Anda di halaman 1dari 22

_______________________________________SenyawaF

FenolikpadaSayura
anIndigenous

SEAFAST Center 2012

I. SENYAWAFENOLIK

Senyawa feno
olik adalah senyaawa yang memiliiki satu atau
lebih gugus hidroksil yang menempeel di cincin aromatik. Dengan
kata lain, senyawaa fenolik adalah senyawa yan
ng sekurang
kurrangnyamemiliki satugugusfenol(Gambar1.1)(V
Vermerrisdan
Niccholson2006).Terkaitdengansenyyawafenolik,seringkaliterjadi
kerrancuan pada peengertian istilah polifenol. Istillah polifenol
kad
dang disalahartikkan sebagai beentuk polimerisaasi senyawa
fen
nolik, padahal po
olifenol hanya meerupakan satu seenyawa yang
memilikilebihdarisatugugusfenol.

Gambar1.1.Fenol.

ubtitusi pada
Banyaknya vaariasi gugus yangg mungkin tresu
kerrangka utama fenol menyebabkan kelompok feno
olik memiliki
ban
nyak sekali anggo
ota. Terdapat leb
bih dari 8.000 je
enis senyawa
yan
ngtermasukdalam
mgolongansenyaawafenolik.Angggotasenyawa
fen
nolik mulai dari yang
y
paling sedeerhana dengan be
erat molekul
yan
ng kecil hingga seenyawa yang kom
mpleks dengan berat molekul
lebihdari30.000Daa(Marinovaetal..2005).Olehkarenasenyawa
mia yang tergolo
ong sebagai senyyawa fenolik sangat banyak
kim
macamnya,berbagaaicaraklasifikasid
dilakukanolehbaanyakilmuan.

SenyawaFenolikpadaSayuranIndigenous____________________________________

Salah satu metode klasifikasi adalah berdasarkan jumlah karbon


padamolekulyangdilakukanolehHarbornedanSimmonds(1964).
RincianklasifikasitersebutdisajikanpadaTabel1.1.

Tabel1.1. Klasifikasi senyawa fenolik berdasarkan jumlah atom


karbon*

Struktur
C6
C6C1

SEAFAST Center 2012

C6C2
C6C3
C6C3
C15
C15
C15
C15
C15
C15
C15
C30
C6C1C6,C6C2C6
C6,C10,C14
C18
Lignan,neolignan
Lignin
Tanin
Phlobaphene

Kelas
Fenoliksederhana
Asamfenolatdansenyawayang
berhubunganlainnya
Asetofenondanasamfenilasetat
Asamsinamat,sinamilaldehid,sinamil
alkohol
Koumarin,isokoumarin,dankromon
Kalkon,auron,dihidrokalkon
Flavan
Flavon
Flavanon
Flavanonol
Antosianidin
Antosianin
Biflavonil
Benzofenon,xanton,stilben
Kuinon
Betasianin
Dimeratauoligomer
Polimer
Oligomerataupolimer
Polimer

*VermerrisdanNicholson(2006).

A. C6:FenolikSederhana

_______________________________________SenyawaF
FenolikpadaSayura
anIndigenous

SEAFAST Center 2012

Secara umum
m senyawa fenolik sederhana memiliki
m
sifat
bakkterisidal, antiseeptik, dan antiihelmintik (Penggelly 2004).
Sen
nyawadarikelom
mpokinimerupakaanhasilsubtitusi gugusfenol.
Sub
btitusitersebutbiisaberupasubtitu
usiduagugusataausatugugus
dalam posisi orto, meta, atau para. Contoh senyyawa fenolik
sed
derhana yang terrsubtitusi oleh dua
d
dan satu guggus hidroksil
berrturutturut adaalah floroglukin
nol (1,3,5trihid
droksibenzen)
(Gaambar 1.2a) dan
n resorkinol (1,3
3dihidroksibenzeen) (Gambar
1.2b)(Vermerrisdan
nNicholson2006)).

(a)

(b)

Gam
mbar1.2. (a) Floroglukinol (1
1,3,5trihidroksibe
enzen); (b)
Resorkinol (1,3dihidroksibenzen) (Veermerris dan
Nicholson2006).

Contohfenol sederhanalainnyyaadalahpkresol,3etilfenol,
3,4dimetilfenol, daan hidrokuinon. Senyawa
S
pkresol merupakan
mo
onofenol yang ditemukan pada beberapa
b
jenis buah,
b
seperti
rasberi dan blackbeerry. Keberadaan senyawa 3etilfeenol dan 3,4
dim
metilfenolmerupaakanpenyebabtim
mbulnyacitarasaasap(smoky
taste) pada beberrapa biji coklat. Berbeda denggan pkresol,
hidrokuinon merupaakan difenol dan
n merupakan angggota fenolik
sed
derhanayangpalingbanyaktersebarditumbuhan(H
Ho1992).

SenyawaFenolikpadaSayuranIndigenous____________________________________

B. C6C1:AsamFenolatdanSenyawayangBerhubungan
Lainnya(Aldehid)

SEAFAST Center 2012

Senyawa fenolik dari golongan asam fenolat adalah fenol


yang tersubtitusi oleh gugus karboksil. Contoh asam fenolat
adalah asam galat (Gambar1.3a).Asam galatmerupakan trifenol
yang biasa terdapat di daun teh dalam bentuk teresterifikasi
bersama dengan katekin. Selain gugus karboksil, gugus lainnya
seperti aldehid juga dapat tersubtitusi di gugus fenol. Contoh
senyawa dari jenis ini adalah vanilin (Gambar 1.3b). Vanillin
berasaldarikacangvanilladanmerupakanflavorpalingterkenaldi
dunia(Ho1992).

Karboksil

Aldehid

(a)

(b)

Gambar1.3. (a)Asamgalat;(b)Vanilin(VermerrisdanNicholson
2006).

C. C6C2:AsetofenondanAsamFenilasetat

Asetofenondanasamfenilasetatadalahgolongansenyawa
fenolikyangjarangditemukandialam.Asetofenondikenalidengan

SEAFAST Center 2012

_____________________________________SenyawaFenolikpadaSayuranIndigenous

adanya gugus aseton yang tersubtitusi di fenol. Asam fenilasetat


juga memiliki gugus karboksil, namun berbeda dengan asam
fenolat, gugus karboksil pada asam fenilasetat tidak berikatan
langsung dengan cincin benzena. Contoh senyawa dari glongan
asetofenon dan fenilasetat berturutturut yaitu 2
hidroksiasetofenon (Gambar 1.4a) dan asam 2hydroksifenil
asetat (Gambar 1.4b) (Vermerris dan Nicholson 2006). Beberapa
senyawa dari glongan asetofenon seperti aposinin dan bentuk
glikosidanya(androsin)memilikikemampuansebagaiantiasmatik.
Kedua senyawa tersebut dapat ditemukan di tanaman Picrorhiza
kurroa(Pangelly2004).

(a)
(a)

(b

Gambar1.4.(a)2hidroksiasetofenon;(b)Asam2hydroksifenil
asetat(VermerrisdanNicholson2006).

D. C6C3:AsamSinamat,SinamilAldehid,danSinamil
Alkohol

Keberadaan senyawa fenolik dengan struktur C6C3


berlimpahditanaman.Fungsidarisenyawainiditanamanadalah
sebagai sistem pertahanan. Di tumbuhan, senyawa ini berada

Seny
yawaFenolikpadaS
SayuranIndigenou
us_____________________________________

SEAFAST Center 2012

dalam bentuk bebas atau sebagai po


olimer di dindingg sel. Asam
sinam
mat dicirikan deengan rangka cin
ncin benzen yangg berikatan
denggan dua atom kaarbon yang memiiliki gugus karbokksil. Contoh
senyyawadarigolongaaniniadalahasam
mpkoumarat(Gaambar1.5a).
Sinamilaldehiddanssinamilalkoholm
memilikikerangkaayangmirip
dengganasamsinamattnamundengan guguskarboksilyyangdiganti
denggan gugus aldehid dan hidroksil. Contoh sinamil aldehid
a
dan
sinam
milalkoholberturutturutadalahp
pkoumarilaldeh
hid(Gambar
1.5b) dan pkoumaril alkohol (Gam
mbar 1.5c) (Vermerris dan
Nicholson2006).

Gam
mbar1.5. (a) Asam pkoumarat; (b) pkoumaril ald
dehid; (c) p
on2006).
koumarrilalkohol(VermeerrisdanNicholso
Selain pkoumaarat, asam kafeatt juga merupakan
nsalah satu
conttoh senyawa daari golongan asam sinamat. Assam kafeat
mem
miliki struktur kimia yang mirip dengan asam pkoumarat
kecu
ualipadajumlahggugushidroksilnyya.Asamkafeatm
memilikidua
gugu
us hidroksi padaa cincin benzenaa. Asam kafeat merupakan
ase dan 5lip
inhib
bitor enzim DOPAdekarboksil
D
poksigenase.
Senyyawa ini tersebar di berbagai taanaman hijau daan biji kopi

SEAFAST Center 2012

_____________________________________SenyawaFenolikpadaSayuranIndigenous

panggang. Dari segi kesehatan, asam kafeat dapat berperan


sebagai analgesik, antiinflamatori, dan meningkatkan motilitas
usus(Pangelly2004).
Asam sinamat di tanaman biasanya ditemukan dalam
bentuk ester bersama asam kuinat, asam sikimat, dan asam
tartarat. Salah satu contoh asam sinamat yang teresterifikasi
adalah asam klorogenat. Asam klorogenat merupakan hasil
esterifikasi asam sinamat dengan asam kafeat dan asam kuinat
(Vermerris dan Nicholson2006). Senyawa inimerupakansubstrat
utamabagienzimpencoklatandiapeldanpir.Contohlainturunan
asam sinamat yang teresterifikasi (ester sinamat) adalah sinapoil
ester.Keberadaansinapoilesterdiprodukpangankurangdisukai.
Hal ini karena sinapoil ester dapat menimbulkan rasa pahit dan
warnayangtidakmenarikpadamakanan(Carteaetal.2011).

E. C6C3:Koumarin

Koumarin memiliki kerangka yang mirip dengan asam


sinamat. Perbedaan antara koamarin dan asam sinamat adalah
atomoksigenpadaguguskarboksilkoumarinmengalamisiklisisasi
(Gambar 1.6) (Vermerris dan Nicholson 2006). Di tanaman,
koumarin berperan dalam pertahanan terhadap penyakit dan
serangan hama karena memiliki aktivitas antimikrobial dan
fungisidal.Distribusikoumarinditanamansangatluas.Senyawaini
banyak terkandung di tanaman RubiaceaeAsperula; Poaceae
Avena; FabaceaeMedicago, Melilotus; RutaceaeRuta, Citrus
spp.,Murraya;ApiaceaeAngelica,Ammi(Pengelly2004).Contoh
koumarinyangsederhanaadalahumbelliferon(Gambar1.6).

Seny
yawaFenolikpadaS
SayuranIndigenou
us_____________________________________

A
AtomOyang

t
tersiklisasi

Gambar1.6.Um
mbelliferon(Verm
merrisdanNicholso
on2006).

F. Flavonoid(C
F
15)

SEAFAST Center 2012

Flavonoiddikettahuiterdistribussisecaraluaspad
datanaman.
Peranan senyawa in
ni di tanaman cukup
c
beragam, mulai dari
mem
mproduksi pigmen berwarna kuning, merah, atau
u biru pada
bungga, hingga sebaggai penangkal terrhadap mikroba dan
d insekta
(Ano
onim 2007a). Seenyawa ini mem
miliki struktur dasar
d
yang
dibangunoleh15ato
omC(C6C3C6).Seecaraumumflavo
onoiddapat
dibagikedalamtigajjenisberdasarkan
nperbedaanstrukkturC3yang
mengikat dua gugus benzen. Ketiga jenis tersebut adaalah kalkon
(Gam
mbar1.7a),auron
n(Gambar1.7b),d
danflavonoid(Gaambar1.7c)
(Vermerris dan Nicho
olson 2006). Lebiih lanjut, berdasaarkan posisi
noid(Gambar1.7c),senyawa
cinciinBterhadapcincinCpadaflavon
flavo
onoid dapat dibaagi menjadi tigaa jenis, yaitu flaavonoid (2
fenilbenzopiran) (Gaambar 1.8a), issoflavonoid (3benzopiran)
mbar 1.8b), dan neoflavonoid (4
4benzopiran) (Gaambar 1.8c)
(Gam
(Marraisetal.2006).

_____________________________________SenyawaFenolikpadaSayuranIndigenous

SEAFAST Center 2012

C3

C3

C3

Gambar1.7. (a) Kalkon; (b) Auron; (c) Flavonoid (Vermerris dan


Nicholson2006).

1. Kalkon
Kalkon dan dihidrokalkon (tidak memiliki ikatan rangkap
padaposisisepertiyangterdapatdikalkon(Gambar1.7a))
merupakan senyawa yang berperan sebagai prekursor utama
untuk pembentukan senyawa berstruktur C6C3C6 lainnya
(Maraisetal.2006).Contohsenyawadarigolongankalkondan
dihidrokalkon secara berturutturut adalah butein dan
phloridzin (phloretin2ODglukosida). Butein merupakan
pigmen berwarna kuning yang banyak terdapat di berbagai
macam bunga. Phloridzin ditemukan di daun apel dan
dilaporkan memiliki aktivitas antitumor (Vermerris dan
Nicholson2006).

SenyawaFenolikpadaSayuranIndigenous____________________________________

SEAFAST Center 2012

Gambar1.8. (a)2fenilbenzopiran;(b)3fenilbenzopiran;(c)4
fenilbenzopiran(Maraisetal.2006).

2. Auron
Auron merupakan senyawa turunan kalkon yang
mengalamisiklisasi(Chopraetal.2006).Sepertihalnyakalkon,
auron juga mengekspresikan warna kuning. Di antara semua
jenisflavonoid,aurondankalkontermasukjenisflavonoidyang
jarang dijumpai (Vermerris dan Nicholson 2006). Contoh
senyawakimiayangtermasukkedalamgolonganauronadalah
aureusidin.SenyawainidapatditemukandibungaAntirrhinum
majusdanbungadahlia(Dahliavariabilis)(LandolinodanCook
2010).

3. Flavonoid
a. Flavonoid(2fenilbenzopiron)
BerdasarkantingkatoksidasidankejenuhanpadacincinC
pada flavonoid (Gambar 1.7c), flavonoid dapat dibagi menjadi
delapan jenis, yaitu flavan, flavanon, flavon, flavonol,

10

_____________________________________SenyawaFenolikpadaSayuranIndigenous

SEAFAST Center 2012

dihidroflavonol, flavan3ol, flavan4ol, flavan3,4diol


(Gambar 1.9) (Marais et al. 2006). Dibandingkan dengan jenis
flavonoidlainnya,jenisflavonoldanflavonmerupakanduadari
jenis flavonoid yang paling banyak terdapat dalam sayur
sayurandanmerupakansenyawayangpalingtersebarluasdari
semuapigmentumbuhan kuning(Robinson1995).Keduajenis
flavonoid ini akan dibahas lebih rinci pada bab Flavonol dan
Flavon.

Gambar1.9.Flavonoid(Maraisetal.2006)

b. Isoflavonoid(3fenilbenzopiron)
Seperti halnya flavonoid, cincin yang terbentuk dari tiga
atomkarbondansatuatomoksigen(cincinC)padaisoflavonoid
juga dapat mengalami modifikasi. Modifikasi ini menyebabkan
senyawa fenolik dari golongan isoflavonoid beragam. Gambar

11

SenyawaFenolikpadaSayuranIndigenous____________________________________

SEAFAST Center 2012

1.10 memperlihatkan bagaimana modifikasi cincin C


mengakibatkan terbentunya kelompokkelompok baru dari
golonganisoflavonoid.

Gambar1.10.Isoflavonoid(Maraisetal.2006)

c. Neoflavonoid(4fenilbenzopiron)
Neoflavonoidmemilikistrukturdansifatbiogenetikyang
mirip dengan flavonoid dan isoflavonoid. Senyawa dari

12

_____________________________________SenyawaFenolikpadaSayuranIndigenous

golonganneoflavonoiddibagilagimenjaditigakelompok,yaitu
4arilkoumarin (4aril2H1benzopiran2one), 3,4dihidro4
arilkoumarin, dan neoflaven. Gambar 1.11 menyajikan rumus
strukturuntukketigakelompoktersebut.

SEAFAST Center 2012

Gambar1.11.Neoflavonoid(Maraisetal.2006).

G. C30:Biflavonil

Biflavoil merupakan senyawa fenolik yang memiliki rangka


yang disusun atas 30 atom karbon dan merupakan dimer dari
flafon. Flafon adalah salah satu anggota dari flavonoid. Biflavonil
yangpalingfamiliaradalahginkgetin(Gambar1.12)yangterdapat
di tanaman Ginkgo biloba (Vermerris dan Nicholson 2006).
Senyawa ini dapat digunakan pada penyembuhan penyakit
demensia dan kelainan pada otak lainnya. Selain itu, ginkgetin
pada Ginkgo biloba juga dapat melegakan pernapasan penderita
asma(Li2008).

13

Seny
yawaFenolikpadaS
SayuranIndigenou
us_____________________________________

SEAFAST Center 2012

Flavon

Gambar1.12.G
Ginkgetin(VermeerrisdanNicholson2006).

H. C6C1C6,C6C2C
C6:Benzofenon,Xanton,danStilben

BenzofenondaanxantonmemilikkistrukturkeranggkaC6C1C6,
sedaangkan stilben memiliki struktur kerangka
k
C6C2C66 (Vermerris
dan Nicholson 2006
6). Garcinia morella dan G. xa
anthocymus
mengandungbenzofeenon.Duajenisbeenzofenonpadattanamanini,
yaitu
u guttiferon daan gambogenon, diketahui meemiliki sifat
sitottoksik pada kanke
er usus SW480. Xanton merupakkan pigmen
berw
warna kuning yaang biasanya teerdapat di bunggabungaan.
Xantton yang ditemu
ukan di tanaman
n Garcinia dulciis diketahui
mem
miliki kemampu
uan dalam menghambat
m
peertumbuhan
Plasm
modium falciparum (Li 2008). Stilben
S
merupakaan senyawa
feno
olikyangseringteerdapatdibatanggkayu.Senyawa inimemiliki
aktivvitas antifungal. Jenis stilben yaang paling terkeenal adalah
resveratol yang dap
pat ditemukan pada
p
Veratrum album var.
gran
ndiflorum. Resveratol memiliki fungsi
f
sebagai antioksidan,
a
antiinflamatori, antip
platelet, dan antialergi pada man
nusia. Selain
itu, resveratol jugga menunjukkan kemampuann
nya dalam
mencegah terjadinyaa kanker (Pengeelly 2004). Gam
mbar 1.13a,

14

_______________________________________SenyawaF
FenolikpadaSayura
anIndigenous

SEAFAST Center 2012

mbar 1.13b, dan Gambar 1.13c berturutturut menyajikan


Gam
con
ntohstrukturbenzzofenon,xanton,danstilben.

Gam
mbar1.13.(a)Benzofenon;(b)Xan
nton;(c)Stilben(V
Vermerris
danNicholson2006).

I. C6,C10,C14:Ku
uinon

Kuinonberdasarkanjumlahato
omkarbonkeranggkanyadapat
digolongkan menjaadi tiga jenis, yaitu benzokkuinon (C6),
nafftakuinon (C10), dan
d antrakuinon (C14). Benzokuinon, misalnya
2,6dimetoksibenzokuinon (Gambar 1.14a), biasanyaa terdapat di
akaarjagung.Naftaku
uinonmerupakan
nsenyawafenolikkyangjarang
diju
umpai. Juglon (Gambar
(
1.14b) adalah salah satu contoh
nafftakuinon yang cu
ukup dikenal. Sen
nyawa ini dapat ditemukan
d
di
walnut.Antrakuinon
nmerupakankuin
nonyangpalingb
banyakdapat
dite
emukanditanam
mantingkattinggimaupundijamu
ur.Salahsatu
con
ntohantrakuinonadalahemodin(G
Gambar1.14c)(V
Vermerrisdan
Niccholson2006).

15

Seny
yawaFenolikpadaS
SayuranIndigenou
us_____________________________________

SEAFAST Center 2012

Gam
mbar1.14.(a)2,6dimetoksibenzokuinon;(b)Juglon;;(c)Emodin
(VermeerrisdanNicholson2006).

J. C18:Betasianin

Betasianin adaalah pigmen merrah dan merupakkan pigmen


mayangadapadaabuahbitmerah..Spektrumwarnaabetasianin
utam
mirip
p dengan antosianin (anggota flavonoid) namun
n betasianin
mem
milikiatomnitrogeenyangtidakdim
milikiolehantosianin.Contoh
betasianinadalahbettanidinyangrumu
usstrukturnyadissajikanpada
Gam
mbar1.15(VermerrrisdanNicholson
n2006).

16

_______________________________________SenyawaF
FenolikpadaSayura
anIndigenous

SEAFAST Center 2012

Gambar1.15.B
Betasianin(VermeerrisdanNicholso
on2006).

K. Lignan,Neolignaan,danLignin

Lignan merup
pakan dimer atau oligomer dari monolignol.
Mo
onolignol yang dimaksud antarra lain pkoumaril alkohol
(Gaambar 1.5c), kon
niferil alkohol (Gambar
(
1.16a), dan sinapil
alkohol (Gambar 1.16b). Koniferil alkohol merupakan
n monolignol
yan
ng paling sering digunakan
d
dalam biosintetis lignaan (Vermerris
dan
nNicholson2006)).

(a)

(b)

Gam
mbar1.16.(a)Koniferilalkohol;(b)Sinapilalkohol(V
Vermerris
danNicholson2006).

17

Seny
yawaFenolikpadaS
SayuranIndigenou
us_____________________________________

SEAFAST Center 2012

Biosintesis lignan merupakaan hasil dari reaaksi radikal


m
monolignol.
Istilah lignan daan neolignan dibedakan
b
berdasarkan
posiisi ikatan mono
olignol dengan monolignol
laainnya.Lignanadaalahhasilpengikaatanduamonolignoldiposisi
karbon nomor deelapan (88). Seebaliknya, neolignan adalah
dimer atau oligom
mer yang terben
ntuk dari ikatan selain 88.
C
Contoh
gambar ikatan 88 padaa lignan dapat dilihat
d
pada
G
Gambar1.17(Verm
merrisdanNichollson2006).
Berbeda deengan lignan dan neolignan yang
y
hanya
atauoligomer,liggninmerupakanp
m
merupakandimer
polimerdari
m
monolignol.Beber
rapasenyawalain
n(selaintigamono
olignolyang
te
elah disebutkan) dapat berikatan
n di lignin walau
upun dalam
ju
umlah yang sed
dikit. Senyawa lain tersebut antara
a
lain
koniferaldehida, sinapaldehida, dihidrokoniferil
d
alkohol, 5
h
hidroksikoniferil
alkohol, tiram
min ferulat, phidroksi
3metoksibenzelde
ehida, phidrokksibenzoat, daan asetat
(V
VermerrisdanNiccholson2006).

Koniferil
K
alkohol
a

Kon
niferil
alko
ohol

G
Gambar1.17.(+)
pinoresinol(Verm
merrisdanNichollson2006).

L. Tanin
T

18

SEAFAST Center 2012

_____________________________________SenyawaFenolikpadaSayuranIndigenous

Khanbabee dan Van ree (2001) yang dikutip Vermerris dan


Nicholson (2006) mengelompokkan tanin menjadi tiga kelompok,
yaitutaninterkondensasi,taninyangdapatdihidrolisis,dantanin
komplek. Tanin terkondensasi atau proantosianidin merupakan
oligomer atau polimer dari flavonoid yang mengandung unit
flavan3ol (katekin). Senyawa dalam kelompok inikurang disukai
beradadalammakanankarenamenimbulkanrasapahitdanwarna
gelap. Selain itu, senyawa dari golongan proantosianidin ini juga
merupakan zat antinutrisi yang dapat menurunkan daya cerna
protein,polisakarida,danzatmakronutrienlainnya(Carteaetal.
2001). Tanin terkondensasi banyak tersebar di bahan pangan
seperti apel, anggur, stawberi, plum, sorgum, dan barli. Contoh
tanin terkondensasi adalah prosianidin B2 (epikatekin(48)
epikatekin)(Gambar1.18).
Tanin yang dapat dihidrolisis dapat dibagi lagi menjadi dua
kelompok, yaitu gallotanin dan ellagitanin. Gallotanin ditandai
denganpusatpoliolyangmengikat1012asamgalat.Residuasam
galat tersebut sering membentuk ikatan yang unik (ikatan meta
depside) dengansesama asamgalat lainnya (Gambar 1.19). Poliol
yang paling sering ditemukan pada gallotanin adalah Dglukosa.
Poliol lainnya dapat berupa katekin atau triterpenoid. Salah satu
contoh senyawa dari golongan gallotanin adalah 2Odigalloil
1,3,4,6tetraOgalloilDglukopiranosa(Gambar1.19)(Vermerris
danNicholson2006).

19

Seny
yawaFenolikpadaS
SayuranIndigenou
us_____________________________________

SEAFAST Center 2012

Katekin

Gambar1.18.ProsiaanidinB2(epikateekin(48)epikkatekin)
(VeermerrisdanNich
holson2006).

Asam
mgalat
Polio
ol

Ikatanmetad
depside

Gam
mbar1.19.2Odiggalloil1,3,4,6tetrraOgalloilDglu
ukopiranosa
(VermeerrisdanNicholson2006).

20

_______________________________________SenyawaF
FenolikpadaSayura
anIndigenous

SEAFAST Center 2012

Ellagitanin memiliki rumus struktur yang mirip


m
dengan
gallotanin, yaitu memiliki gugus poliolsebagai
p
pussatdanasam
galat sebagai ressidu. Perbedaan utama antara elllagitanin dan
gallotaninadalah
hpadaellagitaninkarbondariresid
duasamgalat
yang berdekatan
n saling berikataan (CC) memben
ntuk formasi
heksahidroksidifeenoil (HHDP). Ko
onfigurasi unit HHDP dapat
berbentukSatau
uR(Gambar1.20).

CC
(a)

(b)

Gam
mbar1.20.HHDP:(a)konfigurasiSS;(b)konfigurasi R(Vermerris
danNicholson2006).

Tanin kompleek, sesuai dengan


n namanya mem
miliki struktur
yan
ng komplek. Tanin jenis ini merrupakan hasil dari glikosidasi
gallotanin atau ellaagitanin dengan unit katekin. Contoh
C
tanin
kom
mplekadalahAku
utissiminA(Gamb
bar1.21).

M. Phlobaphene
Struktur phlo
obaphene masih
h kurang dipahaami. Diduga
sen
nyawaini merupaakanpolimerdariiflavan4ol. Contohflavan4
olyyangterlibatadalahsepertiapifero
oldanluteoferol..Ikatanantar
flavvan4olyangterjadimerupakanikkatanyangkuatantaraatomC

21

Seny
yawaFenolikpadaS
SayuranIndigenou
us_____________________________________

SEAFAST Center 2012

nom
mor4danCnomo
or8.Contohperkiraanstrukturphlobaphene
disajjikanpadaGambaar1.22(VermerrissdanNicholson2006).

Katekin

Ellagitani

G
Gambar1.21.Aku
tissiminA(VermeerrisdanNicholso
on2006).

Flavan4ol
F

Gambar1.22.P
Phlobaphen(Verm
merrisdanNicholsson2006)

22