Anda di halaman 1dari 16

LAPORAN PRAKTIKUM DIAGNOSA KLINIK

Oleh: NELLA KHAIRATI RADIX SEPTIAWAN PUTRI AFRINDA CAHYANINGTYAS RISKI DANNY NORISHA 105130101111077 105130101111071 105130101111072 105130101111073 10513010111107

PROGRAM STUDI PENDIDIKAN DOKTER HEWAN PROGRAM KEDOKTERAN HEWAN UNIVERSITAS BRAWIJAYA MALANG 2013

BAB I PENDAHULUAN

1.1

Latar Belakang Kucingdananjingmerupakanhewan yang paling (pet 86,4

populermenjadipilihanmasyarakatuntukdijadikanhewanhewankesayangan animal).Menurutlaporansurvei, adasekitar 78.200.000 anjingdansekitar

jutakucingpeliharaan di AmerikaSerikatpadatahun 2009-2010. Treninijugadialami di Indonesia danselalumengalamipeningkatansetiaptahunnya.Kedekatanpsikologipemilikdenganhew ankesayangansebagaisalahsatu anggotakeluargamenuntutpemilikuntukmemperhatikankeadaanfisik, makananmaupunkesehatantubuhhewankesayangannya. Kesehatanhewankesayanganmenjadisangatpentingselainfaktorkedekatanpsikol ogiuntuktidakmembiarkananggotakeluarganyasakitjugaberpotensimenularkanpenyakitt erhadappemiliknya.Untukmenjagakesehatanhewankesayangannyapemilikmempercayak an kepadadokterhewan.

Sehinggasebagaicalondokterhewanharusmemiliki skill dalammenanganihewankesayang an.Olehkarenaitu kami melakukanpraktekmagang di Klinik PKH UB padatanggal 4 Desember 2012 untukmemberikanwawasanterhadapprofesidokterhewanklinik (pet animal). 1.2 1. 2. 3. 1.3 Tujuan Untukmengetahuimetodepenerimaanpasien Untukmengetahuimetodepemeriksaanfisikdananamessapasien Untukmengetahuimetodediagnosadanterapipenyakitpasien Manfaat Agar mahasiswacalondokterhewandapatmemiliki skill dalammenerimapasien, dapatmelakukanpemeriksaanfisikdananamnesaterhadappasiensertamampumendiagnosa danterapipenyakitpasien.

BAB II TINJAUAN PUSTAKA 2.1 ETIOLOGI Ringworm atau dermatofitosis adalah infeksi oleh cendawan pada bagian kutan/superfisial atau bagian dari jaringan lain yang mengandung keratin (bulu, kuku, rambut dan tanduk). Penyakit kulit yang menular ini pada ternak tidak berakibat fatal, namun sangat mengganggu dan dapat menurunkan produktivitas ternak, sebagai penyakit kosmopolitan, sering dijumpai pada hewan yang dipelihara secara bersama-sama. Ringworm menyerang hewan dan manusia. (Ainsworth and Austwick, 1973). Dermatofitosis ini dapat menular antar sesama hewan, dan antara manusia dengan hewan (antropozoonosis) dan hewan kemanusia (zoonosis) dan merupakan penyakit mikotik yang tertua di dunia (Jungerman and Schwartzman, 1972). Dawson (1968) melaporkan bahwa kejadian penyakit ini ditemukan pada hewan piara, ternak, satwa liar lainnya. Dinamakan ringworm karena pernah diduga penyebabnya adalah worm dan karena gejalanya dimulai dengan adanya peradangan pada permukaan kulit yang bila dibiarkan akan meluas secara melingkar seperti cincin, maka dinamai ringworm, meski sebelumnya memang penyakit ini disebabkan oleh cendawan namun akhirnya pemakaian istilah tersebut tetap dipakai sampai sekarang. Penularan dari hewan ke manusia (zoonosis) dilaporkan pada tahun 1820 dari sapi ke manusia (Mortimer, 1955). Hewan yang terserang umumnya hewan piaraan adalah anjing, babi, domba, kucing, kuda, kambing, sapi dan lainnya, namun yang paling utama ialah anjing, kucing, sapi. Ketiga hewan ini merupakan masalah penting untuk manusia karena sifat zoonosisnya. Trichopyton spp dan Microsporum spp, merupakan 2 jenis kapang yang menjadi penyebab utama ringworm pada hewan. Di Indonesia yang sering diserang adalah anjing, kucing dan sapi. Divisi : Amastigomycotina.

Sub-Divisi : Ascomycotina. Class Ordo Family Genus : Deuteromycetes : Moniliales : Moniliaceae : Microsporum, Trichophyton

Species

: M. canis, M. gypseum, T.mentagrophytes

M. canis bersifat ectothrix dan zoofilik yang terdapat pada kucing, anjing, kuda, dan kelinci, gambaran mikroskopis dari kultur adalah macroconidia berbentuk spindle, berdinding tebal dan kasar. Microconidia berbentuk clubbing dan berdnding halus, sedangkan M. gypseum bersifat ectothrix dan geofilik. Gambaran makroskopisnya macroconidia berbentuk spindle, dinding tipis 3-6 septa, dan microconidianya sedikit dan berbentuk clubbing (Pohan., A. 2009).

2.2 Patogenesis

Sebaran geografis keberadaannya cukup luas, namun penyakit ini lebih banyak ditemukan di daerah beriklim tropis dan subtropis, terutama daerah dengan kondisi udara panas dan kelembaban yang tinggi. Kemudian pada daerah yang mempunyai empat musim, setelah periode multiplikasi kapang pada bulu selama musim panas. Penyebaran infeksi dapat terjadi karena luka, bekas luka atau patahan bulu untuk melangsungkan hidupnya. Dapat

tumbuh pada lingkungan kering, dingin, aerobik serta tanpa mikroorganisme lain dan terlindung dari sinar matahari. Di negara-negara yang beriklim subtropik atau dingin, kejadian ringworm lebih sering, karena dalam bulan-bulan musim dingin, hewan-hewan selain kurang menerima sinar matahari secara langsung, juga sering bersama-sama di kandang, sehingga kontak langsung di antara sesama individu lebih banyak terjadi. Cara penularan jamur dapat secara langsung dan secara tidak langsung. Penularan langsung dapat secara fomitis, epitel, rambut-rambut yang mengandung jamur baik dari manusia, binatang atau dari tanah. Penularan tak langsung dapat melalui tanaman, kayu yang dihinggapi jamur, barang-barang atau pakaian, debu atau air. Disamping cara penularan tersebut diatas, untuk timbulnya kelainan-kelainan di kulit tergantung dari beberapa faktor seperti faktor virulensi dari dermatofita, faktor trauma, kulit yang utuh tanpa lesi-lesi kecil, factor suhu dan kelembaban, kurangnya kebersihan dan faktor umur dan jenis kelamin (Ahmad., R.Z. 2009).

2.3 Gejala klinis Kerusakan bulu di seluruh muka, hidung dan telinga

Perubahan yang tampak pada kulit berupa lingkaran atau cincin dengan batas jelas dan umumnya dijumpai di daerah leher, muka terutama sekitar mulut, pada kaki dan perut bagian bawah

Selanjutnya terjadi keropeng, lepuh dan kerak, dan dibagian keropeng biasanya bagian tengahnya kurang aktif, sedangkan pertumbuhan aktif terdapat pada bulu berupa kekusutan, rapuh dan akhirnya patah (Ahmad., R.Z. 2009).

Umumnya gejala-gejala klinik yang ditimbulkan oleh golongan geofilik pada manusia bersifat akut dan sedang dan lebih mudah sembuh.

Dermatofita yang antropofilik terutama menyerang manusia, karena memilih manusia sebagai hospes tetapnya.

Golongan jamur ini dapat menyebabkan perjalanan penyakit menjadi menahun dan residif, karena reaksi penolakan tubuh yang sangat ringan.

Contoh jamur yang antropofilik ialah: Mikrosporon audoinii Trikofiton rubrum. (Boel., T. 2009).

2.4 Diagnosa Untuk mendiagnosa melalui pemeriksaan laboratorium diperlukan sampel kerokan kulit, serpihan kuku, rambut. Kemudian dapat diperiksa dengan Wood light, atau pemeriksaan langsung dengan mikroskop dengan KOH, atau pewarnaan, atau dengan membuat biakan pada media. Penyakit ini dapat dikelirukan dengan lesi yang diperlihatkan seperti gigitan serangga, urtikaria, infeksi bakteri dan dermatitis lainnya, namun dengan adanya bentuk cincin pada derah yang terinfeksi dan peneguhan diagnose dengan pemeriksaan laboratorium akan memastikan bahwa hewan tersebut menderita penyakit (Ahmad., R.Z. 2009).

2.5 Penanganan & pengendalian Pencegahan yang dapat dilakukan adalah sanitasi kesehatan, lingkungan maupun hewannya. Terdapat 5 kelompok macam obat dengan berbagai cara dapat dipakai untuk menghilangkan dermatofit, yaitu: (1). Iritan, dilakukan untuk membuat reaksi radang sehingga tidak terjadi infeksi dermatofit; (2). Keratolitik, digunakan untuk menghilangkan dermatofit yang hidup pada stratum korneum; (3) Fungisidal, secara langsung merusak dan membunuh dermatofit; (4). Perubah. Merubah dari stadium aktif menjadi tidak aktif pada rambut. Salah satu cara yang efektif untuk penanggulangan adalah mencegah penyebaran sehingga tidak terjadi endemik, peningkatkan masalah kebersihan, perbaikan gizi dan tata laksana pemeliharaan. Hewan kesayangan harus terawat dengan cara memandikan secara teratur, pemberian makanan yang sehat dan bergizi sangat diperlukan untuk anjing dan kucing. Vaksinasi adalah pencegahan yang baik. Di Indonesia pemakaian vaksin dermatofit belum dilaksanakan. Pengobatan dapat dilakukan secara sistemik dan topikal. Secara sistemik dengan preparat Griseofulvin, Natamycin, dan azole peroral maupun intravena dengan cara topikal menggunakan fungisida topikal dengan berulang kali, setelah itu kulit hewan penderita tersebut disikat sampai keraknya bersih; setelah itu dioles atau digosok pada tempat yang terinfeksi. Selain itu, dapat pula dengan obat tradisional seperti daun ketepeng (Cassia alata), Euphorbia prostate dan E. thyophylia (Ahmad., R.Z. 2009).

BAB III PEMBAHASAN 4.1 Hasil A. Signalement Nama pemilik Nama kucing Signalement : vivi : miu : Kucing, betina, warna rambut red tabby smoke, umur 3,5 bln dengan berat badan 1,25kg, temperatur 380c.

B. Anamnesa Inflamasi pada telinga, Bulu rontok dan sering menggaruk.

C. Gejala klinis Bulurontok, saatrambutdisibakterdapatkutu, rambutkusamdantakterawat, Hewan

sering menggaruk-garuk tubuhnya terkadang sampai menimbulkan luka pada kulitnya dan terdapat alopesia, eksaminasi dengan wood lamp hanya terdapat sedit pendaran warna hijau.

Status Present

1. Keadaan Umum

Perawatan Tingkah laku Gizi

: Buruk : Jinak : Buruk : 30,1oC : 120 x/menit : 20 x/menit

Sikap berdiri/habitus : Berdiri di keempat kaki Suhu rectal Frekuensi denyut jantung Frekuensi nafas

2. Kulit dan Rambut Aspek rambut Kerontokan Kebotakan Turgor kulit Permukaan kulit : Kusam : ada : ada : Baik (< 2 detik) : Tidak Rata

3. Kepala dan Leher

1. Inspeksi

Ekspresi wajah Pertulangan wajah Posisi tegak telinga Posisi kepala Sistem Gastro Intestinal

: Ekspresif : Tegas : Tegak keduanya : Tegak

Inspeksi Ukuran abdomen Bentuk rongga abdomen : Tidak ada pembesaran : Simetris

Palpasi Profundal Epigastricus : Tidak ada reaksi kesakitan

Mesogastricus : Tidak ada reaksi kesakitan Hipogastricus : Tidak ada reaksi kesakitan

Anus Kebersihan : Bersih

Refleks sphincter ani : Ada reaksi mengkerut dan menghisap Kebersihan daerah perianal : Bersih

Sistem Urogenital

Vulva dan Vagian : Rose dan tidak terdapat leleran

Alat Gerak dan Ekstremitas

Inspeksi Perototan kaki depan : Kompak Perototan kaki belakang : Kompak Spasmus otot : Tidak ada Kuku kaki : Terawat Cara berjalan : Koordinatif Kesimetrisan : Simetris

Palpasi Struktur pertulangan Kaki kanan depan Kaki kanan belakang Kaki kiri depan Kaki kiri belakang Konsistensi pertulangan Reaksi saat dipalpasi Letak rasa sakit : Tegas : Tegas : Tegas : Tegas : Keras : Tidak ada reaksi kesakitan :-

D. Pemeriksaan Penunjang A. Pemeriksaan scraping Kulit - Terdapat Kutu B. Pemeriksaan dengan menggunakan wood lamp - Terdapat Pendaran warna hijau

BAB III HASIL DAN PEMBAHASAN 3.1 Hasil

Gamabar

Keterangan Terjadi kerontokan pada tubuh kucing, terutama pada bagian ekstremitas, ekor dan thorax

Wood lamp examination terdapat pendaran warna biru kehijauan.

3.2 Pengertian Dermatophitosis Dermatophytosis, secara awam dikatakan sebagai penyakit kulit yang disebabkan oleh jamur, tanpa harus mengetahui spesies jamur kulit tersebut. Dermatophytosis pada kucing umumnya zoonotik dan sangat tinggi penularannya. Penanganan penyakit ini cukup sulit karena sering terjadi reinfeksi disamping membutuhkan waktu dan biaya tinggi. Para dokter hewan kadangkala terkecoh dalam mendiagnosa penyakit kulit jamur ini, seringkali terditeksi hanya sebagai penyakit kulit biasa. Spora jamur akan menetap dalam periode yang lama dalam lingkungannya, melalui spora penyakit dapat menular tidak saja lewat kontak terhadap hewan yang terinfeksi juga dapat melalui kandang yang pernah digunakan hewan terinfeksi, lewat sisir grooming, collar, dan bulu kucing.

3.3 Pathogenesis Terjadinya penularan dermatofitosis adalah melalui 3 cara yaitu: a). Antropofilik, transmisi dari hewan satu kehewan lain. Ditularkan baik secara langsung maupun tidak langsung melalui lantai kandang yang kurang dibersihkan, perkawinan dan udara sekitar kandang atau klinik hewan, dengan atau tanpa reaksi keradangan (silent carrier). b). Zoofilik, transmisi dari manusia ke hewan. Ditularkan melalui kontak langsung maupun tidak langsung melalui kulit yang terinfeksi jamur dan melekatpada rambut hewan. c). Geofilik, transmisi dari tanah kehewan peliharaan menyebabkan kandang lembab. Secara sporadis menginfeksi hewan dan menimbulkan reaksi radang. Untuk dapat menimbulkan suatu penyakit, jamur harus dapat melawan pertahanan tubuh non spesifik dan spesifik. Jamur harus mempunyai kemampuan melekat pada kulit dan mukosa pejamu, serta kemampuan untuk menembus jaringan pejamu, dan mampu bertahan dalam lingkungan pejamu, menyesuaikan diri dengan suhu dan keadaan biokimia pejamu untuk dapat berkembang biak dan menimbulkan reaksi jaringan atau radang. Terjadinya infeksi dermatofit melalui tiga langkah utama, yaitu: perlekatan pada keratinosit, penetrasi melewati dan di antara sel, serta pembentukan respon pejamu.

3.4 Faktor-faktor predisposisi kucing yang mudah terkena infeksi jamur ini adalah: 1. Iklim yang lembab dan hangat 2. Kesehatan yang memburuk

3. Rendahnya nilai kesadaran akan pentingnya kesehatan hewan kesayangannya untuk tingkat sosial tertentu 4. Buruk sanitasi kandang per grup, kucing liar yang tidak terkontrol karena dibebaskan keluar rumah 5. Berhubungan atau berdekatan dengan sejumlah kucing liar atau kelompok kucing yang berjumlah besar (misalnya ditempat penitipan) 6. Kucing dari segala umur, namun di tempat klinik sering ditemukan pada usia mudan dan kucing tua 7. Kucing dengan bulu panjang

3.5 Gejala Klinis Dermathopitosis Gejala klinis dari dermatophytosis berhubungan dengan pathogenesisnya,

dermatophytosis memnginvasi rambut dan epitel tanduk. Jamur akan merusak rambut, dan mengganggu keratinisasi kulit normal, secara klinis bulu rontok, timbul kerak, sehingga dapat juga terinfeksi dengan bakteri lain. 1. Gatal 2. Bulu rontok dan alopecia bisa sebagian kecil simetris ataupun asimetris dengan peradangan maunpun tanpa peradangan 3. Kerak-kerak, kemerahan, sampai lecet dapat berkembang di daerah facial, bucal, telinga, kuku, kaki depan, ekor dan sebagian badan 5. Hyperpigmemtasi walaupun jarang terjadi 6. Kucing dengan dermatophytosis yang parah dan sistemik kadang disertai dengan muntah, konstipasi atau hairball. 3.6 Treatment Dokter hewan mengggunakan obat-obatan sebagai berikut : (Amoxicilin dosis 10 mg/Kg BB; Antibiotik), (Ketoconazole 10-30 mg/Kg BB;Antifungal), (Dexamethason 0,10,15 mg/Kg BB; Anti inflamasi).

3.6.1. Amoxicillin 3.6.1.1 Pengertian Amoxicilin Amoxicillin merupakan antibiotik yang umum digunakan dalam berbagai kasus yang disebabkan infeksi bakteri.Pemberian antibiotik ini bertujuan untuk mencegah infeksi sekunder akibat keradangan yang terjadi pada daerah alopesia akibat infeksi jamur. Amoxicillin adalah obat pilihan pertama untuk menonaktifkan bakteri penyebab

penyakit. Amoxicillin merupakan antibiotik golongan penicillin yang mekanisme kerjanya dengan jalan merusak sintesis dinding sel bakteri. 3.6.1.2Farmakokinetik Absorbsi, Amoxicillin mudah rusak dalam suasana asam pH 2. Caian lambung dengan pH 4 tidak akan terlalu merusak Amoxicillin. Penggunanan Amoxicillin IM lebih efektif jika dibandingkan dengan penggunaan Amoxicillin per Oral. Distribusi, Amoxicillin didisitribusi luas dalam tubuh yang diikat oleh protein plasma sebanyak 20%. Amoxicillin masuk kedalam empedu mengalami sirkulasi enterohepatik, tetapi yang dieksresikan bersama tinja jumlanya cukup tinggi. Biotransformasi dan Eksresi,Biotransformasi Amoxicillin umumnya

dilakukan oleh mikroba berdasarkan pengaruh enzim penisilinase dan amidase. Akibat pengaruh penisilinase terjadi pemecahan cincin betalaktam, dengan kehilangan seluruh aktivitas antimikroba. Amidase memecah rantai samping, dengan akibat penurunan potensi antimikoba. Eksresi Amoxicillin melalui eksresi ditubuli ginjal. 3.6.2 Ketoconazole 3.6.2.1 Pengertian Merupakan turunan dari imidazole sintetik dengan struktur mirip mikonazole. Obat ini bersifat liofilik dan larut dalam air pada pH asam. aktif Ketokonazol aktif sebabai anti jamur baik sistemik maupun non sitemik. Antifungal ini memiliki spektrum yang luas. Pemberian pada kucing hendanya secara topical, para ahli menuturkan pemberian ketokonazole dengan cara proral akan memberkan potensial toxic. 3.6.2.2 Farmakokinetik Absorbsi, Ketokonazole merupakan anti jamur sistemik jika diminum secara peroral yang penyerapanya bervariasi antar individu. Obat ini menghasilkan kadar plasam yang relative tinggi untuk menekan aktivitas berbagai jenis jamur. Penyerapan memlalu saluran caerna akan berkurang pada pasien dengan pH lambung yang tinggi atau bersamaan dengan pemberian obat-obatan antasida. Distribusi, Dalam plasma 84% ketokonazole berikatan dengan protein plasma terutama albumin, 15% berikatan dengan eritrosit dan 1 % dalam bentuk bebas. Sebagian besar obat ini mengalami metabolisme lintas pertama. Setelah pemerian peroral obat ini dapat ditemukan di dalam urin, kelenjar lemak, liur juga pada kulit yang mengalami infeksi.

Eksresi, Sebagian besar obat ini disekresikan bersama cairan empedu kelumen usus dan hanya sebagian kecil saja yang dikeluarkan melalui urin, semuanya dalam bentuk metabolit yang tidak aktif. 3.6.3 Dexamethasone 3.6.3.1 Pengertian Dexametasone merupakan salah satu turunan dari kortikosteroid yang bekerja dengan mempengaruhi kecepatan sintesis protein. Dexametason melewati membran plasma secara difusi pasif. Deksametasone banyak digunakan sebagai anti inflamasi. Dexametashone mampu mencegah atau menekan timbulnya gejala inflamasi akibat radiasi, infeksi, zat kimia atau alergen. Secara mikroskopik obat ini mampu menghambat fenomena inflamasi dini yaitu, edema, deposit fibrin, dilatasi kapiler dan migrasi leukosit ketempat radang dan aktfitas fagositosis. Pengggunakan

Dexamethason di klinik hanya besifat paliatif yaitu hanya gejalanya saja yang dihambat sedangkan penyebab penyakit tetap ada. 3.6.3.2 Farmakodinamik Dexamethason dengan pemberian peroral diabasorbsi cukup baik. Untuk mencapai kadar tinggi dengan cepat dalam cairan tubuh, ester kortisol dan esternya diberikan secara intra vena. Untuk memberikan efek yang lama perlu dllakukan terapi secara IM. Dexamethason dapat dabasorbsi melalui kulit, sakus konjungtiva dan ruang sinovial. Penggunaan jangka panjang atau pada daerah kulit yang luas dapat menyebabkan efek sistemik, antara lain supresi korteks adrenal. Pada keadaan normal, 90% dexamethason terikat pada dua jenis protein plasma yaitu globulin pengikat kortikosteroda dan albumin.

BAB IV KESIMPULAN DAN SARAN

DAFTAR PUSTAKA

Ahmad., R.Z. 2009. Permasalahan & Penanggulangan Ring Worm Pada Hewan. Lokakarya Nasional Penyakit Zoonosis. Balai Penelitian Veteriner. Bogor. AINSWOTH G C and AUSTWICK PKC. 1973. Fungal diseases of animal.2nd Edition The Common Wealth Agricultural Bureaux, Farnham Royal, Slough, England. Boel., T. 2009. Mikosis superficial. Fakultas kedoteran gigi. Universitas Sumatera Utara.

Dawson,

C.

O. 1968. Ringworm in animals.

Rev.Med. Vet. Mycol 6 : 223-233.

JUNGERMAN P.F and R.M SCHWARTZMAN. 1972. Veternary Medical Mycology. Lea and Febiger, Philadelphia.

MORTIMER, P.H. 1955. Man, animals and ringworm. Vet.Rec, 67 : 670-672. Pohan., A. 2009. Bahan Kuliah Mikologi. arthur@fk.unair.ac.id.