Anda di halaman 1dari 10

PeranBetaBlockerdanACEInhibitorpadaGagalJantung

LukmanH.Makmun Div.KardiologiDept.I.Peny.DalamFKUI/RSCM Pendahuluan Definisi Gagal Jantung (GJ) lebih merupakan suatu sindrom klinik daripada suatu diagnosis penyakit (disease entity). Dengan membaiknya pengobatan pada PJK, hipertensi, mereka bertahan hidup selama 20 tahun, tetapi di hari tuanya kemudian, ada kemungkinan mereka akan mengalami Gagal Jantung. Di Amerika didapat 5 juta penderita Gagal Jantung dan setiap tahun timbul 400,000 kasus baru. GJ jarang pada usia dibawah 45 tahun, tetapi menanjak secara tajam pada usia 7584 tahun. Gagal Jantung merupakan penyebab utama terjadinya penyakit kronik dan menurunkan kwalitas hidup, dimana sering masukrumahsakit. SekaranginiadatambahanklasifikasibaruGagalJantungyaitu: GagalJantungSistolik GagalJantungDiastolik. +DisfungsiDiastolikadalahterganggunyarelaksasi,fillingdynamicsdandistensibilitydariLV. EF(EjectionFraction)bisanormalataurendahdanbisasimtomatikatauasimtomatik. +GagalJantungdiastolikadalahdimanafungsidiastolikabnormal,secaraklinisterdapatgambaran gagaljantung,tetapiEFnormal. +GagalJantungsistolikdenganmanifestasiklinikgagaljantung,EFrendahdanfungsisistolik abnormal. Diastolic Heart Failure (DHF) lebih banyak pada usia lanjut, dikaitkan dengan komorbid lain. Penegakan diagnosis pada DHF lebih sulit dibanding dengan GJ sistolik. Menurut guidelines Heart Failure Society 2006, penegakan diagnosis adalah dengan gejala dan tanda klinis CHF, dengan EF yang masih normal atausedikitrendahdenganbatasanberkisar4050%.Selainituperluditanyakantentangkomorbidyang seringmenyertaiDHF,yaituhipertensi,AF,DM,CAD. Pemeriksaan penunjang DHF adalah Ekokardiografi Doppler dapat mengukur fungsi diastolik, yang menunjukkankekhasanpattern.
1

AngiotensinII(ATII) Angiotensin II (A II) adalah peptida aktif hasil dari proses proteolitik dua langkah prekursor angiotensinogen. Langkah pertama adalah renin yang memecah angiotensinogen menjadi angiotensin I (A I) suatu deka peptida yang tidak aktif. Kemudian oleh peptidyl dipeptidase, ACE (Angiotensin ConvertingEnzyme),AIdiubahmenjadibentukaktifyaituAII. Renin diproduksi oleh ginjal, masuk kedalam darah, sedangkan angiotensinogen di sekresi oleh hepar danreaksienzymdengansubstratiniterjadididalamsirkulasidarah. A I dikonversi oleh ACE pada permukaan sel endotel atau oleh ACE plasma yang dilepas oleh selsel tersebut.PembentukanAIIselainmelaluimediasiACE,dapatjugaterjadilangsungdariangiotensinogen dengan mediator kalikrein, cathepsin G dan lainlain, atau dari A I dengan mediator chymase dan lain lain. Chymase di jantung diproduksi oleh mast cell, sel endothelial dan sel interstitial. Produksi A II melalui chymase berbeda pada berbagai organ, tetapi di jantung ternyata 75% oleh chymase, 15% melaluijalurACEdansisanya1015%olehmediatorlain. AIImengaktivasireseptorspesifikdariberbagaitargetorgan.Reseptoriniterdiriatasbeberapaisoform, yaitu: AT1, AT2, AT4. Pada membran AT1 terikat dengan proteinG, sedangkan AT2 tidak terikat denganproteinG,danAT4belumdiketahui. A II bersifat negative feed back terhadap produksi Renin, tetapi positif terhadap ekspresi angiotensinogen. RAA system jaringan sesudah lahir bersifat tidak aktif, tetapi di reaktivasi sebagai respons terhadap luka jaringan. RAA jaringan ini didapat di organorgan major seperti jantung, otak, pembuluh darah, ginjal, adrenaldanlainlain. RAA sirkulasi berpengaruh secara short term seperti vasokonstriksi akut, efek kronotropik atau reabsorpsiakutgaramdanairolehginjal.SedangkanRAAjaringanbersifatjangkapanjangberupaproses remodellingjantung,pembuluhdarahdanperubahanfungsiginjal. Efek AII pada current Na yaitu terjadinya penurunan ambang rangsang (threshold) aksi potensial sehingga memudahkan terjadinya reentrant arrhtymia. Karena itu pada pasien gagal jantung (GJ) kronik mudahterjadiaritmia.
2

Remodelingvaskulardanmiokard Terjadinya hypertrofi miokard karena respons terhadap pressurevolume overload dihubungkan dengan munculnyakembali (reexpression) myosin heavy chain, yaitu suatu fetal contractile protein dan skletal

chain.
Ekspresi gen myosin heavy chain ini dapat langsung di induksi akibat pressure overload yang meningkat. Peningkatan beban mekanis sudah dapat menginduksi RNA sehingga terjadi peningkatan sintesis protein pada cardiocyte mammalia dewasa. Ada penelitian menyebutkan bahwa peregangan papillaris akan mempercepat sintesis protein. Deformationdependent sodium influx kedalam myocyte dapatmerupakansuatusignalawalsebagairesponsterhadapstimulusmekaniksehingganantinyaakan terjadihipertrofimiokard.EfekAIIterhadaphipertrofisecarainvitro,adahubungannyadenganaktivasi protooncogenseperticfosdancjundangrowthfactorsepertiPDGF(PlateletDerivedGrowthFactor). Induksi cfos ini tergantung dari mobilisasi Ca intraseluler dan aktivasi Protein Kinase C (PKC). Melalui aktivasiproteinkinaseCterjadifosforilaseproteinnukleusselototpolosvaskular. Selain itu second messenger yang teraktivasi oleh regangan mekanis pada sel otot jantung adalah: phosphatidylinositol, Raf1 kinase dan MAP kinase yang ada hubungannya dengan reekspresi sejumlah gen,termasukatrialnatriuticpeptide. Jadi AII meng induksi hipertrofi kardiomiosit melalui kaskade PKC, Raf1 kinase dan MAP kinase. Selain ituAIImelaluisignalsignal,menginduksiproliferasifibroblast. Stretch(regangan)menstimulasisekresiET1(Endothelin)selainAIIdarimyositjantung,yangkemudian mengaktivasi kaskade protein kinase dari fosforylase sehingga nantinya akan menyebabkan terjadinya hipertrofi jantung. ET1 dan AII secara sinergismengaktivasi Raf1 kinase dan MAPkinase dalam sel otot jantungsehinggaterjadipeningkatansintesisprotein. Jadi secara bersamasama Na/H exchanger dan peptide vasoaktif AII dan ET1 akan mengaktivasi MAP kinasedanmenyebabkanhipertrofikardiak. ReseptorAT1danAT2: Reseptoriniterdistribusisecaraheterogendijaringanperiferdanotak.DariAT1terdapatisoformAT1a dan AT1b. Reseptor AT1a predominant terdapat dalam sel otot polos vaskular, jantung, paru, ovarium danhypothalamus.AT1ainisangatberperansebagaivasokonstriktorpadapembuluhdarah. Reseptor AT1 ber interaksi dengan berbagai protein G dan bergabung dengan salah satu heteromeric G protein yaitu Gq atau G1. Setelah AII terikat pada reseptor AT1, terjadilah aktivasi secara berurutan
3

phospholipase C, D, dan A2 melalui Gq atau inhibisi adenilat siklase melalui Gi. Aktivasi fosfolipase C menghasilkanpembentukan1,4,5triposphatedandiacylglycerol,menyebabkanaktivasiproteinkinaseC dan peningkatan kadar Ca intraseluler melalui kanal kalsium tipe L. Peningkatan Ca intraseluler berhubungandenganvasokonstriksidansekresialdosterone. UntukterjadihipertroficardiomyocytedancardiacfibrosisdiperlukankeduareseptorAT1danAT2. Gagaljantung:RAAsystem Pada gagal jantung (GJ) terjadi peningkatan RAA system (ReninAngiotensinAldosterone) disamping sistem saraf simpatis. Pasien dengan disfungsi LV minimal, efek RAA system tak sejelas efek sistem saraf simpatis, tetapi Renin sirkulasi, A II dan Aldosterone akan meningkat banyak pada GJ yang makin progresif.SistemRAAjaringanberperanbesardalamremodelingmiokarddanvaskular. FaktorfaktoryangmenyebabkanpeningkatanpelepasanReninadalah: Regulatorpentingdalampelepasanreninadalahpengaruhdarifaktorfisiologisdanfarmakologis. Faktorfisiologisyangmenstimulasipelepasanreninadalah: tekanandarahmenurunvolumecairanmenurunasupanKyangtinggi. Faktorfarmakologisterdiriatasstimulatordanpenekanpelepasanrenin. Stimulatorpelepasanreninadalah: blokadeRAAS diuretik vasodilator Aktivitasbaroreseptorarterirenalis Hipoperfusirenalis Hiponatremicperfusatekemaculadensa Volumecairanberkurangkarenadiuretikdanrestriksigaram Stimulasireseptorbetaadrenergikdiginjal.

Penekanpelepasanreninadalah: betablocker Antihipertensicentral.

A II adalah vasokontriktor kuat dan menstimulasi corteks adrenal untuk melepaskan: aldosterone sehingga terjadi retensi Na. Susunan saraf simpatis dan RAA yang berlebihan akan menyebabkan remodelingmiokarddanvaskulardankemudianmenjadigagaljantung. A II juga dapat menginduksi proliferasi sel, sehingga dapat merubah struktur pada berbagai organ termasuk kardiovaskular, seperti LV hipertrofi dan fibrosis, hipertrofi media vaskular, dan pembentukan neointima. Pada gagal jantung reseptor AT2 meningkat. Efek setelah stimulasi AT2 reseptor, adalah: vasodilatasi natriuresis stimulasibradykininnitricoxidecyclicGMPvasodilatasi. stimulasikonversiprostaglandinE2kePGF2a

Sistem RAA baik sirkulasi maupun jaringan mempunyai peran besar terhadap terjadinya perubahan strukturjaringankardiovaskular. EfekAIIterhadapsistemkardiovaskularadalah: vasokonstriktor inotroppositif aktivasineurohormonal stimulasipertumbuhansel: +ototjantung(hipertrofiventrikel) +ototpolosvaskular(resitenperifer,disfungsiendotel) +fibroblast(ventrikelkaku) SupayatimbulefekAIIdiperlukanreseptorAT1danAT2. AII selain diproduksi melalui mediator ACE , juga melalui mediator chymase dan produksinya jauh lebih banyak. Karena itu penggunaan reseptor AII antagonist yaitu blokade pada reseptor AT1, pada kelainan kardiovaskular,akanbermanfaatuntukmengatasiefekhipertrofidanfibrosisjaringan. PatofisiologiGagaljantung:(GJ) Sesuai dengan definisinya adalah kegagalan jantung untuk memompakan darah dengan cardiac output yang adekwat. Disini yang berperan utama adalah lapisan miokard, yang terdiri dari miosit. Pada miosit terjadihipertrofi,apoptosisselmiosit.
5

Terjadi perubahan pada matrix ekstra seluler berupa penambahan jaringan kolagen, berkurangnya jaringanelastin. Mekanisme terjadinya gagal jantung adalah cardiac remodelling dan aktivasi simpatoneuroendokrin berupa aktivasi adrenergik dan sistem RAAS. Cardiac remodelling dan abnormalitas sistem RAAS dapat dihambatolehACEI. Aktivasi simpatoadrenal adalah bentuk kompensasi jantung untuk mempertahankan cardiac output berupa peningkatan heart rate (denyut nadi) sehubungan dengan penurunan stroke volume (SV). Penurunan stroke volume ini terjadi karena tekanan pompa yang dihasilkan jantung menurun dan sebagai pengimbangnya adalah resistance menaik. Kenaikan resistance vascular ke perifer ini adalah merupakan efek vasokonstriksi. Baik peningkatan heart rate maupun vasokonstriksi adalah hasil aktivasi sistem simpatoadrenal. Karena peningkatan heart rate akan mengakibatkan peningkatan demand sel miokard, sedangkan supply darah sudah berkurang akibat cardiac output yang sudah sangat terbatas, makaakanmemperburukfungsijantung.Karenaitusystemsimpatoadrenalseharusnyadiinhibisi,yaitu antaralainobatpenyekatbeta. PenatalaksanaanGagalJantung: Tujuan utama pengobatan adalah untuk memperbaiki kwalitas hidup, mengurangi kemungkinan kambuh, dan memperpanjang survival. Mencapai kemungkinan terbesar dari pasien supaya dapat mencapaihasilyangoptimal,dalamfungsi,fisik,kognitif,emosionaldankegiatansocial. Kedua adalah untuk meningkatkan semaksimal mungkin kebebasan gerak dan kapasitas exercise. Usaha untukmencapainyaadalah: 1.Koreksisejauhmungkinpenyakitdasarnya,misalrevaskularisasipadaPJKberat

atauAorticreplacementpadaASberat. Sebagai obat pilihan utama pengobatan gagal jantung adalah ACEI. Banyak trial besar dengan ACE Inhibitor pada GJ selain memperbaiki simtom, tetapi juga menurunkan morbiditas dan mortalitas, yaitu 16%padaderajatringandansedang,sedangkan31%padaGJberat.
6

2.Perhatianpadanonfarmakadanrehabilitasimedik. 3.Pertimbanganobatobatan.

ACEInhibitor AsalmulaACEInhibitorberawaldaripenemuanteprotideyaitusatusalahsatupeptidayangdidapatdari bisa ular Brazilia. Kemudian di tahun 1975 pertama kali diproduksi captopril oleh Squibb dengan nama capoten. Semula ditujukan untuk obat hipertensi. Cara kerjanya yang mulamula diketahui adalah menghambat kerja ACE (Angiotensin Converting Enzyme). Enzym ini semula diketahui hanya diproduksi oleh jaringan paru dan kerjanya mengkatalysis Angiotensin I menjadi Angiotensin II. Kemudian ternyata ACE ini diproduksiolehjaringanjaringanlain,sepertivaskular,jantung,ginjaldanlainlain. Penelitian lebih lanjut ternyata ACEI mempunyai efek terhadap pencegahan terjadinya remodelling miokard. ACEI saat ini selain untuk pengobatan hipertensi, tetapi juga menjadi pilihan pertama pengobatangagaljantung. JenisjenisACEI: ACEIinidibagimenjadiduagolonganutama,yaitu: kerjapendek:Captopril kerjapanjang:Lisinopril,fosinopril,perindopril,quinapril,ramiprildll. Masingmasingmempunyaikekhasanberbedabeda,misalnya: Dayaafinitasdidalamplasmadanjaringan Efek first dose hypotension yaitu dapat menurunkan tekanan darah segera pada saat di awal pemberianobat. Obatpenyekatbeta: Terdiri atas bermacam jenis, tetapi yang paling banyak dipakai adalah golongan bisoprolol yang telah banyaktrialnya. Pengobatanfarmaka: ObatobatanuntukGJsistolik,adalah:

Pengeluaranmelaluiginjalataudimetabolismedihati.

ACEInhibitor Digoxin
7

Penyekatbeta Diuretik Nitrat.

ACEI: signifikant menurunkan angka mortalitas, readmission hospital, memperbaiki toleransi exercise danmenaikkankwalitashidup. ACEI merupakan first line therapy pada disfungsi sistolik baik dengan/tanpa GJ. Bila tak tolerans terhadapACEI,dapatdiberikanAIIRA. Digoxin:bilaterdapattakhikardia,terutamaAFrapidrespons Penyekat beta: meng antagonist sympathetic nervous system. Kontra indikasi: GJ berat, asma bronchial, bronchospastik,bradikardia<50/menit,tensisystole<90100mmHg,AVblock. Diuretik: loop diuretic memperbaiki edem paru dan edem perifer, karena itu efeknya bersifat paliatif padaGJ. Spironolacton (Aldosterone antagonist): meng inaktivasi juga Angiotensin II, sehingga dapat dipakai untukpengobatanGJ. .GJ dengan difungsi sistolik LV meningkatkan risiko tromboemboli, sehingga diperlukan obat antitrombotikuntukmencegahnya.TerutamadiberikanpadapascaIMA,UAP,PTCAatauCABG. BeberapatrialpengobatanpadaGagaljantung: MetaanalysismengenaiefekpenyekatbetaterhadapGJdenganmelibatkanjugausia >60tahun,menunjukkanangkasurvivalyangbermakna. BegitujugadenganCIBISIIdanMERITHF,USCaverdilolHFStudyyangmenelititentangobatpenyekat beta.. RESOLVD: Candesartan mempunyai efek yang sama dengan enalapril dan bila digabung efeknya lebih baik. CONSENSUSImenunjukkanhasilyangbaikdenganenalapril.BegitujugaATLAS Menurut CharmPreserved study menunjukkan bahwa dengan penggunaan candesartan dapat mencegahperburukanterjadinyaCHFpadapasienDHF,tetapibukansebagaisingleagent. Penggunaan statin untuk mengambil efek pleiotropik, berkaitan dengan pengurangan atau pencegahan terjadifibrosismiokard.

Pada PEPCHF study dengan menggunakan peridonpril, pada usia < 75 tahun, dan EF >45% dengan parameter echo untuk disfungsi diastolic, dapat memperbaiki jarak 6 walk, tetapi belum jelas bagaimanaperannyadalammengobatikelainanini. Perkembangan terbaru mengenai obatobatan pada GJ, adalah antara lain: target kontraktilitas seperti cardiac myosin activator, ANP; metabolic modulator yang akan mengotimalkan ustilisasi energy miokard. Masih dalam penelitian obat baru yang dapat memperbaiki compliance LV yaitu ALT711 , derivate thiazolium dengan memecah protein dari AGE, sehingga dapat dicegah penumpukan AGE. Dengan demikiancompliancearteriallebihbaikdanmemperbaikifungsijantung. Kesimpulan: YangsangatberperanterjadinyaGagalJantungadalahATIIyangtermasukdalamsystemRAAS. Sebagaikompensasiadalahefeksystemsimpatoadrenal. ACE Inhibitor adalah obat pertama untuk gagal jantung karena menginhibisi ACE sehingga dapat menginhibisiATII. ARBdapatdipergunakanjugasebagaipenggantiACEIataubolehjugakombinasi. Sebagai obat penunjang adalah obat penyekat beta untuk menghambat efek system simpato adrenal yangdiberikansebagaiontoptherapy. AldosteronantagonistjugamenghambatefekATIIsehinggadapatbermanfaatuntukGJ. DiuretikdanDigitalismasihdapatdiberikansesuaikondisi.
Daftarpustaka: 1. Ichihara S et al.Angiotensin II type 2 receptor is essential for LVH and cardiac fibrosis in chronic Angiotensin II induced hypertension.Circulation.2001;July17:346351. 2. Willenbrock R.,Philipp S.,Mitrovic V.,Dietz R. Neurohumoral blockade in CHF management.J.of the RAAS.2000 Sept.;vol.1 (suppl.1):2430 3. 4. McMurrayJ.WhyweneednewstrategiesinCHFmanagement.J.oftheRAAS.2000Sept.;vol.1(suppl.1):1216. YamazakiT.,YazakiY.RoleoftissueAIIinmyocardialremodellinginducedbymechanicalstress.J.ofhumanHypertension. 1999Jan.;13(suppl.1):S4347. 5. Chung O.,Csikos T.,Unger T.AII recepor pharmacology and AT1 receptor blockers. J.of human Hypertension. 1999 Jan.;13(suppl.1):S1120. 6. RobertsR.MolecularBasisofcardilogy.1996.BlackwellWSc.publ.Boston.

7.

Francis GS.Pathophysiology of the heart failure clinical syndrome. In: Textbook of cardiovascular medicine.Editor:.Topol EJ..LippincottWilliamsandWilkins,Philadelphia.2002;2nd.ed.:pg.17934.

8. 9.

Mc.GoriskGM,TreasureCB.EndothelialdysfunctioninCHD.Curr.Opin.Card.1996Jul,11;4:34150. SwinneC.HeartFailure.In:EvasJG,etal.OxfordTextbook.

10. Fox KM,Henderson JR,Bertrand ME dkk. The European trial on reduction of cardiac events with perindopril in stable CAD (EUROPA).Eur.HeartJ..1998;19suppl.J:J525 11. PfefferMAetal.PreventionofeventswithACEI(thePEACEstudydesign).Am.J.Card.1998;82:25H30H. 12. Packer M.,Cohn JN(Eds). Concensus Recommendations for the management of Chronic Heart

Failure.Am.J.Card.1999;100:23128. 13. Remme WJ. Hypotension after first dose ACEI administration in Heart Failure Should doctors stop worrying? Card.vascularDrugsandTherapy2001;15:475477.

10