Anda di halaman 1dari 41

1.

KERAGAMAN BACAAN DALAM QURAN


VARIAN-VARIAN TEKS-TEKS ASLI AL-QURAN: SEJARAH DAN
BAGAIMANA MEMAKNAINYA
OlehDr.UlilAbsharAbdalla

2. TEXTUAL CRITICISM :
SEBUAH PENGANTAR DALAM KAJIAN VARIAN-VARIAN TEKS
PERJANJIAN LAMA
OlehDr.BambangNoorsena,S.H.,M.A.

MakalahdisajikandalamSeminar:
TextualCriticism:MembedahVarianvarianteksAsliAlkitabdanAlQuran
diselenggarakanolehInstituteforSyriacChristianStudies(ISCS),
diRestoranForum,Surabaya,11Juni2013.
KERAGAMANBACAANDALAMQURAN
VARIANVARIANTEKSTEKSASLIALQURAN:SEJARAHDANBAGAIMANAMEMAKNAINYA

OlehDr.UlilAbsharAbdalla

*) Makalah untuk diskusi yang diadakan oleh Institute for Syriac Cultural Studies (ISCS) dengan
temaTextualCriticism:MembedahVarianvarianteksAsliAlkitabdanAlQurandiSurabayapada11Juni
2013.

KONSEPPEWAHYUAN
Makalah ini adalah mengenai keragaman bacaan dalam Quran, atau yang dikenal dengan
qiraatatauhuruf.Tetapisebelumsayamasukketemapokokini,adabaiknyasayabukamakalah
inidenganpembahasansingkattentangkonseppewahyuandalamQuransertabagaimanaKitab
Suci umat Islam ini dikodifikasi atau dikumpulkan dalam sebuah kitab utuh seperti kita lihat
sekarangini.
Istilah yang dipakai dalam Quran untuk menggambarkan proses pwahyuan Tuhan kepada
NabiMuhammadadalahinzldantanzlyangsecaraharafiahberartimenurunkan.Ketika
Tuhan memberikan wahyu kepada Nabi, istilah yang dipakai adalah menurunkan. Yang
menarik, istilah ini bukan saja dipakai dalam konteks pewahyuan Quran kepada Nabi
Muhammad,melainkanjugauntuknabinabilainsebelumdia.DalamQS3:3,misalnya,disebutkan
bahwaTuhanmenurunkan(anzala)TorahdanInjil.Dalamayatini,pemberianwahyukepadaNabi
diartikulasikan dengan istilah nazzala, sementara pewahyuan dua Kitab Suci sebelum Quran,
yakni Torah dan Injil, digambarkan dengan istilah anzala. Duaduanya memiliki makna yang
zama,yaknimenurunkanwahyuyangkemudiandikodifikasikansebagaiKitabSuci.
Dengan kata lain, proses pewahyuan digambarkan dalam Quran sebagai komunikasi di
manasuatupesanturundariataskebawah.Wahyudipandangsebagaisesuatuyangdatangdari
dunia atas, dunia Ketuhanan, menuju ke dunia yang lebih rendah, yakni dunia manusia.
Sebagaimanakitatahu,QuranbukanlahKitabSuciyangturunsekaligusdalambentukbukuyang
sudah jadi. Dia turun secara bertahap. Bagaimana persisnya penahapan itu terjadi? Di kalangan
pengkaji ilmuilmu Quran (ulm alQurn) di era klasik, tema ini menjadi pembahasan yang
cukup luas, dan di antara mereka pun terjadi perdebaan pendapat. Berikut ini adalah ulasan
Ulil Abshar Abdalla
KERAGAMANBACAANDALAMQURAN
2

Edited by Glenn Tapidingan


singkat tentang bagaimana proses penurunan Quran kepada Nabi menurut pandangan para
sarjanaMuslimklasik.
Sebagai wahyu, Quran tersimpan di sebuah tempat yang disebut alLauh alMahfdz
(selanjutnya LM), loh atau tablet yang terjaga. Pada sebuah malam di bulan Ramadan yang
disebutLailatalQadr,MalamPenentuan,Quranturunsekaligussebagaisebuahkitabutuhke
langitterendahyangpalingdekatdenganbumiyangdisebutalsamaaldunya(langitterdekat).
Setelah itu, barulah Quran turun secara bertahap kepada Nabi sesuai dengan kebutuhan sosial.
Ada perbedaan pendapat mengenai bagaimana Quran turun kepada Nabi setelah wahyu itu
bersemayam di langitterdekat. Pendapat pertama mengatakan bahwa Quran diturunkan
pertamatama dari LM ke langitterdekat, dan setelah itu diturunkan kepada Nabi secara
bertahap. Pendapat kedua, Quran turun setiap tahun pada malam Lailat alQadar dalam jumlah
yangcukupuntukwahyuyangdibutuhkanpadatahunitu.Pendapatketiga,QuranturundariLM
secara utuh ke langitterdekat dan kemudian para malaikat penjagawahyu (alhafadzah)
mendiktekanwahyutersebutkepadaMalaikatJibrilselamaduapuluhhari,untukkemudianJibril
menurunkannyakepadaNabiselamakarirkarasulannya.
1

PROSESKODIFIKASIQURAN
Istilah yang umum dipakai dalam sejarah Quran adalah pengumpulan atau jam al
Qurn,bukanpenulisan.ProsespenulisanQuransudahdimulaisejakzamanNabi.Adasejumlah
sahabatyangdikenalsebagaipenuliswahyu(katabatalwahy),salahsatunyayangpalingpopuler
adalah Zaid ibn Thabit. Medium yang dipakai dalam penulisan ini bermacammacam: perkamen,
papan, daun kurma yang telah dikeringkan (semacam papirus/usub) dan tulang binatang. Saat
Nabi wafat, Quran belum terkumpul secara utuh menjadi satu codex atau shahfah. Quran
terserakserakdalamberbagaimediumpenulisan,ataudalamingatansejumlahsahabat.Dengan
katalain,saatNabimeninggal,belumadaQuranresmisebagaimanakitalihatsaatini.Proses
koleksi,pengumpulandankodifikasiQuranbaruberlangsungsetelahNabiwafat.
Pendapat yang luas diikuti oleh umat Islam mengenai proses pengumpulan Quran ini
adalahsebagaiberikut.AdaduatahappengumpulanQuran.Pertamaadalahpengumpulanpada

1
Muhammad Shafa Syaikh Ibrahim Haqqi, Ulum alQuran Min Khilal Muqaddimat alTafasir (Beirut:
MuassasatalRisalah,2004),hlm.5354.
Ulil Abshar Abdalla
KERAGAMANBACAANDALAMQURAN
3

Edited by Glenn Tapidingan


masa Abu Bakar (berkuasa 6334 M), khalifah pertama, dan kedua adalah pada masa Usman,
khalifahketiga.

KodifikasiQuranpadamasaAbuBakar
PeristiwayangmemicupengumpulanQuranpadamasainiadalahadanyaperangYamama
yangterjadipadaDesember632,padabulanbulanpertamaketikaAbuBakarnaiktahtamenjadi
khalifah pertama sepeninggal Nabi. Perang Yamama adalah salah satu dari sejumlah perang
melawan mereka yang murtadd sepeninggal Nabi, yang dikenal dengan hurub alridda.
Dalam perang ini, pasukan Abu Bakar berhadapan dengan kaum pemberontak di bawah
kepemimpinan Musailimah yang dikenal sebagai nabi palsu (impostor; karena itu ia dikenal
dengansebutanalKazzb,SiPembohong).PeranginiterjadidiYamama(SaudiArabiasaatini).
Sejumlah sahabat yang konon dikenal sebagai qurr, pembaca atau penghafal Quran,
gugur dalam perang ini. Peristiwa ini menimbulkan kekhawatiran pada Umar ibn Khattab yang
belakangan nanti akan menggantikan Abu Bakar sebagai khalifah kedua. Jika Quran dibiarkan
dalam keadaan seperti saat itu, yakni tak terkodifikasi secara resmi dalam sebuah Buku atau
Codex, maka,demikianpikiranUmar, dikhawatirkanQuranakanhilangdari mukabumi,jikatak
seluruhnya, ya minimal sebagian besar darinya. Kekhawatiran inilah yang mendorong Umar
untukmendatangiAbuBakardanmengajukanusulagarQurandikumpulkandandibukukan.
Semula Abu Bakar raguragu menerima usulan Umar ini, sebab dia khawatir akan terjatuh
kepadatindakanbidah,yaknitindakanyangtakpernahdicontohkanolehNabi.Sebagaimanakita
tahu, Nabi tak pernah melakukan pembukuan atau kodifikasi atas Quran. Setelah berpikir
beberapa saat, Abu Bakar akhirnya memandang usulan Umar ini sangat baik. Lalu, Abu Bakar
memerintahkanZaidibnThabituntukmemimpinproyekyangteramatberatini.
Abu Bakar bahkan memberikan petunjuk yang spesifik tentang bagaimana proses
pengumpulan harus dikerjakan. Kalian berdua, kata Abu Bakar kepada Umar dan Zaid, harap
dudukdipintumasjid,dansiapapunyangmembawalaporantentangQurandengandisaksikanoleh
duasaksi,makaterimalahdantulislah.
2

Akhirnya, Zaid berhasil mengumpulkan seluruh ayat Quran dalam sebuah buku atau
shahfahyangutuh.Konon,ayatterakhiryangberhasildicatatolehZaidadalahduaayatdalam

2
Muhammad Musthafa alAzami, The History of the Quranic Text: From Revelation to Compilation
(Leicester:UKIslamicAcademy,tt),hal.80.3AlAzami,Ibid,hlm.87.
Ulil Abshar Abdalla
KERAGAMANBACAANDALAMQURAN
4

Edited by Glenn Tapidingan


penutupSurahalTaubah(9):1289.Keduaayatiniditemukanditanganseorangsahabatbernama
AbuKhuzaimahalAnshari.
Quran yang telah berhasil dikumpulkan ini kemudian diserahkan oleh Zaid ibn Thabit
kepada Abu Bakar untuk kemudian disimpan oleh yang terakhir ini sebagai sebuah arsip
negara.SepeninggalAbuBakar,naskahQuraniniberpindahtangankeUmardankemudianke
puterinya,Hafshah,yangjugasalahsatujandaNabi.

KodifikasiQuranpadamasaUsman
Dalam versi yang umum kita jumpai dalam literatur klasik mengenai pengumpulan Quran,
peristiwa yang memicu kembali diskusi soal kodifikasi Quran pada masa ini adalah laporan yang
sampai ke Usman melalui sahabat Hudzaifah ibn alYaman. Yang terakhir ini adalah jenderal
perang yang memimpin pasukan Islam yang melakukan ekspedisi perang ke kawasan Armenia
danAzerbaijan.
Hudzaifah melaporkan kepada Usman tentang terjadinya perbedaan dialek Quran yang
nyarismenimbulkanperpecahandikalangansahabatyangikutperangdiduakasawan tersebut.
Dengan eksplisit, Hudzaifah mengatakan kepada Sang Khalifah, jika keadaan ini tak segera
ditangani,iakhawatirumatIslamakanmengalamiperpecahangaragaraperbedaandalamKitab
Suci,persissepertidialamiolehorangorangYahudidanKristen.
Dengankatalain,padamasaUsmanmunculproblemmengenaiuniformitasataukesatuan
teks Quran karena perbedaan bacaan, dialek, atau hurf dalam Quran. Problem semacam ini
sebetulnya bukanlah hal baru. Pada masa Umar, isu ini sudah muncul. Sebuah riwayat
menyebutkanbahwaUmarmarahkepadasahabatIbnMasudkarenamembacaQurandengan
dialek sebuah suku Arab bernama Hudzail. Kata Umar kepada Ibn Masud, Quran turun
(kepada Nabi) dengan dialek suku Quraisy, maka ajarilah orangorang (di Kufah) membaca Quran
dengandialekitu,bukandengandialekHudzail.
3

Mendengar laporan dari Hudzaifah tersebut, Usman langsung mengumpulkan sejumlah


sahabat di Madinah. Ia mengemukakan pendapatnya bahwa sudah seharusnya umat Islam
bersatu dalam sebuah mushaf sehingga tak terjadi perpecahan di kalangan umat Islam (nara
annajmaa alnasa al mushafin whidin, fala takna firqatun wa l yakna ikhtilfun). Pendapat
Usman ini langsung disepakati oleh semua yang hadir. Kemudian, Usman menyuruh seorang

3
AlAzami,Ibid,hlm.87.
Ulil Abshar Abdalla
KERAGAMANBACAANDALAMQURAN
5

Edited by Glenn Tapidingan


sahabat untuk pergi kepada Hafsah, dan meminta shahfah atau kodex Quran yang ada di
tangannya. Zaid (bersama tiga sahabat lain, yakni Abdullah ibn AlZubair, Sad ibn alsh,
AbdurrahmanibnalHrith)kemudiandiperintahkanuntukmembuatsalinandarikodexHafsah
tersebut. Prinsip kodifikasi yang diikuti oleh Zaid dalam proses pengumpulan Quran kali ini
adalah begitu rupa sehingga jika terjadi perselisihan di antara mereka yang mendapat tugas
kodifikasi kedua ini berkaitan dengan bacaan dan dialek, maka yang harus dijadikan pilihan
utama adalah dialek Quraisy. Setelah proyek ini selesai, kemudian Usman memerintahkan agar
seluruhkodexkodex(shuhuf)lainyangadaditanganparasahabatuntukdihancurkan.
Usman kemudian memerintahkan untuk membuat sejumlah salinan dari Teks Induk yang
kemudiandikenalsebagaiMushafUsmaniataualMushafalImmitu,dandikirimkankesejumlah
kota utama: Kufa, Basrah, Mekah dan Damaskus. Dengan demikian Usman berhasil untuk
pertama kalinya melakukan unifikasi tekstual atas Quran, dan perpecahan umat karena
perbedaandialekbisadihindarkan.

KeragamanbacaandalamQuran
Apakah proyek unifikasi Usman berhasil secara menyeluruh? Secara umum, unifikasi itu
memang berhasil. Tetapi tidaklah seluruhnya. Beberapa shahfah nonUsmani masih bertahan,
dua di antaranya yang terkenal adalah kodex di tangan dua sahabat yang cukup terpandang,
yakni Ibn Masud dan Ubayy ibn Kab. Salah satu kajian paling awal mengenai sejumlah mushaf
dikerjakan olehsarjanaMuslimsejakawal,yangterkenalantara lainadalahkajiandariabadke9
oleh Ibn Abi Dawud: Kitb alMashhif yang terbit sebagai naskah cetak (bukan manuskrip)
untuk pertama kali pada 1937. Dengan kata lain, Kodex Usmani tidaklah menghilangkan kodex
kodex lain. Sebab rekaman tentang perbedaan tekstual dalam Quran sebagaimana dijumpai
pada kodex nonUsmani masih dapat kita baca dalam sejumlah kajian yang dilakukan oleh para
pengkajiQurandieraklasik.
Perbedaanlainyangtakbisadihilangkanadalahberkenaandengandialekataubacaan.Jika
kita telaah kajian para sarjana Islam klasik yang khusus mengkaji Quran, tampak dengan jelas
sekalisuatugambaranberikutini:Quransebagaikorpussucitidaksetunggaldanseseragam
yang kita bayangkan sekarang ini. Fase Quran sebagai teks yang tampak seragam dan tunggal
hanyalah muncul belakangan setelah melalui proses yang panjang selama ratusan tahun. Pada
awalnya, situasi Quran sangat kuat dicirikan dengan pluralisme yang kerap ekstrim dan
cenderungkeotik.SituasiinitercermindalambentukkergamandialekdanbacaanQuran.
Ulil Abshar Abdalla
KERAGAMANBACAANDALAMQURAN
6

Edited by Glenn Tapidingan


Ada beberapa sebab kenapa terjadi perbedaan bacaan ini. Pertama adalah perbedaan
geografis.SetiapkotakotautamadalameraIslamklasik,sepertiMadinah,Mekah,Kufah,Basrah,
Mesir, Damaskus, memiliki guruguru bacaan Quran yang membaca Quran dengan cara yang
berbedabeda, sesuai dengan transmisi riwayat yang mereka terima dan yang bersumber
langsung dari Nabi sendiri. Di Madinah, misalnya, ada guru bacaan Quran yang terkenal, yaitu
Nafi (w. 785 M) yang sampai kepada kita melalui dua versi periwayatan: Warsh (w. 812 M) dan
Qlun(w.835M).DiKufa,salahkotapentingtempatberdiamnyaparapakargurubacaanQuran,
terdapattokohterkenal,yaitushim(w.744M).BacaanAshimsampaikepadakitamelaluidua
riwayatyangterkenal:Hafsh(w.805M)danShuba(w.809M).Duabacaaninilahyangsekarang
populerdikalanganduniaIslamsaatini,terutamabacaanHafsdariAsim(biasadisebutdengan
istilahArab:qirahHafshansim).
Sebab yang lain adalah berkaitan dengan ortografi, rasm, atau penulisan aksara Arab.
Tidak sebagaimana yang dibayangkan oleh sebagian umat Islam saat ini, aksara Arab yang
menjadi medium penulisan Quran tidaklah muncul sekaligus, melainkan berkembang secara
gradual,danmengalamiberbagaitahappenyempurnaan.SaatMushafUsmanidikeluarkansecara
resmi oleh otoritas negara di Madinah dan kemudian disebarkan ke berbagai kota utama di
berbagai kawasan dunia Islam saat itu, ia ditulis dengan aksara Arab yang masih dalam tahap
perkembangannya yang primitif. Karena itu, Kodex Usmani ditulis dalam aksara yang dalam
istilah yang dipakai oleh sarjana pengkaji Quran di Barat disebut scriptio defectiva, atau aksara
yang belum sempurna. Sebagaimana kita tahu, aksara Arab hanya mengenal konsonan tanpa
huruf vokal. Beberapa jenis aksara konsonan dalam tahap awal belum mengalami pembedaan
seperti titik. Misalnya hurufhuruf seperti masih ditulis dengan bentuk yang sama
tanpatitikyangmembedakan.Begitujugadenganhurufhurufsepertiditulisdalambentuk
yang sama tanpa tanda diakritik atau titik. Ada dua tokoh penting yang dikenal karena
kontribusinya dalam penyempurnaan ortografi aksara Arab, yaitu alHajjaj (berkuasa 694 714
M),gubernurIraqpadamasakhalifahAbdulMalikibnMarwan(salahsatukhalifahdalamDinasti
UmayyahyangberpusatdiDamaskus).Dialahyangmerintispengenalantandatitikdanvokalisasi
(shakl) aksara Arab. Tokoh kedua adalah Abu lAswad alDuali (w. 688). AlDuali lah yang
memperkenalkan vokalisasi aksara Arab dalam bentuk titik dengan warna yang berbedabeda
(agakmiripdenganvokalisasidalamaksarabahasaIbraniklasik).
Dengan penyempurnaanpenyempurnaan yang bertahap ini, aksara Arab yang menjadi
medium penulisan Quran dalam versi Mushaf Usmani mengalami tahap akhir yang sempurna
yangdisebutscriptioplena.Bentukterakhirinilahyangkitalihatdalamaksaradanvokalisasiyang
Ulil Abshar Abdalla
KERAGAMANBACAANDALAMQURAN
7

Edited by Glenn Tapidingan


dipakaidalamQurandalamedisiyangpopulerdiduniaIslamsaatini.Akan tetapi,harapdiingat
bahwatahaptahapyangditempuhaksaraArabuntuksampaikepadakondisisempurnainibutuh
waktuyangamatpanjang.
Contohcontoh perbedaan karena soal ortografi ini banyak kita jumpai dalam Quran.
Misalnya,kata(yaqussu)QS6:57dibacayaqussudalamversibacaanNafi,IbnKatsirdan
shim.Sementaraversibacaanlainnyamembacanya(yaqdli).
Tentu saja, kondisi keotik karena perbedaan bacaan ini tidaklah nyaman bagi ortodoksi
Islam pada zamannya. Upaya unifikasi tekstual Quran terus dilakukan, baik oleh otoritas politik
ataupunolehkalanganulamaortodoks,ataukeduanyasekaligus.Biasanya,uniformitastekstual
ini mempunyai keuntungan politik yang cukup signifikan, yakni guna menegakkan kontrol atas
penduduk. Keragaman bacaan Quran, meskipun hanya lah praktek keagamaan yang sifatnya
terbatas dan tak ada sangkutpautnya dengan kehidupan politik, bisa memiliki implikasi politis
yang berbahaya, yaitu munculnya perpecahan sosial dan instabilitas politik. Karena itu, unifikasi
tekstualKitabSuciadalahranahdimanaotoritaspolitikmempunyaikepentinganyangbesar.
Sebagaimanakitalihat,momenmomenpentingdalampenyeragamandanunifikasiQuran
selalu dimulai dengan inisiatif penguasa, meskipun pengusulnya bisa berasal dari kalangan
sipil.ItuterjadipadaeraAbuBakar,khalifahpertama,Umar,Usman,danalHajjaj.
Keragaman bacaan Quran, dengan demikian, merupakan tantangan yang harus diatasi
oleh otoritas politik dan kaum ortodoks. Untuk menggambarkan betapa keotiknya situasi
keragaman bacaan Quran ini, sebuah laporan menuturkan bahwa Syubah, salah satu perawi
shim,gurubacaandarikawasanKufasepertisudahdisebutdiatas,mengkoleksitakkurangdari
delapanbelasriburagambacaandalamseluruhQuran.
4

Salahsatutokohpenting yangberjasadalamstandardisasibacaanadalahIbnMujahid(w.
935 M). Dialah yang melakukan filterisasi atas puluhan model bacaan yang ada pada zamannya
menjadiTujuhBacaanstandaryangdikenaldenganqirahsabah.

4
TaufikAdnanAmal,RekonstruksiSejarahQuran(Yogyakarta:FkBA,2001),hlm.313.
Ulil Abshar Abdalla
KERAGAMANBACAANDALAMQURAN
8

Edited by Glenn Tapidingan


Ketujuhbacaanituadalah:
Wilayah Gurubacaan Perawipertama Perawikedua
Madinah Nafi(785M) Warsh(812M) Qln(835M)
Mekah IbnKathir(737M) alBazzi(854M) Qunbul(903M)
Damaskus Ibnmir(736M) Hishm(859M) IbnDhakwn(856M)
Basra AbuAmr(770M) alDr(860M) alSs(874M)
Kufa shim(744M) Hafsh(805M) Shuba(809M)
Kufa Hamza(772M) Khalaf(843M) Khalld(835M)
Kufa AlKisai(804M) alDr(860M) AbulHrith(854M)

Upaya Ibn Mujahid untuk menyeragamkan bacaan ini tak begitu saja diterima oleh semua
kalangan. Banyak kalangan yang mengkritik upaya dia ini, sebab dengan demikian standardisasi
itubisamemberangusbeberapajenisbacaanyangpopulerdisejumlahkawasan.Karenaitu,ada
upaya dari kalangan ortodoks Islam untuk memperlunak standar versi Ibn Mujahid ini dengan
memperkenalkan Bacaan Sepuluh, bahkan sebagian kalangan yang lain ada yang menambahnya
menjadiBacaanEmpatBelas.KetujuhbacaandiluarTujuhBacaanyangstandardiatasadalah:

Madinah `AbuJafar(747M)
Basrah YaqbalHadrami(820M)
Kufa Khalaf(843M)
Mekah IbnMuhayshin(740M)
Basra AlYazidi(817M)
Basra AlHasanalBashri(728M)
Kufa AlAmash(765M)
5

UnifikasitekstualQurantidakhanyaberhentidisana.Pada1923,sebuahteksQuranedisi
Kairo terbit dengan memakai bacaan Hafsh dari shim. Quran ini dicetak dengan mesin cetak
modern hasil penemuan Johanes Guetenberg dari Jerman yang dikenal dengan mesin
Guetenberg. Berkat mesin modern ini, dimungkinkanlah pencetakan Quran dalam jumlah yang
massaldandalamwaktuyangsingkat.Iniadalahkeadaanyangtakpernahterjadisebelumnya,di
mana Quran biasa digandakan dengan metode tulisan tangan. Edisi Kairo ini mencapai

5
W. Montgomery Watt dan Richard Bell, Introduction to the Quran (Edinburgh: Edinburgh University
Press,1970),hlm.49.
Ulil Abshar Abdalla
KERAGAMANBACAANDALAMQURAN
9

Edited by Glenn Tapidingan


kesuksesan yang luar biasa dan diterima oleh mayoritas umat Islam di seluruh dunia. Edisi Kairo
inipulayangkitapakaidiIndonesiahinggasekarang.
Dengan demikian, mesin Guetenberg telah berjasa dalam mencapai ambisi yang sudah
ada sejak zaman Usman, yaitu uniformitas tekstual Quran. Dengan edisi ini, ragamragam
bacaan (variae lectiones) yang kita kenal dalam tradisi bacaan Quran selama ratusan tahun
hilang.Sekarangini,kemanapunkitapergidiberbagaikawasanduniaIslam,hanyabacaanHafs
darishiminilahyangkitajumpai.BacaanlainyangjugacukuppopuleradalahversiWarshdari
Nafi yang banyak dipakai di kawasan Afrika Utara, tetapi bacaan ini masih kalah populer dari
bacaanyangsebelumnya.
Dengankeadaansemacamini,teksQuransekarangtelahmencapaitahapyangstabilyang
oleh Muhammad Arkoun disebut sebagai korpus yang tertutup. Sekarang ini, problem
keragaman bacaan tak lagi menjadi soal bagi umat Islam. Masalah muncul dari arah lain, yaitu
keragaman tafsir yang tampaknya juga hendak diseragamkan oleh kalangan ortodoks. Tetapi ini
temalaindiluarcakupanpembicaraanmakalahini.****

Halamaninisengajadikosongkan
(Thispageisintentionallyleftblank)
, ,
~

.

~

.

-

-

~

-

,


- -

. ~


\

.






TEXTUALCRITICISM:SEBUAHPENGANTAR
DALAMKAJIANVARIANVARIANTEKSPERJANJIANLAMA

OlehDr.BambangNoorsena,S.H.,M.A.

*) Makalah disajikan dalam Seminar Textual Criticism: Membedah Varianvarian teks Asli Alkitab
danAlQuran,yangdiselenggarakanolehInstituteforSyriacChristianStudies(ISCS),diRestoranForum,
Surabaya,11Juni2013.

1. CATATANPENDAHULUAN
DiduniaKristianiTextualCriticism(KritikSalinan)adalahsalahsatubidangkajianteksKitab
Suci yang sangat penting. Karena teksteks suci itu sampai kepada kita setelah ribuan tahun
dalam perjalanannya yang panjang, tentu saja wajar apabila kemudian muncul berbagai varian
bacaanyangberbeda,karenacarapenulisanyangberubah,atauperbedaanbudayadaripenyalin
dalamprosestranmisiteks.Karenaitu,apabilaterjadivarianteksyangberbeda,bidangkajianini
berupaya menemukan teks yang sedekat mungkin ke bentuk aslinya.
1
Dibandingkan dengan Al
Quran,studikritikteksterhadapAlkitabPerjanjianLama,tentusajajauhlebihkompleks.Karena
serumit apapun studi terhadap AlQuran, kita berhadapan dengan dokumen Kitab Suci yang
berasal dari satu zaman, satu nabi, satu bahasa, dan satu agama. Apabila dibandingkan dengan
studi Kritik Salinan Alkitab, hal tersebut mirip dengan studi terhadap Perjanjian Baru, karena
samasama berasal dari satu zaman, satu Kristus, satu bahasa, yaitu Yunani Koine, dan satu
agama (yaitu Kristen, baik Ortodoks, Katolik, maupun Protestan). Sebaliknya, khusus untuk
Perjanjian Lama, peneliti harus berhadapan dengan satu Kitab Suci yang dimiliki bersama oleh 2
agama, yaitu Yahudi dan Kristen. Sedangkan khusus untuk kelima kitab Musa yang dikenal
dengan Torah (Arab: Taurat), kitab ini bersamasama dirujuk oleh 3 agama yang berbeda dan

1
R. C. Briggs, Interpreting the New Testament Today: An Introduction to Methods and Issues in the
StudyoftheNewTestament,(Nashville:Abingdon,1982),.hlm.4547.
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
12

Edited by Glenn Tapidingan


sudahberpisahkuranglebih2.000tahunyanglalu,yaituYahudi,SamariadanKristen.Kitabkitab
yang oleh orang Kristen disebut Perjanjian Lama adalah kitab Suci yang sama yang oleh umat
Yahudi disebut TANAKH (Torah Nevim Khetuvim) atau Taurat, Nabinabi dan Tulisantulisan.
Meskipun antara Yahudi dan Kristen sudah berpisah sebagai komunitas agama sejak Konsili
YahudidikotaYavnetahun89M,danmengembangkantradisitafsiryangberbedabeda,namun
keduanyamengacukepadaKitabSuciyangsatudansama.
2
KalauAndakeIsrael,danAndamau
membeli Alkitab bahasa Ibrani, tidak perlu Anda harus mencari edisi Kristen. Anda boleh
membaca semua terbitan Kristen maupun Yahudi, karena isinya sama saja, Kecuali dalam edisi
terjemahan, orang Kristen biasanya membaca terjemahan King James Version, New International
Version, dan lainlain, dan orang Yahudi akan mencari Jewish Holy Scriptures. Diakui memang
diantara terjemahan dalam bahasabahasa lain terdapat banyak perbedaan, karena teks sumber
yangdipakainyatidakselalumengacuteksIbrani,melainkankadangdidasarkanatasterjemahan
Yunani kuno, yaitu Septuaginta (LXX) yang berasal dari tahun 280 SM, atau Latin Vulgata (abad
IVM),yanglebihlazimdigunakandiGerejaKatolik.
Meskipun demikian, seiring dengan dialogdialog YahudiKristen, terjemahan antara
keduanya semakin lama semakin mendekat satu sama lain, karena umat Kristen tidak bisa
melepaskan akar keyahudiannya. Untuk memberikan pemahaman awal mengenai berbagai
varian teks Ibrani, karena studi ini terlalu luas, maka saya hanya akan memberikan beberapa
contoh saja: (1) Untuk Perjanjian Lama, akan ditampilkan beberapa varian teks yang masing
masing mewakili 3 klasifikasi TANAKH, yaitu terdiri dari Torah (Taurat), Nevim (Nabinabi) dan
Khetuvim (Tulisantulisan); dan (2) Beberapa Varian teks dari Perjanjian Baru. Seperti sudah
dikemukakan, studi Kritik Teks Perjanjian Baru dapat dikatakan lebih mudah, karena hanya
menyangkutstudidokumendariumat,zaman,danbahasayangsama,sebagaikajianterhadapAl
Quran.

2. KRITIKSALINANPERJANJIANLAMA
2.1. KITABTAURAT:SATUKITAB3AGAMA
Kitab Taurat yang berasal dari Nabi Musa, sampai zaman sekarang ini secara utuhutuh
diterima oleh 3 komunitas agama yang berbeda, yaitu Yahudi, Samaria dan Kristen, yang lebih
jelasdapatdiuraikansebagaiberikut:

2
Joseph A. Fitmyer, SJ.,Response to 101 Questions on the Dead Sea Scrolls (New York: Paulist Press,
1992),hlm.1620.Juga:HershelShanks,UnderstandingtheDeadSeaScrolls(NewYork:VintageBooks,1993),
hlm.8084.
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
13

Edited by Glenn Tapidingan


SContohtulisanIbraniMasoreticdalamCodexAllepo

2.1.1. TeksMasoretik:YahudidanKristen
Istilah Masoretic berasal dari kata
Ibrani mesorah () yang artinya
transmisi (penyalinan). Sebelum dike
temukannya Naskahnaskah Laut Mati
(Qumran),manuskripataunaskahtulisan
tangan tertua yang dimiliki berasal dari
abad IX dan X M, yang lebih dikenal
dengan naskah Masoretic, yaitu Naskah
Geniza, Naskah Leningrad, dan Naskah
Allepo. Berkaitan dengan naskah Allepo,
dapat disebut 2 madzab yang penting: Pertama, madzab Timur atau madzab Babel; dan Kedua,
madzab Barat atau madzab Palestina. Madzab Palestina dapat dibagi lagi dalam 2 cabang, yaitu
BenAsherdanBenNaphtali.Padatahun930M,AronbenMosesbenAshermenerbitkanCodex
Allepo, tetapi baru pada tahun 15241525 setelah ditemukannya mesin cetak, terbit edisi cetak
yang akhirnya dipakai hingga zaman sekarang, dikerjakan oleh Daniel Bomberg di Venesia.
NaskahMasoretikditulisdalamhurufIbraniMasoretik,yangakhirnyaberkembangmenjadihuruf
Ibranimoderensekarang.
Patut dikemukakan pula, bahwa meskipun dunia Kristen mulamula mengacu kepada
beberapa terjemahan kuno, misalnya Septuaginta (LXX) terus dipertahankan di Gereja
OrtodoksYunani,VulgatadiGerejaKatolik,PeshittaAramaikdiGerejaOrtodoksSyriadangereja
gereja rumpun Syria lainnya, dan bahasa Koptik (dialek Bohairi dan Sahidi) di Gereja Ortodoks
Koptik, namun setelah diterbitkan edisi cetak yang lebih luas menyebar, teks Masoretik yang di
kalanganumatYahudimenjadibaikdalamkonteksliturgisatautekssehariharidalampembacaan
Kitab Suci, di kalangan Kristen menjadi Alkitab Studi, sementara dalam liturgi tiaptiap gereja
lebih menggunakan bahasa Aramaik (Gerejagereja Syria), Yunani (Gereja Ortodoks Yunani dan
Katolik Melkit), Latin (Gereja Roma Katolik). Selain pemakaian bahasa Aramaik, Yunani dan
Koptiksebagaibahasaliturgi,bahasaArabsecaraberdampingandigunakandigerejagerejaSyria,
GerejaOrtodoksYunanidanMelkit,danGerejaOrtodoksKoptik,sampaisekarangini.Jadi,dalam
hal rujukan terhadap Taurat, antara Yahudi dan Kristen mengacu kepada teks yang satu dan
sama,sekalipunmengembangkantafsiranteologisyangberbeda.

Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
14

Edited by Glenn Tapidingan

2.1.2. TeksLautMati(Qumran)
Setelah diketemukannya naskah Gulungan Laut Mati (The Dead Sea Scrolls) yang memuat
hampir seluruh Perjanjian Lama (abad III SM1 M), kita mempunyai manuskrip yang berusia
kurang lebih 1.000 tahun lebih tua dari naskah Masoretik. Teks Qumran yang merupakan
peninggalan madzab Eseni ini, ternyata meneguhkan keseksamaan penulisan teksteks
Masoretik. Menilik bentuk aksaranya, Albright dan Cross, muridnya, menyimpulkan bahwa
naskahnaskahQumranyangpalingmudatidaklebihdaritahun135M,danpalingtuaberasaldari
abad III SM (antara tahun 225200 SM). Kesimpulan ini akhirnya dibenarkan dengan temuan
temuan suratsurat Bar Kohba di Wadi Marabaat, sedangkan Bar Kohba adalah pemimpin Israel
yang memperjuangkan kemerdekaan Israel dari penjajahan Romawi pada tahun 135 M, yang
akhirnyaberhasilditumpas,danKotaSuciYerusalemjatuhsamasekaliketanganRomawi.
Jadi,dengantemuanpentinginikitamemilikimanuskripyang1.000tahunlebihtuadari
Manuskrip Masora. Tetapi setelah diselidiki dengan teliti antara 2 naskah tersebut, tidak ada
perbedaan yang cukup berarti. Semua penemuan ini membuktikan bahwa sepanjang zaman,
Allah selalu menjaga firmanfirmanNya sehingga bersih dari segala usaha pemalsuan dan
perubahan tangantangan kotor manusia. Kendatipun harus ditekankan, bahwa Iman Kristen
tidakmemahamiwahyudalammaknayangmekanistik,sehinggaadanyaperbedaanperbedaan
dalam detil pengisahan dalam kitabkitab itu, dipahami karena latarbelakang para penulis dalam
zaman,budayadanbahasayangberbedadankompleksitaspergumulanmerekamasingmasing.
Meskipun ada perbedaanperbedaan kecil akibat proses penyalinan selama ribuan tahun, sama
sekalitidakmengubahpesanasliKitabSuci.
PenemuansejumlahbesarnaskahAlkitabdiLautMatitersebutsangatpentingmaknanya,
bukan hanya bagi umat Kristen, tetapi juga umat Yahudi. Meskipun kedua komunitas iman
tersebut sudah berpisah sejak diselenggarakannya Konsili Yamnia tahun 89 M, namun kedua
agamasamasamamerujukkepadaKitabSuciyangsatudansama.OrangYahudimenolakYesus
sebagai Sang Mesias, sebaliknya orang Kristen percaya bahwa semua yang dinubuatkan kitab
kitab TANAKH (Torah Neviim Khetuvim) atau Taurat, Nabinabi dan Tulisantulisan Kitab Suci
yang sama tetapi disebut berbeda oleh umat Kristen sebagai Kitab Suci Perjanjian Lama, telah
digenapi dengan kedatangan Yeshua HaMashiah (Yesus Sang Mesias) atau Yesus Kristus.
Misalnya, nubuat Yes. 52:1315; 53:112, bagi umat Kristen jelasjelas sudah digenapi dengan
penderitaan Yesus di atas kayu salib, sebagaimana Yesus dan para muridNya meyakini hal itu
(Mat. 26:29; Mrk. 14:212; Luk. 22: 22; 37; 24:2627; Yoh.12:28; Rom. 10:16; 1Pet. 2:2425, dan
sebagainya). Sebaliknya, bagi orang Yahudi, ayatayat yang sama dipahami sebagai nubuat
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
15

Edited by Glenn Tapidingan


S Yes.53:112dalamTeksQumran(100SM),1.000tahunlebihtuadariNaskahMasoreticyangdituliskira
kiraabadIXXM.
penderitaanbangsaIsrael,
3
namunKitabSuciyangdipakaitetapsamadantidakpernahdiubah
ataudipalsukan.Tafsiranayatayatinitentusajaberbeda,namunteksnyatetapsama.

3
Rabbi Nossom Scherman (ed.), Tanakh: The TwentyFour Books of the Bible Newly Translated and
Annotated(MesorahPublishing,2011),hlm.10471049.
W

GulunganKitab
Imamat(11Q1)
yangditulis
dalamaksara
PaleoIbrani
(250150SM)
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
16

Edited by Glenn Tapidingan

2.1.3. TeksSamaria
Taurat Samaria (Inggris: Samaritan Pentateuch atau Samaritan Torah; Ibrani:
, Torah shomronit) merupakan salinan kuno lain dari kelima TauratMusa yang dipakai
oleh komunitas orang Samaria, adalah salah satu teks Ibrani yang ditulis dengan aksara Ibrani
yangdisebutaksaraSamaria.AksarainisangatdekatdenganaksaraPaleoIbrani,yanglebihkuno
dibandingkan dengan aksara Hasmonean, Herodian maupun Masoretik. Ada tambahan bagian
yangdisebutgulunganAbisha(AbishaScroll),yangdipakaidisinagogeSamariadiNablus.Orang
orangSamariapercayagulunganituditulisolehAbisuabinPinehas,cicitNabiHarun(1Taw.6:50),
13 tahun setelah orangorang Israel masuk ke tanah Kanaan di bawah pimpinan Yosua bin Nun.
Namun para pakar Alkitab moderen mengamati bahwa gulungan itu berisi sejumlah karya
berbagai penulis dari abadabad berbeda, yang paling tua sekitar abad ke12 M. Taurat Samaria
mengandung sejumlah perbedaan dengan Teks Masoret, yaitu sumber utama Alkitab Ibrani,
maupunterjemahanPerjanjianLamadalambahasaYunani,Septuaginta.

W
GulunganKitab
NabiYesaya
(1QIsaa)yang
ditulisdalam
aksaraIbrani
Hasmonean
(15050SM)

W
Gulungan
BaitAllah
(11Q19)yang
ditulisdalam
aksaraIbrani
Herodian
(50SM70M)

W
GulunganKata
kataHikmat
Anakanak
Terang(4Q298)
yangditulis
dalamaksara
IbraniCryptograf
yanglazim
digunakandalam
ajaranrahasia
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
17

Edited by Glenn Tapidingan

Sumber perbedaan ini ternyata


bisa dilacak dari pemuliaan
mereka atas Gunung Gerizim, di
Nablus, yang mereka percayai
sebagai Bait Allah sejati. Orang
orang Samaria sebenarnya
berasal dari orang Yahudi di
wilayah utara yang samasama
dibuang ke Babel pada zaman
Nebukatnezar. Karena mereka
menikah dengan sukusuku
Asyur, maka sepulang dari
pembuangan Babel pada tahun
586 SM, mereka ditolak oleh
orang Yahudi untuk turut serta
dalam pembangunan Bait Allah
di Yerusalem (Ezra 4:15). Hal itu
yang menyebabkan mereka
membaca kata Erets HaMoryah
menjadi Erets HaMoreh (Tanah
Moreh), sedangkan dalam
Asheret HaDebarim (Sepuluh Perintah Allah), mereka menempatkan Yos. 8:3133 sebagai
sambungan Kel. 20:17, sehingga meneguhkan posisi teologis mereka bahwa Bait Allah yang
diperintahkan Allah untuk dibangun Musa harus berada di Tanah Moreh di Gerizim, berbareng
denganitumerekamenolakBaitAllahyangdibangunolehRajaDauddanputranya,RajaSalomo,
di Yerusalem (2 Taw. 3:1). Karena isi Kitab Nabinabi (Nevim) dan Tulisantulisan Suci (Khetuvim)
mereka anggap terlalu meninggikan kerajaan selatan (Yerusalem), maka akhirnya mereka
menolakseluruhkitabkitablainselainTauratMusa.

2.2. KESATUANDANKEPENULISANTAURAT
Kelima buku yang disebut Torah dihubungan dengan kepenulisan Musa, dan baru pada
abad XVII fakta ini mulai dipersoalkan. Untuk menghilangkan hubungan Musa dengan Taurat,
dimunculkanteoriteoridokumen,bahwaTaurattidaklebihdarikaryatambalsulamyangpara
S NaskahTorahSamaria,SeferVayiqra(Imamat),diAskalon,
Israel,1189(MS.201).
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
18

Edited by Glenn Tapidingan


penulisnya dilabeli dengan J (Jahwist), E (Elohist), D (Deuteronomist) dan P (Priest).
4
Tetapi
dengansemakinmajunyailmuarcheologi,teorispekulatifinitidakbertahan.Bagianyangdahulu
dianggapgabungandarisumberyangberbedabeda,karenatekstekstersebuttidakbisadinalar
dengan logika abad XVII, dengan penemuan inskripsiinskripsi Nuzi (1900 SM) dan Undang
Undang Lipit Isytar (20001950 SM), ternyata bisa menjelaskan kehidupan keluarga Abraham,
misalnya hukum pengangkatan anak (Kej. 15:14), status hamba yang diambil tuannya untuk
melahirkan anak, dan status anak yang dilahirkannya untuk nyonyanya (Kej. 16:12), seperti
tercemindarikisahAbraham,Sarah,danHagar,dengananak merekaIshak danIsmael,ternyata
bisa dijelaskan sepenuhnya dengan penemuan arkheologi tersebut. Karena itu hipotesa
dokumenteryangspekulatifitu,akhirnyasekarangsudahbanyakditinggalkan.
Meskipun demikian, fakta ada proses rewriting terhadap sumbersumber Taurat tidak
perluharusdisangkal,sebabAlkitabdantradisiYahudikunosendirimeneguhkanhalitu.Faktaitu
menjadi aneh apabila dipahami dengan kacamata karyakarya modern, misalnya fakta bahwa
Kitab Taurat mencatat kematian Musa (Ul. 34). Tradisi kuno Yahudi tidak pernah meragukan
kepenulisan Taurat oleh Musa, dan catatan kematian Musa ditulis oleh Yosua bin Nun,
penggantinya. Seperti Yer. 52 yang tidak ditulis Nabi Yeremia tetap disebut Sefer Yermiyahu
(KitabYeremia),demikianjugaUl.34tidakditulisMusa,tetapitetapdisebutTauratMusa.Dalam
kaitan dengan Kitab Yeremia, dalam Yer. 51:64 jelas disebutkan sampai disinilah perkataan
perkataanYeremia(adhenahdivreiYirmyahu),danselanjutnyaYer.52yangmenyajikanlaporan
mengenai kejatuhan Yerusalem fakta yang juga dilaporkan dalam 2 Raj. 24:1825:21 dan 2 Taw.
36:1121 menurut sumber Yahudi, Baba Bathra 14b, ditulis oleh Barukh, murid Nabi Yeremia.
DemikianpulamulaiUl.34:5Yosuayangmenulis,sepertidisebutdalamsumberYahudi:
WayyamatshemMosheh(danMusamatidisana)ephiserMoshehmatmenunjukkan
bahwaMusatelahmatiketikaayatinidituliskan,WekatavwayyamatshamMosheh
(Lalu bagaimana mungkin Musa menuliskan kematiannya sendiri: Lalu matilah Musa
di sana? Al ad khen katav Mosheh, me khan wa illak katav Yehoshua (Tidak mungkin
Musa menuliskan kematiannya sendiri, karena memang dibuktikan bahwa mulai Ul.
34:5iniYosuayangtelahmenuliskannya).
5

Berkaitan erat dengan hal di atas, catatan Yos. 24:26 yang menyebutkan: Wa yikhtov
YehoshuaetHaDevarimhaelehbeSeferToratElohim...(YosuamenuliskatakataitudalamKitab
Taurat Allah), dengan jelas membuktikan bahwa Yosua sebagai pengganti Musa, memberikan

4
G.HerbertLivingstoon,ThePentateuchinItsCulturalEnvironment(GrandRapids:Baker,1974),hlm.
218221.
5
RabbiNossonSchermanRabbiMeirZlotowitz(ed.),TheTorahwithRashisCommentary:Translated,
AnotatedandElucidated(Brookyn,NewYork:MesorahPublications,Ltd.,1998),hlm.400401.
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
19

Edited by Glenn Tapidingan


catatancatatanpenjelasdariTauratMusa.KebiasaaniniterusberlanjutsampaizamanparaRasul
Kristus,misalnyaSilwanusmenulissuratatasnamagurunya,RasulPetrus.Jadi,dalamhalinikita
harus lebih mempercayai keterangan penulis kuno yang berakar dari budaya dan zaman yang
sama dengan kitabkitab itu, ketimbang mempercayai teori dokumen yang sangat spekulatif,
dikembangkan kesarjanaan moderen yang berakar dari budaya dan zaman yang jauh sekali dari
kitabkitabyangdibahasnya.

2.3. CONTOHVARIANVARIANTEKSTAURAT:MASORETIK,SAMARIADANQUMRAN
Berdasarkanhalyangdiuraikandiatas,makaapabilaadavarianteksyangberbedabahkan
kadangtampaksalingbertentangan,makamelaluikritiktekskitaharusmemilihteksyangpaling
dekat ditinjau dari bahasanya, konteks zamannya, bahkan kalau diperlukan, motif teologis
penyalin dari naskah yang dibahasnya. Misalnya, pernyataan yang terlalu umum dari beberapa
sarjana bahwa ada kurang lebih 6.000 perbedaan antara teks Masoretik Taurat dan Taurat
Samaria, menimbulkan kesan bahwa Taurat sebagai teks suci tidak bisa dipercaya karena sudah
diubahubah atau dipalsukan. Padahal diantara 6.000 perbedaan itu menyangkut ejaan dan cara
penulisan, varian bacaan yang berbeda, atau bagianbagian dari ayat Perjanjian Lama lain yang
dimasukkan ke dalam Taurat Samaria. Karena itu, kalau teks ini dihitung, tentu saja akan
menambahkan jumlah perbedaan antara keduanya. Padahal faktanya, perbedaan antara Taurat
Yahudi dan Taurat Samaria umumnya kecil, dengan perkecualian, misalnya umur orangorang
yang dicatat dalam silsilah dalam Kej. 511, penekanan bahwa tempat berbakti yang menurut
Taurat Samaria adalah di gunung Gerizim, dan perintah monogami yang hanya ada di Taurat
Samaria,dantidakadadalamTauratYahudi(Im.8:18).
Selain perbedaan di atas, selebihnya cara pembacaan yang berbeda, dan parafrasa
parafrasayangdiambildaribagianlainPerjanjianLama,dansamasekalitidakmengubahmakna.
Misalnya, parafrasa yang panjang setelah Kel. 20:17 yang berisi tentang perintah Allah untuk
membangun mezbah yang tidak dipahat di Gunung Gerizim. Pencantuman parafrasa yang
W

TeksTaurat
Samariadalam
bahasaIbrani
aksaraSamaria
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
20

Edited by Glenn Tapidingan


panjang dalam Asheret Haddevarim (10 Perintah Allah) dalam Taurat Samaria ini, sebenarnya
merupakan pengulangan dari Ul. 11:29; 27:28; 1115; dan Ul. 11:29; Kel. 20:25. Perintah yang sama
dengan penekanan Gunung Gerizim, juga disebutkan dalam Yos. 8:3035. Untuk lebih jelasnya,
bunyiprafrasaUl.20:17dalamteksSamariaberbunyi:
Dan ketika TUHAN, Ilahmu membawa engkau ke tanah Kanaan yang akan engkau
kuasai dan engkau duduki, haruslah engkau mendirikan batubatu besar dan
mengapurnya. Dan harulah engkau tuliskan di atas batubatu itu semua perkataan
hukum Taurat ini, dan sesudah engkau menyeberang sungai Yordan, haruslah kamu
mendirikan batubatu ini yang telah Aku perintahkan kepadamu hari ini di Gunung
Gerizim. Juga haruslah kamu membangun mezbah di sana bagi TUHAN Ilahmu,
sebuah altardari batubatu yang tidak boleh kamu olah dengan perkakas besi, kamu
harus mendirikan mezbah bagi TUHAN Ilahmu yang tidak dipahat. Haruslah kamu
mempersembahkan korban bakaran kepada TUHAN Ilahmu, dan juga kamu harus
mempersembahkan korban keselamatan dan memakannya di sana, dan bersukacita
dihadapan TUHAN, Ilahmu. Gunung itu terletak di seberang sungai Yordan, di luar
jalan menuju ke Tanah Kanaan di Arabah, dekat dengan Gilgal, pohon Terbantin di
Moreh,yangterletakdekatSikhem.
6

Dapat disimpulkan bahwa ada atau tidaknya pengulangan beberapa ayat yang disebutkan
dan diletakkan sebagai parafrasa setelah Kel. 20:17, sama sekali tidak ada maknamakna yang
ditambahkan atau dikurangi, atau sesuatu yang bertentangan satu sama lain. Sebab ayat
parafrasa tersebut ternyata hanya merupakan prinsip teologis yang ditekankan, padahal
sumbernyadenganmudahditemukanataudijumpaidalambagianbagianAlkitabyanglain.Untuk
lebih jelasnya, di bawah ini akan dibandingkan ragam teks Maroretik, Samaria dan Qumran, baik
ditinjaudariqiraah(bacaan),carapenulisan,maupunbeberapaperbedaanlain:
2.3.1. AyatayatyangdilafalkanBerbeda,TulisannyaSama
Pelafalan dan tatabahasa Samaria secara radikal berbeda dengan bahasa Ibrani Masoretik
yang dipakai kaum Yahudi. Dalam pelafalan Samaria, aksaraaksara alep, he, het dan ayin dibaca
dengan alaf, y, t, dan in. Karena itu sekalipun sebuah ayat ditulis dalam aksaraaksara yang
persissama,namuncarabacanyamenjadiberbeda:
Kej.11:9,TeksMasoretik




AlkenqarashmahBavelkisham
balalYHWHsfatkalhaarets
umishamhefitsamYHWH
alfenekalhaarets

6
MarkShoulson,TheTorah:JewishandSamaritanVersionCompared(newYork:Evercype,2008),hlm.
204205.
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
21

Edited by Glenn Tapidingan


Kej11:9,TeksSamaria

Alkanqarashemah
Babelkishamaballal
YHWHitasfatwmishamma
ifisimaYHWHal
fenekalhaarets
Artinya: Itulah sebabnya sampai sekarang nama kota itu disebut Babel, karena disitulah
dikacaubalaukan TUHAN bahasa seluruh bumi dan dari situlah mereka diserakkan TUHAN
keseluruhbumi.

2.3.2. AyatayatyangMaknanyaSama,TulisannyaBerbeda
Selain tulisannya sama cara bacaan berbeda seperti ditunjukkan dari teks Masoretik dan
teks Samaria di atas, sebaliknya ada pula ayat yang maknanya sama tetapi ditulis dengan sistem
penulisan yang berbeda. Tentang hal tersebut dapat dicontohkan antara sistem penulisan
Masoretik dengan sistem penulisan Qumran. Perbedaan sistem penulisan semua bisa dilacak
tuntas dalam ilmu ortografi (orthography), yang mempelajari perkembangan ejaan. Karena
bahasa Ibrani kuno tidak memiliki hurufhuruf hidup (vowel letters), pembacaan sebuah teks
kadangkadang dibantu dengan penggunaan konsonan tertentu yang lazim disebut matres
lectionis(harfiah:mothersofreadings),yaituhuruf(waw)dan(yod)untuko/udanI.
Huruf (He) dan huruf glotal yang berhenti ( aleph yang dalam tranliterasi ditulis ), juga
digunakan sebagai huruf hidup a. Beberapa Manuskrip Laut Mati menggunakan pelafalan
penuh (yang disebut teknis plene), dan manuskrip lain mempertahankan pelafalan defective,
yaitu beberapa matres lectionis konvensional yang juga digunakan dalamteksteksAlkitabIbrani
tradisional.
Selanjutnya, beberapa contoh penggunakan lafal plene dalam beberapa naskah Qumran,
misalnya: kwl untuk kl (artinya: semua), hwah untuk hwa (artinya:
dialakilaki),hyahuntukhwa(artinya:diaperempuan),dankyauntuk
ky (artinya: sebab). Sistem pelafalan matres lectionis seperti yang dicontohkan di atas,
tentu saja asing apabila dibandingkan sistem yang berlaku bagi pembacaan Taurat dalam aksara
Ibrani sekarang. Misalnya, kata Elohim (Allah) yang terdiri dari 5 huruf, yaitu alep,
lamed, he, yod dan mem, dalam Naskah Qumran menjadi 6 huruf karena huruf waw
sebagaimatreslectionissetelahhuruflamed.Begitujuga,kata (Tuhan)yangterdiridari4
huruf, yaitu alep, dalet, nun dan yod, ditulis dalam 5 huruf, dengan huruf waw sebagai
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
22

Edited by Glenn Tapidingan


matreslectionisyangditempatkansetelahhurufdalet.Untuklebihjelasnya,dibawahinidapat
ditampilkansalahsatufragmenMazmur136dariQumran(11QPs),danperbedaannyadengancara
penulisanNaskahMasoretikdalampenulis3kata:

S Tiga contoh penuh (pene) ejaan semua melibatkan penggunaan dari ibrani huruf w (waw) untuk
mewakili o panjang. Tiga kata yang ditunjukkan terjadi pada Mazmur 136, ayat 2,5, dan 7. Dalam
gulungan Mazmur dari Qumran gua 11 semuanya ditulis dalam ejaan penuh, dalam teks Masoret
standarMazmur,sepertiyangditemukandalamAlkitabIbranimodern,ketigakataditulistanpalectionis
matres.
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
23

Edited by Glenn Tapidingan


Untuk contoh selanjutnya, di bawah ini akan kita bandingkan teks asli Ibrani dari Sefer
Bereshit dalam aksara PeleoIbrani (abad V SM), Samaritan (abad II SM), Qumran (abad I SM),
danaksaraIbranimodern(dengantandatandabacayangdidasarkanatasnaskahMasoretik):

Kej.1:1,AksaraPaleoIbrani(sebelumtahun585SM)

Kej.1:1,AksaraSamaria(150SM)

Kej.1:1,AksaraIbraniyangdigunakandiQumran(100SM)

Kej.1:1,AksaraIbranidenganTandaBacaMasoretik
:

Transliterasi:BereshitbaraELOHIMethashamaimweethaarets
Kalaudicermati,dalamcontohdiatashanyaadasatuhurufyangberbeda,yaitupadakata
dalam naskah Qumran ada tambahan huruf waw yang ditempatkan setelah huruf
lamed dan sebelum huruf He. Perbedaan semacam ini dapat dibandingkan dengan perubahan
penulisan kata PANTJASILA dalam ejaan Soewandi dengan PANCASILA dalam ejaan sekarang
(EYD). Dalam seluruh naskah yang dikutip di atas, Kej. 1:1 artinya tidak berbeda: Pada mulanya
Allahmenciptakanlangitdanbumi.

Berdasarkanperbandinganbentuk
aksaraantaraPaeloIbranidengan
Samaritan,tampaknyaaksara
Samaritanadalahbentuk
pengembangandariaksaraPaleo
Ibraniyangmulaieksiskirakira
padamasadinastiHasmonaim
(Hasmonean),sekalipunpemisahan
orangSamariatelahterjadikurang
lebih350tahunlebihkunodari
zamanHasmonaimyangdidirikan
olehYudasMakabe.






Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
24

Edited by Glenn Tapidingan

Dalam contoh di atas, dapat disimpulkan bahwa Kej. 1:1 dalam teks Masoretik dan teks
Samariaditulisdalambentukaksarayangberbedadenganjumlahhurufyangsamayaitu29huruf,
sedangkan dalam teks Qumran karena ada perbedaan dalam kasus matres lectionis yang
menggunakanpelafalanpenuhpenulisankataElohim(artinya:Allah)jumlahhurufnya
menjadi 30 huruf (karena o ditulis dengan huruf hidup waw seperti telah diuraikan di atas),
namunketiganaskahtersebutmaknanyatidakberbedaatautetapsama.

2.3.3. AyatayatyangMemangBerbeda:CriticusApparatus
Selanjutnya, harus diakui diantara berbagai teks kuno yang satu sama lain bisa berjarak
lebih dari 1.000 tahun tersebut, memang ada perbedaanperbedaan. Dalam tradisi Yahudi
maupun Kristen, perbedaanperbedaan tersebut tidak pernah diseragamkan dengan cara
menghancurkan teksteks yang berbeda. Misalnya, perbedaan Kej. 22:2 antara Teks Yahudi
Kristen (baik teks YahudiMasoretik, atau terjemahan Yahudi kuno seperti Septuaginta yang
danbukan
S ManuskripQumranyangmemuatKej.1ditemukandiGua4(4QGen9),yangberasaldariperiodeakhir
Hasmonean(100SM).Manuskripinidiawalidenganayat:PadamulanyaAllahmenciptakanlangitdan
bumi. Tema terang dan gelap mulai dari Kej. 1:3, dan selanjutnya dijumpai dalam seluruh Alkitab,
bukankhasmilikkaumEseni.
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
25

Edited by Glenn Tapidingan


diterima oleh umat Kristen) dengan teks Samaria, yaitu Erets HaMoriah (Tanah Moria) menjadi
Erets HaMoreh (Tanah Moreh), adalah persoalan khusus orang Samaria dan tidak pernah terjadi
padamadzabYahudimanapun(Saduki,Parisi,Eseni)maupunKristenselamahampir3.000tahun.
Teks ini dalam tradisi Yahudi lebih dikenal dengan Aqedah Yitshaq (Pengikatan Ishak), yaitu
peringatan penyembelihan Ishak Putra Abraham, yang sejak ribuan tahun diperingati setiap
TahunBaru(RoshHaShanah).PerbedaanteksKej.22:2tersebutlebihjelasnyadikutipdibawahini:
Kej.22:2,TeksMasoretik



WayyomerQahnaetbinkhaetYehidkhaasher
AhavtaetYitshaq,welekhlekaelarets
HaMoryah
Artinya: Dan FirmanNya: Ambillah anakmu yang tunggal, yang engkau kasihi, yakni Ishak,
pergilahketanahMoriyah...

Kej.22:2,TeksSamaria
- - -

WuyaumerQahnaetbinkhaetYehidkha
asher Ahavta et Yitshaq, we lekh leka el arets
HaMoreh

Artinya: Dan FirmanNya: Ambillah anakmu yang tunggal, yang engkau kasihi, yakni Ishak,
pergilahketanahMoreh...

Dalam kasus Kej. 22:2 tidak ada perbedaan mengenai identitas Ishak sebagai Putra
Abraham yang nyaris dikurbankan, baik itu naskah Ibrani Masoretik (Abad IX M), Samaria, dan
W

Kej.22:14
dalambahasa
Ibranimodern
dengan
terhemahan
katademi
katadalam
bahasaArab
(Beirut:
Jamiahal
Anthuniyyah,
2007)
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
26

Edited by Glenn Tapidingan


berbagai terjemahan kuno manapun, seperti Septuaginta (Tahun 280 SM), Targumtargum
Aramaik(antaraabadIISMIIM),VulgataLatin(abadIVM),PeshittaAramaik(abadIIM),Koptik
(AbadIIIM),dansemuanaskahkunolain.TetapimengenaitempatpengurbananPutraAbraham,
naskah Samaria (abad II SM) menyebut Tanah Moreh yang merujuk Gunung Gerizim, dan
bukan Tanah Moria di Yerusalem. Jadi, dalam hal Putra Abraham yang nyaris dikurbankan,
seluruh teks kuno, baik yang dipelihara oleh orang Yahudi, Samaria, maupun Kristen, tidak ada
perbedaan. Sedangkan penyebutan Tanah Moreh hanya terdapat dalam Naskah Samaria,
sedangkanYahudidan Kristenyangsudahberpisahsejaktahun89M(KonsiliYamnia)tidakada
perbedaansamasekali.

2.4. CONTOHVARIANVARIANTEKSNEVIM(KITABNABINABI)DAN
KHETUVIM(TULISANTULISANSUCI)DALAMPERJANJIANLAMA

Meskipun ada varianvarian penulisan dan bacaan dalam proses penyalinannya selama
ribuan tahun, apalagi Kitab Suci yang satu dan sama diwarisi oleh agama yang berbeda (Yahudi
dan Kristen) masingmasing dengan keyakinan teologisnya, perbedaanperbedaan kecil dalam
varianbacaanitusangatmentakjubkan.Misalnya,Yes.53teksQumranyangterdiridari166kata,
hanyaterdapat17huruf,masingmasingdenganrincian:10hurufhanyaperbedaancarapenulisan
yang tidak mengubah arti, 4 huruf adalah kata sambung, dan 3 huruf dari satu kata, yaitu kata
or(terang),yangtidakdijumpaidalamnaskahMasoretikyang1.000tahunlebihmuda.
7

7
Norman Geisler and Willeam Nix, A General Introduction to the Bible (Chicago Moody Publishers,
1986),hlm.263.
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
27

Edited by Glenn Tapidingan

PerbandinganYes.53:11dalamteksQumrandanMasoretik

PerbandinganYes.21:8dalamteksQumrandanMasoretik
Manuskrip Yesaya (1QIsa
a
) ditemukan pada Gua 1 tersebut ditulis di atas perkamen
dengan panjang 734 cm dan lebar 31 cm, ternyata setelah dicocokkan dengan seksama dengan
teksMasoretikyangberusia1.000tahunlebihtua,hanyaterdapatsekitar20ayat,karenatuanya
tulisan tangan hingga tidak jelas lagi atau terhapus sebagian kata dan cara penulian yang
berbeda.
8
Sebagai contoh, dapat dikemukakan Yes. 21:8a dalam naskah Masora dan Naskah
Qumran,yangmenyebabkanperbedaandalamberbagaiterjemahandalambahasabahasalain.

8
JohnC.Trever,ScrollsfromQumranCave1.TheGreatIasiahScrollsTheOrderofCommunityThe
Pesher to Habakkuk (Jerusalem: The Albright Institute ofArcheologicalResearch andthe Scrine of the Book,
1972),hlm.16123.
YES. 53:9-11, TEKS QUMRAN (1QI sa
a
)
(Abad I SM)

TeksQumran:

Sesudahkesusahanjiwanyaiaakan
melihatterangdanmenjadipuas.

TeksMasoret:
(AbadIXXM)

Sesudahkesusahanjiwanyaiaakan
melihatdanmenjadipuas.

Satu
satunya
katayang
tidakada
dalam
naskah
Masoret
Berbedapenulisan:
(tidak)ditulisdengan3huruf:
(huruf waw sebagai
matreslectionis)
Yesaya53adalahbagian
yangseringdiperdebatkan
olehorangYahudidan
Kristen,yaitumengenai
penggenapannubuat
HambaTUHAN(Ebed
Yahwe)yangmenderita.
UmatKristenmenafsirkan
sebagainubuat
penderitaanYesusdikayu
salib,sedangkanorang
Yahudimenafsirkan
sebagaipenderitaan
bangsaYahudi.Perbedaan
tafsirantarakeduaagama
samasekalitidak
mengubahteksYesaya53,
yangadaditanganYahudi
maupunKristen.
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
28

Edited by Glenn Tapidingan


Yes.21:8,TeksMasoretik
- WeyiqraaryehalmitspehAdonay
Artinya: Maka berserulah ia: Seekor singa Tuhan, bahwasanya aku berdiri pada bangun
bangun...(TerjemahanLama).

Then he cried as a lion, Lord, I am standing on my watchower... (New King James


Version).

Yes.21:8,TeksQumran(1QIsa
a
):
- WeyiqraHaRoehalmitspehAdonay...

Artinya: Lalu berserulah orang yang melihat itu: Di tempat peninjauanku, ya Tuanku, aku
berdiri...(TerjemahanBaruLAI).

Then lookout shouted, O Lord, I stand continually upon the watchtower (Literal
TranslationDSS).

Bagaimana kita menjelaskan perbedaan tersebut? Singa dan orang yang melihat?
Ternyata dalam ayat ini ada perbedaan pada naskah Masoretik, yaitu kata Ibrani: HaRoeh
( )menjadiAryeh( ).DisinihurufIbraniH()tidakadapadanaskahMasora,dan2
huruf berikutnya: R () dan A () tertukar tempatnya, sehingga terjadi perbedaan arti. Namun
konteks ayat ini juga jelas, bahwa yang disebut orang yang melihat (HaRoeh, ) adalah
seorang peninjau yang diutus Tuhan, supaya apa yang dilihatnya (yireh, ) haruslah
diberitahukannya (Yes. 21:6). Untuk lebih jelasnya perbedaan teks di atas, bisa diperhatikan
kesejajaranantaraYes.21:6denganYes.21:8ateksQumransebagaiberikut:

Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
29

Edited by Glenn Tapidingan

Berdasarkan perbandingan kedua ayat di atas, jelaslah bahwa seorang peninjau


(HaMtsapeh, ) dalam ayat 6 berkaitan dengan di tempat peninjaanku (Al Mitspeh,
) dalam ayat 8. Dan karena tugas yang diberikan kepada peninjau agar apa yang
dilihatnya (yireh, ) diberitahukannya, maka jelas pula bahwa teks Yes. 21:8a Qumran
orang yang melihat (HaRoeh, ) lebih tepat ketimbang seekor singa (Aryeh, )
dalam naskah Masora. Mulai kapankah kekaburan teks Yes. 21:8 sehingga seluruh teks yang
umum diterima (Textus Receptus) mencantumkan Aryeh, dan bukan , HaRoeh?
Tidak jelas, tetapi minimal pada saat penerjemahan Alkitab Septuaginta abad II SM, teks Ibrani
yang didasarinya sudah berbunyi , Aryeh. Mungkin karena penerjemah Septuaginta
mendapatikejanggalandalamteksini,makakata ,Aryehdipahaminyasebagainamadiri
(propername)dariseorangpeninjaudalamayat6,yaitu(Ourias),sebagaiberikut:
:
.
Sebab beginilah firman Tuhan kepadaku: Pergilah,
tempatkanlah seorang peninjau apa yang dilihatnya
haruslah diberitahukannya.

Kemudianberserulahorangyangmelihatitu:
Ditempatpeninjauanku,yatuanku
Yesaya21:8a,4QIsa
a

Yesaya21:6tidakada
perbedaan
Yes.21:68
a
Manuskrip
Qumran,ayat8a
memuatkata
HaRoeh
bukanAryeh



Masalah: Adaketidakjelasanataukekaburannaskahkunokarenaribuantahundalam
prosespenyalinan.
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
30

Edited by Glenn Tapidingan

.
KaikalesonOuriaseis
tenskopiavKuriou..
Artinya:MakaberserulahUrias:Ditempatpeninjauanku,YaTuanku..(Yes.21:8,LXX).
9

Sebaliknya,dalamAlkitabbahasaLatin(Vulgata)St.Hieronimus(abadIVM)mengikutiteks
Masoretik: leo (singa) sebagai berikut: Et clamavit leo super specula Domini, ego sum stans
(Dan berserulah singa itu: Dari menara ini aku berdiri, Ya tuanku..
10
Bacaan yang diragukan
selama berabadabad dalam teks asli Ibrani, dan diterjemahkan secara berbedabeda dalam
berbagai Alkitab terjemahan kuno, dengan diketemukannya naskah Qumran kini bukan menjadi
kesulitan lagi. Dengan Naskah Gulungan Laut Mati (The Dead Sea Scrolls) sekarang kita
mempunyai bacaan asli Nabi Yesaya yang selama kurang lebih 1.600 tahun semenjak zaman
Nabi Yesaya (700 SM) hingga naskah Masoretik tertua (9001.000 M) telah diketemukan
kembali.

2.5. PEMELIHARAANKEASLIANTEKSALKITAB:
DARIPOLAMASORETIKKETIV(YANGTERTULIS)DANQERE(BACAANDIUSULKAN)
HINGGA CRITICUS APPARATUS DALAM EDISI KRISTIS BIBLIA HEBRAICA
STUTTGARTENSIA.

Jauh sebelum zaman Kristen, upayaupaya yang serius untuk memelihara keaslian Kitab
Suci ternyata sudah berkembang. Kitab Talmud, yang merupakan kompilasi tradisi Yahudi,
menyebut para Soferim, karena begitu telitinya mereka dalam menyalin Kitabkitab suci sampai
sampai harus menghitung hurufhuruf Taurat (cf. Qiddusim Bab 30a). Kata Soferim berasal dari
akar kata sfr, artinya menghitung atau menjumlah (band. pemakaian akar kata ini dalam
Kej.15:5).PadazamanKristustidakpernahmenyangkalreputasiahliahliTauratdanimamimam
Farisi karena keseksamaan mereka dalam kegiatan penyalinan dan pemeliharaan Kitab Suci,
sehinggamerekadisebuttelahmendudukikursiMusa.Walaupundemikian,Kristusmengecam
kemunafikan mereka seraya menuntut kita supaya menuruti ajaran mereka, tetapi jangan
mengikuti perbuatan mereka. Maksudnya, pengajaran mereka bisa diterima, tetapi perbuatan
merekatidaksesuaidenganapayangmerekaajarkan(Mat.23:14).

9
Isa21:121,SeptuagintadimuatdalamJohnR.KohlenbergerIII(ed.),TheNIVTriglotOldTestament
(GrandRapids:ZondervanCoorporation,1981).

10
RogerGryson(ed.),BibliaSacraVulgata(Suttgart:DeutscheBibelsellschaft,1994),hlm.1116.
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
31

Edited by Glenn Tapidingan

MengenaikegiatanSoferimyangdapatdipercayakesaksamaannyaitusecaraimplisitdiakui
pula oleh Yesus, antara lain dibuktikan dari ungkapanNya: satu iota atau satu titikpun tidak
ditiadakan dari Hukum Taurat, sebelum semuanya terjadi (Mat. 5:17). Istilah iota dalam sabda
Yesus tersebut, menunjuk huruf Ibrani yang terkecil (yod) yang bentuknya menyerupai titik.
Jelasnya, idiom yang dipakai Yesus itu mengacu pada pengakuanNya atas reputasi ahli Taurat,
karena ketelitian dan kecermatan mereka dalam proses transmisi atau penerusan manuskripnya
dari tangan ke tangan secara tradisional. Selanjutnya, apabila para penurun tradisi tertulis awal
disebutSoferim(imadalahbentukplural,maksudnyaparapenulis),makakitabkitabsuciitu
sendiri disebut Sefarim (tulisantulisan). Istilah sefer yang menunjuk kitabkitab tertulis, juga
dilestarikan dalam bahasa Arab yang lazim digunakan umat Kristen di Timur Tengah untuk
W

ManuskripAllepo
dengancatatan
tengahdanbawah
barisdariteksstandar
yangmenunjukkan
sikapparaMasorayang
ekstrahatihati.

Apabilamenjumpai
bacaanyangkurang
jelas,merekatidak
beranimengubah
begitusaja,tetapi
mencantumkanQere
(bacaan)yang
diusulkandengan
membiarkanayatitu
apaadanyayanglazim
disebutKetiv(yang
tertulis).
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
32

Edited by Glenn Tapidingan


menunjuk kitabkitab dalam Alkitab. Misalnya: Sifru AtTakwn (Kitab Kejadian), Sifru alKhurj
(KitabKeluaran),SifrualMulkatsTsn(KitabRajarajakedua),dansebagainya.
11

Begitu juga, sebuah ayat dalam AlQuran menyebut kata asfar, yang merujuk kitabkitab
Yahudi, yakni sebagai sindiran kepada mereka yang dibebani Taurat tapi tidak mampu
mengamalkannya: kamatsali alhimari yahmilu asfar. Artinya: Keledai yang mengangkut
kitabkitab (Q.s. alJumuah/62:5). Memang, ungkapan itu sudah ada dalam Talmud Yahudi
sendiri, yang dalam bahasa Ibrani berbunyi: Hamor nose sefarim. Artinya: Keledai yang
membawa kitabkitab.
12
Kembali pada keseksamaan penyalinan kitabkitab Allah, Ezra yang
berhasil mengembalikan Taurat sebagai inti dan pusat keagamaan Yahudi pada abad ke6 SM,
adalahorangyangpertamadigelariHaSofer(sangpenulis).Sejakitulahtradisipenerusantertulis
Kitab Suci digelari Soferim, yang berlangsung terus sampai abad V M. Sedangkan setelah sekitar
tahun 5001.000 M, peran itu digantikan oleh para Masora. Metode yang dikembangkan untuk
menjagafirmanfirmanIlahiitutidakjauhberbeda,tetapimalahanlebihdetillagi.Begitutelitinya
mereka dalam menerima Kitab suci tanpa perubahan, sehingga apabila mereka menemui
keraguan dalam membaca teks yang kabur karena tidak jelasnya sebuah tulisan tangan atau
kaburnyatintakarenatuanyanaskah yangbersangkutan,merekatetapmembiarkansepertiapa
adanya. Jika mereka merasa perlu melakukan perbaikan, mereka hanya menaruhnya di lajur tepi
manuskripdengantandakhusus.Misalnya,hurufIbrani (Q)dan(K)maksudnyaQere(bacaan
yang diusulkan), dan Ketiv (yang tertulis dalam naskah). Contohnya, ahliahli Taurat meragukan
kata HaSharemotdalamYer.31:40yangberbunyi:
We kal haShademot ad mahal Qidron
Artinya:dansegenaptanahdatarditepisungaiKidron.

ParapenyalinNaskahMasorameragukankata: HaSharemotkarenakataitutidak
dijumpaidalambahasaIbrani,karenaitudibarisbawahdengankodeQ(Qere)denganpenunjuk
ayat 40, diusulkan bacaan alternatifnya: HaShademot, yang artinya fields, lembah
atautanah datar.Bacaanalternatif itupun,tidakdiusulkansekenanyasaja,tetapiberdasarkan
naskahnaskah terjemahan kuno, misalnya Septuaginta/LXX (Yunani) atau Peshitta (Aramaik/

11
Arabic Bible: AlKitb alMaqaddas alAhd alQadm wa alAhd alJadd (Beirut: Dr AlKitb al
MaqaddasfAsySyarqalAusath,1992).

12
Lihat: Article Yahudi (H. Speyer) in H.A.R. Gibb and J.H. Kramers (ed.), Shorter Encyclopaedia of
Islam(LeidenLondon:E.J.BrillandLusac&CO,1961),hlm.639.
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
33

Edited by Glenn Tapidingan



Q (Qere, bacaan) diusulkan HaShademot
(lembah,tanahdatar).
K (Ketiv, tertulis) dalam teks: HaSharemot, meskipun kata ini
tidak ada artinya dalam bahasa Ibrani, tetapi para penyalin (Masora) tidak
beranimengubahnya.
Syriac).PerbedaantersebutdisebabkankarenamiripnyakeduahurufIbraniresh(R)dandalet
(D),lebihlebihapabilakeduahurufitudituliskandengantangan.
13

13
Perbedaanperbedaantekssepertidiatasdenganjujurdiakuidansecaralengkapdapatdiikutipada
terbitan R. Kittel (ed.), Biblia Hebraica Stugartensia (Stuttgart, Germany: Deutsche Bibelgesellschaft, 1990),
hlm.847.
Yeremia31:3840


Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
34

Edited by Glenn Tapidingan

Dibawahteks
standar
yangumum
diterima
(TextusReceptus)
dimuatsecara
jujur
Varianteksyang
berbedanamun
tidak
mempengaruhi
isinya.
Tidakada
pemalsuan,
semuaperbedaan
didatasecarajujur
dan
terbuka
S Yesaya21:717dalamAlkitabTerbitanKritisyangmencantumkanCriticusApparatusmenurutBiblia
HebraicaStuttgartensia(BHS).
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
35

Edited by Glenn Tapidingan


2.6. AHAZIAMENJADIRAJAUMUR22TAHUNATAU42TAHUN?:
SEBUAHKASUS2RAJ.8:26DAN2TAW.22:2

2.6.1. DuateksyangMemangBerbeda,BukanKesalahanProsesPenyalinan
Selainproblemvarianteksbisadilacakdariprosespenyalinanselamaribuantahun,banyak
pulateksteksyangmemangberbeda.Prinsipyangharusdipegang,apabilasebuahteksaslitidak
berbeda dalam naskah kuno manapun juga, bahkan dalam naskahnaskah terjemahan kuno juga
tidak ada masalah apapun, maka harus dianggap bahwa teks tersebut memang berbeda dari
penulis yang berbeda. Dalam hal ini perbedaan itu harus dicari bukan dengan menggunakan
metodekritiksalinanlagi,melainkanharusmenggalidatadatasejarahdanarkheologiyangse
zaman.Seringkaliangkatahunatauusiayangyangberbedabedadaritokohtokohatausejarah
yangdiuraikanAlkitab,antaralainbisadilacakdariperhitungankalenderyangberbeda,ataujuga
karenaterjemahanyang tidaktepat. Misalnya,mengenaiumurAhaziaada yangmempersoalkan
perbedaan 2 Raj 8:26 dengan 2 Taw 22:2 mengenai umur Ahazia ketika diangkat menjadi Raja.
Untuklebihjelasnyademikianperbedaanantarakeduaayatyangdimaksudmenurutterjemahan
LAI1974:
Ia berumur dua puluh dua tahun pada waktu ia menjadi raja dan setahun lamanya ia
memerintahdiYerusalem.NamaibunyaialahAtalya,cucuOmrirajaIsrael(2Raj8:26).

Ahazia berumur empat puluh dua tahun pada waktu ia menjadi raja dan setahun
lamanyaiamemerintahdiYerusalem.NamaibunyaialahAtalya,cucuOmri(2Taw22:2).

Gleason L. Acher dalam Encyclopedia of Bible Difficulties, menanggap bahwa telah terjadi
kesalahan salin dalam 2 Taw. 22:2. Masalahnya, dalam seluruh teks kuno Ibrani tidak pernah ada
masalah, sehingga kita harus menganggap bahwa memang dalam 2 Taw 22:2 aslinya memang
tertulisempat puluhduatahun.Untuklebihjelasnya,dalambahasaIbrani2Raj8:26berbunyi
sebagaiberikut:
-


Ben`erm tayim nh ahazyh
vmolk wnh ahat mlak brlaim
wm im `atalyh batOmr melek
yirl.
Terjemahanharfiah: Ahazia berumur dua puluh dua tahun pada waktu ia menjadi raja dan
setahun lamanya ia memerintah di Yerusalem. Nama ibunya ialah Atalya,
cucuOmri,rajaIsrael(2Raj8:26).

Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
36

Edited by Glenn Tapidingan


Sedangkan 2 Taw 22:2 disebutkan bunyi yang sama, meskipun konteksnya berbeda.
Sebelumnya, dalam 2 Taw 22:1 dijelaskan bahwa penduduk Yerusalem mengangkat Ahazia,
anaknya yang bungsu, menjadi raja menggantikan Yoram, karena semua anaknya yang tua telah
dibunuholehgerombolanyangdatangketempatperkemahanbersamasamaorangorangArab.
Selanjutnya2Taw22:2dalamteksasliIbraniberbunyi:

-


Benarb`m tayim nh ahazyh
vmlk wnh ahat mlak brlaim
wmim`atalyhbtOmr.
Terjemahanharfiah: Berumurlah empat puluh dua tahun ketika Ahazia menjadi raja, dan
setahun lamanya ia memerintah di Yerusalem. Nama ibunya ialah Atalya,
cucuOmri(2Taw.22:2).

Kata ben (anak, keturunan) yang mengawali kedua ayat di atas bisa menunjuk usia
Ahazia ketika menjadi raja, tetapi juga usia dinasti Omri ketika Ahazia menjadi raja. Karena itu,
maka 2 Taw 22:2 dapat juga diterjemahkan sebagai berikut: Umur dinasti Omri adalah empat
puluh dua tahun ketika Ahazia menjadi raja, dan setahun lamanya ia memerintah di Yerusalem.
Nama ibunya ialah Atalya, cucu Omri (2 Taw 22:2). Dengan memperbaiki terjemahan 2 Taw 22:2
seperti di atas ternyata cocok dengan usia dinasti Omri sampai Ahazia naik tahta kerajaan
Yehuda,sepertitampakdariTabeldibawahini:

Generasi Nama
Lama
Pemerintahan
Referensi
Usia
Dinasti
I Omri(RajaIsrael) 12tahun IRaja16:23 12tahun
II Ahab(RajaIsrael) 22tahun IRaja16:29 34tahun
III Yoram(RajaYehuda) 8tahun IITaw.21:20 42tahun
IV Ahazia(RajaYehuda) 2tahun IITaw.22:2 43tahun

Beberapa penerjemah Alkitab menyangka adanya kesalahan dalam salinan, sehingga


meskipun dengan mencantumkan catatan kaki bahwa teks asli Ibrani memang berbunyi empat
puluh dua, New International Version (NIV) menerjemahkan dengan dua puluh dua. Rupanya,
dugaanadanyasalahsalininisudahlamasekalisehinggaterjemahanSeptuaginta(LXX)dariabad
ketigaSMmenerjemahkan:
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
37

Edited by Glenn Tapidingan

hneikosietnokhozias
ebasileusenkaieniautonhena
ebasileusenenhierousalmkai
onomatmtriautougotholia
thugatrambri
Artinya: Dan berusia dua puluh dua tahun ketika Ahazia menjadi raja, setahun lamanya
memerintahdiYerusalem.NamaibunyaAtalya,anakOmri
14

Menurut saya, terjemahan tidak bisa mendasarkan kepada terjemahan, meskipun itu
terjemahan kuna. Sebab keberadaaan teks asli Ibrani memang terbukti, dibandingkan dengan
LXX dan terjemahan manapun. Lagi pula, dalam semua naskah Ibrani tidak pernah ada masalah
dengan 2 Taw 22:2 ditinjau dari kritik salinan (textual criticism). Karena itu, kita harus menggali
lebihdalam,baikdariteksteksAlkitabsendiri,maupundarisumbersumbersejarahdiluarAlkitab
mengenailamanyadinastiOmriberkuasa.
2.6.2. DukunganSejarahDiLuarAlkitab
Secara umum mengenai kerumitan perbedaan perhitungan tahuntahun kekuasaan raja
raja Israel, ternyata ditemukan juga dalam prasastiprasasti di luar Alkitab. Misalnya, mengenai
dua macam kalender yang berbeda antara Israel dan Yehuda, secara implisit ternyata dikuatkan
olehtemuankalenderGeser,yangmenghitungtahundaribulanTishri,sekitarOktober.Kalender
Geserditemukantahun1908,ditulisdalambahasaIbranikunoyangmenggunakanaksaraproto
Sinaitikdiataslempenganbatukapurlunak,dansetelahditelitiberasaldariabadXSM,taklama
setelah zaman Raja Salomo. Mungkin kalender berasal dari pelajaran sekolah pada zaman itu.
Bunyi inskripsi Kalender Geser: Dua bulan musim panen, sebulan musim menabur, dua bulan
musimmenaburakhir,dansebulanmusimmemotongbatang.
15
Katayangditerjemahkanmusim
panen ternyata berkaitan dengan Hari Raya Penuaian (Hag HaQatsr) dalam
Alkitab (Kel. 23:16), yang membuktikan bahwa kalender masyarakat agraris yang dimulai dari
musim gugur (SeptemberOktober). Kalender ini setelah Israel terpecah menjadi dua,
dipertahankan di wilayah Yehuda, yang menghitung tahun baru dari bulan Tishri. Sedangkan
Israel utara yang berpusat di Samaria, mengembangkan sistem kalender lain yang perhitungan
tahun barunya dimulai dari bulan Nisan, sekitar bulan April. Perbedaan angkaangka yang sering

14
Lihat:ParaleipomenonB22:2Septuaginta(LXX)dalamJohnR.KohenbergerIII(ed.),TheNIVTrigot
OldTestament(Michigan:TheZondervanPublishingHouse,1994).

15
Article Geser dalam Trent C. Butler (ed.), Holman Bible Dictionary (Nasville: Holman Bible
Publishers,1991),hlm.548549.
TE

muncul
sebelum
Israel da
IsraelRa
Se
pemerin
ditemuk
faktanya
yang be
keteran
di atasn
Alkitab
Israel da
(34 bar
Tengah.
Pr
Alkitab.
Melek Y
yangrel
O
m
m
pe
ka
di
Ke
M
A
pe
m
(T

Pe
Moab, s

16
2002),hl
17
diakses1
EXTUALCRI
dalam 12 T
m pembuang
an Yehuda,
ayatersebut
elanjutnya,
ntahan Ahaz
kan juga da
a mengapa
erisi sinkret
ganAlkitab
nya (1 Raj 16
disebut Dib
an kemudian
ris) dari zam
.
rasastiinide
Namanya d
Ysrail (Omr
levandenga
Omri,RajaIs
marah terhad
menindas Mo
emerintahan
alah. Kemud
i sana samp
emudian Ka
Maka berang
ku menaklu
erempuan
mempersemb
TUHAN)dan
ernyataan M
serta perlaw

GleasonL.Ar
m.225.
Lihat: Mes
11April2011.
ITICISM:Seb
Tawarikh yan
gan Babel,
serta perbe
t.
16

untuk meny
zia, khususn
alam sumbe
dinasti Omr
isme agama
bahwaMoa
6:3133). Pras
on), untuk m
n pembangu
mannya yang
enganjelasm
dieja dalam
ri Raja Israe
anIsrael,khu
srael,untuk
dap negerin
oab. Ia (a
nku. Namun
dian Omri ju
pai setenga
amos berkat
gkatlah aku
ukkannya se
dan perem
bahkannya b
nkuinjakinja
Mesha tenta
wanannya te

rcher,Encyclo
sha Stele (M
buahPengan
ng ditulis se
antara lain
edaan sistim
yelidiki lebih
nya dalam
er sejarah n
ri ini menda
a Yahudi de
ab,anakOm
sasti Moab
memperinga
unan banya
g pernah d
menyebutn
bahasa Ibra
el). Terjemah
ususnyaRaja
beberapala
nya. Omri da
anak pengga
n aku berha
uga telah me
ah masa pe
ta kepadak
malam itu d
rta membun
mpuan asing
bagi AstarK
akdidepanD
ang peninda
erhadap Isra

opediaofBible
Moabite Stone
ntarDalamK
etelah pemb
bisa dilacak
perhitunga
h mendalam
kaitannya d
nonBiblikal,
tangkan mu
engan peny
mri,telahme
berisi sesum
ati pembero
k kota pent
itemukan d
namaOmri,R
ani aksara P
han baris 4
aOmridank
amatelahm
an anak pen
anti Omri i
sil menguas
erampas har
emerintahan
u: Pergilah
dan menyer
nuh semuan
g, serta bu
Kamos. Dari
DewaKamo
asan yang d
ael secara t
eDifficultiesb
e) dimuat da
KajianVaria
buangan Bab
k dari perbe
n penobata
m misteri an
dengan dina
yaitu pras
urka Tuhan,
yembahan B
endirikanku
mbar Mesha
ontakannya
ing (2 Raj. 3
di negerineg
RajaIsraelya
ProtoSinatik
8, dan 1418
keturunanny
menekanMoa
nggantinya j
tu) mengat
sainya dan s
rta benda n
anaknya, y
h, dan tang
rbunya dari
nya, 7.000 la
udakbudak
sana kuam
s.
17

ilakukan Om
tepat meneg
basedontheN
alam en.wikip
Bam
anVarianTe
bel dan 12 R
edaan kalen
an Raja di du
ngka 42 yan
asti Omri, R
sasti Moab.
temuan pra
Baal dan As
uilBaaldanp
a, Raja Moa
melepaskan
3:45). Inilah
geri sebelah
angkejahat
k
8 dari prasa
yaberbunyi:
ab,sehingga
juga berteka
takan hal it
seisi rumahn
egeri Mada
yaitu selam
kaplah Neb
fajar hingg
akilaki dan
perempua
bil bejanab
mri dan ketu
guhkan cata
NIVandNASB
pedia.org/wik
mbang No
eksPerjanji
Edited by Glenn
Rajaraja yan
der yang d
ua kerajaan
ng dikaitkan
Raja Israel,
Sedangkan
asasti Kuntil
hera, memb
patungDew
b, di Dhiban
n diri dari ke
prasasti ter
h timur pan
annyadicata
asti tersebut

aDewaKam
ad: Aku ak
tu pada ma
nya, dan Isr
ba dan tingg
ma 40 tahun
o dari Israe
ga tengah ha
lakilaki asin
an. Aku te
bejana Yahw
urunannya t
atan sejarah
(Michigan:Zo
ki/File:Mesha_
oorsena
anLama
3
nn Tapidingan
ng ditulis
ipakai di
pecahan
dengan
ternyata
n rincian
ed Ajrud
buktikan
wiAshera
n (dalam
ekuasaan
rpanjang
ntai Laut
atdalam
Omri,
t, bagian
mos
kan
asa
ael
gal
n
el!
ari.
ng,
lah
weh
terhadap
h Alkitab
ondervan,
_stele.jpg,
38
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
39

Edited by Glenn Tapidingan


dalam 2 Raj 1:1 dan 3:45. Kemenangankemenangan yang diklaim oleh Mesha mestinya benar,
meskipuntidakdijelaskansecararincidalamAlkitab,sebabyangmenjadiperhatianAlkitabadalah
kisahkisahNabiElisa,ketikaSangNabimenubuatkantentangrajarajaIsraeldanYehuda.Alkitab
mencatatbahwaketikaMesha,RajaMoab,melihatperangituberatbaginya,makaiamengambil
700 orang pemegang pedang menerobos ke jurusan Edom, tetapi tidak berhasil (2 Raj 3:26).
Catatan Alkitab ini membuktikan bahwa mulamula Mesha tidak berhasil, tetapi begitu ia
mengorbankan anak bungsunya di atas mezbah kurban bakaran, orangorang Israel menjadi
sangat gusar dan meninggalkan dia dan pulang ke negerinya. Mundurnya Israel ini, oleh raja
Moab diklaim sebagai kemenangannya atas Israel, yang kemudian dirincinya bahwa telah jatuh
korban sebanyak 7.000 orang. Meskipun para ahli masih mempersoalkan rincian faktafakta
antara Alkitab dan prasasti Moab, namun dalam garis besar bukti prasasti ini secara luar biasa
meneguhkanfaktakesejahteraanAlkitab.
Rincian fakta yang masih diperdebatkan itu antara lain Mesha, raja Edom, memberontak
kepada Israel ketika Ahab sudah mati (2 Rajaraja 1:1, dan 3:5), sedangkan dalam prasasti Moab,
MeshamengklaimbahwaiatelahmengalahkananakOmridanseisirumahnya:Namunakutelah
berhasil menguasai dia (anak Omri, pen.), dan seisi rumahnya. Masalah ini dapat dijelaskan,
bahwa kata anak dalam bahasabahasa Timur Tengah kuno, tidak hanya berarti anak
langsung, tetapi juga bisa berarti cucu, keturunan. Misalnya, Yesus disebut Anak Daud,
maksudnya keturunan Daud (Mat. 1:1). Begitu juga anak Omri bisa berarti Ahab, anaknya,
begitujugaYoram,cucunya.Dan2Rajaraja3:56mencatatbahwapemberontakanMoabterjadi
padamasaYoram,RajaIsrael.
Selanjutnya,prasastiMoabjugamencatatbahwapenjarahanterhadaphartabendanegeri
Madeba telah terjadi mulai dari masa Omri sampai pertengahan masa pemerintahan anak
keturunannya,yaituselama40tahun.BerdasarkanlamanyadinastiOmriberkuasadalamcatatan
Alkitab dan sumbersumber sejarah sezaman, diperkirakan Raja Omri mulai bertahta pada tahun
885874 SM, Raja Ahab berkuasa antara tahun 874853 SM, Raja Ahazia tahun 853852, dan Raja
Yoram antara tahun 852841 SM. Karena itu, pertengahan masa kekuasaan keturunan Omri,
jatuh pada masa Yoram, antara tahun 852841 SM, kirakira tahun 845 SM. Jadi, angka 40 dalam
prasasti Moab memang merupakan pembulatan dari angka 36 tahun, seperti lazimnya pada
budaya Timur Tengah kuno. Misalnya, Shavuot (7X7=49) dibulatkan menjadi 50, sehingga Hag
haSavuotdikenaljugadenganHariKelimapuluh(Pentakostes).
18

18
IstilahdijumpaidalamSeptuaginta(LXX)sebagaiterjemahandariharikelimapuluh.
Bambang Noorsena
TEXTUALCRITICISM:SebuahPengantarDalamKajianVarianVarianTeksPerjanjianLama
40

Edited by Glenn Tapidingan

Perlu dijelaskan di sini, bahwa Ahazia yang


bertakhtadiIsrael(853852SM)berbedadengan
Ahazia yang bertakhta di Yehuda (841 SM).
Begitu juga ada dua nama Yoram, yaitu Yoram
yang bertakhta di Israel (852841 SM) dengan
Yoram yang bertakhta di Yehuda (853841 SM),
ayah Ahazia, raja Yehuda. Masa 40 tahun dari
dinasti Omri menguasai Madeba menurut
prasasti Moab, ternyata bukan tanpa kebetulan
bahwalamanyacocokdenganmasadinastiOmri
sampai Ahazia, anak Yoram, Raja Yehuda,
berkuasa yaitu 42 tahun, dari Omri naik takhta
tahun 885 SM hingga Ahazia, raja Yehuda, naik
takhtatahun841SM.Jadi,angka42tahunadalah
angkayangditekankan2Taw22:2sampaiAhazia,
raja Yehuda, naik takhta, dan selanjutnya masih
ada beberapa raja Yehuda yang mewarisi
kejahatanOmri,yangseringdisebutKeBaitAhab
hidupmenurutkelakuankeluargaAhab(2Taw
22:3), karena Ahab adalah raja terbesar dari
dinastiOmri.

S Prasasti batu Moab yang disimpan di


MuseumLouvre,Paris.

Anda mungkin juga menyukai