la voz
para el canto, activando por otra parte, el pensamiento
abstracto con la subdivisin rtmica del tiempo y el concepto
morfolgico de la msica, lo cual incide en los aprendizajes
de la matemticas y otras ciencias. El trabajo colectivo
en los conjuntos musicales promueve la cooperacin, la
organizacin de roles y el respeto de jerarquas, aspectos
fundamentales en el desarrollo de los nios y las nias como
individuos y como parte integral de la sociedad.
Respecto a la expresin, produccin o elaboracin musical,
la enseanza y el aprendizaje se realizan a travs de tres
medios diferentes: la voz y el canto, los instrumentos y el
movimiento y la danza. La voz es el instrumento comunicativo
y expresivo por excelencia Las canciones son un elemento
bsico del comportamiento musical Los alumnos y las
alumnas de primaria han de conocer muchas canciones
que les aporten variedad expresiva, que tenga inters y
significado para ellos, a fin de dar cauce a sus sentimientos
y enriquecer la representacin del mundo.
2

2. Educacin plstica
Las artes plsticas se caracterizan por la construccin de
conceptos que se expresan de forma visual, por ello el rea
incluye el conocimiento e interpretacin de imgenes, la
observacin activa del mundo visual, el conocimiento de los
elementos visuales bsicos que lo constituyen como la lnea
el color, la forma el volumen, las texturas de los materiales
y las tcnicas para expresarse de manera creativa con
autonoma. Para esto se promueve la observacin activa
del entorno, tambin los nios y las nias aprenden
a analizar cmo los artistas construyen los discursos
visuales para expresar sus ideas y sentimientos, lo cual
tienen la oportunidad de ensayar (de manera individual y
colectiva) al realizar sus propias creaciones de tal forma
que se traduzcan en objetos artsticos visuales en donde se
expresan en su propio lenguaje. El rea tambin considera
conceptos para comprender la funcionalidad e iconicidad
de las artes visuales en la sociedad, lo cual contribuye a
construir criterios vlidos para la apropiacin y valoracin
crtica de los objetos visuales a los que estn expuestos
en la vida cotidiana; con la resolucin de la configuracin
bidimensional y tridimensional por medio de las fases
del proceso de diseo se promueven la innovacin y el
pensamiento abstracto vinculndose con la matemtica;
enfatiza el anlisis, la observacin y la expresin,
relacionndose con las asignaturas de Ciencia, salud y
medio ambiente, Estudios sociales y Lenguaje.
3. Educacin escnica
Se centra en la educacin integral del alumno, ya que se
integran diferentes recursos expresivos. Se trabaja como un
proceso convencional en el cual las personas, los objetos y
los hechos dejan de ser lo que realmente son y se convierten
en otros que los representarn. Para esto se combinan, en
forma progresiva, elementos de: La expresin corporal como
el gesto, el movimiento, el espacio y el tiempo; La expresin
oral en la que se trabaja la respiracin, la vocalizacin,
el volumen. Tambin se promueven experiencias para
estimular y potenciar sus sentidos. Adems, se experimenta
con el uso de otras tcnicas dramticas que incluye la
elaboracin de tteres, las sombras chinas , la coreografa
y las bases para la elaboracin de un guin dramtico, y
con estas tcnicas logre comunicar sus ideas , sentimientos
y experiencias en forma variada y atractiva frente a una
audiencia.
4. Arte y cultura:
Comprende contenidos que permiten la valoracin y
apropiacin de las diversas expresiones artsticas y culturales
locales y nacionales. Al contextualizar las producciones
musicales, plsticas o de artes escnicas como parte del
2
Espaa. Ministerio de Educacin y Ciencia. rea de Educacin Artstica. Primaria.
188
Programa de estudio de cuarto grado
Se han cambiado los nombres de las unidades atendiendo
al nfasis de cada una. El cambio de nombre de la primera
unidad La expresin artstica y nuestro entorno se debe
a la intencin de valorar los elementos visuales, sonoros
y de movimiento que los nios y las nias encuentran en
su entorno y en sus vivencias personales como inspiracin
para su comunicacin.
El cambio en la segunda unidad "El arte en el tiempo"
se justifica por la necesidad de relacionar la cultura
y el arte de pocas pasadas y del presente con el fin
patrimonio cultural, se accede a los valores y significados
artsticos de pas.
Relacin entre los bloques de contenido
y las unidades didcticas
Los bloques de contenido se organizan en tres unidades
de aprendizaje, de manera integrada y complementaria.
El nombre de las unidades, sus contenidos y organizacin
presentan algunas modificaciones con relacin al
programa de estudio anterior. A continuacin, se detallan
las adecuaciones ms significativas:
Se han programado algunos contenidos de manera
que coincidan con las otras asignaturas en los mismos
trimestres. As, los docentes tendrn mayor facilidad
para integrar o correlacionarlos. Como ejemplo,
destacamos que en la Unidad 2 de Educacin artstica se
desarrollan varios contenidos relacionados con las culturas
prehispnicas como patrimonio inmaterial, cermica
prehispnica y construccin de un palo de lluvia, los cuales
sern un antecedente para desarrollar los contenidos
histricos que presenta la asignatura de Estudios Sociales
en la Unidad 5.
Mayor integracin de los contenidos de plstica, msica y
artes escnicas; de manera que tengan presencia en todas
las unidades para fortalecer la comunicacin artstica en los
nios y las nias. Por ejemplo, el programa de cuarto grado
tiene al final de la Unidad 3 el montaje y creacin de msica
para un cuento en el cual tienen un papel importante las
tcnicas para la dramatizacin que se han abordado en el
rea de artes escnicas.
nfasis en la conexin de la expresin artstica que realizan
los nios y las nias con sus vivencias y actividades en
el centro escolar, y con su cultura para otorgarle mayor
sentido al aprendizaje. Esto se proyecta en las unidades 2 y
3 de Educacin Artstica en los contenidos de investigacin
y apreciacin del patrimonio inmaterial de msica, de
danza y de otras manifestaciones culturales locales como
el Himno Nacional de El Salvador y las Bandas de Paz.
1. Desarrollemos nuestro
sentimiento artstico
2. Compartamos
experiencias artsticas
3. Trabajemos con
el arte
1. La expresin artstica en
nuestro entorno
1. Desarrollemos nuestro 1. La expresin artstica en
Unidades del
programa anterior
Unidades del
programa actual
2. El arte en el tiempo
3. Culturas y tecnologas
en el arte
de facilitar referentes para enriquecer la expresin y
la valoracin del patrimonio cultural y artstico y revisar
las relaciones entre las manifestaciones del pasado y de
la actualidad.
Finalmente, la tercera unidad Culturas y tecnologas en
el arte enfatiza el impacto de las nuevas tecnologas en
las manifestaciones artsticas, lo cual se manifiesta en su
concepto, en los soportes y formas actuales de difusin de
las artes.
Los cambios de nombre se presentan de manera comparativa
en el siguiente cuadro:
189
Programa de estudio de cuarto grado
El aprendizaje y la apropiacin de las competencias
de Educacin Artstica requieren de un tratamiento
interrelacionado de los bloques de contenido. Esta versin
presenta los contenidos de los diferentes bloques en tres
dimensiones: conocimientos, procedimientos y actitudes, lo
que facilita an ms la integralidad de los aprendizajes.
Unidades Bloques de contenido
1. La expresin
artstica y nuestro
entorno
Plstica, Msica y Escnica tienen mayor
nfasis. Se introducen elementos y tcnicas
que fortalecen la expresin artstica por
medio de prcticas colectivas que generan
confianza de grupo, respeto y solidaridad
hacia los dems, se motiva la
observacin reflexiva de producciones y
obras artsticas de autores nacionales y
extranjeros para reconocer la aplicacin
de tcnicas diversas.
2. El arte en el
tiempo
Se evidencia una mayor
orientacin hacia Arte y Cultura.
Se desarrollan contenidos relativos
al patrimonio material e inmaterial
salvadoreo, la cermica, danzas,
instrumentos y tradiciones musicales
de culturas antiguas.
Objetivos de cuarto grado
1. Explorar con iniciativa y creatividad las texturas, las formas
y los sonidos; las posibilidades expresivas de la voz, del
cuerpo y los sentidos, utilizando de manera espontnea
las tcnicas y recursos de las artes plsticas, escnicas
y musicales en la creacin artstica y la actividad cultural
para disfrutar de la produccin artstica a la que tenga
acceso y fortalecer su capacidad creativa y expresiva.
2. Identificar y valorar las propiedades expresivas
de los lenguajes artsticos; los procesos, estrategias,
instrumentos y tecnologas para materializar sus
inquietudes al expresarse creativamente con
dichos recursos.
3. Aproximarse con entusiasmo y creatividad a las
manifestaciones del arte y la cultura local y de otros
pueblos para apreciar y preservar el patrimonio artstico,
cultural. natural y su entorno social.
Lineamientos metodolgicos
El desarrollo curricular de Educacin Artstica privilegia
experiencias que permiten un desempeo activo del
alumnado, con oportunidades para la manipulacin y la
accin externa: dibujo, canto, baile, etc.; as como para
acciones internas: plantearse interrogantes, relacionar lo
que se sabe con los nuevos contenidos, buscar soluciones,
entre otros.
Por lo tanto, las y los docentes deben planificar sus clases
para generar situaciones que permitan que los y las
nias aporten desde su propia experiencia, de manera
que sientan seguridad de opinar a partir de lo conocido
y de sus propias reflexiones. A partir de su experiencia
personal, las y los estudiantes aplicarn en forma
progresiva los conocimientos y procedimientos que les
ofrece la asignatura.
3. Culturas y
tecnologas
en el arte
En los bloques de Plstica, Msica y
Escnica se desarrollan tcnicas para
la elaboracin de tteres, figuras de
papel y musicalizacin de personajes y
situaciones. Se abordan algunos medios
aplicados a las artes, la publicidad y la
cultura de masas, como la fotografa, el
dibujo digital y los instrumentos musicales
electrnicos.
190
Programa de estudio de cuarto grado
Conviene alternar el trabajo individual y en equipo,
ya que refuerzan aspectos diferentes. Por ejemplo, el
trabajo individual favorece la autonoma; y al trabajar con
compaeros y compaeras, se permite el intercambio y
apoyo entre iguales, lo que favorece la convivencia.
Con el propsito de orientar la metodologa, se presenta
una secuencia de pasos o procedimientos generales para
el desarrollo de los contenidos. Las y los docentes debern
precisar y adecuar las actividades segn las necesidades de
sus estudiantes y las particularidades de los contenidos.
1. Fase de motivacin
Aunque las actividades expresivas de esta asignatura
son por s mismas atractivas, se debe insistir en iniciar
los contenidos a partir de su experiencia personal
(vivencias) o de su percepcin (observacin, escucha
o manipulacin). Un ambiente de confianza propiciar
que el alumnado se exprese, explore y comparta desde
el inicio. Previamente al desarrollo de contenidos que
impliquen expresin oral, as como canto, el docente
orientar a nios y nias en la respiracin diafragmtica
con el fin de facilitar la proyeccin de la voz sin perjuicio
de sus cuerdas vocales.
2. Actividades de desarrollo
La comprensin del hecho artstico inicia con la
exploracin y la manipulacin de recursos y tcnicas.
El contacto de las y los alumnos con la produccin
artstica debe permitir que opinen con libertad desde
su experiencia, que se hagan preguntas y generen sus
propias conjeturas o hiptesis. La manipulacin de
instrumentos para la expresin plstica, la ejecucin de
instrumentos musicales o la experimentacin con la voz
y el cuerpo deben llevar al nio o a la nia a descubrir
sus posibilidades expresivas. Como consecuencia de
esta experiencia sensorial, los nios y las nias pueden
tomar conciencia y expresar su propia apreciacin
artstica. As, debern abrir espacios para explicar los
detalles que les llamaron la atencin en un texto literario,
lo que ms les gust de una cancin, las emociones
que experimentaron al bailar, lo que comprendieron al
escuchar o ver una representacin, etc. Las actividades
debern combinar organizacin grupal e individual y
en el caso de la educacin musical, la banda rtmica y
el coro del aula son recurso obligado para aplicar los
conocimientos aprendidos en clase.
El uso del musicograma resulta atractivo para los nios
porque brinda la ilusin de aprehender la msica
dibujndola en un papel, adems de captar su atencin
durante una audicin. Optimiza resultados en las
audiciones comprensivas ya que en un musicograma
se puede plasmar la forma de una pieza musical (por
ejemplo, representando con cuadros de colores cada una
de sus partes); tambin se pueden dibujar los instrumentos
que se escuchan o los personajes a que alude el texto
de una cancin. Es un recurso de gran versatilidad y se
implementa con materiales de uso comn en el aula,
La aproximacin a las producciones plsticas se
puede realizar a partir de la lectura de un texto literario
relacionado con el contenido de la obra, propiciando el
dilogo sobre estas relaciones y otras que ataen a los
diferentes contextos incluyendo los personales. Tambin
se puede partir de la lectura de la propia obra plstica,
sobre todo en aquellas de carcter figurativo en donde
la narrativa de la obra es clara. En cuanto a las obras
abstractas su lectura se basa en la observacin del
gesto, las gamas cromticas, el lenguaje expresivo de
los elementos visuales (trazo, mancha, textura, etc.) y lo
que sugieren junto al ttulo de la obra de manera ms
abierta a la interpretacin personal. Otras actividades
relacionadas pueden ser:
Carteles vivos y textos ambientales ilustrados en
equipos usando elementos visuales para que refuercen
191
Programa de estudio de cuarto grado
su manejo de los mismos y el sentido de la imagen como
medio expresivo.
Crculo de valoracin de las obras artsticas con relacin
a los contextos culturales, histricos, geogrficos, etc.
en los cuales se inserta la temtica tratada y el tipo de
imagen que se discute de acuerdo a su funcionalidad
en contexto. Esto es particularmente propicio para la
interpretacin de las imgenes que ilustran un cuento
abordando el manejo de los elementos visuales, as como
el significado de las ilustraciones con relacin al texto.
Las ilustraciones producidas en este tipo de sesiones
pueden ser secuencias complementarias al cuento que
se ha ledo en clase variaciones del desenlace de la
misma historia.
Visitas a salas de muestra de artes visuales como el
Museo Nacional de Antropologa David J. Guzmn; la
Sala Nacional de exposiciones del Parque Cuscatln; el
Museo de Arte de El Salvador, MARTE. Tambin a talleres
artesanales y estudios de artistas locales.
Demostracin de las diferentes tcnicas de parte
del docente.
Cada actividad tendr sus particularidades en el uso del
espacio, el manejo del tiempo o los recursos, de acuerdo
con el rea en que se enfatice: msica, plstica o artes
escnicas. Sin embargo, se propone plantear actividades
que las integren.
3. Actividades de culminacin
En este momento, se deber reforzar las tcnicas
empleadas por medio de conclusiones, confirmacin
de conceptos y procedimientos, y la organizacin de
exposiciones para que los y las estudiantes compartan
los resultados y conozcan la opinin e interpretacin
de los dems. Siempre y cuando sea posible, se debe
contar con la participacin de la familia y la comunidad
educativa. Al final de aquellas actividades artsticas que
resulten en la alteracin del orden habitual y aseo del aula
o de la escuela, el docente promover la participacin de
nios y nias en la limpieza y organizacin del espacio
escolar, as como en el mantenimiento de sus
instrumentos de trabajo.
Lineamientos de evaluacin
La evaluacin inicial o diagnstica
Los Fundamentos Curriculares de la Educacin Bsica
recomiendan realizar un diagnstico previo que permita
determinar las condiciones psicopedaggicas de los
educandos en relacin con sus necesidades e intereses;
adems se podr descubrir el potencial de recursos que
el medio natural, social y cultural ofrece para determinar el
nivel real de conocimiento y desarrollo de habilidades
(pg. 61).
Algunos nios y nias presentarn mayor espontaneidad
para cantar, bailar o recitar; otros y otras estudiantes
tendrn mayor disposicin a las artes plsticas como el
dibujo, el modelado, etc. Es importante conocer las aptitudes
de los nios y las nias para potenciarlas adecuadamente,
respetando las diferencias individuales.
Con la informacin oportuna se podr tomar decisiones
pertinentes para brindar ptimas condiciones de
aprendizajes a los nios y a las nias, atendiendo sus
particularidades.
La evaluacin del proceso o formativa
La observacin del trabajo de las y los alumnos es muy
importante en todos los tipos de evaluacin. No es suficiente
observar los productos finalizados, porque pueden haber
sido elaborados por familiares de los nios y las nias,
lo que afecta la valoracin del trabajo y la intencin
de la evaluacin. Al observar cmo trabajan los y las
estudiantes se puede detectar sus errores o las omisiones
192
Programa de estudio de cuarto grado
y reforzar oportunamente los procedimientos que se estn
aprendiendo. Asimismo valorar si realiza su trabajo sin
ayuda, con ayuda o an no la hace.
La evaluacin final o sumativa
Para asignar calificaciones, el o la maestra debe tener claro
los criterios con los que juzgar o valorar los desempeos
descritos en los indicadores de logro y con qu actividades
de evaluacin los pondrn en evidencia.
Para ello, el o la docente deber elaborar una lista de cotejo
o escala de valoracin, de acuerdo con la tcnica o la
actividad que se realice. Por ejemplo, al evaluar la ejecucin
musical en la banda rtmica se deben considerar aspectos
bsicos del desempeo y ciertas actitudes esperadas
durante la actuacin del alumnado.
Rbrica para evaluar la ejecucin con banda rtmica (30%)
Instrumentos como este se emplean para evaluar diferentes
procedimientos como la participacin en una obra escnica,
el canto, el baile, etc. Asimismo, orientan la autoevaluacin
y co-evaluacin, de manera que los nios y las nias tomen
conciencia de sus avances y adquieran mayor autonoma y
responsabilidad.
Para estructurarlos, el o la docente puede orientarse a partir de
los indicadores de logro del programa de estudio.
Los criterios de evaluacin deben responder al enfoque de
la asignatura y a sus competencias. Pueden ser variados, de
acuerdo con la naturaleza de cada actividad y al bloque de
contenido que prevalezca, por ejemplo:
Escucha atenta de la cancin (para el caso de la msica).
Seguimiento del procedimiento (para el caso de la plstica).
Creatividad en el uso de colores, materiales o formas
(depender de la actividad).
Esmero en finalizar su tarea.
Responsabilidad y precaucin con el uso de ciertos
materiales.
Orden y aseo del lugar donde trabaja.
Iniciativa y autonoma al improvisar en una actuacin o
seleccionar una tcnica.
Colaboracin y respeto por el trabajo de otros y otras
compaeras.
Espontaneidad al cantar o bailar.
Respeto por el patrimonio cultural.
Es importante dar a conocer al alumnado, de forma clara y
sencilla, los criterios de evaluacin y los desempeos esperados
en los indicadores de logro. As podrn autoevaluarse de manera
responsable.
Criterios Dominio bajo Dominio medio Dominio alto
Ejecucin exacta del
comps, las figuras
y dems aspectos
rtmicos (10%).
Ejecuta de acuerdo a
un aspecto: comps o
figura rtmica.
Ejecuta de acuerdo
al comps y al
instrumento.
Ejecuta de acuerdo al
comps, el instrumento
y otros aspectos rtmicos
que aparezcan en la
pieza musical como
acentos, puntillos y
poliritmias.
In Inst stru rume ment ntos os ccoo
Autoevaluacin (6%). Autodisciplina en los ensayos.
ommoo es este te s see em empl plea eann pa para ra eeva valu om om
Entusiasmo en la participacin del conjunto.
(escala del 1al 3)
uuar ar ddif ifer eren ente tess aalu lu
(escala del 1al 3)
Ejecucin del
instrumento de manera
apropiada (5%).
Ejecuta el instrumento
pero no logra las notas
ni las figuras requeridas.
Ejecuta el instrumento
de acuerdo a las notas
requeridas.
Ejecuta el instrumento
de acuerdo a las notas
y figuras requeridas.
Cuidado y
mantenimiento del
instrumento que
ejecuta (5%).
Sigue parcialmente
las indicaciones para
cuidar el instrumento
que ejecuta.
Sigue indicaciones con
diligencia para cuidar
el instrumento que
ejecuta.
Realiza de forma
autnoma medidas
de cuidado y
mantenimiento del
instrumento que
ejecuta.
Coevaluacin (4%). Colabora y respeta a los dems en la
prctica colectiva.
(escala del 1al 4)
Programa de estudio de cuarto grado
193
1.1 Explica y ejercita con dominio
e inters la mecnica de la
respiracin diafragmtica
dosificando el aire al sacarlo
en forma de sonido.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
UNIDAD 1
LA EXPRESIN ARTSTICA Y
NUESTRO ENTORNO
Tiempo probable: 45 horas clase
Objetivos
Desarrollar la expresin musical utilizando figuras rtmicas variadas, la escala de Do mayor
y los parmetros de tiempo y registro introduciendo la respiracin diafragmtica en funcin
del canto; para entonar canciones usando figuras rtmicas conocidas con agrado e inters.
Explorar con iniciativa y entusiasmo sus posibilidades expresivas al observar y ejecutar
danzas tradicionales valorando su importancia artstica y cultural para mejorar su expresin
corporal al seguir ritmos y direcciones en forma acertada.
Explorar con inters y entusiasmo sus posibilidades plstico expresivas por medio del dibujo,
la pintura y el collage, inspirndose en obras artsticas, el entorno natural, rural y grfico
para comunicar sus ideas y su percepcin del entorno con creatividad y autonoma.
D ll l i i l tili d fi t i i d l l d D
La respiracin
diafragmtica al hablar.
Descubrimiento y
ejercitacin de la
mecnica de la respiracin
diafragmtica: aspiracin
y espiracin con sonido
de vocales.
Inters y concentracin al
practicar la respiracin.
1.2 Comenta con espontaneidad lo
que le sugieren las pinturas y las
caractersticas particulares que
observa en ellas.
1.3 Identifica y aprecia los
elementos visuales y
composicin observados
en pinturas de autores con
estilos diversos.
Elementos visuales de
composicin y la pintura:
punto, lnea (como trazo),
color, textura, figura-
forma, volumen y plano.
Observacin y comentario
de pinturas de artistas
con estilos diversos para
identificar los elementos
visuales bsicos y su
composicin.
Espontaneidad al
comentar los elementos
visuales y la composicin
de las obras.
Apreciacin de las
caractersticas y la
utilidad de los elementos
visuales en la pintura
para conformar una
composicin.
Programa de estudio de cuarto grado
194
1.4 Utiliza creativamente
elementos visuales al expresar
un mensaje o su percepcin de
un ambiente.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Expresin de mensajes
o de la percepcin del
ambiente utilizando
elementos visuales.
Creatividad al utilizar
elementos visuales.
1.8 Aprecia y comenta
con espontaneidad las
combinaciones cromticas
pticas caractersticas y
particulares de la tcnica
del puntillismo en las obras
observadas.
Las combinaciones
cromticas pticas en la
tcnica del puntillismo.
Observacin y comentario
de las combinaciones
cromticas pticas y
dems caractersticas
particulares en los cuadros
de pintores reconocidos
que utilizaron la tcnica
del puntillismo.
1
Espontaneidad al
comentar la apreciacin
personal de obras
pictricas realizadas con
la tcnica del puntillismo.
1.7 Relaja sus msculos al
realizar los ejercicios
corporales y manifiesta
confianza en el grupo.
L b
Ejercicios corporales
para generar confianza
de grupo.
Ob i t i
Experimentacin en grupos
pequeos, de ejercicios
corporales que generen
confianza de grupo.
E t id d l
1. Manifestacin de bienestar
y confianza con el grupo
durante la realizacin
de los ejercicios.
1.5 Identifica y clasifica con acierto
y esmero el tiempo (rpido
o lento) y el registro (agudo
o grave) de la msica que
escucha.
1.6 Identifica con iniciativa los
instrumentos musicales utilizados
para caracterizar personajes de
pelcula y dibujos animados.
Los elementos musicales:
tiempo (rpido-lento) y
registro (agudo o grave).

Los instrumentos
musicales usados en
la caracterizacin de
personajes de pelcula y
dibujos animados.
Caracterizacin de
los elementos musicales
tiempo (rpido-lento)
y registro (agudo-grave)
de la msica utilizados
en pelculas o
dibujos animados.
Identificacin de
instrumentos musicales
utilizados para caracterizar
personajes en pelculas.
Esmero en la clasificacin
de elementos musicales
y sus calidades: rpido-
lento, agudo-grave e
instrumentos musicales.
Iniciativa en la
identificacin de elementos
musicales que caracterizan
personajes.
Programa de estudio de cuarto grado
195
Creacin de
combinaciones cromticas
pticas para representar
formas vegetales utilizando
la tcnica del puntillismo.
Disfrute al representar
formas vegetales utilizando
la tcnica del puntillismo.
1.9 Representa formas vegetales
al crear combinaciones
cromticas pticas utilizando
la tcnica del puntillismo
valorando la utilidad del
punto para describir formas.
1 9 R f l
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
1.10 Escribe con esmero y
limpieza figuras de blanca,
negra, grupos de 2 corcheas
y de 4 semicorcheas.
1.11 Ejecuta con exactitud e
inters las figuras rtmicas
aisladas y en secuencias
con el cuerpo y con la
banda rtmica.
Figuras rtmicas:
blanca, negra, grupos
de dos corcheas y
cuatro semicorcheas.
Escritura de figuras de
blanca, de negra, grupos
de dos corcheas y de
cuatro semicorcheas.
Ejecucin de
figuras aisladas y
en secuencias con
percusiones corporales.
Ejecucin de las figuras
rtmicas con banda
rtmica para acompaar
canciones salvadoreas
y latinoamericanas.
1
1
Esmero en la escritura
musical de figuras de
blanca, de negra, grupos
de dos corcheas y de
cuatro semicorcheas.
Atencin en la ejecucin
de las figuras rtmicas.

Inters en la coordinacin
de la banda rtmica.
1.12 Describe y ejemplifica
activamente y con acierto las
caractersticas del sonido altura,
duracin, intensidad y timbre.
1.13 Identifica y clasifica con
exactitud y esmero las
caractersticas de los sonidos del
entorno escolar segn su altura,
duracin, intensidad y timbre.
Caractersticas del
sonido: altura, duracin,
intensidad, timbre y
su presencia en el
entorno escolar.
Descripcin y
ejemplificacin de
caractersticas del
sonido: altura, duracin,
intensidad y timbre.
Clasificacin de los
sonidos de acuerdo
a la fuente sonora,
altura, duracin,
intensidad y timbre.
Participacin activa
en la descripcin de
caractersticas del
sonido: altura, duracin,
intensidad y timbre.
Atencin y esmero en el
ejercicio de percepcin y
clasificacin de sonidos
del entorno escolar.
Esmero en la clasificacin
de alturas, duraciones e
intensidades de sonidos
del entorno escolar.
Programa de estudio de cuarto grado
196
Caractersticas de las
obras creadas con
texturas reales.
Observacin y comentario
de pinturas en donde se
enfatiza el uso de texturas.

Realizacin de un collage
con materiales de texturas
diferentes para representar
una escena rural.
Espontaneidad
al comentar las
caractersticas de las
pinturas observadas.
Creatividad y agrado al
realizar un collage de una
escena rural con texturas
reales.
1.14 Comenta con espontaneidad
lo que le sugieren las
caractersticas particulares de las
obras realizadas con texturas.
1.15 Realiza con creatividad y
agrado un collage de texturas
reales para representar una
escena rural.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
1.16 Representa diferentes tipos
de follaje utilizando texturas
visuales con agrado y
creatividad.
Tcnicas para obtener
texturas visuales.
Realizacin de una
escena forestal utilizando
diferentes tcnicas para
obtener texturas visuales
que representen distintos
tipos de follajes.
Disfrute y creatividad
por representar distintos
tipos de follaje utilizando
texturas visuales.
1.17 Domina y controla su cuerpo
al realizar movimientos y
desplazamientos al seguir ritmos
y direcciones en forma acertada.
1.18 Sigue ritmos y direcciones
en forma acertada con
espontaneidad y agrado.
Desplazamiento y control
del movimiento a partir de
ritmos variados.
Exploracin y
perfeccionamiento
de diferentes
desplazamientos con
variados ritmos y
direcciones.
1.
1
Disposicin para explorar
diferentes ritmos,
direcciones y formas de
desplazamiento.
Espontaneidad y agrado
al seguir ritmos con
diferentes desplazamientos.
1.19 Comenta con espontaneidad
la realidad y la fantasa que
interpreta al observar
personajes de tiras cmicas.
1.20 Crea un personaje de
tira cmica utilizando lneas
de diferente grosor y color
manifestando disfrute
e iniciativa.
El trazo, grosor y color
de la lnea y el movimiento
en el dibujo de una
tira cmica.
Observacin y comentario
sobre la realidad y
fantasa en los rasgos de
los personajes de una
tira cmica.
Creacin de un personaje
de tira cmica utilizando
lneas de diferente grosor
y color.
1
Espontaneidad al
comentar la realidad y
fantasa en los personajes
de una tira cmica.
Disfrute e iniciativa en
la creacin de un
personaje original de
una tira cmica.
Programa de estudio de cuarto grado
197
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
1.25 Realiza con esmero los
ejercicios de respiracin
diafragmtica y de vocalizacin
sobre notas de la escala de Do
mayor usando vocales abiertas.
1.26 Aplica la respiracin
diafragmtica en el canto
de canciones salvadoreas y
latinoamericanas, con inters
y agrado.
Aplicacin de la
respiracin diafragmtica
en la vocalizacin y
el canto.
Realizacin de
ejercicios de respiracin
diafragmtica y de
vocalizacin sobre la
escala de Do mayor con
vocales abiertas.
Aplicacin de la
respiracin diafragmtica
en el canto de canciones
salvadoreas y
latinoamericanas.
1
Atencin y esmero en la
realizacin de ejercicios de
respiracin diafragmtica
y vocalizacin sobre la
escala de Do mayor con
vocales abiertas.
Inters y agrado en el canto
de canciones salvadoreas
y latinoamericanas
haciendo uso de la
respiracin diafragmtica.
1.21 Escribe la escala de Do mayor
con limpieza cumpliendo las
reglas de la caligrafa musical.
1.22 Escribe la escala de Do mayor
con limpieza cumpliendo las
reglas de la caligrafa musical.

1.23 Ejecuta con exactitud las notas
de la escala de Do mayor con
flauta dulce usando figuras
rtmicas conocidas y silencio
de negra.
1.24 Entona con esmero la escala
de Do mayor con las notas y
frases de diversos contenidos.
Grafa y sonoridad de la
escala de Do mayor.
Escritura en pentagrama
de la escala de Do mayor
cumpliendo las reglas de
la caligrafa musical.


Ejecucin en flauta dulce
de la escala de Do mayor
usando figuras rtmicas
conocidas y silencio
de negra.

Entonacin de la escala
de Do mayor con los
nombres de las notas
y con frases de contenido
diverso
1
1
1
1
Esmero en la escritura de
la escala de Do mayor en
el pentagrama.
Esmero en la escritura de
la escala de Do mayor en
el pentagrama.
Participacin activa en la
ejecucin de flauta dulce
de la escala de Do mayor
usando figuras rtmicas
conocidas y silencio
de negra.
Esmero y creatividad en
la entonacin de la escala
de Do mayor y la
aplicacin de frases.
Programa de estudio de cuarto grado
198
INDICADORES DE LOGRO CONTENIDOS
1.30 Observa y describe con atencin
e iniciativa el contenido y los
elementos del la danza del
Torito pinto.
1.31 Investiga y opina con iniciativa
sobre el valor cultural del Torito
pinto y la procedencia de los
bailes taurinos.
1.32 Ejecuta con exactitud e
inters el tema musical del
Torito pinto en flauta dulce
y con acompaamiento de
banda rtmica.
El Torito pinto: tradicin de
msica y danza.
Observacin de la
danza del Torito pinto
y descripcin de su
contenido y de sus
elementos musicales
y escnicos.
Investigacin de la
procedencia de los bailes
taurinos y del valor cultural
de esta tradicin.
Ejecucin del tema musical
del Torito pinto en Do
mayor en la flauta dulce
con acompaamiento de
banda rtmica.
Atencin e iniciativa en
la observacin del Torito
pinto y en la descripcin
del contenido y de los
elementos musicales
y escnicos.
Responsabilidad en
la investigacin de la
procedencia y del valor
cultural del baile del
Torito pinto.
Inters en la ejecucin
del tema del Torito
pinto con flauta dulce
y acompaamiento de
banda rtmica.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
1.29 Representa con dramatizaciones
los juegos populares que
investiga y explica con claridad
sus reglas.
El juego dramtico y
la prctica de juegos
populares.
Investigacin sobre juegos
populares que se practican
en su comunidad para
representarlos frente a
la clase.
Atencin, valoracin
y respeto hacia la
prctica de los juegos
populares investigados.
1.27 Imita con claridad, gestos
y movimientos de personas
y animales observados
manifestando respeto y disciplina.
1.28 Utiliza sus recursos corporales
para realizar imitaciones con
respeto y creatividad.
Imitacin de gestos. Imitacin de gestos,
posturas y desplazamientos
de personas y animales,
despus de haberlos
observado en un recorrido
por su comunidad.
1
1
Demostracin de respeto
y disciplina durante la
actividad fuera del aula.
Realizacin de imitaciones
con respeto y creatividad.
Programa de estudio de cuarto grado
199
1.33 Dibuja con agrado objetos de
la naturaleza utilizando en
forma correcta la tcnica del
contorno ciego.
INDICADORES DE LOGRO CONTENIDOS
1.34 Dibuja con inters y creatividad
una escena urbana utilizando
lneas de fuga aproximadas y
la cuadrcula.
1.35 Ubica figuras dentro de
la escena en tres planos:
cerca, lejos e intermedio,
conservando el tamao
relativo de las figuras.
Planos de profundidad:
cerca, intermedio y
lejos, y el uso de las
lneas de fuga.
Utilizacin de la
cuadrcula, las lneas
de fuga e imgenes de
referencia visual para
ampliar y reducir las
figuras en una escena y
ubicarlas en tres planos
de profundidad: cerca,
intermedio y lejos.
1.
1.3
Inters y creatividad al
desarrollar el entorno de
una escena inspirndose
en las imgenes de
referencia visual y
utilizando diferentes planos
de profundidad.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
1.36 Escribe con orden y
responsabilidad un resumen
sobre las caractersticas
generales de un musicograma
y la forma binaria, a partir de
una consulta bibliogrfica.
1.37 Escucha e identifica con
atencin El Carbonero de
Pancho Lara y su forma
binaria A-B
1.38 Identifica con acuciosidad y
autonoma las partes de la
forma binaria A-B al escuchar
El Carbonero y lee su
meloda en un musicograma.
Estructura de la forma
binaria A-B en la cancin
El Carbonero de Pancho
Lara en un musicograma.
Consulta bibliogrfica de
las caractersticas generales
de un musicograma y de la
forma binaria A-B.
Audicin comprensiva de
la cancin El Carbonero
de Pancho Lara para
identificar su forma binaria.
Realizacin de
musicograma
representando las partes
de la forma binaria A-B de
la msica y el texto de la
cancin El Carbonero.
1
1
1.
Orden y responsabilidad al
investigar las caractersticas
de un musicograma.
Inters en la audicin y la
identificacin de la forma
binaria de El Carbonero de
Pancho Lara.
Acuciosidad y autonoma
en la representacin de las
partes de la forma binaria
A-B de El Carbonero en
un musicograma.
l d f d d d
La tcnica del
contorno ciego.
l d l
Utilizacin de la tcnica
del contorno ciego
para dibujar plantas,
combinando lpiz de color,
yeso graso y rotuladores.
d d l
Disfrute al realizar
un dibujo utilizando
la tcnica del
contorno ciego.
200
Programa de estudio de cuarto grado
EL ARTE EN EL TIEMPO
Tiempo probable: 39 horas clase
Objetivos
Identificar y valorar manifestaciones del patrimonio inmaterial de msica y danza propiciando
su recreacin y la construccin de instrumentos musicales explorando diversas percusiones para
favorecer su identidad cultural y gusto musical.
Expresar en forma individual y en equipo experiencias de su entorno escolar y de su comunidad, a
travs de la observacin y audicin de situaciones y eventos, con el objeto de reconocer su entorno
cultural y de enriquecer su forma de comunicacin sensorial y dramtica.
Interpretar y recrear expresiones artsticas del pasado, utilizando como medio de inspiracin
para la expresin plstica el arte popular tradicional, el arte prehispnico y obras de arte
salvadoreo y universal, para ampliar su repertorio de posibilidades expresivas visuales y valorar
el patrimonio cultural.
2.1 Identifica con inters y acierto
el significado, los elementos
musicales y escnicos en
tradiciones de msica y danza
salvadorea.
2.2 Aplica con inters el concepto
de patrimonio inmaterial a
tradiciones de msica y danza
a partir de la investigacin y
comprensin de su significado.
2.3 Propone con iniciativa
acciones individuales e
institucionales para la
preservacin del patrimonio
inmaterial de msica y danza
en su localidad y en el pas
Patrimonio inmaterial
de msica y danza de El
Salvador.
Observacin de
tradiciones salvadoreas
de msica y danza para
identificar significado,
elementos musicales y
escnicos.
Realizacin de consulta
bibliogrfica sobre
concepto de patrimonio
inmaterial y aplicacin a
las tradiciones estudiadas.
Preservacin del patrimonio
inmaterial de msica y
danza en su localidad y en
el pas.
2.
2.
2.3
Inters en la identificacin
del significado y de
elementos musicales y
escnicos en tradiciones
salvadoreas.
Inters por el patrimonio
inmaterial.


Responsabilidad e iniciativa
en la propuesta de acciones
individuales e institucionales
para preservar el patrimonio
inmaterial de msica y danza
en su localidad y en el pas.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
UNIDAD 2
Id ifi l if i d l i i i i l d i d i i d
Programa de estudio de cuarto grado
201
La figura humana, de
plantas y de animales en la
cermica prehispnica.
Observacin y comentario
sobre la figura humana,
de plantas y animales en
la cermica prehispnica
y su relacin con las
culturas que las crearon.
Realizacin de dibujos de
las figuras prehispnicas
a partir de los ejemplos.
Modelado de figuras
humanas, de plantas
y animales originales
inspiradas en la
cermica prehispnica.
Apreciacin de las
caractersticas de las
figuras en la cermica
prehispnica y de las
culturas que las crearon.
Dedicacin y esmero en el
dibujo de los detalles de
las figuras prehispnicas.
Valoracin de la cermica
prehispnica.
2.4 Comenta y aprecia las
caractersticas particulares
de las figuras en la cermica
prehispnica y las relaciona con
las culturas que las crearon.
2.5 Realiza dibujos detallados de
las figuras prehispnicas con
dedicacin y esmero.
2.6 Modela figuras humanas,
vegetales y animales
inspirndose en las figuras
de la cermica prehispnica.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
2.7 Escribe con aplicacin e
inters figuras rtmicas con
valores correspondientes al
comps 4/4.
2.8 Escucha y reconoce con
atencin y acierto la aplicacin
del comps de 4/4 en piezas de
msica clsica y popular.
2.9 Ejecuta con exactitud el
acompaamiento con acento
en el primer tiempo del comps
4/4 con la banda rtmica.
Estructura del comps de
4/4.
Escritura de figuras
rtmicas con valores
correspondientes al
comps 4/4.
Reconocimiento del
comps 4/4 en piezas de
msica clsica y popular.
Ejecucin de
acompaamiento con
banda rtmica de msica
clsica y popular con
acento en el primer tiempo
del comps 4/4.
2
2
2
Concentracin e inters en
la audicin comprensiva
y aplicacin del comps
4/4 en piezas de msica
clsica y popular.
Diligencia en el
acompaamiento de
msica clsica y popular
con la banda rtmica.
Programa de estudio de cuarto grado
202
2.10 Seala y comenta detalles
de puertas y ventanas en
casas antiguas y actuales
manifestando atencin e inters
en sus elementos.
2.11 Dibuja casas trazando detalles
de sus puertas y ventanas
con regla, escuadras y
comps utilizando lneas
perpendiculares y paralelas
con esmero y creatividad.
2.12 Finaliza dibujos de casas
evitando trazos inexactos
y apresurados y demostrando
inters por realizar un dibujo
limpio y preciso de puertas
y ventanas.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Lneas paralelas,
perpendiculares y arcos
en elementos
arquitectnicos.
Identificacin de tipos de
lneas y arcos en puertas y
ventanas de casas
antiguas y actuales.
Dibujo de casas y trazo
de puertas y ventanas
con lneas paralelas,
perpendiculares y arcos
tangentes, utilizando,
regla, escuadras
y comps.
2
2
2
Atencin en los detalles al
identificar los elementos
de las puertas y ventanas
en las imgenes
observadas.
Inters por realizar un
dibujo limpio y preciso de
puertas y ventanas.
2.13 Escucha e identifica el ritmo
de msica popular afrolatina
aplicando el concepto poliritmia
con inters y agrado.
2.14 Crea con originalidad
una lnea rtmica para
la poliritmia aplicando
el comps de 4/4 con
asertividad y esmero.
2.15 Ejecuta con exactitud una parte
asignada de la poliritmia con la
banda rtmica.
La poliritmia. Aplicacin del concepto
poliritmia para identificarla
en el ritmo de msica
popular afrolatina.
Creacin colectiva de una
poliritmia aplicando el
comps 4/4 y las figuras
rtmicas conocidas.

Ejecucin de la poliritmia
creada en clase con la
banda rtmica.
2
2
2
Atencin e inters en la
audicin de poliritmias de
la msica afrolatina.
Asertividad y esmero para
aplicar el comps de
4/4 y las figuras rtmicas
conocidas en la creacin
de una lnea para la
poliritmia.
Cuidado para ejecutar
con exactitud su parte
de la poliritmia con la
banda ritmica.
Programa de estudio de cuarto grado
203
2.16 Prepara colores secundarios
puros a partir del rojo magenta,
cian y amarillo manifestando
disfrute e inters.
2.17 Decora objetos pintando puntos
y lneas con colores secundarios
puros y diferentes patrones de
repeticin respondiendo a la
audicin de diferentes ritmos
musicales.
2.18 Cuida y utiliza de forma
adecuada los instrumentos y
organiza su espacio de trabajo.
Creacin de ritmos
visuales con lneas
y puntos de colores
secundarios puros.
Preparacin de colores
secundarios puros a
partir de la combinacin
de pintura color rojo
magenta, cian y amarillo.
Decoracin de objetos
pintando con colores
secundarios puros,
lneas, puntos y utilizando
patrones de repeticin
a partir de diferentes
ritmos musicales.
Cuido en la utilizacin
de los instrumentos y
organizacin en su espacio
de trabajo.
Disfrute e inters
en preparar colores
secundarios puros a
partir del rojo magenta,
cian y amarillo para
decorar objetos.
Disfrute al decorar
objetos utilizando
colores secundarios
puros y diferentes
patrones de repeticin
de puntos y lneas.

Orden y aseo en su
espacio de trabajo.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
2.19 Coordina sus movimientos
con los de los dems para
imitar en forma colectiva el
funcionamiento de una
mquina o la movilidad de
una criatura imaginaria: subir,
bajar, avanzar y retroceder.
2.20 Encuentra y ejecuta
posibilidades de movimiento
complementario como parte
de un grupo, manifestando
respeto y consideracin por
los dems.
El movimiento corporal
complementario y las
creaciones en equipo.
Realizacin de
movimientos en
coordinacin con
otros compaeros y
compaeras para simular
el funcionamiento de una
mquina o la movilidad
de una criatura
imaginaria: avanzar,
retroceder, subir,
bajar, etc.
2
Adaptacin corporal
espontnea para
responder a las
propuestas de los dems.
Programa de estudio de cuarto grado
204
2.21 Observa y deduce con inters el
proceso para construir un palo
de lluvia.
2.22 Participa con asertividad en
el crculo de opinin y en la
definicin de relacin del palo
de lluvia y de otros instrumentos
antiguos relacionados con la
naturaleza.
2.23 Participa con empeo en la
construccin colectiva de un
palo de lluvia y respeta los
pasos del proceso.
2.24 Ejecuta ritmos con aplicacin
en el palo de lluvia y otras
percusiones de la banda
rtmica para acompaar
canciones salvadoreas y
latinoamericanas valorando
la importancia de los
instrumentos antiguos.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Caracterstica y proceso
constructivo de un palo
de lluvia.
Observacin de la forma
de un palo de lluvia
para identificar posibles
formas de construccin y
definicin de sus formas.
Realizacin de crculo de
opinin para definir la
relacin del palo de lluvia
y de otros instrumentos
antiguos con la naturaleza.
Construccin colectiva
de un palo de lluvia
de acuerdo al proceso
definido colectivamente.
Incorporacin y ejecucin
del palo de lluvia y otras
percusiones en la banda
rtmica para acompaar
canciones salvadoreas
y latinoamericanas.
2
2
2
2.
Concentracin y
en la observacin
del instrumento e
identificacin de los
pasos para construirlo.
Asertividad en el crculo
de opinin para definir la
relacin del palo de lluvia
y de otros instrumentos
antiguos con la naturaleza.
Compromiso y empeo en
el proceso de construccin
de un palo de lluvia
de acuerdo al proceso
definido colectivamente.
Valoracin de los
instrumentos antiguos.
2.25 Expresa con entusiasmo
detalles y pormenores al
describir su experiencia visual
y auditiva del entorno.
Exploracin sensorial:
vista y audicin.
Observacin, audicin e
identificacin de formas y
colores y discriminacin de
sonidos del entorno.
2 Socializacin amena de
sus experiencias auditivas
y visuales.
2.26 Comenta las caractersticas
de gallardetes y banderitas de
papel picado, en su localidad
y en otros pases e identifica su
relacin con las festividades en
las que se utiliza.
La tcnica del papel
picado en El Salvador.
Observacin y comentario
sobre ejemplos de
gallardetes y banderitas de
papel picado, su uso local
y en otros pases.
Espontaneidad e inters
por comentar las
caractersticas del
papel picado local y
de otros pases.
Programa de estudio de cuarto grado
205
2.26 Crea con originalidad
gallardetes y banderitas con
la tcnica del papel picado
utilizando motivos alusivos a
una festividad especfica.
2 26 Crea con originalidad
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Elaboracin de gallardetes
y banderitas alusivos a una
festividad para decorar el
grado un espacio escolar.
2
Colaboracin con su grupo
de clase y originalidad al
crear y realizar gallardetes
con la tcnica de papel
picado y decorar un espacio
escolar.
2.27 Imita con inters y
expontaneidad diferentes
animales tomando en cuenta
sus formas de comunicarse y
movimientos corporales.
Imitacin oral y corporal
de animales.
Imitacin caracterizada
de animales grandes y
pequeos, tomando en
cuenta formas del cuerpo y
caractersticas de sus sonidos.
2 Inters en los animales y
su forma de comunicarse.
2.28 Identifica con inters y acierto
las percusiones membranfonas
e idifonas en una Banda
de Paz.
2.29 Reconoce el timbre de
percusiones membranfonas
e idifonas en audiciones
musicales manifestando
iniciativa.
Percusiones
membranfonas e
idifonas en una Banda
de Paz.
Identificacin de
las percusiones
membranfonas e idifonas
en una Banda de Paz.
Reconocimiento del
timbre de percusiones
membranfonas e
idifonas en audiciones
musicales.
2
2
Inters en la identificacin
de los tipos de percusin
membranfonas e idifonas
en una Banda de Paz.
Iniciativa en el
reconocimiento del
timbre de percusiones
membranfonas e
idifonas en audiciones
musicales.
2.30 Participa acertadamente en la
discusin y reflexin al escuchar
una leyenda o historia popular.

2.31 Acta oportunamente
adaptando su cuerpo y su
voz para representar
personajes de historias
populares o leyendas
escuchadas.
Historias populares
salvadoreas: su narracin
y su representacin.
Discusin y reflexin
sobre las acciones y
acontecimientos que
componen una historia
narrada por el docente o
persona invitada.
Interpretacin y
caracterizacin, con voz y
cuerpo, de los personajes
y acciones de una historia
escuchada.
2
2
Concentracin para seguir
la historia relatada.
Programa de estudio de cuarto grado
206
2.32 Identifica con inters la
procedencia, el significado,
y los componentes musicales
y escnicos de una danza
folclrica a partir del anlisis y
la investigacin bibliogrfica.
2.33 Ejecuta con esmero el tema
musical y la coreografa de una
danza folclrica.
2.34 Participa con ingenio y limpieza
en el proceso de elaboracin de
vestuario y coreografa para una
danza folclrica.
2.35 Participa con responsabilidad
y entusiasmo en la
presentacin de la danza en
un acto escolar.
2 32 Id f l
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Caractersticas y
componentes
de una danza
folclrica salvadorea.
Investigacin y anlisis
de una danza folclrica
salvadorea para
identificar procedencia,
significado, componentes
musicales y escnicos.
Ejecucin de la msica
con canto, flauta dulce
y acompaamiento de
banda rtmica.
Montaje de coreografa y
elaboracin de vestuario
con materiales de bajo
costo y de deshecho.

Presentacin de la danza
en un acto escolar.
2
Inters y autonoma
en la investigacin y
anlisis de una danza
folclrica salvadorea.
Responsabilidad y esmero
en la ejecucin musical,
coreogrfica y en la
elaboracin de vestuario
para el montaje del baile
en la escuela.
Ingenio y limpieza al
elaborar vestuario y
coreografa.
Responsabilidad y
entusiasmo en la
presentacin de la danza
en un acto escolar.
2.36 Sistematizacin por escrito
y con apoyos grficos de las
manifestaciones culturales de
su comunidad identificando
y valorando los personajes,
lugares y situaciones
observados.
2.37 Expresa su valoracin de
los detalles identificados en
las manifestaciones culturales
al exponer sus hallazgos en
la clase.
Manifestaciones artsticas
culturales de
la comunidad.
Reconocimiento,
sistematizacin y
valoracin de las
manifestaciones culturales
de su comunidad.
Valoracin y reflexin de
los detalles observados
en los personajes,
acciones y situaciones
durante la puesta en
comn en el aula.
2.
2.
Participacin activa en la
planeacin de la actividad.

Demostracin de respeto
hacia las personas, objetos
y lugares que intervienen a
lo largo de la actividad.
Programa de estudio de cuarto grado
207
3.1 Escucha e identifica con
atencin la aplicacin del
comps de 4/4 en el Himno
Nacional.
3.2 Menciona los datos biogrficos
ms relevantes del compositor
del Himno Nacional
Juan Aberle.
3.3 Aplica la respiracin
diafragmtica al cantar el
Himno Nacional.
3.4 Ejecuta ritmos con aplicacin
y exactitud acentuando el
primer tiempo del comps
4/4 del Himno Nacional.
CONCEPTUALES PROCEDIMENTALES
Comps 4/4 en el Himno
Nacional de El Salvador.
Audicin comprensiva
para identificar aplicacin
del comps de 4/4 en el
Himno Nacional.
Elaboracin colectiva
de resea biogrfica del
compositor del Himno
Nacional Juan Aberle.
Aplicacin de la
respiracin de diafragma
en el canto del
Himno Nacional.
Ejecucin rtmica para
acompaar la msica y el
canto del Himno Nacional
acentuando el primer
tiempo del comps 4/4.
3
3
3.
3.
Atencin en la audicin
comprensiva del
Himno Nacional.
Responsabilidad en la
elaboracin de la resea
biogrfica de Juan Aberle.
Diligencia en la aplicacin
de la respiracin de
diafragma para el canto
del Himno Nacional.
Esmero en la ejecucin
rtmica y en el canto del
Himno Nacional.
ACTITUDINALES
Objetivos
Reconocer y reproducir con inters y esmero melodas y sonidos de instrumentos musicales de tipo
meldico y armnico y parmetros de tiempo y de ritmo en compases binarios para comprender
y valorar la naturaleza rtmica del Himno Nacional y de la frmula de la cumbia y aplicarlos en
celebraciones cvicas y en la creacin de msica original.
Crear con cierta calidad esttica diferentes expresiones del arte escnico a travs de una
coreografa contempornea, un baile folclrico, la elaboracin y manejo de un ttere con el objeto
de expresar sus ideas y su capacidad creadora.
Crear con agrado y entusiasmo imgenes, carteles, tarjetas y mviles utilizando procedimientos
ordenados de manera creativa, herramientas digitales, fotografas y tipos de papel en a fin de
fortalecer sus habilidades expresivas y aprovechar los recursos tecnolgicos y tradicionales.
CULTURAS Y
TECNOLOGAS EN
EL ARTE
Tiempo probable: 36 horas clase
UNIDAD 3
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
Programa de estudio de cuarto grado
208
3.5 Identifica la saturacin visual
del entorno al explorarlo
visualmente y reflexiona sobre
sus efectos en el paisaje urbano
y rural.
3.6 Explica la importancia
de dosificar los mensajes
visuales en el entorno y
propone estrategias para
poder visualizar y disfrutar
el paisaje rural y urbano.
Saturacin visual en
el entorno.
Identificacin de la
saturacin visual del paisaje
urbano y rural por medio
de la exploracin visual
del entorno.
Comentario sobre la
saturacin visual del entorno
y la importancia de dosificar
el uso de mensajes visuales
para visualizar y disfrutar el
paisaje rural y urbano.
3.
Inters en analizar las
imgenes que muestran la
saturacin visual del paisaje.
Inters por disminuir la
saturacin visual del
entorno para visualizar y
disfrutar el paisaje rural
y urbano.
3.5 Identifica la saturacin visual
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
3.7 Explica con iniciativa y
espontaneidad la funcionalidad
de los carteles y sus elementos
al observarlos y analizarlos en
el entorno.
3.8 Selecciona un tema y elabora
una campaa escolar
demostrando actitudes
democrticas.
3.9 Colabora activamente en
el diseo de una serie de
carteles para una campaa
escolar siguiendo las fases
del proceso de diseo
incluyendo la fase
de reciclaje.
Carteles para una
campaa escolar.
Observacin y comentario
sobre diferentes
carteles para identificar
su funcionalidad y
elementos.
Seleccin de un tema
para la realizacin de
una campaa escolar
por medio del diseo
de carteles.
Diseo de una serie
de carteles para una
campaa escolar
siguiendo las fases
del proceso de diseo
(incluyendo la fase de
reciclaje al caducar la
vigencia del cartel).
3
3
3.
Iniciativa y espontaneidad
al comentar la
funcionalidad de los
carteles e identificar sus
elementos.
Participacin activa
y democrtica en la
seleccin de un tema
para la elaboracin
de carteles para una
campaa escolar.
Inters y entusiasmo en el
diseo en grupo de una
serie de carteles para una
campaa escolar.
Asertividad al seguir
las fases del proceso
de diseo para la
visualizacin y elaboracin
de una serie de carteles
para una campaa
escolar.
209
Programa de estudio de cuarto grado
3.10 Identifica y explora con
esmero las melodas y
sonidos simultneos y
acordes de los instrumentos
observados y escucharlos.

3.11 Presenta creativamente algunos
instrumentos meldicos y
armnicos a partir de una
investigacin bibliogrfica.
INDICADORES DE LOGRO CONTENIDOS
Caracterstica de
instrumentos armnicos y
meldicos.
Observacin y audicin
de instrumentos para
identificar su capacidad
de producir melodas
y sonidos simultneos
y acordes.
Realizacin de
consulta bibliogrfica
sobre caracterstica de
instrumentos armnicos
y meldicos.
3.
3
Esmero en la identificacin
y produccin de melodas
y sonidos simultneos y
acordes a los instrumentos
observados.

Inters en la consulta
bibliogrfica sobre
instrumentos armnicos
y meldicos.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
3.12 Explica las caractersticas y
usos de fotografas artsticas,
periodsticas y familiares,
clasificndolas y valorndolas
como medio de registro
y expresin.
La fotografa como medio
de registro y expresin.
Observacin y comentario
de las caractersticas de
las fotografas artsticas,
periodsticas y familiares,
el uso de la fotografa
como medio de registro
y expresin.
Valoracin de las
fotografas artsticas,
periodsticas y familiares.
3.13 Construye con inters un mvil
con fotografas, decorando sus
marcos con motivos alusivos
al tema que representa.
Mvil de fotografas. Utilizacin de un conjunto
de fotografas familiares
para la realizacin de
un mvil decorado con
motivos alusivos
al tema que registran
las fotografas.
Inters en recrear la
temtica del conjunto
de fotografas en la
decoracin del marco
y mvil.
Programa de estudio de cuarto grado
210
3.14 Utiliza creativamente su
repertorio grfico en la
decoracin de los marcos
y el mvil con fotografas
manteniendo organizado su
espacio de trabajo.
INDICADORES DE LOGRO CONTENIDOS
Enmarcado de las
fotografas con cartulina
de colores.
3 Aplicacin creativa de su
repertorio grfico en la
decoracin de los marcos
y el mvil con fotografas.
Cuidado en mantener
organizado el espacio
de trabajo.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
3.15 Diferencia con exactitud
los instrumentos acsticos y
electrnicos por su timbre.
3.16 Clasifica y describe con esmero
y orden instrumentos acsticos
y electrnicos en un cuadro o
esquema, especificando sus
diferencias y coincidencias.
3.17 Escucha con inters y opina
con autonoma sobre las
diferencias entre una pieza
clsica y una electrnica
segn los instrumentos
empleados.
Diferencias y coincidencias
entre instrumentos
musicales electrnicos
y acsticos.
Diferenciacin de
instrumentos electrnicos
y acsticos a partir de
diferencias de timbre.
Elaboracin colectiva de
tabla de clasificacin de
instrumentos musicales
acsticos y electrnicos
con descripcin de
diferencias y coincidencias
segn la forma de producir
sonido, timbre y aspecto.
Audicin de una pieza
de msica clsica con
instrumentos acsticos
y una pieza de msica
electrnica para opinar
sobre ambas segn los
instrumentos empleados.
3
3
3
Atencin e inters en
el reconocimiento de
instrumentos acsticos y
electrnicos por su timbre.
Esmero y orden en la
clasificacin y descripcin
de instrumentos, sus
diferencias y coincidencias.

Autonoma al opinar
sobre las diferencias
de la pieza clsica y la
electrnica segn los
instrumentos empleados.
3.18 Participa con precisin en la
expresin conjunta de ritmos
y sonidos siguiendo ritmos
propuestos por otros.
Posibilidades
rtmicas orales.
Reproduccin oral de
sonidos siguiendo ritmos
propuestos por otros.
3.
Disposicin y aceptacin
para reproducir propuestas
rtmicas de otros.
Programa de estudio de cuarto grado
211
3.19 Utiliza diversas tonalidades y
ritmos al realizar sus propuestas
de sonidos orales, con esmero
y claridad.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
Creacin y propuesta
de sonidos con ritmos y
tonalidades diferentes a
travs de la exploracin
oral individual.
Esmero y claridad al
realizar sus propuestas de
ritmos y sonidos.
3.20 Escribe con esmero figuras
rtmicas con valores
correspondientes al
comps 2/4.
3.21 Escucha con atencin y
reconoce y acierta en la
aplicacin del comps de
2/4 en piezas de msica
clsica y popular.
3.22 Ejecuta con exactitud el
acompaamiento con
acento en el primer tiempo
del comps 2/4 con la
banda rtmica.
Estructura del comps
de 2/4.
Escritura de figuras
rtmicas con valores
correspondientes al
comps 2/4.
Audicin comprensiva
y reconocimiento de la
aplicacin del comps
2/4 en piezas de msica
clsica y popular.
Ejecucin de
acompaamiento con
banda rtmica de msica
clsica y popular con
acento en el primer tiempo
de comps 2/4.
Concentracin en la
audicin comprensiva
para reconocer la
aplicacin del comps
2/4 en piezas de msica
clsica y popular.
Diligencia en el
acompaamiento de
msica clsica y popular
con la banda rtmica.
3.23 Reproduce con esmero los
pasos observados en una
coreografa simple que
observa en vivo o en vdeo.
Pasos de una coreografa. Observacin en vivo o en
vdeo de bailes creativos
contemporneos y
reproduccin de pasos.
Identificacin de bailes
ejecutados con calidad
esttica.
Programa de estudio de cuarto grado
212
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
3.24 Propone con iniciativa
pasos y movimientos de su
invencin para realizar una
coreografa corta a partir de
ejemplos observados.
Creacin de coreografas
cortas a partir de ejemplos
observados.
3
Demostracin de iniciativa
al proponer pasos y
movimientos nuevos.
3.25 Aplica el concepto de frmula
rtmica y explica con inters su
uso en gneros bailables que
escuchas.
3.26 Reconoce asertivamente la
frmula rtmica de la cumbia
al escucharla y comenta
crticamente su letra.
3.27 Ejecuta con exactitud la frmula
rtmica de la cumbia con la
banda rtmica.
Estructura de frmula
rtmica de la cumbia:
negra y 2 corcheas.
Aplicacin del concepto
de frmula rtmica y
explica su uso al estimular
gneros bailables.
Audicin comprensiva
de cumbias para el
reconocimiento de frmula
rtmica del bajo: negra y 2
corcheas en comps 2/4.
Ejecucin de
acompaamiento con
marcacin de la frmula
de cumbias colombianas y
salvadoreas con
banda rtmica.
Inters en la frmula
rtmica negra y dos
corches.
Criticidad al escuchar la
letra de cumbias.

Acuciosidad en la
ejecucin de la frmula
rtmica de la cumbia con
la banda rtmica.
3.28 Prepara un baile folclrico a
partir de una investigacin de su
historia, ubicacin geogrfica y
vestuario.
3.29 Ejecuta un baile folclrico
con valor esttico e histrico
frente a una audiencia
demostrando entusiasmo al
hacerlo.
Montaje y representacin
de coreografas cortas de
bailes folclricos.
Investigacin sobre la
historia, la ubicacin
geogrfica y el vestuario del
baile folclrico a representar.
Ejecucin de la
coreografa de un baile
folclrico investigado.
3
3
Participacin activa en la
investigacin relacionada
con el baile a representar.
Cooperacin durante los
ensayos para el montaje y
finalizacin del baile.
Demostracin de
entusiasmo ante una
audiencia al ejecutar el
baile seleccionado.
Programa de estudio de cuarto grado
213
3.30 Observa y comenta las
caractersticas y diferencias entre
los dibujos convencionales y los
digitales valorando el aporte de
la persona que dibuja.

3.31 Dibuja con esmero un motivo
para una tarjeta navidea
utilizando herramientas
digitales de dibujo.
INDICADORES DE LOGRO CONTENIDOS
El dibujo con medios
digitales.
Observacin y comentario
sobre las diferencias entre
imgenes digitales, no
digitales y una muestra
de tarjeta de diferentes
motivos.
Manipulacin de un
programa de dibujo digital
bsico para realizar un
motivo para una tarjeta.
3
3.
Valoracin del aporte
del ser humano en la
realizacin de dibujos
tradicionales y digitales.


Inters en aprender
los procedimientos y
herramientas del software
para la realizacin de
un motivo para una
tarjeta navidea.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
3.32 Intercambia opiniones sobre el
origen de la estrella navidea
a partir de investigacin
bibliogrfica y testimonial.
3.33 Traza y recorta con precisin y
limpieza una estrella con ncleo
poligonal para decorar una
estrella de navidad.
Una estrella de Beln de
ncleo poligonal regular.
Investigacin bibliogrfica
y testimonial sobre el
origen de la estrella
navidea.
Dibujo y recortado
de estrellas aadiendo
tringulos issceles
a los lados de un
ncleo poligonal.
3
3
Inters por conocer el
origen de las tradiciones.


Creatividad al decorar una
estrella de Beln.
Apreciacin de las
cualidades decorativas
de las estrellas.
Programa de estudio de cuarto grado
214
3.32 Termina el ttere y utiliza los
materiales propuestos.
3.33 Combina materiales y colores
al decorar su ttere
3.34 Manipula el ttere con
movimientos claros de cabeza
y brazos.
3.35 Caracteriza al ttere con
personalidad particular
durante la representacin.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
3.36 Comenta reflexivamente sobre
el hecho de cmo se modela
un objeto tridimensional a partir
de una superficie plana.
3.37 Modela con inters y agrado
figuras tridimensionales
sencillas utilizando la tcnica
de la papiroflexia.
Transicin del plano al
volumen en la papiroflexia.
Observacin de
ejemplos de figuras
realizadas con la tcnica
de la papiroflexia y
demostracin de su
elaboracin.
Realizacin de figuras
sencillas con la tcnica
de la papiroflexia a partir
del plegado de pginas
de papel.
3
3
Reflexin y comentario
sobre el hecho de cmo
se desarrollan objetos
tridimensionales a partir
de una superficie plana.
Disfrute al modelar figuras
sencillas utilizando la
tcnica de la papiroflexia.
Otras tcnicas dramticas:
el ttere.
Construccin y decoracin
de un ttere, utilizando una
bolsa de papel, un calcetn
o tela.
Manipulacin del
ttere construido en
representaciones cortas
de historias cotidianas que
desarrollen valores.
3
3
3
3
Manifestacin de respeto
hacia su propia creacin
y la de sus compaeros
Programa de estudio de cuarto grado
215
3.38 Participa con iniciativa en la
seleccin de un cuento, que se
musicalizar en la identificacin
de personajes, caractersticas y
momentos trascendentales.
3.39 Selecciona con asertividad los
elementos musicales apropiados
para caracterizar los personajes
y situaciones escogidos de
un cuento.
3.40 Crea con responsabilidad y
entusiasmo partituras y efectos
sonoros para personajes y
situaciones del cuento.
3.41 Ejecuta con diligencia las
partituras musicales y efectos
sonoros con banda rtmica,
canto y otros instrumentos.
INDICADORES DE LOGRO CONTENIDOS
Msica que ambienta
personajes y situaciones
de cuentos.
Seleccin de un cuento
e identificacin de
personajes principales,
sus caractersticas y
momentos trascendentes.
Seleccin de los elementos
musicales apropiados
para caracterizar los
personajes y situaciones
escogidos.
Creacin de una meloda
o ritmo para personajes y
situaciones principales.


Creacin de efectos
sonoros para situaciones
y personajes secundarios
del cuento.
Ejecucin de partitura
musical y efectos sonoros
con banda rtmica, canto
y otros instrumentos
durante la narracin o
dramatizacin del cuento.
3
3
3
3
Iniciativa y entusiasmo
en la seleccin de un
cuento, identificacin de
personajes principales,
caractersticas y momentos
trascendentes.
Asertividad en la seleccin
de los elementos
musicales apropiados para
caracterizar los personajes
y situaciones escogidos.
Compromiso e inters
en la creacin de las
partituras y los efectos
sonoros para personajes y
situaciones del cuento.
Diligencia en la ejecucin
de las partituras musicales
y efectos sonoros con
banda rtmica, canto y
otros instrumentos.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
216
Programa de estudio de cuarto grado
GLOSARIO
Banda rtmica: tipo de agrupacin integrada por instrumentos de percusin
de diferente tipo que se implementa en el mbito escolar para la prctica
rtmica.
Bidimensin (espacio bidimensional): espacio limitado por dos dimensiones
para la representacin de la imagen sobre el plano y la ilusin de profundidad
en dicha superficie.
Cartabn: es un Instrumento de dibujo en forma de tringulo escaleno, se
caracteriza por tener tres ngulos diferentes: de 90, 30 y 60. El cartabn y la
escuadra en dibujo lineal se pueden utilizar en conjunto para facilitar el trazo
de lneas perpendiculares y paralelas.
Composicin: en artes visuales es la forma en que se organizan los elementos
visuales en una unidad orgnica (variedad dentro de la unidad), la cual
es consistente con la manera de ver el mundo de quien crea la obra. La
composicin en las artes visuales se sostiene y expresa de manera material,
por la estructura que a su vez esta constituida por las relaciones entre los
elementos visuales y conceptuales (contenido) de la obra. Componer es
distribuir los elementos visuales para crear una forma global.
Contorno ciego: esta tcnica se conoce tambin como la tcnica de contornos
puros. Consiste en dibujar los contornos de una modelo sin mirar el dibujo
hasta que se termina, por lo tanto requiere de atenta observacin, desarrolla
la percepcin, una apreciacin del espacio, de la forma, la ubicacin de un
cuerpo en el espacio, su direccin e intencin. Introducida por el profesor
Kimon Nicolaides (USA, 1892-1938) es un mtodo de dibujo que promueve
el uso del hemisferio derecho del cerebro. Este mtodo lo ha retomado la
Dra. Betty Edwards (USA, 1926) en su libro Aprender a dibujar: un mtodo
garantizado El dibujo de los contornos puros o contorno ciego forma parte
de una serie de tcnicas para aprender a dibujar desde el hemisferio
derecho, para evitar los bloqueos que genera el enfoque que hace del dibujo
el hemisferio izquierdo del cerebro. Este mtodo es aplicado en la enseanza
de nios, jvenes y adultos.
Comps de 4/4: es el comps cuya unidad de tiempo es la figura de negra
(cuarto) y se completa con el valor de cuatro negras o su equivalente en cada
comps.
Comps de 2/4: es el comps cuya unidad de tiempo es la figura de negra
(cuarto) y se completa con el valor de dos negras o su equivalente en cada
comps.
Comps de 3/4: es el comps cuya unidad de tiempo es
la figura de negra (cuarto) y se completa con el valor
de tres negras o su equivalente en cada comps.
Comps de 6/8: es el comps cuya unidad de tiempo
es la figura de corchea (octavo) y se completa con
el valor de seis corcheas o su equivalente en cada
comps. En este comps estn escritas canciones
tradicionales salvadoreas, como San Miguel en
Carnaval, Adentro Cojutepeque y del folclore como Torito pinto.
Do mayor: tonalidad musical que se construye sobre la escala con base en la
nota Do, la cual tiene la tercera mayor.
Estructura de la forma binaria A-B: forma musical simple que consta de dos
secciones con material musical diferente. Cuando se trata de canciones con
estribillo como El Carbonero de Pancho Lara, tienen dos estrofas (AA) con
igual msica y un estribillo (B) como se ve en el ejemplo:
A
Soy Carbonero que vengo
De las cumbres, s, seor,
Con mi carboncito negro
Que vierte lumbre de amor
A
De las cumbres del Rosario
De otros pueblos y el volcn,
Bajo siempre solitario
A venderles mi carbn.
B
S mi seor, es buen carbn,
cmprelo usted de nacascol,
y de chaperno y de copinol,
todo seor, es buen carbn.
Estructura de la forma ternaria A-B-A: forma musical simple que consta
de tres secciones con material musical contrastante en la seccin central.
La figura compuesta de
corchea y 2 semicorcheas
aparece remarcada 2
veces en este ejemplo en el
primer y tercer tiempos del
comps (de izq. a derecha)
217
Programa de estudio de cuarto grado
Figura de corchea y dos semicorcheas: es una figura rtmica compuesta que
une dos figuras distintas, una corchea y dos semicorcheas.
Figura de corchea con punto y semicorchea: es una figura compuesta que
une dos figuras distintas, una corchea con puntillo y una semicorchea.
Figuras rtmicas: blanca, negra, grupos de dos corcheas y cuatro semicorcheas:
son las figuras mas utilizadas en la prctica rtmica de la escuela y guardan
una relacin de valor de acuerdo a su duracin en el tiempo.
Folclore: del ingls folk=pueblo y lore=conocimiento, es la expresin (musical,
de danza, culinaria, artesanal, etc.) de un pueblo que se afinca en el tiempo
convirtindose en tradicin y patrimonio del mismo.
Forma: es la configuracin de un objeto bidimensional tridimensional, la
interrelacin de sus partes de una obra. Tambin significa el aspecto exterior
de la cosas, se delimita por lneas (contornos) y superficies. Las formas pueden
expresar infinidad de ideas y conceptos: movimiento, grandeza, pesadez,
calma, armona, etc.
Intervalos: distancia que separa a dos sonidos, la ms corta de las cuales es
un semitono (en algunos tipos de msica se consideran distancias menores).
La escala de Do mayor por ejemplo, consta de 12 semitonos.
Lnea (como trazo): la lnea es la representacin grfica de la trayectoria de
un punto y por ello surge del trazo que deja un punto en movimiento. Es uno
de los elementos bsicos del lenguaje visual. La lnea plstica es expresiva,
presenta variedad de formas, colores y texturas. Las caractersticas de la
lnea como trazo son intensidad, color, grosor. La lnea puede trazarse con
diferentes instrumentos, puede expresar ideas emociones y sentimientos, el
trazo muestra la singularidad de quien traza, como en la caligrafa. Los tres
principales tipos de lnea por su trayectoria son: curvas, oblicuas y rectas.
Lneas de fuga: en el dibujo de perspectiva se compone de los siguientes
elementos: punto de vista, lnea de horizonte, punto de fuga y lneas de
fuga. Las lneas de fuga son lneas que desde el punto de vista (punto del
observador) se dirigen hacia el punto de fuga generando en el dibujo la
sensacin de lejana.
Movimiento meldico: las melodas tienen movimiento de acuerdo a la
secuencia de notas que la componen. Ejemplo: cuando en una meloda se
repite la misma nota durante largo tiempo se considera esttica.
Musicograma: consiste en la
representacin grfica y libre de las
partes y/o contenidos de una pieza
musical. La representacin puede
ser desde un simple esquema que
simboliza las partes de una cancin,
Cuando se trata de canciones, el texto
central siempre es distinto, mientras que
la letra de la seccin A puede repetirse
o variarse.
Fases del proceso de diseo:
hay coincidencias entre muchos
autores contemporneos en que
el proceso de diseo en general
consiste en:
Etapa 0: Investigacin preliminar:
problema (Brief)
Etapa 1. Investigacin y anlisis:
concepto
Etapa 2. Generacin de
alternativas: ideas,
bocetos, modelos a
pequea escala
Etapa 3. Sntesis: prototipo: dibujo
tcnico, Modelo Funcional en 3D
Etapa 4. Realizacin: pruebas
Etapa 5. Evaluacin: produccin
Frase musical: como el lenguaje escrito y hablado, la msica tambin se
estructura en frases que en grupos de dos o ms constituyen un tema o
meloda. Por ejemplo: en el Himno Nacional de El Salvador la primera frase
musical abarca el verso Saludemos, la patria orgullosos a la que sigue una
segunda: de hijos suyos podernos llamar.
Figura: una unidad delimitada por un contorno, es decir un espacio delimitado
por lneas o planos que se percibe con relacin a un fondo.
Figura reversible: un efecto de
percepcin visual en donde se percibe
de manera ambigua la figura y el fondo
en una composicin bi o tridimensional.
Esta ambigedad causada por ciertos
patrones estructurales, se caracteriza.
Por que las figuras estn dispuestas de
tal manera con relacin al fondo que
intercambian sus atributos respectivos
en la composicin.
Ejemplo de
figura reversible
en una
composicin
bidimensional.
No es estable la
percepcin de la
figura y el fondo.
Ejemplo de musicograma con dibujo que
representa la cancin El carbonero de Pancho
Lara (fragmento sobre la primera estrofa y el
estribillo de la cancin)
Ejemplo de musicograma con esquema que
representa la forma ternaria A-B-A de la cancin
Brilla, brilla estrellita
Ejemplo de musicograma con dibujo que representa
tanto la forma ternaria A-B-A- como el contenido de la
cancin Brilla, brilla estrellita
218
Programa de estudio de cuarto grado
hasta dibujos ms elaborados de acuerdo a lo que cada persona interpreta
de la msica escuchada.
Msica de proyeccin folclrica: es la msica de una regin que es proyectada
en otra de distinta idiosincracia sin un proceso de transculturacin. Por
ejemplo, los grupos de msica andina que existen en El Salvador.
Papel picado: es una tcnica que consiste en decorar secciones de papel
(generalmente papel de china) con el calado, forma parte del patrimonio
indgena de Izalco, departamento de Sonsonate. Su origen se remonta a
la cultura china. Forma parte del patrimonio cultural de El Salvador, ya que
tradicionalmente se han utilizado banderitas y gallardetes para las fiestas
tradicionales y festividades de los pueblos. Actualmente, Don Manuel Pasasin
es el artista ms destacado en esta tcnica, quien es miembro de la comunidad
indgena de Izalco, departamento de Sonsonate. Para su elaboracin se
utilizan tijeras para cortar figuras en el papel plegado de china, bond y
crespn, de manera que al desdoblar los pliegues los cortes generen calados
que forman figuras a lo largo del papel semejando encaje. Las secciones de
papel caladas se pegan a secciones de cordel para hacer tiras de gallardetes
en palos para hacer banderitas que decoran las ofrendas para la cofrada
en las fiestas patronales de las ciudades y pueblos.
Papiroflexia: es el nombre con el que se le denomin en Espaa al arte que
utilizando tcnicas de plegado en papel permite obtener formas y figuras
decorativas. El pas que ms ha cultivado ampliamente este arte es el Japn
en donde se le denomina Origami.
Plano: es una configuracin que se caracteriza por tener dos dimensiones:
ancho y alto.
Patrimonio inmaterial: es aquel tipo de patrimonio cuya naturaleza es intangible
(sonora, de ideas, de movimientos) el cual se transmite oralmente y constituye
una parte valiosa de la cultura de un pueblo, de un pas o del mundo, como
sucede con el sitio arqueolgico Joya de Cern declarado
como patrimonio de la humanidad por UNESCO.
Puntillo: el puntillo o punto se escribe a la derecha de
las figuras rtmicas para aumentar la mitad de su valor
original.
Relacin figura fondo: toda superficie rodeada tiende
a percibirse como figura, mientras que el rea que la
rodea como fondo. El fondo da la impresin de pasar
atrs de la figura, la figura tiende a ser de menor
tamao, de color ms denso y presenta mayor claridad
y definicin que el fondo.
Respiracin diafragmtica: se auxilia del movimiento
del msculo del diafragma para generar una mayor
capacidad de inspiracin y control de la expulsin del
aire utilizando plenamente la capacidad respiratoria para el habla y para el
canto.
Registro: trmino con que popularmente se denomina el rango o diapasn de
notas musicales que alcanza la voz de cada persona y que se define por las
notas extremas graves y agudas que puede emitir.
Silencio de blanca y de negra: a cada figura rtmica le corresponde un
silencio con el mismo valor en el tiempo que se escribe tambin sobre le
pentagrama.
Textura: es la cualidad que caracteriza la superficie de los objetos, hay dos
tipos de texturas: las reales y las visuales. Las texturas reales son sensibles
al tacto y en las texturas visuales la sensacin tctil que caracteriza a las
texturas reales nada ms es aparente, se trata de un efecto ptico logrado
por patrones de repeticin de formas, color la manera en que refleja la luz
la superficie del objeto.
Tridimensin: espacio en donde se experimenta el volumen el cul se percibe
en tres dimensiones: grosor, ancho y alto.
Volumen: es el espacio que ocupa un cuerpo. El volumen es el resultado de la
configuracin de un objeto en tres dimensiones: ancho, alto y profundidad.
Trada: acorde de tres sonidos que se basan en uno fundamental que le da su
nombre. A partir del sonido fundamental se construye un intervalo de tercera
y uno de quinta para formar una trada. Ejemplo: la trada mayor de Do esta
formada por la fundamental Do, su tercera, Mi y su quinta, Sol.
Tiempo musical: el tiempo en msica es una abstraccin que se realiza
subdividiendo el tiempo real a partir de parmetros rtmicos como comps,
valor de las figuras rtmicas, indicaciones de tiempo rpido o lento y otros.
Voces blancas: se dice de las voces infantiles.
En el ejemplo aparece
remarcada la figura de
negra con puntillo.
En el ejemplo aparece
remarcada la figura
compuesta de corchea con
puntillo y semicorchea. Es
muy usada en los gneros
musicales bailables y en
la msica infantil por su
carcter saltarn.
EDUCACIN
FSICA
220
Programa de estudio de cuarto grado
Presentacin de la asignatura
La Educacin Fsica brinda la oportunidad a la nia
y al nio de aprender, desarrollar y potenciar su
cuerpo, entendindolo como un ser integral en desarrollo,
a lo largo de sus etapas evolutivas comprendidas en los
niveles de Educacin Bsica. Las vivencias educativas de
esta asignatura se centran en la toma de conciencia del
cuerpo, sus adaptaciones morfolgicas y funcionales, los
movimientos orientados, el aprendizaje de habilidades,
conductas y hbitos positivos, en mbitos de la salud y
convivencia. Adems propicia aprendizajes que inciden en
la calidad de la vida de las personas como hbitos de vida
saludables, las propiedades y cualidades fsico-funcionales,
la construccin de una cultura de paz y de una vida con
perspectivas, satisfacciones y responsabilidades.
Enfoque de la asignatura:
motriz de integracin dinmica
Este enfoque concibe el movimiento como parte de la
experiencia vital de las personas indispensable para la
salud y la interaccin con el entorno. Orienta los contenidos
no solo para desarrollar hbitos, destrezas y habilidades
motoras, sino tambin para promover experiencias para
enfrentar retos que ofrece la dinmica diaria, desarrollar
valores y normas de convivencia, generar aceptacin
personal y satisfaccin, promoviendo as en los educandos
su desarrollo biolgico, psicolgico y social.
Competencias a desarrollar
Comunicacin corporal
Supone el conocimiento y la valoracin del cuerpo y sus
funciones desde una percepcin global que integra lo
fsico, psicolgico y social de la persona. Esta competencia
moviliza las posibilidades expresivas del cuerpo por medio
de los movimientos, gestos y otras posibilidades. Con ello
se supera la divisin tradicional entre mente, sentimientos y
cuerpo, asumiendo que son componentes indivisibles de la
persona, que se conjugan en cualquier actuacin motora.
Se abordan los valores y su incidencia en las relaciones
interpersonales y formacin de la personalidad, hasta la
prctica de estos de forma dirigida y regulada en la vivencia
de la actividad fsica.
Movimiento y salud
Promueve el desarrollo de la orientacin en el tiempo y el
espacio al realizar diversas actividades e interactuar en el
entorno, permitiendo el aprendizaje de otras habilidades ms
complejas. Se enfatiza el desarrollo equilibrado, la atencin
de la base sensorial y perceptiva, as como los hbitos que
promuevan la salud preventiva para la edificacin de una
motricidad consciente en los educandos.
Aptitud fsica y deportiva
Se manifiesta en el desarrollo de las propiedades y
caractersticas anatmicas y fisiolgicas innatas en cada
individuo, de tal forma que se potencien para su desempeo
ptimo en el contexto sociocultural. Esta competencia
requiere el respeto y la atencin a la diversidad existente
221
Programa de estudio de cuarto grado
forma de desarrollar y ampliar la comunicacin, partiendo
de los movimientos, gestos y otras posibilidades.
3. Aptitud fsica y habilidades deportivas:
Agrupa las propiedades y caractersticas anatmicas y
fisiolgicas innatas en cada individuo, de tal forma que
se potencien para el desempeo ptimo en el contexto
sociocultural de las personas. Esto implica respetar y
atender la diversidad existente entre los educandos. Con este
planteamiento se promociona el desarrollo de habilidades
y destrezas tcnicas que facilitan la prctica de algunas
modalidades deportivas, grupales e individuales.
4. Movimiento y salud:
Este bloque comprende contenidos relacionados con
las posturas y formas adecuadas de movernos tanto en
condiciones cotidianas, en la ejercitacin fsica y en las
prcticas deportivas; adems aborda conocimientos de
carcter fisiolgico y hbitos higinicos que permiten
proteger el organismo al ejecutar actividad fsica.
Relacin entre los bloques de contenido y las unidades
didcticas
Los bloques de contenido se han organizado en tres unidades
de aprendizaje, a fin de integrarse y complementarse de
forma armnica, tal como se constituyen en las actividades
de la vida cotidiana. Sin embargo, cada unidad didctica
presenta como eje un bloque especfico que se complementa
con los otros.
Los contenidos que integran los cuatro bloques se
plantean en tres dimensiones integradas de aprendizaje:
conocimientos, procedimientos y actitudes, lo que facilita
an ms la integralidad de los aprendizajes.
entre los educandos. Con este planteamiento se promociona
el desarrollo de habilidades y destrezas tcnicas que
facilitan la prctica de algunas modalidades deportivas,
grupales e individuales.
Bloques de contenido
La naturaleza de los contenidos de esta asignatura y de
sus procedimientos didctico-metodolgicos facilita la
interaccin activa de los nios y las nias en los diversos
entornos en los que se desenvuelven, coadyuvando as a su
desarrollo fsico, psquico, intelectual y espiritual.
Los bloques de contenido que estructuran la propuesta
curricular de la Educacin Fsica son los siguientes:
1. Habilidades perceptivo-motoras:
Comprende aspectos relativos a la percepcin sensorial
y motora: lateralidad, equilibrio, ritmo; y la orientacin
del movimiento en el tiempo y espacio, entre otros. Este
bloque de contenidos es bsico para el aprendizaje de
otras habilidades ms complejas. El desarrollo equilibrado
requiere atencin de la base sensorial y perceptiva para la
edificacin de una motricidad inteligente.
2. Conocimiento y expresin corporal:
Este bloque integra aspectos relacionados con el
conocimiento del cuerpo y sus funciones, desde la percepcin
global (auto concepto y auto imagen) hasta la percepcin de
las partes y sus funciones motoras como componentes de un
todo en la intervencin psicomotora. Esto permite integrar
componentes de valores, como el respeto y la convivencia,
en el mbito de la Educacin Fsica. Este bloque tambin
incluye las posibilidades expresivas del cuerpo como una
222
Programa de estudio de cuarto grado
El bloque Conocimiento y expresin corporal es el eje que
estructura la unidad 3. Sin embargo se complementa con
contenidos sobre salud (postura corporal) y el juego (aptitud
fsica y habilidades deportivas).
Aunque el programa de estudio actual presenta tres
unidades, igual que el programa anterior, los contenidos se
han reorganizado y enriquecido a partir de la integracin
y estructuracin de los cuatro bloques. Esta propuesta los
presenta de manera explcita. Al hacerlo as se previene
que muchos sean interpretados como metodologa al
ser aprendizajes bsicos, como la expresin corporal, la
educacin postural, la direccionalidad, entre otros.
Esta nueva presentacin vuelve ms sencillo y claro el
desarrollo del programa para los maestros y las maestras. En
la siguiente tabla se presenta tanto las reas y contenidos del
programa de estudio anterior, como las reas y contenidos
del programa actual.
La organizacin de estos bloques en unidades didcticas
obedece a criterios pedaggicos y psicolgicos. Por lo tanto
se han estructurado, segn su importancia, en el periodo
evolutivo que presentan los educandos en los niveles
educativos. Por ejemplo, la primera unidad desarrolla con
mayor nfasis las habilidades perceptivo-motoras, a fin de
que las y los nios fortalezcan la confianza y aceptacin
de s mismos, la autonoma motora, la orientacin en el
espacio, entre otros. Estos aprendizajes son prerrequisitos
para desarrollar posteriormente habilidades ms complejas
y de mayor exigencia en cuanto a la funcionalidad del
organismo, las cuales pertenecen al tercer bloque y se
agrupan con mayor nfasis en la unidad dos.
El bloque de movimiento y salud se integra en todas las
unidades, organizando los contenidos de acuerdo con la
relacin de otros bloques y la aplicabilidad en la clase y en
la vida. Por ejemplo, el aseo del lugar de las prcticas, el
proceso de digestin y su incompatibilidad con la actividad
fsica vigorosa simultnea.
Relacin de bloques de contenido y unidades didcticas del programa anterior y programa
actual de segundo ciclo
Actividades rtmicas.
Equilibrio esttico y dinmico.
Flexibilidad general.
Rodada al frente.
Cachar y lanzar.
Respeto al medio ambiente.
Unidad 1: Mejoremos nuestras
habilidades fsicas
Bloques de contenido
Unidad 1: Mejoremos nuestras
PROGRAMA ANTERIOR
Unidad 1: As sentimos, nos movemos
y orientamos
Bloques de contenido
Unidad 1: As sentimos, nos movemos
PROGRAMA ACTUAL
Estructura, imagen corporal y movimiento.
Discriminacin tctil.
Flexibilidad corporal.
Postura de brazos y piernas en la carrera.
El lenguaje corporal como complemento en
la comunicacin.
Habilidades perceptivo-motoras.
Aptitud fsica y habilidades
deportivas.
Conocimiento y expresin corporal.
223
Programa de estudio de cuarto grado
Pase y recepcin del baln.
Resistencia aerbica.
Fuerza de brazos, piernas y tronco.
Resistencia aerbica y saltos.
Valoracin del trabajo en equipos.
Unidad 2: Reforcemos nuestras
habilidades fsicas
Unidad 2: Nuestras habilidades fsico-
motoras y deportivas
Formas naturales de orientacin espacial.
El equilibrio como punto de partida.
Fuerza y desempeo diario.
La respiracin en los esfuerzos de corta,
media y larga duracin.
La importancia de las actividades de
acondicionamiento y de recuperacin en
la clase.
Habilidades perceptivo-motoras.
Aptitud fsica y habilidades
deportivas.
Movimiento y salud.
Habilidades perceptivas-motoras.
Aptitud fsica y habilidades
deportivas.
Conocimiento y expresin corporal.
Movimiento y salud.
Voleo.
Velocidad de reaccin.
Velocidad de reaccin.
Mini- tenis.
Tolerancia y respeto a las reglas del juego.
Unidad 3: Demostremos nuestras
habilidades fsicas
Bloques de contenido
Bloques de contenido
Unidad 2: Reforcemos nuestras
PROGRAMA ANTERIOR
Unidad 3: Nos comunicamos corporalmente
y protegemos nuestro organismo
Unidad 2: Nuestras habilidades fsico-
Bl d t id
PROGRAMA ACTUAL
Exploracin de los espacios reducidos y
amplios.
Pausa y duracin de las acciones.
Tipos de velocidad y sus caractersticas.
Significado del gesto, postura y
movimiento.
Medidas de prevencin y proteccin de la
regin lumbar en la ejercitacin.
224
Programa de estudio de cuarto grado
Objetivos de cuarto grado
Prevenir lesiones la columna vertebral, principalmente
en la zona lumbar, aplicando con autonoma y
responsabilidad, conocimientos sobre posturas correctas
del tronco en las actividades y en la ejercitacin
cotidiana.
Fortalecer con perseverancia la condicin fsica,
ejercitando sistemticamente la flexibilidad, la capacidad
aerbica, los tipos de velocidad y la tcnica de la
carrera, para construir la base de la aptitud fsica en
correspondencia con sus caractersticas y capacidades
fsico-funcionales.
Utilizar oportunamente y con creatividad su cuerpo,
representando acciones cotidianas sencillas con
movimientos y gestos, para incrementar sus posibilidades
comunicativas.
Incrementar la agudeza perceptiva, mediante el
establecimiento de relaciones entre las partes del cuerpo,
de este con los objetos y entre los objetos en el espacio,
para elevar cualitativamente su motricidad.
Lineamientos metodolgicos
Para el tratamiento de los diferentes tipos de contenido
deben elaborarse las previsiones necesarias (planificacin),
as encontramos para el tratamiento de los contenidos
actitudinales las siguientes tcnicas de intervencin:
conflicto socio-cognitivo, la persuasin y el modelaje.
El empleo de la primera tcnica se manifiesta al intervenir
racionalmente ante conductas inadecuadas de uno o
varios educandos, en el momento en que se presentan,
deteniendo la actividad brevemente y realizando las
reflexiones apropiadas.
La tcnica del modelaje se concreta con la actuacin del
docente al modelar los valores socialmente aceptados; as
se observa su respeto, su nivel de tolerancia a la igualdad en
el trato a todas y todos y otras actitudes y valores deseables
de imitar por parte del estudiantado.
La tcnica de persuasin supone abordar contenidos
actitudinales, ofreciendo puntos de vista, informacin e
ideas que invitan a los estudiantes a actuar de acuerdo
a normas y valores aceptados socialmente; la informacin
que se brinda tiene entonces un poder de convencimiento.
Los contenidos conceptuales representan en gran medida la
posibilidad de hacer realidad la condicin de integralidad
en la Educacin Fsica; por ello debern ser bien ponderados
previendo su entrega en los momentos oportunos en que
explican o amplan las razones y maneras de la ejercitacin
fsica saludable y adecuada, estas entregas pueden
apoyarse con escritos multicopiados o pegados en el
peridico mural, su carcter de motivadores surgen de su
arraigo con los eventos prcticos.
Los contenidos procedimentales cuentan con la virtud
de estar conformados por actividad fsica en la mayora
de casos, los que podrn tratarse con las tcnicas y
procedimientos conocidos: recorrido, olas, estaciones,
circuito y trabajo frontal, lo cual est dado por el contenido
a desarrollar o por la existencia de material didctico y
equipo disponible.
El recorrido surte efecto cuando deban resolverse tareas
variadas, consecutivamente en desplazamiento. Las
olas se utilizan cuando tenemos escasos implementos en
proporcin al nmero de participantes, se forman varias
225
Programa de estudio de cuarto grado
columnas de alumnos frente a un material o equipo donde a
la seal pasan los primeros de cada columna a resolver una
determinada tarea despus de la cual se integran al final de
su columna respectiva, pasando a trabajar las alumnas y
los alumnos que continan en el orden y as sucesivamente.
Las estaciones y circuitos se semejan, ya que en ellas se
distribuyen diferentes tareas en el espacio de juego, teniendo
cada lugar de trabajo una tarea determinada (estaciones).
El trabajo frontal se emplea en tareas estacionarias, para
lo cual se prev el espacio personal de cada alumno y se
realizan las tareas dadas por la profesora o el profesor;
ejemplo: posiciones de equilibrio sobre un pie en su lugar.
Asociados a las tcnicas anteriores se prev el uso de los
estilos de enseanza, los cuales se adecuan ms o menos
a cada una de ellas, En lo posible se recomienda aplicar
aquellos que fomentan en los educandos la autonoma,
ejemplo: el descubrimiento guiado, la resolucin de
problemas y la exploracin libre.
El primero comprende una serie de orientaciones a manera
de pistas que se ofrecen a los alumnos para que con esa
gua ejecuten de manera adecuada una destreza dada.
La resolucin de problemas tan solo deja planteado el
problema de habilidad motriz que el alumno debe descubrir
como realizarla adecuadamente y por ltimo la exploracin
libre empleada frecuentemente en la manipulacin o
pedipulacin que el alumno realiza sobre un objeto o
utensilio buscando familiarizarse con l o crear maneras de
uso de este, as como en algunos casos es imprescindible la
aplicacin de otros estilos de enseanza como: de mando
directo, asignacin de tareas y uso del compaero, los
cuales brindan una mnima posibilidad de autonoma o su
ausencia total.
En todo caso deber procurarse que el estudiante se
mantenga activo la mayor cantidad de tiempo durante la
clase, en tal sentido presentan la clase y contenidos de
esta en correspondencia a la cantidad de materiales y al
espacio disponible.
En la conformacin de grupos o equipos debe considerarse
la ocasin en que los dbiles o poco habilidosos elijan a
sus compaeros de equipo, a fin de proporcionarles la
oportunidad de ser los primeros a cambio de estar a la
espera de ser elegidos hasta el final, en otras ocasiones
el profesor conformar los grupos de manera equilibrada,
igual para conseguir que aquellos que evitan trabajar
juntos lo hagan ocasionalmente, de la misma manera
intercambiar participantes de un equipo a otro en un mismo
periodo de clase.
En el trabajo individual se respetar el descanso y ritmo de
trabajo que decide para s cada nio, procurando cumplir
los requerimientos de los indicadores de logro, despus de
todo se busca la autonoma, adems se debe aceptar el
tomar agua en el transcurso de la clase, lo que trata de la
conformacin de la cultura de la hidratacin.
La clase se organiza en tres fases como se propone en los
otros ciclos de la Educacin Bsica: fase inicial, fase de
desarrollo y fase final.
Fase Inicial
Esta debe contar con un tiempo de entre 5 a 8 minutos,
en el que debe prepararse el educando para el ptimo
desempeo en la clase, esta preparacin debe referirse a
tareas jugadas que le hagan entrar en contacto con los
otros y otras, adems se realizan actividades para que los
educandos tengan la disposicin a atender indicaciones
(prestar atencin).
226
Programa de estudio de cuarto grado
Todas las actividades deben tener implcita la lubricacin
de las principales articulaciones del cuerpo, elevando
la viscosidad de los lquidos sinoviales, disponiendo al
movimiento eficiente as como el estiramiento muscular
elevando la temperatura media y con ello se dispongan las
fibras contrctiles para una mejor respuesta en la actividad
muscular, igual deber realizarse tareas que impliquen la
activacin del sistema cardiovascular procurando el aporte
sanguneo adecuado a los grupos musculares implicados
en la activacin fsica de la clase.
Otras actividades de esta fase son las de presentar los
contenidos a tratar, enunciando los primeros de ellos,
sean conceptuales o actitudinales y sobre todo preparan
el escenario de trabajo, limpindolo de basuras, piedras y
otros que puedan ocasionar accidentes.
Fase de desarrollo
En esta se realizan actividades afines a los contenidos de
la clase en particular y consecuentemente a la concrecin
del objetivo, debiendo el maestro crear las condiciones
pertinentes para el aprendizaje con autonoma, as como
modelar las tareas, reforzar permitiendo respuestas
diversas en relacin a la ejecucin de las actividades o
tareas por parte de los educandos. Cuando las tareas a
mostrar no estn al alcance de la habilidad del profesor,
este deber solicitar la ayuda de las nias y los nios hbiles
o avanzados para poder presentar el modelo deseado. El
tiempo destinado para esta fase es de 30 a 35 minutos.
Fase final
Las actividades que se desarrollan en esta fase persiguen
reducir la excitacin y activacin del organismo a fin de que
el estudiante se recupere de forma paulatina y est apto
psicolgica y fsicamente para la hora de clase siguiente,
es decir en el transcurso de esta, se recomienda ejecutar
la respiracin consciente, movimientos de aflojamiento y
estiramiento muscular y otras actividades propias de la
relajacin; tambin pueden presentarse actividades de
reflexin y evaluacin sobre los contenidos desarrollados
y su participacin, para ello se destinarn entre 3 y 5
minutos.
Es deseable que las y los nios acostumbren llevar una
toalla o trapo limpio con el cual se retiren el sudor al
finalizar la clase, as como calzado cmodo y apropiado
para las prcticas fsicas. Cuando sea necesario el conteo
de tiempo o nmero de repeticiones se sugiere el trabajo en
pareja, es apropiado tambin para propiciar el tiempo de
descanso para cada uno.
Lineamientos de evaluacin
Todo proceso formal de enseanza-aprendizaje comprende
la evaluacin como uno de sus componentes, la que
presenta tres claros momentos, como son: inicio del proceso,
durante el proceso y final de este. Su objetivo es aportar
la informacin oportuna sobre el proceso de aprendizaje
constituyndose por ello en una estrategia contra el fracaso
escolar.
La evaluacin considera las diferentes manifestaciones del
educando en la comprensin y aplicacin de la informacin
en diversas situaciones y la prctica constante y permanente
de normas, principios y habilidades sociales.
Evaluacin inicial o diagnstica
El propsito de esta parte de la evaluacin es establecer el
nivel de habilidades, destrezas, conocimientos y actitudes
227
Programa de estudio de cuarto grado
Para asignar la calificacin, el docente debe tener claro los
criterios con qu valorar los desempeos descritos en los
indicadores de logros y con que actividades e instrumentos
los pondr en evidencia. Los criterios de evaluacin deben
responder al enfoque integrador de la asignatura reflejado
en las competencias; los instrumentos susceptibles de
aplicacin son: los test o pruebas estandarizadas, bateras
de pruebas, pruebas de ejecucin, escalas de clasificacin
y listas de cotejo.
A continuacin se presentan algunos ejemplos de criterios de
evaluacin:
Prcticas de hbitos higinicos.
Postura adecuada.
Prevencin de accidentes y cuidados de la salud
durante la actividad fsica.
Seguimiento de indicaciones.
Apropiacin de valores (colaboracin, respeto,
perseverancia, responsabilidad y otros)
Conservacin del orden en los desplazamientos durante
la clase.
Aplicacin de normas de convivencia.
que en relacin a los contenidos a tratar, presentan
los estudiantes en el inicio del proceso; de manera de
planear las adecuaciones necesarias. Para esta fase de
evaluacin se recomienda la utilizacin de algunos
instrumentos como el inventario de actitudes y conductas
al interaccionar en clases, test o pruebas estandarizadas y
pruebas de ejercicio.
Evaluacin de proceso o formativa
Esta permite valorar continuamente el proceso del
estudiante, igual sus dificultades y deficiencias frente al
aprendizaje, con el propsito de la toma de decisiones
acerca de la conduccin diaria del proceso, de manera
de encontrar los mtodos ms eficaces, los utensilios y
materiales ms adecuados y las actividades apropiadas al
grupo de alumnos y contenido tratado.
La observacin es la tcnica a emplear, la cual se consolida
en registros anecdticos, lista de progreso, escalas de
tareas, lista de verificacin y escalas de estimacin, todas
ellas de mucha utilidad en el caso de los diferentes tipos
de contenidos. En este tipo o momento de evaluacin
se le da realce a la retroalimentacin con el debido
cuidado de considerar las posibilidades y caractersticas
de cada educando, as como su uso oportuno, lo cual
junto a los reconocimientos verbales y refuerzos operan
beneficiosamente.
Evaluacin final o sumatoria
Al trmino del tratamiento a cada contenido o cada unidad
didctica se hace necesario establecer el nivel de logro del
estudiante para efectos de su respectiva promocin, este
es el momento donde el producto del proceso enseanza-
aprendizaje cobra valor.
228
Programa de estudio de cuarto grado
UNIDAD 1
Objetivos
1.1 Corrige cientficamente los mitos
respecto a las consecuencias de
la ejercitacin fsica durante el
perodo menstrual, mostrando
respeto y aceptacin por esa
condicin natural femenina.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
Mitos sobre las
consecuencias de la
ejercitacin fsica durante
el perodo
de menstruacin.
Fundamentacin y
correccin de mitos sobre
las consecuencias de la
ejercitacin fsica durante
el perodo menstrual.
Actitud sana y de respeto
a la mujer por su
condicin natural
de menstruar.
ASI SENTIMOS,
NOS MOVEMOS Y
ORIENTAMOS
Tiempo probable: 34 horas clase
Aplicar la discriminacin tctil, en la manipulacin de objetos de texturas, formas y
consistencias diferentes, para incrementar el conocimiento y manejo de los diferentes
implementos en el juego y en las actividades cotidianas.
Desarrollar habilidades bsicas en desplazamientos y otras acciones motoras, aplicando la
flexibilidad, la postura adecuada y la coordinacin de los segmentos corporales implicados
en estas, para el desarrollo, la eficiencia motriz y la salud preventiva.
1.2 Describe su imagen corporal
al saltar y correr esquivando
y pasando entre dos
referentes, manifestando
aceptacin de s mismo y
de los dems.
Aspectos que interactan
en la actualizacin de la
estructura e imagen
corporal a partir del
movimiento y las relaciones
con elementos del entorno.
Percepcin consciente y
actualizacin de la imagen
corporal a partir de la
relacin entre su estructura
corporal, el espacio y
elementos de actuacin
en las actividades fsicas.
Aceptacin de su imagen
corporal como resultado
de su actuacin en
actividades fsicas.
1.3 Manifiesta correspondencia en
la manera de ejecutar acciones
fsicas con diversos objetos y la
textura, consistencia y forma de
cada uno de stos.
Textura, consistencia y forma
de los diversos implementos
deportivos e incidencias en
la manipulacin en
actividades fsico-deportivas.
Aplicacin de acciones
motrices con implementos
deportivos, adecuados a
la textura, consistencia y
forma de estos.
Inters por dominar
implementos con
texturas, formas y
consistencias diversas.
229
Programa de estudio de cuarto grado
1.4 Evidencia incremento
de la flexibilidad en
las articulaciones de
las extremidades y el
tronco, considerando
responsablemente factores
endgenos y exgenos
presentes y previniendo
posibles daos en las partes
ejercitadas.
INDICADORES DE LOGRO CONTENIDOS
Factores que influyen en la
flexibilidad corporal:
-Exgenos (hora del da y
temperatura ambiente).
-Endgenos (grado
de entrenamiento,
temperatura corporal,
disposicin mental
a la tarea, grado de
hidratacin, estado de
salud).
Desarrollo de la
flexibilidad de tronco
y extremidades,
identificando la
incidencia de factores
endgenos y exgenos.
1 Prevencin del dao en
msculos, articulaciones
y tendones en la
ejercitacin de la
flexibilidad.
Responsabilidad en tener
en cuenta los factores
exgenos y endgenos
como indicadores para
ejercitar la flexibilidad.
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
1.5 Corre mostrando confianza y
estabilidad, oscilando los
brazos en el plano vertical,
con un ngulo de ms o
menos 90 en el codo y un
desplazamiento de ms o
menos 90.
1.6 Corre mostrando autonoma
en el movimiento cclico de
piernas en el plano vertical
(hacia adelante), acorde con el
balanceo controlado de brazos.
1.7 Presenta creatividad y
coherencia al acompaar
la conversacin con gestos
y movimientos.
Postura de brazos y
piernas durante su
oscilacin en la carrera.



El lenguaje corporal
como complemento en
la comunicacin.
Oscilacin voluntaria y
controlada de brazos y
piernas en la carrera,
como base de impulso
y estabilidad.


Aplicacin de
movimientos corporales
para enfatizar palabras
y acciones en la
comunicacin.
Valoracin positiva de
la funcin de apoyo y
estabilidad de la
oscilacin de brazos y
piernas en la carrera.


Creatividad al apoyar la
conversacin con gestos
y movimientos.
Programa de estudio de cuarto grado
230
2.1 Ejecuta con inters
secuencias de actividades
de acondicionamiento,
describiendo sus beneficios
en el sistema cardiovascular
y seo-articular.

2.2 Ejecuta con perseverancia
actividades de recuperacin
del organismo posterior
a los esfuerzos vigorosos,
explicando su importancia.
Importancia de
las actividades de
acondicionamiento previo
a la actividad fsica
vigorosa y/o prolongada y
de otras de recuperacin
dirigidas a la finalizacin:
- Estiramientos.
- Movimientos de
lubricacin.
- Activacin del sistema
cardiovascular.
Ejecucin de la secuencia
de actividades de
acondicionamiento previo
a la realizacin de un
esfuerzo fsico vigoroso y/o
prolongado.
Ejecucin de actividades
de recuperacin despus
de la actividad fsica.
2
2
Inters por crear las
condiciones apropiadas
para la ejercitacin fsica
vigorosa y prolongada.




Perseverancia en efectuar
las actividades de
acondicionamiento previo
y de vuelta a la calma.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
UNIDAD 2
NUESTRAS HABILIDADES
FSICO-MOTORAS
Y DEPORTIVAS
Tiempo probable: 40 horas clase
Objetivos
Habituar las condiciones orgnicas que faciliten y garanticen el pleno desarrollo
y funcionamiento del organismo en la ejercitacin fsica aplicando la respiracin
consciente y adecuada al realizar esfuerzos de corta, mediana y larga duracin,
as como el control del equilibrio y la orientacin espacial para potenciar las
propiedades fsicas y fisiolgicas del organismo.
CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
2.3 Se moviliza en relacin
a puntos de referencia
naturales de su entorno
y stos con los
puntos cardinales.
Formas naturales de
orientacin espacial en los
desplazamientos.
Recorridos, giros y saltos
en relacin a puntos de
referencia del entorno natural
(volcanes, ros, rboles,
lagos, puesta y salida del sol).
Inters por relacionar
los elementos naturales
del entorno en su
orientacin espacial.
231
Programa de estudio de cuarto grado
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
2.4. Controla el equilibrio del
cuerpo al manipular objetos,
caminando, saltando y girando,
explicando su origen biolgico.
Factores biolgicos que
controlan y regulan el
equilibrio corporal:
a. Analizador visual
b. Analizador laberntico
c. Analizador kinestsico
Ejecucin controlada de
diversas acciones motrices
que generan desequilibrio-
equilibrio, manipulando
objetos e instrumentos.
Perseverancia en lograr
y mantener equilibrio en
diversas acciones fsicas.
2.5. Controla el equilibrio al
caminar sobre instrumentos
altos (zancos y vigas
entre otros).
Importancia del
equilibrio en el desarrollo
de habilidades y
destrezas fsicas.
Explicacin del origen 2 Seguridad al caminar
sobre superficies o
instrumentos altos.
2.6. Regula, registra y describe
los cambios experimentados
en la respiracin despus de
realizar esfuerzos de corta,
media y larga duracin.
2.7 Muestra un ritmo estable de
respiracin al correr distancias
cortas (100 a 200 m), medias
(200 a 400 m) y largas (400 a
800) en corrspondencia con su
capacidad fsico - funcional.
El papel de la respiracin
en esfuerzos fsicos de
corta, media y larga
duracin.
Regulacin consciente de
la respiracin al realizar
esfuerzos fsicos de corta,
media y larga duracin,
registrando los cambios
que se presentan.
2 Atencin adecuada al
proceso respiratorio
durante el esfuerzo.
23
2.8 Maneja cerca del eje
longitudinal de su cuerpo
los objetos para su lanzamiento
y manipulacin.
2.9 Presenta la flexinextensin
plena en el lanzamiento y
golpe de objetos.
Aspectos que intervienen
en la manipulacin y
lanzamiento de objetos
diversos en situaciones
de juego.
Tcnicas para la
utilizacin ptima de las
extremidades y el tronco
en la manipulacin,
recepcin, empuje,
golpe y lanzamiento
de objetos.
Valoracin positiva de la
funcionalidad del cuerpo
humano.
Programa de estudio de cuarto grado
232
UNIDAD 3
NOS COMUNICAMOS
CORPORALMENTE Y
PROTEJEMOS NUESTRO
ORGANISMO
3.1 Flexiona profundamente las
piernas, ejerciendo la mayor
cantidad de fuerza con ellas,
manteniendo la espalda recta
al levantar, cargar y empujar
objetos voluminosos y pesados
del piso.
3.2 Realizar responsablemente
ejercicios dorsales,
flexionando el tronco y al
extenderlo no sobrepasar la
lnea recta de la zona lumbar
(posicin acostado boca
abajo).
Medidas de prevencin
y proteccin de la regin
lumbar en la ejercitacin
fsica:
- Al levantar y cargar
objetos pesados.
- Al ejercitarse
fsicamente.
- Al realizar tareas
cotidianas.
- En posturas de pie y
sentado.
CONCEPTUALES
Control de la zona lumbar
manteniendo la postura
correcta y apoyando
oportuna y debidamente
con otros segmentos
corporales.
- Al levantar y cargar
objetos pesados.
- Al ejercitarse
fsicamente.
- Al realizar tareas
cotidianas.
- En posturas de pie y
sentado.
PROCEDIMENTALES
3
Prevencin de daos
a la regin lumbar de
la columna vertebral,
poniendo atencin en las
posturas y movimientos
que realiza.
ACTITUDINALES CONCEPTUALES PROCEDIMENTALES ACTITUDINALES
INDICADORES DE LOGRO CONTENIDOS
Tiempo probable: 46 horas clase
Objetivos
Enfatizar con gestos y movimientos creativos aspectos relevantes de la conversacin,
utilizando gestos y movimientos coherentes con el contenido del mensaje, para
comunicarse agradable y eficientemente.
Aplicar medidas de prevencin de lesiones en la regin lumbar de la columna vertebral,
desarrollando los msculos de la espalda y adoptando posturas correctas en la ejercitacin
fsica para educarse en la salud preventiva y mejoramiento de la calidad de vida.
Programa de estudio de cuarto grado
233
3.3 Realizar abdominales
acostado boca arriba,
minimizando la presin
en la zona lumbar
(evitando la formacin
del arco), flexionando las
extremidades inferiores.
3.4 Mantiene su espalda recta
en posicin de pie, al
agacharse y sentarse.
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
3.5 Muestra control del espacio
prximo, realizando diversos
movimientos coordinados con
creatividad sin desplazarse,
respetando la forma particular
de moverse de los dems.

3.6 Muestra control del espacio
lejano al ejecutar diversidad de
movimientos coordinados con
desplazamiento individual y en
pequeos grupos, disfrutando y
aceptando las posibilidades de
movimiento de los dems.
Caractersticas de la
motricidad de acuerdo al
espacio prximo y lejano.
Orientacin y control
motriz en el espacio
prximo con diversidad
de movimientos que no
impliquen desplazamiento.
Orientacin y control
en el espacio amplio
con diversidad de
desplazamientos
individualmente y
en parejas.
3
3
Creatividad al realizar
diversidad de movimientos
sin desplazarse.
Aceptacin de las
posibilidades de
movimiento de s mismo
y de los dems.
Disfrute de los movimientos
realizados individualmente
o en parejas.
234
Programa de estudio de cuarto grado
INDICADORES DE LOGRO CONTENIDOS
PROCEDIMENTALES ACTITUDINALES CONCEPTUALES
3.7 Ejecuta acciones motrices
respetando las secuencias
y estableciendo pausas
controladas en su duracin
con autonoma.
Aspectos que intervienen
en la percepcin del
tiempo: orden y duracin
de las acciones.
Percepcin e identificacin
de las pausas y duracin
de la accin en la
secuenciacin de ciclo o
acclica de las acciones
motrices variadas.
3. Autonoma en las acciones
rtmicas realizadas.
3.8 Reacciona con rapidez ante
estmulos tctiles, visuales
y auditivos mostrando
atencin y velocidad en la
respuesta motriz.
3.9 Muestra disposicin y
rapidez en situaciones en
las que combina acciones
de recepcin, carrera,
lanzamientos, saltos, gateo
y desplazamientos de
tramos cortos.
3.10 Muestra rapidez y empeo
al repetir movimientos
especficos en una actividad
fsica determinada.
Tipos de velocidad y sus
caractersticas.
- De reaccin.
- Gestual.
- De desplazamiento.
Aplicacin de velocidad
de reaccin, gestual, y
de desplazamiento en
lanzamientos, recepciones,
carreras libres y esquivando
obstculos y otras acciones
motrices combinadas que
demanden una pronta
intervencin.
3
3
Atencin para identificar
el estmulo orientador.



Disposicin corporal
positiva para responder a
la demanda del estmulo
orientador.
3.11 Representa personajes de
cuentos, fbulas e historietas,
en pequeos grupos, haciendo
nfasis en gestos, posturas
y movimientos, mostrando
responsabilidad y respeto
por los dems.
Significado e importancia
del gesto, postura y
movimiento corporal en la
comunicacin eficiente.
Aplicacin de gestos,
posturas y movimientos
caractersticos de
personajes en
un contexto.
Respeto por las maneras
expresivas de los dems.
Responsabilidad en
la adopcin de roles
figurados.
Programa de estudio de cuarto grado
235
Actividades de acondicionamiento: conjunto de acciones fsicas que se
realizan al inicio de una sesin de clase, de entrenamiento o de competencia,
con las que busca preparar la actitud (lo psicolgico y social) y la aptitud
(fsico) para potenciar la participacin y el aprendizaje en el evento.
Descanso activo: son espacios de tiempo en los que se ha dejado de realizar
la actividad fsica principal o central, ya sea de forma parcial o total. Las
pausas de recuperacin se caracterizan por bajar a niveles mnimos la
participacin de los sistemas del organismo despus de ejecutar una
actividad con demanda de esfuerzos mayores como parte de una jornada o
en tareas dispersas. En el descanso activo no se debe parar completamente,
se camina o se baja el ritmo de intensidad de la actividad fsica.
Direccionalidad: de acuerdo con Kephart (1972) no hay direcciones objetivas
en el espacio. Las direcciones que atribuimos al espacio exterior (derecha,
izquierda, arriba, abajo, etc.) resultan de la proyeccin de las sensaciones
por medio de las cuales se perciben las actividades del propio organismo.
Cuando el nio o la nia ha logrado desarrollar la lateralidad en su propio
organismo, es capaz de proyectar la direccionalidad al espacio exterior.
Puede darse cuenta que, para alcanzar algo, necesita dirigirse hacia delante
o hacia atrs, hacia la izquierda o hacia la derecha, de la misma manera
dirige otras acciones hacia una direccin determinada como los trazos
para dibujar las letras, desplazamientos corporales u otras acciones ms
complejas.
Ejes corporales: son lneas imaginarias que pasan por el centro de las
superficies corporales o articulares, estn determinados por los planos
corporales.
Equilibrio: es la interaccin entre varias fuerzas, especialmente la de
gravedad y la fuerza motriz de los msculos esquelticos o la capacidad de
mantener la estabilidad mientras se realizan diversas actividades motrices.
Tiene su base biolgica que regula posturas en condiciones normales, pero
tambin se desarrolla controlando y regulando el centro de gravedad del
cuerpo al adoptar diversas posturas en diferentes situaciones. El equilibrio
puede ser esttico y dinmico.
El equilibrio dinmico se define como la facultad de mantener una posicin
del cuerpo mientras se est en movimiento. Mientras que el equilibrio
esttico se refiere a mantener una posicin durante un perodo de tiempo sin
desplazarse.
Tambin intervienen como determinantes del equilibrio corporal el esquema
corporal y la estructuracin espacial que se tenga.
Esquema corporal: es la toma de conciencia de las partes que conforman
el cuerpo y que permite su utilizacin en correspondencia a su ubicacin de
determinadas partes de l, conservando su unidad en las mltiples acciones
que puede ejecutar.
Expresin corporal: se refiere a la utilizacin consciente y creativa del
movimiento y los gestos corporales para expresar emociones, sentimientos,
mensajes con la finalidad de comunicarse.
Flexibilidad corporal: es el grado de amplitud de movimiento de una o
varias articulaciones. Refleja la capacidad de elongacin de los msculos y
tendones.
Habilidades deportivas: se refiere a las acciones fsicas aplicadas a
habilidades y destrezas en el dominio de materiales e implementos
deportivos bajo ciertas caractersticas y reglas que especifican una actividad
determinada.
Habilidades manipulativas: es la capacidad para manejar y dirigir objetos
con las manos de acuerdo a parmetros establecidos, segn sea la finalidad
y los medios con los que se cuente, as tambin ser el nivel de exigencia
requerido.
Habilidades pedipulativas: es la capacidad para controlar y dirigir objetos e
implementos deportivos con los pies cumpliendo parmetros establecidos en
correspondencia con una finalidad.
GLOSARIO
Programa de estudio de cuarto grado
236
Imagen corporal: es la visualizacin que cada uno tiene de su estructura
corporal. La conciencia que el nio tiene de su cuerpo es fundamentalmente
el resultado de sus experiencias (de su propio cuerpo) con el mundo de las
cosas, de los objetos y de los dems. Estas experiencias no son pasivas sino
fruto de ensayos con la realidad, en la que ir obteniendo xitos o fracasos,
placer o displacer, al tiempo que va integrando los valores sociales que el
medio va relacionando con el cuerpo o a ciertas partes de l. As ser como el
concepto de lo corporal se va invistiendo de significaciones, de sentimientos y
de valores de muy diversa ndole, pero siempre subjetivos y personales.
Lenguaje corporal: es el conjunto de actitudes y de comportamientos que
tienen un sentido para otro u otra, o para una interlocutora o un interlocutor
supuesto, es decir que nuestros gestos, actitudes o comportamientos
corporales puedan ser siempre interpretados por otro u otra.
Planos corporales: son superficies imaginarias que atraviesan o limitan el
cuerpo en un sentido determinado. El plano sagital o antero posterior divide
el cuerpo en derecha e izquierda, el plano frontal divide al cuerpo en parte
anterior y parte posterior y el plano transversal divide al cuerpo en parte
superior e inferior.
Habilidades motoras: es un rea de la Educacin Fsica que estimula el
desarrollo de la movilidad del cuerpo en sus diversas manifestaciones y
aplicadas a diversas situaciones de la vida.
Habilidades perceptivo-motoras: es un rea de la Educacin fsica que
estimula los rganos de los sentidos mediante estmulos que nos llegan del
medio ambiente (sensacin), permitiendo diferenciar uno del otro (sensacin),
relacionarlo con la experiencia (imaginacin), simbolizarlo (representacin),
abstraerlo y categorizarlo (conceptualizacin). Esto significa que el estmulo
es el primer paso para que se d el aprendizaje. Los estmulos puede ser
tanto externos (provenientes del medio ambiente), como internos (los que
se producen como resultado del funcionamiento del propio organismo) y
es, a travs de estos estmulos, o la combinacin de varios de ellos, como el
individuo va aprendiendo y va adaptando su conducta para sobrevivir en el
medio que le rodea.
Habilidad: es la capacidad psicolgica, fsica, motriz y social para intervenir
de manera racional, eficiente y asertiva en las diversas actividades y retos
de la vida cotidiana, la habilidad se adquiere y desarrolla mediante el
aprendizaje sistemtico.
Programa de estudio de cuarto grado
237
aplicaciones. Editorial Thomson. Mxico.
Santos, Manuel y Snchez, Ernesto. (1996). Perspectivas en educacin matemtica.
Editorial Iberoamrica. Mxico.
Stedino, Laurie. (1996). Ya lo tengo. Juegos y problemas matemticos 1 y 2. Editorial
Albatros. Buenos Aires.
Van Cleave Janice. (2002). Ven, juega y descubre la matemtica. Editorial Limusa.
Noriega editores. Mxico.
Zamora C, Gmez M, y otros. (1993). Matemtica Primer Ciclo de Educacin
Primaria. Proyecto Orientacin Pedaggica. Edeb. Barcelona.
Ciencia, Salud y Medio ambiente
Argentina. Ministerio de Cultura y Educacin de la Nacin. Consejo Federal de
Cultura y Educacin (1995). Contenidos bsicos comunes para la Educacin
General Bsica.
Benlloch, M. (2001). La educacin en la ciencia: Ideas para mejorar su prctica.
Paids Educador. Barcelona, Espaa.
Bernal, M. J. M. (2001). Renovacin pedaggica y enseanza de las ciencias.
Medio siglo de propuestas y experiencias escolares (1882-1936). Biblioteca Nueva.
Memoria Crtica de la Educacin. Madrid, Espaa.
Camusso, D. N. (1996). Nosotros y la naturaleza. Un esperado reencuentro.
Propuesta prctica para trabajar con nios. Errepar. Buenos Aires, Argentina.
Cerda, G. H. (2000). La creatividad en la ciencia y en la educacin. Asociacin
Colombiana para el avance de la ciencia. Colombia.
El Salvador, Direccin General de Proteccin Civil, Prevencin y mitigacin de
desastres. (2006). Ley y reglamentos de proteccin civil, prevencin y mitigacin de
desastres, C. A.
El Salvador, Ministerio de Educacin IEA. TIMMS/ 2007. (2006). Estudio internacional
de tendencias en Matemtica y Ciencias (TIMMS). Documento Informativo. C A.
El Salvador, Ministerio de Educacin. (1996). Gua Didctica I, II, III. Educacin
Ambiental. Ministerio de Educacin. C. A.
El Salvador, Ministerio de Educacin. (1999). Estndares de contenido y desempeo
para primero y segundo ciclo de educacin bsica. Asignaturas: Lenguaje,
Matemtica, Ciencia, Salud y Medio Ambiente, C. A.
El Salvador, Ministerio de Educacin (1999). Libros de Ciencia, Salud y Medio
Ambiente: 1, 2, 3, 4, 5 y 6. Coleccin Cipotes, C. A.
El Salvador, Ministerio de Educacin. (1999). Programa de capacitacin permanente.
Contenido y metodologas para la Educacin Bsica. Vida y Salud.
El Salvador, Ministerio de Educacin. (2002). Mdulo sobre prevencin de desastres,
C. A.
El Salvador, Ministerio de Educacin (2006). Plan de proteccin escolar.
Orientaciones para su elaboracin. C. A.
Gmez, R. William. (1994). Investiguemos. Ciencia Integrada. Editorial Voluntad.
Lenguaje
Cassany, Daniel, y otros. Ensear Lengua. Editorial Gra, 1994.
Coll, Csar y otros. Los contenidos de las reformas.Enseanzas y aprendizajes
de conceptos, procedimientos y actitudes. Editorial Santillana, ula XXI. Madrid,
1992.
El Salvador, Ministerio de Educacin. (2007) Evaluacin al servicio
del aprendizaje.
El Salvador, Ministerio de Educacin. (2007) Currculo al servicio del aprendizaje.
Harris, Abigail. Evaluacin continua, Mdulo II del curso de especializacin en
lenguaje y matemtica para maestros y maestros y maestras de primer ciclo
Ministerio de Educacin, San Salvador, 2007.
Kaufman, Ana Mara. La escuela y los textos. Editorial Santillana, 2001.
Zavala Antoni. Marco curricular.
Surez, Patricia. La escritura literaria: cmo y qu leer para escribir/ con prlogo
de Beatriz Actis. Ediciones HomoSapiens Rosario Argentina, 2005.
El Salvador, Ministerio de Educacin. (2007). Comprensin de textos. Mdulo 4 de
la especializacin Docente en Lenguaje de I ciclo y II ciclo de Educacin Bsica.
Matemtica
Abrantes Paulo, Barba Carme, y otros. (2002). La resolucin de problemas en
matemtica. Teora y experiencias. Editorial Gra. Barcelona.
Alsina Claudi, Burgus Carme, y otros. (1998). Enseanza matemticas. Editorial
Gra de Servicios Pedaggicos. Barcelona
Carrillo Mirian; Snchez, Elsa, y otros. (1995). Matemtica 1, 2. Editorial Santillana.
San Jos, Costa Rica.
Casas, Esperanza. (2000). Desarrollo del pensamiento visual y espacial. Festival
matemtico. Editorial Aula Alegre Magisterio. Bogot.
Delgado, Kenneth y Godea, Santa. (1990). Evaluacin y calidad de la educacin.
Nuevos aportes, procesos y resultados. Editorial Magisterio, Colombia.
Dellepiani, Alicia. (1995). Matemtica para la Educacin Inicial. Editorial Magisterio
del Ro de la Plata. Argentina.
Jimnez, Joaqun; Girondo, Luisa. (1993). Clculo en la escuela. Reflexiones y
respuestas para la Enseanza Primaria. Editorial Gra de Servicios Pedaggicos.
Barcelona.
Kerr Jean, Thompson Virginia. (1987). Matemtica para la familia. Editorial
Universidad de California. Printing. Departament. California.
Martnez , Basilio; Mirn Ignacio. (1993). Matemticas Magisterio Casals1 y 2.
Editorial Magisterio Madrid.
Nieto Javier y otros. (1999). Didctica de las matemticas. Editorial Salamanca.
Ortega, Isabel. (1997). Entretenimientos para la clase de Matemtica. Actividades
para la E.G.B. Editorial Magisterio del Ro de la Plata. Argentina
Prez ,Jos; Fernndez, Josefina, y otros. (1990). Nmeros y figuras 1,2. Editorial
Everest. Espaa.
Rodrguez J, Carballo A, y otros. (1997). Razonamiento matemtico. Fomentos y
Referencias bibliogrficas
y sitios web
238
Programa de estudio de cuarto grado
Bogot.
Piaget, J. (2001). Inteligencia y afectividad. AIQUE. Buenos Aires, Argentina.
Pozo, J.J y Antn, Y.P. (2000). Los procedimientos como contenidos escolares. Edeb.
Barcelona, Espaa.
Programa Naciones Unidas para el Desarrollo, PNUD (2005). Plan comunitario;
manejo de riesgos con equidad (Manual). Yucatn, Mxico.
Van Cleave, Janice P. (1994). Qumica para nios y Jvenes: 101 Experimentos
Superdivertidos. Editorial Limusa. Mxico.
Wood, R.W. (1994). Fsica para nios. 49 Experimentos sencillos con calor, acstica,
y de ptica. Mc Graw Hill. Mxico.
Zolugan G. O. L. y otros.(2003). Pedagoga y epistemologa. Editorial Magisterio.
Grupo Pedagoga e Historia. Colombia.
Zubiaurre, S. (1994). Qumica. Gua de Experimentos. 70 experimentos a partir de
11 aos. Envase y moldes de maletn. Grupo Anaya, S.A., Madrid, Espaa.
Estudios Sociales
Alvarenga, Ivo Pramo Las Causas de la Crisis que sufre El Salvador, ANPES, San
Salvador, El Salvador, 1990.
Biagi, Shirley Impacto de los Medios Comunicacin.Editorial THomson S.A. de C.V.
4 Edicin. Mxico, 1999.
Braner, Jeff y otros Conozca El Salvador.Publicaciones.
Calero Perez, Mavilo ON YOUR OWN, Estados Unidos 1997 Potencialidades y
Limitaciones de la Educacin Constructivista Editorial San Marcos,1 Edicin Per
20p2.
Chinchilla, Miguel ngel Geografa Visualizada. El Salvador. Editorial Piedra Santa
1 Impresin. Guatemala, 1993.
Diaz Pineda, Francisco Ecologa y Desarrollo. Editorial Complutense. Madrid,
Espaa, 1996.
Feo Basto, Jos Vicente Geografa de Amrica. LATITUDES. Editorial NORMA. 1
Edicin, Colombia, 2002.
Flores Palencia, Miguel ngel y Martnez Salazar, Manuel Geografa General
Fsica y Poltica.Editorial Harla S.A. de .C.V. Mxico 1993.
Guevara, Ricardo Historia Ilustrada de El Salvador Impresiones Robles, 1 Editorial.
El Salvador 1993.
Lopez, Carlos Gregorio Historia de El Salvador. EQUIPOMAZ, 5 Edicin, El
Salvador, 2002.
Luna, David Manual de Historia Econmica de El Salvador. Editorial Universitaria
El Salvador, 1971.
Martinez Peate, Oscar Historia de El Salvador El Salvador. Del Conflicto armado
a la negociacin 1979-1989. El Salvador los Acuerdos de Paz y el Informe de la
Comisin de la Unidad Editorial Nuevo Enfoque, 1 Edicin, El Salvador, 2007.
Marrero, Levi Viajemos por Amrica. Editorial Cultural Venezolano. 4 Edicin
Venezuela 1979.
Marban, Edilberto Historia de Amerita. Editorial Kapeluzs 2, Buenos Aires,
Argentina, 1969.
Marroquin, Alejandro Dagoberto Panchimalco, Investigacin Sociolgica. Editorial
Universitaria, El Salvador, 1959. Apreciacin Sociolgica de la Independencia. El
Salvador, 1964.
Waiselfisz, Jacobo El Comercio Exterior, El Mercado Comn y la Industrializacin
en relacin al Conflicto Honduras, El Salvador, 1969.
White, Alastair El Salvador, UCA/Editores, San Salvador 1983.
Umaa, Carlos Un Nuevo Mapa para El Salvador, Edicin Tendencias. 1 Edicin,
El Salvador, 1996.
El Salvador Constitucin de la Repblica El Salvador, Edicin Especial 1983. Censo
de El Salvador, 2008 Cdigo de Trabajo. Cdigo de la Familia.
Editorial Televisa INTERNACIONAL Almanaque Mundial 2008 Edicin 54, Mxico,
2008.
Ministerio de Educacin Guas Didcticas sobre Educacin en Poblacin para
Educacin Bsica. 2 Edicin, El Salvador, 1990. Guas Didcticas sobre Educacin
Ambiental. 1997. Libro de texto de Estudios Sociales 5. Coleccin Cipotes 1997.
Federacin Internacional de Planificacin de la Familia, Regin Occidental.
Sexualidad Humana y de Relaciones personales Nueva. York, Estados Unidos de
Amrica, 1983.
Editorial Santillana. Libro de texto de Estudios Sociales, Quinto grado.
UNESCO Gua Metodolgica de Educacin en Derechos Humanos. Ciclos de
Educacin Bsica, Guatemala, 1996. Manual de Educacin en Derechos Humanos.
Instituto Interamericano de Derechos Humanos 2 Edicin. San Jos Costa Rica,
1999.
Revista de Estudios Centroamericano N 254-255. Extraordinaria. Conflicto
Honduras- El Salvador UCA/Editores. El Salvador, Noviembre-Diciembre, 1969.
CENITEC. Centro de Investigaciones Tecnolgicas y Cientficas. El Problema
del Medio Ambiente en El Salvador: Alternativas de Solucin. San Salvador. El
Salvador, 1989.
Educacin Artstica
Averett, F.: Creative Communication, Perfecting Learning Corporation, USA, 2003.
Cervera, J.: Cmo Practicar la Dramatizacin con Nios de Cuatro a Catorce Aos,
Cincel, Madrid, 1981.
Delue, N.: A Class Act, A Creative Drama Guide for Teachers, Good Apple, USA,
1994.
Espaa. Ministerio de Educacin y Ciencia. Secretara de Estado de Educacin:
Primaria, rea de Educacin Artstica. 1992.
Faure, G., y Lascar, J.: El Juego Dramtico en la Escuela, Cincel, Kapeluz, Madrid,
1981.
Velis, C.: Manual Didctico de Teatro estudiantil, Clsicos Roxsil, El Salvador,
1999.
R. Terradellas R. y otros, Formas# 1 y 2, Editorial Vences Vives, S.A. Barcelona,
1999.
J.m. Maideu Puig y otros, Plstica 5, Edeb, Barcelona, 1994.
Edwards, Betty. Color, Penguin Group, New York, 2004
Jerstorp, Karin, Khlmark, Eva. The Textile Design Book, Larks Books,
London,1995.
Arheim, Rudolf. Art and Visual Perception, University California Press, London,
England, 1974.
Crespi, Irene. Lxico tcnico de las artes plsticas, Editorial Universitaria, Buenos
Aires, 1997.
239
Programa de estudio de cuarto grado
Fichner-Rathus, Lois. Understanding Art, Prentice Hall, New Jersey, 1986.
Viadel Marn, Ricardo. Didctica de la Educacin Artstica, Prentice Hall, New
jersey, 2003.
Cerdag, Hugo, Cerdag. Enrique. El Teatro de Tteres en la educacin, Editorial
Andrs Bello, 1989.
Caja, J, Berrocal, J.C. y otros. La Educacin visual y plstica hoy, Editorial Grao,
Barcelona, 2004.
Arheim, R (1993). Consideraciones sobre la educacin artstica. Paids, Barcelona,
1993.
J. Lancaster. Las artes en la educacin primaria, Ediciones Morata, Madrid, 1991.
Real Snchez, Laura, Currculo al servicio el aprendizaje, Algiers Impresores, El
Salvador, 2007.
Real Snchez, Laura, Evaluacin al servicio de los aprendizajes, Algiers
Impresores, El Salvador, 2007.
Coll, Csar; Saravia, Bernab; Valls, Enric, Los contenidos en la reforma. Enseanza
y aprendizaje de conceptos, procedimientos y actitudes, Grupo Santillana de
Ediciones S. A., Espaa, 2001.
Primaria, rea de Educacin Artstica. Gua documental y de recursos, Ministerio
de Educacin y Ciencia, Espaa, 1992.
Daz Barriga, Frida; Hernndez Rojas, Gerardo, Estrategias docentes para
un aprendizaje significativo. Una interpretacin constructivista, McGraw-Hill
Interamericana Editores, Mxico, 1998.
Aretz, Isabel, (relatora), Amrica Latina en su msica, Siglo Veintiuno Editores,
Mxico D.F., 1987.
Froseth, James O., Weikart, Phyllis, Msica y movimiento. Actividades rtmicas en el
aula, Editorial GRA, de IRIF, S. L., Barcelona, 2001.
Baratta, Mara de, Cuscatln Tpico, primera parte, Publicaciones del Ministerio de
Cultura, El Salvador, fotocopia del facsmile, 1991.
Boggs, Stanley H., Apuntes sobre instrumentos de viento pre-colombinos de El
Salvador en Coleccin Antropologa e Historia No. 19, Direccin de Publicaciones
e Impresos, Ministerio de Educacin, San Salvador, s/f.
Rodrguez Legendre, Fidel, De la Historia de la msica a la historia cultural de
la msica en Revista Musical de la Sociedad Venezolana de Musicologa, No. 4,
1995
Salazar, Adolfo, La msica como proceso histrico de su invencin, Editorial Arte y
Literatura, Habana, Cuba, 1987.
Rosales, Marta, Manual de Educacin musical en la Educacin artstica, Editorial
Roxsil, 1999.
Rosales Marta; Valle, Marta Eugenia; De la Ossa, Tatiana, Del concepto a al
expresin, Coordinacin Educativa Centroamericana CECC, Costa Rica, 2002.
Rosales, Marta, Mosaico, libros de texto de Educacin musical para Educacin
Bsica, Editorial Montaas de Fuego, El Salvador, 2005.
Msica, libros de texto para 4to, 5to y sexto grados, EDEB, Barcelona,
Espaa,1993.
Enciclopedia Larousse de la Msica, Argos-Vergara, S. S., Barcelona, Espaa,
1991.
El mundo de la msica, Ocano Grupo Editorial, Barcelona, Espaa, 1999.
Rosales, Marta, La huella prehispnica. Registro de tradiciones de msica y danza
de El Salvador (video). CONCULTURA, El Salvador, 2007.
Sitios web
Sitio de la Red Telemtica Europea para la Educacin http://www.xtec.es/rtee/esp/
rtee.htm
Biblioteca Virtual de Educacin Musical
http://80.34.38.142:8080/bivem/
Revista electrnica de la Universidad Complutense de Madrid de Investigacin en
Educacin musical http://www.ucm.es/info/reciem/
Foro Latinoamericano de Educacin Musical FLADEM Sede Argentina
http://www.fladem.org.ar/news.php Sede Mxico
http://flademmex.org.mx/ -Sitio de la Universidad de Texas USA sobre educacin
musical
http://music.utsa.edu/tdml/ -Gua de Recursos para la educacin musical de la
Universidad de Indiana USA
http://library.music.indiana.edu/music_resources/mused.html
Educacin fsica
Harrow, Anita. Taxonoma del dominio psicomotor, editorial Matiz, Madrid, 1987.
Carranza, Marta. Castellar Gil. La Educacin Fsica en el segundo ciclo de
primaria, gua para el profesorado, Editorial Paidotribo, Barcelona, S.F.
Ritter, Ingerborg, Reh, Johannes. Introduccin a la Teora y Metodologa del
entrenamiento de las capacidades fsicas.Leipzig, 1988. Deutsche Hochschule Fur
Korper Kultur Leipzig.
Hernndez, Mara. y otros Educacin Fsica 3. Editorial Anaya, Educacin.
Barcelona, 1995.
Hernndez, Mara. y otros Educacin Fsica 4 Editorial Anaya, Educacin.
Barcelona Espaa.
Academia FIG. Anatoma para la gimnasia, S.E.S.F.S.L.
Gonzlez, Ma. Esther. Educacin Fsica en primaria, fundamentacion y desarrollo
curricular. Editorial Paidotribo, Barcelona.
Contreras, Onofre. Didctica de la Educacin Fsica, un enfoque constructivista.
INDE publicaciones.
Snchez Fernando. Didctica de la Educacin Fsica printince Hall, Madrid, 2003.
Arto Polanco y otros. La Educacin Fsica en secundaria, su prctica CEPID.
Zaragoza, 1992.
Ministerio de Educacin y Ciencia. Educacin Fsica Primer ciclo, secundaria,
obligatoria, S.E. S.L. 1994.
Ministerio de Educacin. Programa de Estudio de Educacin Fsica, tercer ciclo de
educacin bsica, San Salvador, 1998.
Grupo de Estudio Kinesis. Actividad Fsica y Salud para la Vida, Coleccin Deporte
para todos, Armenia, 2003.
La presente edicin consta de ________________ejemplares, se imprimi con
fondos del Gobierno de la Repblica de El Salvador provenientes
del Fideicomiso para la Educacin, Paz Social y Seguridad.
Impreso en __________________ por ____________________
(fecha)___________________