Anda di halaman 1dari 17

210

Vol.4, No. 2, Juli Desember2012

TherapeuticDrugMonitoring(TDM)padaPenggunaanAspirin sebagai Antireumatik


Therapeutic Drug Monitoring (TDM) in The Use of Aspirin as Antirheumatoid Drugs
IsnatinMiladiyah1*
ABSTRACT Therapeuticdrugmonitoring(TDM)isusedindrugtherapyforselecteddrugswithnarrowtherapeuticindex,or abroadrangeofkineticsvariation,ordrugswithstrongcorrelationbetweenplasmaconcentrationandclinical effectsortoxicity.Aspirinisoneofthewidelyusedoldgenerationdrugs,withabroadrangeofactivityspectrum: analgesic,antipyretic,antiinflammatory,andantiplatelet.Asantiinflammatorydrug,aspirindirectedastherapy formanyofchronicinflammation,suchasrheumatoidarthritis.Asanantirheumaticagent,aspirinshowsawide variationinthepharmacokineticofaspirinmetabolism,andhasanarrowtherapeuticindexbecauseiteffectives atconcentrationof1030mg/dl,butatmorethan40mg/dlintoxicationoccurs(metabolicacidosis,hyperpnea, anddeath).Thosearewhyaspirinuseasantirheumaticagentneedtherapeuticdrugmonitoring,sothatdoctors canguaranteethatplasmaaspirinconcentrationisinthetherapeuticrange,toachieveoptimilizationoftherapy withminimalsideeffects.Thisarticlerevealsaboutuseofaspirinasantirheumatoiddrugsandwhytherapeutic drugmonitoringisneededinaspirinuse(SainsMedika,4(2):210226). Keywords:aspirin,salicylates,monitoring,antirheumaticagent,overdose ABSTRAK Therapeutic drug monitoring (TDM) banyak diterapkan di dalam pengobatan untuk obatobat dengan indeks terapisempit,variasikinetikasangatbesar,atauobatyangkonsentrasinyadalamplasmabanyakterkaitdengan efek klinis yang ditimbulkan atau timbulnya efek samping. Aspirin merupakan obat generasi lama dan telah digunakansecarasangatluas,denganspektrumkerjayangbervariasi,yaituanalgesik,antipiretik,antiinflamasi, danantiplatelet.Sebagaiantiinflamasi,penggunaanaspirinbanyakdiarahkanuntukmengatasiberbagaikelainan inflamasi kronis, misalnya sebagai antireumatik pada kasus rheumatoid arthritis. Obat ini mempunyai variasi kinetika yang cukup besar dalam hal metabolismenya, selain itu indeks terapinya sempit karena untuk berefek sebagaiantirematikdibutuhkankonsentrasiobatdalamplasma sebesar1030mg/dl,sedangkankonsentrasidi atas 40 mg/dl sudah menimbulkan efek samping yang berbahaya (asidosis metabolik, hiperpnea, sampai kematian).Dengandemikianaspirinmerupakansalahsatuobatyangperludilakukantherapeuticdrugmonitoring, untuk memastikanbahwa konsentrasi obat dalamplasma berada dalam rentangkonsentrasi yang ditargetkan, sehingga mampu meminimalkan efek samping tanpa mengurangi efikasi obat. Tulisan ini disajikan untuk memberikan informasi mengenai aspirin dan manfaatnya sebagai antireumatik, serta mengapa penggunaan aspirinsebagaiantireumatikperludilakukantherapeuticdrugmonitoring(SainsMedika, 4(2):210226). Katakunci:aspirin,salisilat,monitoring,antireumatik,overdosis

PENDAHULUAN TherapeuticDrugMonitoring(TDM)seringjugadisebutDrugTherapyMonitoring merupakan suatu cara untuk mengukur konsentrasi obat dalam plasma sekaligus mengetahuiinterpretasinya(Flores, 2004; Touw et al., 2007). Metode ini diperkenalkan
1 * DepartemenFarmakologiFakultasKedokteranUniversitas IslamIndonesia(FKUII)Yogyakarta Jl.KaliurangKm14,5Sleman55584Yogyakarta(0274)898444psw2096;Fax(0274)898444psw2007

TDM Penggunaan Aspirin

211

pertamakalisekitarpadatahun1970denganasumsibahwakonsentrasiobatdalamcairan tubuh (darahatau plasma)merupakan prediktor yanglebih baikuntuk memperkirakan efek obat daripada dosis obat (Touw et al., 2007). Dengan mengukur kadar obat dalam cairantubuhini,makadapatdilakukantitrasidosispadapasiensecaraindividual,sehingga konsentrasi obat dalam tubuh memberikan respon paling optimal dengan tolerabilitas danrisikotoksisitasyangpalingrendah(Hiemkeetal.,2011). Pada dasarnya, TDM merupakan salah satu upaya mengintegrasikan ilmu farmakinetikadanfarmakodinamika,denganmengukurkonsentrasiobatdalamplasma untukmengoptimalkandanmelakukanindividualisasidosissehinggasesuaiuntukpasien (Neef,2011).HasildariTDMinidimanfaatkanuntukmengevaluasiderajatresponterapi suatu obat, memberikan informasi yang bermanfaat mengenai kesesuaian terapi obat, evaluasikepatuhanpasienterhadapdosisyangdiberikan,mendeteksikemungkinanefek sampingdantoksisitassuatuobat,mengkonfirmasikemungkinanadanyainteraksiobat, sertauntukpenyesuaiandosisobat(Abdelrahim,2008). Tidak setiap obat memerlukan TDM. Suatu obat perlu dilakukan TDM apabila kadarnya dalam plasma sangat mempengaruhi efek yang ditimbulkan (terutama pada obat dengan indeks terapi sempit),obat yang memberikan profil farmakokinetika yang sangat bervariasi, untuk menetapkan target konsentrasi obat tertentu dalam plasma (Ghiculescu,2008),atauadanyaketerkaitaneratantarakonsentrasidalamplasmadengan efekklinikyangditimbulkan,namuntidaktersediaparameterklinisyangmemadai(Neef, 2011). Pengukuranbiasanyadilakukanterhadapkadarobattotaldalamplasma,namun pada laboratorium tertentu dapat dengan menetapkan kadar obat bebas atau bahkan dengansampeldarisaliva.Beberapaobatmungkinsajatidakmenunjukkankorelasiantara kadarobatdalamplasmadenganaktivitasterapetiknya,dalamhalinimonitoringdilakukan untuk mengidentifikasi kemungkinan ketidakpatuhan penderita dalam mengkonsumsi obat.Dengan demikianTDMmerupakan suatusistempenjaminan kualitasmanajemen obat,yangbertujuanuntukmemberikanobatyangtepat,padapasienyangsesuai,dalam dosisyangtepat,sehinggamencapaiefekyangdiharapkan(Neef,2011). Obatgolongansalisilatmerupakansalahsatuobatyangpalingseringdigunakan, karenamempunyaisifatanalgesik,antipiretik,antiinflamasi,antireumatik,danyangpaling mutakhiradalahsebagaiantiagregasitrombosit(antitrombotik)atauantiplatelet(Beckman

212

Vol.4, No. 2, Juli Desember2012

Coulter,2003).Salisilattersediadalamberbagaibentuksediaanobat,diantaranyatopikal, tablet,serbuk,dansupositoria.Selainbentukregular,salisilatjugatersediadalambentuk tabletsalutselaputyangdiharapkanakanmengalamidisolusidalamusushalus(Chykaet al.,2007). Obatgolongansalisilatyangpalingbanyakdigunakanadalahaspirin(asamasetil salisilat).Sampaisaatini,obatinimasihmerupakananalgesikantipiretikdanantiinflamasi yang paling banyak diresepkan dan menjadi standar untuk pembanding atau evaluasi antiinflamasilain(Roberts&Morrow,2001).Aspirinberbedadenganderivatasamsalisilat lainnya karena mempunyai gugus asetil. Gugus asetil inilah yang nantinya mampu menginaktivasienzimsiklooksigenase,sehinggaobatinidikenalsebagaiAINSyangunik karenapenghambatannyaterhadapenzimsiklooksigenasebersifatireversibel(Majeedet al.,2003),sementaraAINSlainnyamenghambatenzimsiklooksigenasesecarakompetitif sehinggabersifatreversibel(Roy,2007). Sebagai obat yang sering digunakan di masyarakat, aspirin dilaporkan sering menimbulkan keracunan.Di Inggris,angka kejadian keracunanaspirin adalah57% dari seluruhkeracunanobatyangdibawakerumahsakitdanmenyebabkan3040kematian pertahun(Woodetal.,2005).SementaradiAmerikaSerikat,padatahun2004,keracunan aspirin tingkat sedang dilaporkan sebanyak 9% dari kasus keracunan obat seluruhnya, keracunantingkatberat1%,dansebanyak64orangmeninggaldunia(0,2%)(Chykaetal., 2007). Aspirin merupakan salah satu obat yang perlu dilakukan TDM, terutama dalam fungsinya sebagai antirematik, dimana penggunaannya memerlukan dosis yang cukup tinggidandalamjangkalama.MenurutRoberts&Morrow(2001);Agrawal(2011)perlunya dilakukanTDMpadapenggunaansalisilatinidisebabkanoleh: 1. Salisilat dalam plasma terikat dengan protein plasma (albumin), dimana kapasitas pengikataniniterbatassehinggapadakadartertentumakalebihbanyakobatyang bebas,akibatnyaefekobatlebihsulitdikontrol. 2. Salisilat dimetabolisir hepar menjadi beberapa metabolit dengan dikonjugasikan denganbeberapazattertentu.Kapasitasmetabolismeinijugaterbatassehinggajuga mempengaruhikadarsalisilatdalamplasma. 3. Kadarsalisilatplasmadalamrentangterapisebagaiantirematikternyatatetapdapat memunculkan efek samping (sehingga mungkin perlu penyesuaian dosis). Sebagai

TDM Penggunaan Aspirin

213

contohadalahtinnitusdapatterjadipadakadarterapi20mg/dL(padahalkadarterapi untukantirematikadalahantara1035mg/dL). Penelitian menunjukkan bahwa farmakokinetika aspirin pada pasien dewasa menunjukkan variasiyang besar.Variasi kinetika yangbesar ini,menyebabkan perlunya dilakukan pengukuran kadar metabolit aspirin di dalam plasma dan dimonitor. Hal ini bertujuanuntukmemastikanbahwakonsentrasiterapetikaspirintelahdicapaidandapat dipertahankan dan efek pengobatan sesuai dengan yang diharapkan (Ziu & Giasuddin, 1993a).

TINJAUANPUSTAKA FarmakokinetikaAspirin Absorpsi Aspirincepatdiabsorbsidarisaluranpencernaandansegeradihidrolisismenjadi asamsalisilat,dengankadarpuncakasamsalisilatdalamplasmatercapaidalam12jam (BeckmanCoulter,2003).Sediaantabletsalutselaputmenunjukkankecepatanabsorpsi yangbervariasi,dimanakonsentrasipuncakdalamplasmatercapaidalam46jamsetelah pemberian,namunonsetinidapattertundasampai812jampadadosistinggi(Chykaet al.,2007).Kecepatanabsorpsiinidipengaruhiolehbentuksediaan,adatidaknyamakanan dalamlambung,tingkatkeasamanlambung,danfaktorfisiologislainnya(BeckmanCoulter, 2003).

Distribusi Di dalam sirkulasi, sebanyak 8090% salisilat terikat dengan protein plasma, terutamaalbumin.Salisilatinidapatdidistribusikankehampirseluruhcairantubuhdan jaringan, serta mudah melalui sawar darah plasenta sehingga dapat masuk ke dalam sirkulasidarahjanin(Roy,2007).Padadosisrendah(konsentrasidalamplasma<10mg/ dL),90%salisilatterikatolehalbumin,sedangkanpadakonsentrasiyanglebihtinggi(>40 mg/dl),hanya75%salisilatyangterikatolehalbumin.

Metabolisme Aspirin dihidrolisis menjadi asam salisilat di dalam sistem gastrointestinal dan sirkulasidarah(denganwaktuparuhaspirin15menit)(Chykaetal.,2007).Dalambentuk

214

Vol.4, No. 2, Juli Desember2012

asamsalisilat,waktuparuhdalamplasmadalamdosisterapetikmenjadi24,5jam,namun dalamdosisyangberlebihan(overdosis)waktuinidapatlebihpanjang,antara18sampai 36jam(Ijazetal.,2003).Jadidapatdikatakanbahwawaktuparuhasamsalisilatiniterkait dengandosis.Semakintinggidosisaspirinyangdiminum,makawaktuparuhasamsalisilat jugasemakinpanjang.Padapemberianaspirindosistinggi,jalurmetabolismeasamsalisilat menjadijenuh;akibatnyakadarasamsalisilatdalamplasmameningkattidaksebanding dengan dosis aspirin yang diberikan (Beckman Coulter, 2003). Karena aspirin segera dihidrolisissebagaisalisilatdidalamtubuh,makasalisilatinilahyangbertanggungjawab terhadapterjadinyaintoksikasi(Chykaetal.,2003). Kirakira80%asamsalisilatdosiskecilakandimetabolisirdihepar,dikonjugasikan dengan glisin membentuk asam salisil urat, dan dengan asam glukoronat membentuk asamsalisilglukoronat,dansalisilfenolatglukoronat.Sebagiankecildihidroksilasimenjadi asam gentisat (Ijaz et al., 2003). Metabolisme salisilat ini dapat mengalami saturasi (kejenuhan).Padaorangdewasanormal,saturasikinetikasalisilatterjadipadapemberian aspirindosis12g.Apabilakapasitasmetabolismeiniterlampaui,makaakanmenyebabkan waktuparuhasamsalisilatdalamplasmasemakintinggidanmeningkatkanrisikotimbulnya efek samping. Kinetika saturasi salisilat inilah yang berperan besar dalam kasuskasus intoksikasisalisilat(Chykaetal.,2007).

Ekskresi Ekskresi asam salisilat melalui ginjal sebesar 5,6% sampai 35,6% (Kementerian Kesehatan Malaysia [Kemkes Malaysia], 2001). Terdapat korelasi positif antara pH urin dengan klirens asam salisilat (Rashid et al., 2003), dimana alkalinisasi (peningkatan pH urin) akan meningkatkan klirens asam salisilat yang selanjutnya meningkatkan ekskresi asam salisilat melalui urin (Buck, 2007). Akibatnya waktu paruh asam salisilat dapat diperpanjang oleh pH urin yang rendah (asam) dan pada fungsi ginjal yang terganggu (Kemkes Malaysia, 2001; Chyka et al., 2007). Selain itu pada urin asam, salisilat berada dalam bentuk tidak terion sehingga direabsorpsi kembali sehingga menyebabkan konsentrasisalisilatdalamdarahlebihtinggi.Olehkarenaitudinyatakanbahwaekskresi salisilat selain dipengaruhi filtrasi glomeruler juga dipengaruhi oleh reabsorpsi dalam tubulus(Majeed,2003). Klirensmelaluiginjalinibisaberbedanilainyadarinilaistandar,tergantungpada

TDM Penggunaan Aspirin

215

pengaruh lokal daerah (Rashid et al., 2003). Bahkan variasi kinetika ini berbeda antara lakilakidanperempuan dalamdaerahyangsama,danberbeda puladenganpenduduk daridaerahyangberbeda(Ijazetal.,2003). Salisilatdiekskresikedalamurinmelaluiprosesfiltrasiglomerulerdansekresiaktif tubulus. Ekskresi salisilat dalam urin adalah dalam bentuk asam salisilat bebas (10%), asamsalisilurat(75%),fenolatsalisilat(10%),asilglukoronat(5%),danasamgentisat(1%). (Roy,2007).Dalamcairantubuhlain,ekskresiasamsalisilatbervariasi.Ekskresiasamsalisilat dalam ASI dianggap tidak aman sehingga tidak disarankan bagi ibu menyusui. Ekskresi asamsalisilatdankonsentrasinyadalamairmatabervariasiantara1%sampai8%daripada konsentrasiasamsalisilatplasmasebagaiantiinflamasi(KemkesMalaysia,2001).

FarmakodinamikaAspirin Penggunaan aspirin sebagai antiinflamasi terutama adalah untuk pengobatan rheumatoidarthritis,yaitusuatupenyakitkronissistemikyangmelibatkanbanyakorgan, dandianggapsebagaipenyakitautoimun.Aspirinmampumereduksiprosesinflamasidi dalam sendi dan jaringan sehingga mengurangi gejala dan memperbaiki mobilitas penderita.Meskipundemikian,obatinitidakmampumenghambatprogresivitascidera jaringanpatologis(Roy,2007).Jikadenganaspirinsajabelumefektif,makadapatdiganti denganAINSlain,kortikosteroid,atauobatyangbersifatdiseasemodifyingdrug.Halyang perlu diperhatikan adalah bahwa jika akan menggunakan kombinasi AINS dengan obat lain untuk rheumatoid arthritis (misalnya AINS dengan methotrexate), maka sebaiknya digunakanAINSselainaspirin(Colebatchetal.,2011).

MekanismeAksi Efektivitaspenggunaanaspirinadalahberdasarkankemampuannyamenghambat enzim siklooksigenase (cyclooxygenase/COX), yang mengkatalisis perubahan asam arakidonatmenjadiprostaglandinH2,prostaglandinE2,dantromboksanA2.Aspirinhanya bekerja pada enzim siklooksigenase, tidak pada enzim lipooksigenase, sehingga tidak menghambat pembentukan lekotrien (Roy, 2007). Tidak seperti AINS lainnya yang menghambatenzimsecarakompetitifsehinggabersifatreversibel,aspirinmenghambat enzim COX secara ireversibel. Hal ini disebabkan karena aspirin menyebabkan asetilasi residuserin padagugus karbonterminal darienzim COX,sehingga untukmemproduksi

216

Vol.4, No. 2, Juli Desember2012

prostanoid baru memerlukan sintesis enzim COX baru (Vane & Botting, 2003). Hal ini pentingkarenaterkaitdenganefekaspirin, dimanadurasiefeksangatbergantungpada kecepatanturnoverenzimsiklooksigenase(Roy,2007). Mekanisme kerja aspirin terutama adalah penghambatan sintesis prostaglandin E2dan tromboksanA2. Akibatpenghambatan ini,maka ada tigaaksi utamadari aspirin, yaitu:(1)antiinflamasi,karenapenurunansintesisprostaglandinproinflamasi,(2)analgesik, karenapenurunanprostaglandinE2akanmenyebabkanpenurunansensitisasiakhiransaraf nosiseptif terhadap mediator pro inflamasi, dan (3) antipiretik, karena penurunan prostaglandinE2yangbertanggungjawabterhadappeningkatansetpointpengaturansuhu dihipotalamus(Roy,2007). AspirinmenghambatsintesisplateletmelaluiasetilasienzimCOXdalamplatelet secara ireversibel. Karena platelet tidak mempunyai nukleus, maka selama hidupnya platelettidakmampumembentukenzimCOXini.AkibatnyasintesistromboksanA2(TXA2) yang berperan besar dalam agregasi trombosit terhambat. Penggunaan aspirin dosis rendahregular(81mg/hari)mampumenghambatlebihdari95%sintesisTXA2sehingga penggunaanrutintidakmemerlukanmonitoring(Harrison,2007).Molekulprostaglandin I2 (PGI2) yang bersifat sebagai anti agregasi trombosit diproduksi oleh endothelium pembuluh darah sistemik. Selsel endotel ini mempunyai nukleus sehingga mampu mensintesisulangenzimCOX.Halinilahyangdapatmenjelaskanmengapaaspirindosis rendah dalam jangka panjang mampu mencegah serangan infark miokard melalui penghambatanterhadapTXA2namuntidakterlaluberpengaruhterhadapPGI2(Roy,2007). Selain melalui penghambatan terhadap COX, aspirin juga mampu mengasetilasi enzimNitricOxideSynthase3(NOS3)yangakanmeningkatkanproduksiNitricOxide(NO). NitricOxidediketahuibersifatsebagaiinhibitoraktivasiplatelet,dengandemikianhalini menambahinformasimengenaimanfaataspirinsebagaiantiplatelet(OKaneetal.,2009).

PenggunaandalamKlinik Aspirin sering dipakai untuk meredakan nyeri ringan sampai sedang, sedangkan untuk mengatasi nyeri berat (misalnya nyeri pada kanker) kadang dikombinasi dengan opiat.Dosisaspirindalamterapiberbedatergantungpadaindikasipenggunaandanusia pasien(Tabel1).

TDM Penggunaan Aspirin

217

Tabel1.

Dosisaspirinmenurutindikasidanusia(Chykaetal.,2007)

Dosislazim(oral) Dewasadanremaja 325500mgtiap3jam,325650tiap4jam,atau650 1000mgtiap4jam(bilaperlu) Dosismaksimumharian:4g Analgesik Anak: 1,5g/m2LPTdalam46dosisterbagi 24th:160mgtiap4jam 46th:240mgtiap4jam 69th:320325mgtiap4jam 911th:320400mgtiap4jam 1112th:320480mgtiap4jam Antirematik(antiinflamasi) Dewasadanremaja: 3,65,4g/haridalamdosisterbagi Anak: 80100mg/kg/haridalamdosisterbagi Profilaksijantungdan 81325mg/hari(kasustanpakomplikasi) antiagregasiplatelet(dewasa) 3251000mg/hari(setelahepisodeiskemik) Pencegahanthrombosis(dewasa) 325mgpreoperasi,dilanjutkan325mgtigakali/hari

Indikasi Analgesikdanantipiretik

Sebagaianalgetikantipiretik,kadarasamsalisilatdalamdarahdiharapkankurang dari6mg/dL(Roy,2007).Halinidapatdicapaidengandosispemberianaspirin325650 mgsetiap4jam(BeckmanCoulter,2003).Untukpenggunaansebagaiantiinflamasibaik rheumatoidarthritismaupundemamrematik,aspirindiberikandalamdosistinggi(anak 80100mg/kgBB/hari,dewasa36g/hari)(Buck,2007;Roy,2007).Dosisaspirinsebesar ini akan memberikan kadar asam salisilat dalam darah sebesar 1035 mg/dL (Kemkes Malaysia,2001). Sebagaiantiplatelet,dosisaspirinyangdigunakanlebihrendahdaripadadosisuntuk analgetikatauantiinflamasi,yaitu81325mgperhari(KemkesMalaysia,2001)atau110 mg/kgBB/hari untuk anak (Buck, 2007). Penelitian mutakhir menunjukkan bahwa pemberianaspirin100mgsekalisehariselama2tahunpadapasientromboembolivenosa pascaterapiantikoagulan,mampumencegahrekurensitanpamenimbulkanperdarahan mayor(Becattinietal.,2012).

EfekSamping a. Efekneurologisdalamberbagaisistem Efek samping aspirin yang sering adalah nausea, vomitus, dan tinnitus (karena

218

Vol.4, No. 2, Juli Desember2012

salisilismus).Apabilahalinisudahmuncul,makaharussegeradilakukanpengukurankadar asamsalisilat dalamplasma,dankadar iniharusterusdikontrol. Gejalagastrointestinal karenaintoksikasiaspirinakutmeliputimuntah,nyeriabdominaldanhematemesis.Nausea danvomituskarenasalisilatinidisebabkankarenastimulasidiareachemoreceptortrigger zone di medulla. Nausea dan vomitus ini biasanya muncul pada konsentrasi salisilat 27 mg/dL (Roberts & Morrow, 2001). Adanya intoksikasi sistemik akut ditandai dengan hiperpnea,takipnea,tinnitus,ketulian,hiperpireksia,diaphoresis,letargi,konfusi,koma, dankejang(Chykaetal.,2007). Pemberianaspirindalamdosistinggi dapatmenyebabkanstimulasisistemsaraf pusatyangdiikutidengandepresi;selainitudapatjugatimbulkonfusi,dizziness,tinnitus, gangguanpendengarannadatinggi,delirium,psikosis,stuporbahkankoma.Tinnitusdan gangguan pendengaranpada intoksikasisalisilat initerjadi karenapeningkatan tekanan dalamlabirindanpengaruhselselrambutdicochlea,didugaakibatvasokonstriksidalam mikrosirkulasiditelingadalam(Roberts&Morrow,2001).Selaintinnitus,efekototoksik aspirinlainnyaadalahkehilanganfungsipendengarandankadangkadangdisertaidengan disfungsivestibular.Sebagianbesarkasuskehilanganfungsipendengaranbersifatbilateral, simetris danreversibel, namun jugadapat menetap (sebagian kecil).Pemulihan parsial terjadidalam2448jamsetelahkonsumsiaspirindanpendengarankembalinormaldalam waktu710hari(AmericanSpeechLanguageHearingAssociation,1994).

b.

Gangguankeseimbanganasambasa Sebagianbesarpasienyangmengalamiintoksikasiasamsalisilatberatmenunjukkan

alkalosisrespiratorikataugabunganalkalosisrespiratorikdanasidosismetabolik.Alkalosis respiratorik terutama terjadi pada anak.Kelainan keseimbangan asam basa yang mula mulaterjadipadaintoksikasisalisilatadalahalkalosisrespiratorik,karenastimulasilangsung salisilatterhadappusatpernafasandiotak(BeckmanCoulter,2003).Alkalosisrespiratorik inidapattimbulsedemikianhebatnyadisertaidengantetani,yangseringditandaidengan adanyagangguandalamgambaranelektrokardiogramnya(Wilmana&Gan,2007). Akibatalkalosis,makatimbulkompensasiolehtubuh,berupapeningkatanekskresi bikarbonat oleh ginjal yang disertai dengan peningkatan ekskresi Na+ dan K+; akibatnya bikarbonat plasma turun sehingga pH darah kembali normal (Roberts & Morrow). Jika keadaaniniterusberlanjut,makaakanterjadiasidosismetabolik(BeckmanCoulter,2003).

TDM Penggunaan Aspirin

219

Asidosismetabolikiniakansangatdipengaruhiolehlamanyakejadianintoksikasiaspirin, hiperventilasi, kegagalanpernafasan dan pengaruhkompensasi oleh ginjal(Wilmana & Gan,2007). Terjadinya asidosis metabolik pada intoksikasi salisilat dapat terjadi melalui beberapa mekanisme. Selain karena hiperventilasi, salisilat juga mengganggu produksi energimelaluisiklusKrebsdanprosesfosforilasioksidatif,jugamenyebabkaninsufisiensi ginjalsehingga terjadiakumulasi fosfatdan asamsulfat. Ditambahdengan peningkatan metabolisme asam lemak bebas, keseluruhan mekanisme ini menyebabkan timbulnya asidosismetabolikpadapasiendenganintoksikasisalisilat(Judge,2005). GangguandalamsiklusKrebsdanfosforilasioksidatifmeningkatkanprosesglikolisis untukmenghasilkanenergi,sehinggameningkatkankonsumsi glukosa.Jikahaliniterus berlanjut, maka cadangan glikogen hepar akan habis dan glukoneogenesis tidak akan mampumemenuhikebutuhanglukosa,akibatnyaakanterjadihipoglikemia.Penurunan glukosa didalam cairan serebrospinal (danseluruh bagian otak lain)terjadi lebih cepat daripadapenurunandidalamplasma,sehinggaefekneurologidangangguankesadaran timbuldengansegera(Roy,2007).Dugaanbahwagangguanmetabolismeberperanbesar dalammenimbulkanasidosismetabolik,dibuktikandenganditemukannyahipoglikemia danketosispadasebagianbesarpasiendenganintoksikasiaspirin(Wilmana&Gan,2007). Gangguan asambasaakibat overdosis asamsalisilat tergantung padaumur dan beratnyaintoksikasi(BeckmanCoulter,2003).Kadartoksikinibiasanyaterjadipadakadar asamsalisilatdalamplasmamencapai50mg/dL.Kadarsalisilatdalamplasmajugaharus diukur pada pasien dengan keracunan yang tidak teridentifikasi atau pasien keracunan dengan gambaran klinis mirip keracunan salisilat (misalnya koma, asidosis metabolik, alkalosisrespiratorik,tinnitusdanlainlain)(Watson,2002).

c.

Gangguaneritrosit Secara in vitro, telah terbukti bahwa salisilat mampu menyebabkan oksidasi

glutationtereduksi secarabesarbesarandan mampumembentuk methemoglobin.Hal initerutamadiperankanolehderivatsalisilisatyaituasamgentisat,sedangkanasamsalisilat danasamsalisilurattidakmenunjukkanefektersebut.Fenomenainitampaklebihnyata padapasiendengandefisiensienzimGlucose6PhosphateDehydrogenase(G6PD)daripada pasien yang tanpa defisiensi enzim G6PD. Hal ini dapat menjelaskan mengapa pasien

220

Vol.4, No. 2, Juli Desember2012

dengan defisiensi enzim G6PD menjadi rentan mengalami hemolisis pada pemberian aspirin(Ziu&Giasuddin,1993b).

KontraindikasiPenggunaan Aspirin tidak direkomendasikan untuk anak di bawah 12 tahun karena risiko terjadinya sindroma Reye (ditandai dengan ensefalopati non inflamatorik akut dan hepatopati berat). Pemeriksaan laboratorium menunjukkan adanya peningkatan kadar transaminaseserum,bilirubindanammoniasecarasignifikan.Secarahistopatologi,dapat ditemukangambaransteatosismikrovesikulerdanedemamitokondriadengancristaeyang rusak.Sindrominilebihseringterjadisetelahinfeksivirus,terutamavaricelladaninfluenza (Orlowskietal.,2002;Glasgow,2006).Dengandemikian,aspirindanseluruhderivatnya tidakbolehdiberikansebagaiterapigejalamiripflupadaanakanak. Aspirin juga dikontraindikasikan pada ulkus lambung, hemofilia, dan penderita gout(karenaaspirindosiskecildapatmeningkatkankonsentrasiasamurat).Kontraindikasi lainadalahasma,penyakitalergidanpasiendengankelainanginjaldanatauhepar(Kemkes Malaysia,2001).

PEMBAHASAN TherapeuticDrugMonitoringUntukAspirin TherapeuticDrugMonitoringaspirindirekomendasikanpadabeberapahalberikut ini(White&Wong,1998): 1. 2. 3. 4. kecurigaantoksisitassalisilatkarenaoverdosis penggunaanjangkapanjang kecurigaanketidakpatuhanmengkonsumsiobat adanyaperubahanfungsiginjal,statusmental,statusasambasaataustatuspulmoner padapasiendenganpenggunaansalisilatjangkapanjang 5. setelah pemberian obat tambahan yang diduga dapat mempengaruhi parameter farmakokinetikasalisilat

Parameteryangdapatdigunakandalammemonitorpenggunaanaspirin,yaitu: 1. Parameterterapetik Tujuan terapi pada artritis rematoid adalah meredakan nyeri, menghilangkan

TDM Penggunaan Aspirin

221

inflamasi, mempertahankan kapasitas fungsional, mencegah kerusakan struktur dan mengembalikankemampuanpasienpadakehidupannormalnya.Responpositifpemberian aspirinditandaidenganhilangnyakeluhannyeribaiksubyektifmaupunobyektifberkurang (demam,gerakansendi,bengkak)danpasienmerasanyaman.Dalamterapiuntukartritis rematoid,makaparameterklinisberikutinidapatdipakai:jumlahpembengkakansendi, skala analog visual (misalnya untuk nyeri atau skor global pasien), reaktan fase akut (misalnyaCreactiveprotein)dandurasimorningstiffness(kekakuanpagihari)(Kemkes Malaysia,2001). Responterapetikaspirinsebagaiantireumatikdicapaipadakadarasamsalisilat dalamdarah/plasmaadalahantara1030mg/dL(Agrawal,2011).Namundalamrentang terapiinipuladapatmunculefeksampingaspirin,misalnyatinnitus,yangdapatmuncul padakadarasamsalisilatdalamplasma2045mg/dL(Roberts&Morrow,2001).

2.

Parametertoksik Gejala dan tanda intoksikasi salisilat terkait dengan adanya iritasi traktus

gastrointestinal, stimulasi langsung terhadap pusat pernafasan di sistem saraf pusat, stimulasi kecepatan metabolisme, gangguan metabolisme karbohidrat dan lipid, serta gangguanterhadapproseshemostasis(Chykaetal.,2007).Komplikasiyangdapattimbul adalah dehidrasi, gangguan keseimbangan asam basa, udem otak, glukopenia cairan serebrospinal dan udem paru. Kelainan metabolik yang sering menyertai adalah hipoglikemia dan ketosis. Ketosis ini terjadi karena salisilat menyebabkan peningkatan metabolismeasamlemakbebas(Judge,2005). KarenaaspirinbekerjadenganmenghambatenzimCOX1yangmerupakanjalur bagi pembentukan tromboksan A2 (TXA2), maka monitoring konsentrasi aspirin dapat dilakukan dengan mengukur kadar TXA2 dan metabolitnya baik dalam serum maupun urin. Secara in vivo, TXA2 secara cepat akan diubah menjadi metabolit TXB2 yang lebih stabildanlarutair,selanjutnyadiubahmenjadi11dehidroTXB2,yangmerupakanproduk utama dalam urin. Pengukuran TXB2 dengan berbagai metode immunoassay dapat membantumenilaikapasitasplateletdalammembentukTXA2(Harrisonetal.,2007). Monitoring kadar asam salisilat dalam plasma seperti dijelaskan di atas sangat pentingdalammemperkirakanberatnyatoksisitas.Penatalaksanaanuntuktoksisitasasam salisilat ini ditujukan terutama untuk mengurangi absorbsi asam salisilat lebih lanjut,

222

Vol.4, No. 2, Juli Desember2012

meningkatkaneliminasidanmengoreksigangguankeseimbanganasambasadanelektrolit (BeckmanCoulter,2003).Prinsipmonitoringsalisilat(Tabel2). Tabel2. Monitoringpadapenggunaanaspirinsebagaiantirematik


HPLC,kromatografigas,spektrofotometer,immunoassay 5mLdarahdalamtabung 1035mg/dL(1,02,5mmol/L)=150350g/mL Toksisitas dikaitkan dengan tingginya kadar asam salisilat dalam plasma Deteksikeracunan/toksisitasaspirin efekanalgetikantipiretik kurangdari6mg/dL efekantirematik 1030mg/dL tinnitus 2045mg/dL nausea,vomitus 27mg/dL hiperventilasi 35mg/dL asidosis 46mg/dL hiperpnea 50mg/dL Untuk pengukuran rutin TDM sebagai antirematik dengan dosis lazim: Kadar steadystate (SS) dicapai dalam 34 hari. Namundatamenunjukkanbahwadengandosismaintenens salisilat, perlu waktu 7 hari untuk mencapai kadar SS yang baru.WaktupencapaianyanglebihlamadaripadawaktuSS lazim ini disebabkan oleh kapasitas metabolisme salisilat yangterbatas. Untukpengukurandugaanintoksikasi: o Intoksikasi simtomatik/dengan gejala setelah 2 jam ataulebih o Intoksikasiasimtomatiksetelah4jamataulebih Rentang toksik apabila > 50 mg/dL (>3,6 mmol/L) ada yang menyatakan bahwa kadar 35 mg/dL (2,5 mmol/L) sudahmerupakanintoktikasisalisilat Kadar dalam plasma > 12 mmol/dL dianggap sebagai overdosismasif Apabila>5,4mmol/dL(atau>3,6mmol/dLdisertaiasidosis metabolik)diterapidengandiuresisalkalipaksa Apabila>6,5mmol/dL(atau>5,4mmol/dLdisertaidengan gagal ginjal) diterapi dengan hemodialisis. Setelah dialisis, kembali dilakukan pengukuran kadar salisilat dalam plasma. Memantauasidosis dengananalisisgasdarah(AGD)

Metode Spesimen Intervalterapetik (antireumatik) Aplikasi Hubunganantara kadarasamsalisilat plasmadenganefek

Pengambilansampel

Interpretasitoksisitas

Terapi

ImplikasiKlinisTDMAspirin Pengukuran konsentrasi salisilat dalam plasma selain membantu menegakkan diagnosisjugamengarahkankepadapenatalaksanaanyangsesuai,karenakonsentrasiini

TDM Penggunaan Aspirin

223

dapat memprediksi beratnya kondisi dan sebagai indikasi perlunya perawatan intensif atauhemodialisis.KonsentrasisalisilatdanimplikasiklinisnyadapatdilihatdalamTabel3 (Dawson&Whyte,1999).Denganmengetahuikonsentrasiini,makadapatdipilihtindakan penatalaksanaanyangsesuai,baikuntukkondisikeracunanakutmaupunkronis. Tabel3. Konsentrasisalisilatdalamplasmadanimplikasiklinis(Dawson&Whyte,1999)
Implikasiklinis monitoringdiICU hemodialisis hemodialisis

Konsentrasisalisilat G>4mmol/l >9,4mmol/l(ingestiakut) >4,45mmol/l(ingestikronis)

TherapeuticDrugMonitoringrutinpadapenggunaanaspirinjangkapanjangperlu dilakukanterutama sebagaiantirematik, namunberapa kalifrekuensi monitoringperlu dilakukanselamaterapi,sampaisaatinibelumadakepastian.Berdasarkankecenderungan penggunaanaspirinsebagaiantireumatiksaatiniyanghanyasebesar2,665g/haridimana dosisinimenunjukkanprofilkeamananobatyangbaikdandarisegibiayacukupefektif, makapadadosistersebuttidakperlumonitoringsecararutin.Namunapabiladibutuhkan dosis yang lebih tinggi, harus dipertimbangkan bahwa kondisi steady state diharapkan dapatberlangsungminimalsatuminggusejakpeningkatandosis(White&Wong,1998). Pengukurankonsentrasisalisilatjuga dapatmengukurefektivitasdekontaminasi dan peningkatan eliminasi. Salisilat dapat membentuk suatu massa dalam sistem gastrointestinal sehingga memperpanjang fase absorpsi. Dengan demikian diperlukan pengukuranulangdalamselangwaktu2jamsampaidapatdipastikanbahwakonsentrasi obatmemangsudahmenurun(Dawson&Whyte,1999). Pengukuran (assay) obat dalam TDM ini membutuhkan biaya besar dan belum tentu ada di setiap pusat layanan kesehatan (Ghiculescu, 2008), sehingga pada kasus kasus keracunan akut, pengukuran konsentrasi salisilat dalam plasma tidak dijadikan protokol penatalaksanaanrutin (Wood et al., 2005). Pengukuran ini baru dilakukan jika ada riwayat positif mengkonsumsi salisilat dan penurunan tingkat kesadaran disertai dengan gambaran klinis yang mendukung intoksikasi salisilat, misalnya koma, asidosis metabolik,alkalosisrespiratorikdantinnitus(Woodetal.,2005),sertaadanyagangguan keseimbangan asam basa setelah mengkonsumsi aspirin atau salisilat lainnya (Dawson andWhyte,1999).Monitoringkadarobatsecararutintidakdiperlukanpadapasienyang

224

Vol.4, No. 2, Juli Desember2012

secaraklinissudahstabil(Ghiculescu,2008). Saat ini telah ada derivat difluorofenil dari asam salisilat, yaitu diflunisal, yang mempunyai aktivitas antiinflamasi dan analgesik yang setara dengan aspirin. Obat ini mempunyaistrukturyangmiripdengansalisilat,namundidalamtubuhtidakdihidrolisis menjadiasamsalisilat(Roy,2007).Efekpenghambatandiflunisalterhadappembentukan prostaglandin lebih kuat daripada aspirin. Waktu paruh diflunisal lebih lama daripada aspirinyaitu812jam(Wilmana&Gan,2007),sehinggamemungkinkanpemberiansehari dua kali.Kejadian efeksamping gastrointestinalmaupun efeksamping lainlebih ringan daripadaaspirin.Selainitu,diflunisaltidakmampumenembussawardarahotaksehingga tidak mampu berefek sebagai antipiretik (Roy, 2007). Diflunisal dilaporkan tidak menimbulkanefeksampingtinnitussebagaimanaaspirin(Wilmana&Gan,2007).

KESIMPULAN Aspirinmerupakansalahsatuobatyangmemerlukantherapeuticdrugmonitoring karenaindeksterapinyasempit,variasikinetikabesardanadanyaketerkaitaneratantara konsentrasi saslisilat dalam plasma dengan efek klinis yang ditimbulkan. Meskipun demikian,therapeuticdrugmonitoringinitidakmenjadiprosedurrutindalamterapiaspirin sebagai antireumatik. Pengukuran konsentrasi aspirin mutlak dilakukan jika dosis pemberianmelebihi100mg/kgBBperhariatauadanyagangguankeseimbanganelektrolit atau asam basa setelah konsumsi aspirin. Beberapa penyebabnya adalah karena biaya pemeriksaantherapeuticdrugmonitoringyangmahal,fasilitasyanghanyaadadipusat pelayanankesehatanbesar,selainitudosislazimsebagaiantireumatiksaatinimasihberada dibawahdosisyangmenyebabkanintoksikasi.Meskipunaspirinsangatbermanfaatsebagai antireumatik,namunsaatiniperannyasudahdigantikandenganobatobatlain,misalnya diflunisal (yang tidak mempunyai efek samping seperti aspirin) atau obatobat disease modifyingdrugyangmampumenghambatprogresivitaspenyakit.

DAFTARPUSTAKA Abdelrahim H.E.A., 2008, Therapeutic Drug Monitoring Service in Malaysia: Current PracticeandCostEvaluation,Thesis,UniversitySainsMalaysia. AgrawalY.,2011,Criticalvaluesfortherapeuticdruglevels,www.clronline.com,Diakses: 19Oktober2012.

TDM Penggunaan Aspirin

225

American Speech_LanguangeHearing Association [ASHA]. Audiologic Management of Individuals Receiving Cochleotoxic Drug Therapy. 1994.www.asha.org/policy. DOI:10.1044/policy.GL199400003. Anonim,2005,Salicylate/Aspirin/Salicylamide/MethylSalicylate,www.show.scot.nhs.uk/ monkland/ClinicalServices/LabServices/Biochem/test/Salicylate.htm,diaksespada 20Oktober2012. BecattiniC.,AgnelliG.,SchenoneA.,EichingerS.,BucheriniE.,SilingardiM.,etal.,2012, AspirinforPreventingtheRecurrence ofVenousThromboembolism.NEJM 366: 19591967. Beckman Coulter, 2003, Salicylate (SALY), Bulletin 9282 tdm 9, Beckman Cuolter, Inc. www.beckmancoulter.com,diaksespada3Oktober2012. Buck M.L., 2007, Use of Aspirin in Chi ldren with Cardiac Disease. Pediatric Pharmacotherapy.Newsletter2007;13.www.healthsystem.virginia.edu/pediatrics/ pharmanews/home.cfm. Chyka P.A., Erdman A.R.,Christianson G., Wax P.M., Booze L.L.,Manoguerra A.S., et al., 2007, Salicylate poisoning: An evidencebased consensus guideline for outof hospitalmanagement.ClinToxicol45:95131.DOI:10.1080/15563650600907140. ColebatchA.N.,MarksJ.L.,EdwardsJ.C.,2011,Safetyofnonsteroidalantiinflammatory drugs, including aspirin and paracetamol (acetaminophen) in people receiving methotrexate for inflammatory arthritis (rheumatoid arthritis, ankylosing spondylitis, psoriatic arthritis, other spondyloarthritis) (Review). Cochrane Database of Systematic Reviews, Issue 11. Art. No.: CD008872. DOI: 10.1002/ 14651858.CD008872.pub2. DawsonA.H.,WhiteA.M.,1999,Therapeuticdrugmonitoringindrugoverdose.BrJClin Pharmacol48:278283. Flores,J.O.,2004,DrugTherapyMonitoring,www.healthatoz.com/healthatoz/Atoz/ency/ drug_therapy_monitoring_pr.jsp,diaksespada20Oktober2012. GhiculescuR.A.,2008,Therapeuticdrugmonitoring: Whichdrugs,why,when,andhow todoit.AustrPresc31:4244. Gilman A.G., Hardman, J.G., Limbird, L.E., (ed)., 2001, The Salicylates in Goodman and Gilmans The Pharmacological Basis of Therapeutics, McGrawHill Medical PublishingDivision,NewYork,hal:696703. GlasgowJ.F.T.,2006,ReyesSyndrome:thecaseforacausallinkwithaspirin,DrugSafety 29:111121. HarrisonP.,FrelingerA.L.,FurmanM.I.,MichelsonA.D.,2007,Measuringantiplateletdrug effectsinthelaboratory,ThrombRes120:323336. Health Protection Agency, 2012, Poisoning with an unknown substances, http:// www.clinbiochem.info/toxidromes_npis_2012.pdf,diaksespada20Oktober2012. Hiemke C.,Baumann P., BergemannN., ConcaA., Dietmaier O.,Egberts K., etal., 2011, AGNPConsensusGuidelinesforTherapeuticDrugMonitoringinPsychiatry:Update 2011,Pharmacopsychiatry44:195235.

226

Vol.4, No. 2, Juli Desember2012

Ijaz,A.,Bhatti,H.N.,Rasheed,S.,Sadaf,B.,danNawaz,R.,2003.PharmacokineticStudyof AspirininHealthyFemaleVolunteers.PakistanJofBiolSci6:14041407. JudgeB.S.,2005,Metabolicacidosis:differentiatingthecausesinthepoisonedpatients, MedClinNAm89:11071124. KementerianKesehatanMalaysia,2001.Aspirin.MonografUbat174,September2001. Majeed B., Bhatti H.N., Fatima K., 2003, Renal handling of Aceylsalicylic acid in female volunteers,PakistanJBiolSci6(13):11911194. OKane P., Xie L., Liu Z., Queen L., Jackson G., Ji Y., et al., 2009, Aspirin acetylates nitric oxide synthase type 3 in platelets thereby increasing its activity. Cardiovasc Res 83:12330. OrlowskiJ.P.,HannahU.A.,FallsM.R.,2002,IsaspirinacauseofReyesSyndrome?Acase against.DrugSafety25:22531. RashidS.,BhattiH.N.,IjazA.,SadafB.,AhmedS.,2003,RenalClearanceofAcetylsalicylic AcidinHumanMaleVolunteers.PakistanJBiolSci6:13991403. RoyV.,2007,PharmacologyAutacoids:NonsteroidalAntiinflammatoryDrugs,Antipyretics, Analgesics:DrugsusedinGout,www.nsdl.niscair.res.in/bitstream/123456789/744/ 1/revised+autacoids+nonsteroidal+antiinflammatory+drugs.pdf,diaksespada19 Oktober2012. TouwD.J,NeefC.,ThomsonA.H.,VinksA.A.,2007,Costeffectivenessoftherapeuticdrug monitoring:anupdate,EJHPSci13:8391. VaneJ.R.,BottingR.M.,2003,Themechanismofactionofaspirin,ThrombRes110:255 58. WatsonI.,2002,Laboratoryanalysesforpoisonedpatients:jointpositionpaper,AnnClin Biochem39:328339. WhiteS.,WongS.H.Y.,1998,Standardsoflaboratorypractice:analgesicdrugmonitoring, ClinChem44(5):11101123. Wilmana P.F., Gunawan S.G., 2007, Analgesikantipiretik, Analgesik Antiinflamasi non steroid, dan Obat Gangguan Sendi Lainnya, dalam Gunawan SG, Setiabudy R, Nafrialdi, Elysabeth (editor), Farmakologi dan Terapi, edisi 5, Departemen FarmakologidanTerapetikFKUI,Jakarta,pp:234237. WoodD.M.,DarganP.I.,JonesA.L.,2005,Measuringplasmasalicylateconcentrationsin all patientswith drug overdoseor alteredconsciousness: is itnecessary? Emerg MedJ22:401403.DOI:10.1136/emj.2003.010298. ZiuM.M.,GiasuddinA.S.M.,1993a,Invitrochemotoxicityofaspirinmetabolitesoneritrosit manusiadenganG6PDnormaldandefisiensiG6PD,JIslamicAcadSci6:202208. ZiuM.M.,GiasuddinA.S.M.,1993b,PlasmalevelofaspirinmetabolitesinLibyanpatients withrheumatoidarthritisandrheumaticfever,JIslamicAcadSci6:3641.