Anda di halaman 1dari 39

BABI

PENDAHULUAN
A. LATARBELAKANG
Kimia medisinal adalah ilmu pengetahuan yang merupakan
cabang ilmu kimia dan biologi, digunakan umtuk memahami dan
menjelaskanmekanismekerjaobatpadatingkatmolekul.
BatasanKimiaMedisinalmenurutBurger(1970)adalah:
Ilmu pengetahuan yang merupakan cabangdariilmukimia dan
biologi,dan digunakan untuk memahami dan menjelaskan mekanisme
kerjaobat.
BatasanKimiaMedisinalmenurutIUPAC(1974)adalah:
Ilmu

pengetahuan

yang

mempelajari

penemuan,

pengembangan, identifikasi dan interpretasi cara kerja senyawa


biologisaktif(obat)padatingkatmolekul.
Batasan Kimia Medisinal menurut Taylor dan Kennewell
(1981)adalah:
Studi kimiawi senyawa atau obat yang dapat memberikan efek
menguntungkan dalam sistem kehidupan dan melibatkan studi
hubungan struktur kimia senyawa dengan aktivitas biologis serta
mekanisme cara kerja senyawa pada sistem biologis, dalam usaha
mendapatkan efek pengobatan yang maksimal dan memperkecil efek
sampingyangtidakmenguntungkan.

Ruang lingkup bidang kimia medisinal menurut Burger


(1980)adalah:
1. Isolasi dan identifikasi senyawa aktif dalam tanaman yang secara
empiriktelahdigunakanuntukpengobatan.

HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI
1
KIMIA FARMASI

2. Sintesis struktur analog dari bentuk dasar senyawa yang


mempunyaiaktivitaspengobatanpotensial.
3. Mencaristruktur induk barudengancara sintesis senyawaorganik,
denganataupuntanpaberhubungandenganzataktifalamiah.
4. Menghubungkanstrukturkimiaobatdengancarakerjanya.
5. Mengembangkanrancanganobat.
6. Mengembangkan hubungan struktur kimia dan aktivitas biologis
melaluisifatkimiafisikadenganbantuanstatistik.

Kimia Medisinal (Medicinal Chemistry) disebut pula Kimia


Farmasi (Pharmaceutical Chemistry), Farmakokimia (Farmacochemie,
Pharmacochemistry)dankimiaterapi(ChimieTherapeutique).

Hubungankimiamedisinaldengancabangilmulainyaitu:
KimiaAnalisis
KimiaOrganik
KimiaFisikFarmasetika
BiokimiaBiofarmasi
KimiaMedisinal>farmakologi>KedokteranKlinik
BiologiToksikologi
MikrobiologiPatologi
Fisiologi

HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI
2
KIMIA FARMASI

Berdasarkansumbernyaobatdigolongkanmenjaditiga,yaitu:
1. Obatalamiah
Obatyangterdapatdialam.
Padatanaman,contoh:kuinindanatropin
PadaHewan,contoh:minyakikandanhormon
Padamineral,contoh:belerang(S)dankaliumbromida(KBr).
2. Obatsemisintetik
Obathasilsintesis yangbahan dasarnya berasaldaribahanobatyang
terdapatdialam.
Contoh:morfinmenjadikodeindandiosgeninmenjadiprogesteron.
3. Obatsintetikmurni
Obat yang bahan dasarnya tidak berkhasiat, setelah disintesis
akandidapatkansenyawadengankhasiatfarmakologistertentu.
Contoh: obatobat golongan analgetikantipiretik, antihistamin dan
diuretika.

Dari 252 obat pada daftar obat esensial yang dikeluarkan oleh
WHO(1985),sumbersumberobatdapatdibagisebagaiberikut:
1.Sintesiskimia(48,9%)
2.Semisintetik(9,5%)
3.Mikroorganisme(6,4%)
4.Vaksin(4,32%)
5.Sera(2%)
6.Mineral(9,1%)
7.Tumbuhtumbuhan(11,1%)
8.Hewan(8,7%)

Sifatsifat fisika kimia merupakandasaryang sangat pentinguntuk


menjelaskanaktivitasbiologisobat,olehkarena:

HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI
3
KIMIA FARMASI

1. Sifat kimiafisika memegang perananpentingdalampengangkutanobat


untukmencapaireseptor.
2. Hanya obat yang mempunyai struktur dengan kekhasan tinggi saja
yangdapatberinteraksidenganreseptorbiologis.

HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI
4
KIMIA FARMASI

BABII
PEMBAHASAN

A. Hubungan Struktur, Sifat Kimia Fisika dengan Proses Absorpsi,


DistribusidanEkskresiObat

Setelah masuk ke tubuh melalui cara tertentu (oral, parenteral,


anal, dermal, dll) obat akan mengalami proses absorpsi, distribusi,
metanolismedanekskresi.
TigaFasayangmenentukanterjadinyaaktivitasbiologisobatadalah:
1.Fasafarmasetik
Meliputi proses pabrikasi, penganturan dosis, formulasi, bentuk
sediaan, pemecahan bentuk sediaan dan terlarutnya obat aktif. Fasa ini
berperandalamketersediaanobatuntukdapatdiabsorpsiketubuh.
2.FasaFarmakokinetik
Meliputi proses absorpsi, distribusi,metabolisme dan ekskresiobat
(ADME). Fasa ini berperan dalam ketersediaan obat untuk mencapai
jaringan sasaran (target) atau reseptor sehingga dapat menimbulkan
responsbiologis.
3.FasaFarmakodinamik
Fasa terjadinya interaksi obatreseptor dalam jaringan sasaran.
Fasainiberperandalamtimbulnyaresponsbiologisobat.

Setelah obat bebas masuk ke peredaran darah, kemungkinan


mengalamiprosesprosessebagaiberikut:
1. Obatdisimpandalamdepojaringan
2. Obatterikatolehproteinplasma,terutamaalbumin
3. Obat aktif yang dalam bentuk bebas berinteraksi dengan reseptor
selkhasdanmenimbulkanresponsbiologis.

HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI
5
KIMIA FARMASI

4. Obatmengalami metabolismedengan beberapajalurkemungkinan


yaitu:
a. Obat yang mulamula tidak aktif, setelah mengalami
metabolisme akan menghasilkan senyawa aktif, kemudian
berinteraksi dengan reseptor dan menimbulkan respons
biologis(bioaktivasi)
b. Obat aktif akan dimetabolisis menjadi metabolit yang lebih
polardantidakaktif,kemudiandiekskresikan(bioinaktivasi)
c. Obat aktif akan dimetabolisis menghasilkan metabolit yang
bersifattoksik(biotoksifikasi)
5. Obatdalambentukbebaslangsungdiekskresikan.
Setelah masuk ke sistem peredaran darah,hanya sebagian
kecil molekul obat yang tetap utuh dan mencapai reseptor pada
jaringan sasaran. Sebagian besar obat berubah atau terikat pada
biopolimer. Tempat dimana obat berubah atau terikat sehingga
tidak dapat mencapai reseptor disebut sisi kehilangan (site of
loss).
Contoh sisi kehilangan: protein darah, depodepo penyimpanan, sistem
enzimyang dapat menyebabkanperubahanmetabolismeobatdaribentuk
aktif menjadi bentuk tidak aktif dan proses ekskresi obat baik sebelum
maupunsesudahprosesmetabolisme.

HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI
6
KIMIA FARMASI

B. Hubungan Struktur, Sifat Kimia Fisika dengan Proses Absorpsi


Obat
Proses absorpsi merupakan dasar yang penting dalam
menentukan aktivitas farmakologis obat. Kegagalan ata kehilangan
obat selama proses absorpsi akan mempengaruhi efek obat dan
menyebabkankegagalanpengobatan.

1. AbsorpsiObatmelaluiSaluranCerna
Pada pemberian secara oral, sebelum obat masuk ke
peredaran darahdandidistribusikan keseluruh tubuh,terlebihdulu
harusmengalamiprosesabsorpsipadasalurancerna.
Faktorfaktor yang berpengaruh terhadap proses absorpsi obat pada
salurancernaantaralain:
Bentuksediaan
Sifatkimiafisika
Carapemberian
Faktorbiologis
Faktorfaktor lain seperti umur, diet (makanan), adanya interaksi
obatdengansenyawalaindanadanyapenyakittertentu.
Absorpsi obat melalui saluran cerna terutama tergantung
pada ukuran partikel molekul obat, kelarutan obatdalam lemak/air
danderajationisasi.
2. AbsorpsiObatmelaluiMata
Bila suatu obat diberikan secara setempat pada mata,
sebagian diabsorpsi melalui membran konjungtiva dan sebagian
lagi melalui kornea. Kecepatan penetrasi tergantung pada derajat
ionisasi dan koefisien partisiobat.Bentukyangtidakterionisasidan
mudah larut dalam lemak cepat diabsorpsi oleh membran mata.
Penetrasi obat yang bersifat asam lemah lebih cepat dalam

HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI
7
KIMIA FARMASI

suasana asam karena dalam suasana tersebut bentuk tidak


terionisasinya besar sehingga mudah menembus membran mata.
Untuk obat yang bersifat basa lemah penetrasi lebih cepat dalam
suasanabasa.

3. AbsorpsiObatmelaluiParu
Obat anestesi sistemik yang diberikan secara inhalasi akan
diabsorpsi melaluiepitelparudanmembranmukosasalurannapas.
Krena mempunyai luas permukaan besar maka absorpsi melalui
buluhdarahparuberjalandengancepat.

Absorpsiobatmelaluiparutergantungpada:
Kadarobatdalamalveoli
Koefisienpartisigas/darah
Kecepatanalirandarahparu
Ukuranpartikelobat

4. AbsorpsiObatmelaluiKulit
Absorpsi obat melalui kulitsangattergantungpadakelarutan
obat dalam lemak karena epidermis kulit berfungsi sebagai
membranlemakbiologis.

C. Hubungan Struktur, Sifat Kimia Fisika dengan Proses Distribusi


Obat

HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI
8
KIMIA FARMASI


Setelah masuk ke peredaran sistemik, molekul obat secara
serentakdidistribusikankeseluruhjaringandanorgantubuh.
Kecepatan dan besarnya distribusi obat dalam tubuh
bervariasidantergantungpadafaktorfaktorsebagaiberikut:
Sifatkimiafisikaobat,terutamakelarutandalamlemak
Sifatmembranbiologis
Kecepatandistribusialirandarahpadajaringandanorgantubuh
Ikatanobatdengansisikehilangan
Adanyapengangkutanaktifdaribeberapaobat
Masaatauvolumejaringan

1. StrukturMembranBiologis
Membranbiologismempunyaiduafungsiutama,yaitu:
Sebagaipenghalangdengansifatpermeabilitasyangkhas
Sebagaitempatuntukreaksibiotransformasienergi

a.KomponenMembranSel
LapisanLemakBimolekul
Protein
Mukopolisakarida

b.ModelMembranSel
ModelStrukturMembranDavsonDanielli(1935)

HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI
9
KIMIA FARMASI

Struktur membran sel terdiri daru dua bagian dalam adalah


bagian lapisanlemakbimolekuldanbagianluaradalahsatulapisan
protein, yang mengapit lapisan lemak bimolekul. Protein ini
bergabung dengan bagian polar lemak melalui kekuatan
elektrostatik.

ModelStrukturMembranRobertson(1964)
Memperjelas model membran biologis Davsondanielli yaitu
daerah polar molekul lemak secara normal berorientasi pada
permukaan sel dan diselimuti oleh satu lapis protein pada
permukaanmembran.
ModelStrukturMembranSingerdanNicholson(1972)
Disebut model cairan mosaik dimana struktur membran
terdiri dari lemak bimolekul dan protein globular yang tersebar
diantaralemakbimolekultersebut.

2. Hubungan Struktur, Kimia Fisika dengan Proses Distribusi


Obat
Pada umumnya distribusi obat terjadi dengan cara
menembus membran biologis melalui proses difusi. Mekanisme
difusidipengaruhiolehstrukturkimia,sifatkimiafisikaobatdansifat
membranbiologis.
Prosesdifusidibagimenjadiduayaitudifusipasifdandifusiaktif.

Difusipasif
Difusipasifmelaluipori
Difusipasifdengancaramelarutpadalemakpenyusunmembran
Difusipasifdenganfasilitas

10
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI


Difusiaktif
Sistempengangkutanaktif
Pinositosis
Interaksiobatdenganbiopolimer

D. HubunganStruktur,KimiaFisikadenganProsesEkskresiObat

1. EkskresiobatmelaluiParu
Obat yang diekskresikan melalui paru terutama obat yang
digunakan secara inhalasi. Sifat fisik yang menentukan kecepatan
ekskresiobatmelaluiparuadalahkoefisienpartisidarah/udara.
2. EkskresiobatmelaluiGinjal
EkskresiobatmelaluiGinjalmelibatkantigaproses:

PenyaringanGlomerulus

AbsorpsiKembalisecaraPasifpadaTubulusGinjal

SekresiPengangkutanAktifpadaTubulusGinjal

3. EkskresiObatmelaluiEmpedu
Obat dengan berat molekul lebih dari 150 dan obat yang
telah dimetabolisis menjadi senyawa yang lebih polar, dapat
diekskresikan dari hati, melewati empedu menuju ke usus dengan
mekanisme pegangkutan aktif. Obat tersebut biasanya dalam

11
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

bentuk terkonjugasi dengan asam glukuronat, asam sulfat atau


glisin. Di usus bentuk terkonjugat tersebut secara langsung
diekskresikan melaui tinja, atau dapat mengalami proses hidrolisis
oleh enzim atau bakteri usus menjadi senyawa yang bersifat non
polar, sehingga diabsorpsi kembali ke plasma darah, kembali ke
hati, dimetabolisis, dikeluarkan lagi melaui empedu menuju ke
usus,demikian seterusnya sehingga merupakan suatu siklus yang
dinamakan siklus enterohepatik. Siklus ini menyebabkan masa
kerjaobatmenjadilebihpanjang.
3. HubunganstrukturdanprosesMetabolismeObat
Prosesmetabolisme dapatmempengaruhiaktovitasbiologis,
masa kerja dan toksisitas obat sehingga pengetahuan tentang
metabolisme obat dan senyawa organik asing lain (xenobiotika)
sangatpentingdalambidangkimiamedisinal.

Suatu obat dapat menimbulkan respons biologis dengan

melaluiduajalur,yaitu:
a. Obataktifsetelahmasukkeperedarandarah,langsungberinteraksi
denganreseptordanmenimbulkanresponsbiologis.

12
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

b. Praobat setelah masuk ke peredaran darah mengalami proses


metabolisme menjadi obat aktif, berinteraksi dengan reseptor dan
menimbulkanresponsbiologis(bioaktivasi).
Metabolisme obat adalah mengubah senyawa yang relatif
non polar, menjadi senyawa yang lebih polar sehingga mudah
dikeluarkandaritubuh.

A. FaktorfaktoryangMempengaruhiMetabolismeObat
1. FaktorGenetikatauKeturunan
Perbedaan individupada proses metabolismesejumlahobat
kadangkadang terjadi dalam

sistem kehidupan. Hal ini

menunjukkan bahwa faktor genetik atau keturunan ikut berperan


terhadapadanyaperbedaankecepatanmetabolismeobat.
2. PerbedaanSpesiesdanGalur
Pada proses metabolisme obat, perubahan kimia yang
terjadi pada spesies dan galur kemungkinan sama atau sedikit
berbeda, tetapi kadangkadang ada perbedaan yang cukup besar
pada reaksi metabolismenya. Pengamatan pengaruh perbedaan
dilakukan terhadap tipe resksi metabolik atau perbedaan kualitatif
danpadakecepatanmetabolismeatauperbedaankuantitatif.
3. PerbedaanJeniskelamin
Pada beberapa spesies binatang menunjukkan ada
pengaruhjeniskelaminterhadapkecepatanmetabolismeobat.
4. PerbedaanUmur
Bayi dalam kandungan dan bayi yang baru lahir jumlah
enzimenzim mikrosom hatiyang diperlukan untuk memetabolisme
obatrelatifmasihsedikitsehinggasangatpekaterhadapobat.

13
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

5. PenghambatanEnzimMetabolisme
Pemberian terlebihdahuluatau secarabersamasamasuatu
senyawa yangmenghambat kerjaenzimenzimmetabolisme dapat
meningkatkan intensitas efek obat, memperpanjang masa kerja
obat dan kemungkinan juga meningkatkan efek samping dan
toksisitas.
6. InduksiEnzimMetabolisme
Peningkatan aktivitas enzim metabolisme obatobattertentu
atau proses induksi enzim mempercepat proses metabolisme dan
menurunkan kadar obat bebas dalam plasma sehingga efek
farmakologis obat menurun dan masa kerjanya menjadi lebih
singkat.Induksienzim jugamempengaruhitoksisitasbeberapaobat
karena dapat meningkatkan metabolisme dan pembentukan
metabolitreaktif.
7. Faktorlainlain
Diet

makanan, keadaan kekurangan gizi, ganguan

keseimbangan hormon, kehamilan, pengikatan obat oleh protein


plasma,distribusiobatdalamjaringandankeadaanpatologishati.

B. TempatMetabolismeObat
Perubahan kimia obat dalam tubuh terutama terjadi pada
jaringan dan organorgan seperti hati, ginjal, paru dan saluran
cerna. Hati adalah organ tubuh yang merupakan tempat utama
metabolisme obat oleh karena mengandung lebih banyak
enzimenzimmetabolisme dibandingorganlain. Setelahpemberian
secara oral, obat diserap oleh saluran cerna, masuk keperedaran
darah dan kemudian ke hati melalui efek lintas pertama. Aliran
darah yang membawa obat atau senyawa organik asing melewati
selsel hati secara perlahanlahan dan termetabolisis menjadi

14
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

senyawa yang mudah larut dalam air kemudian diekskresikan


melaluiurin.

C. JalurUmumMetabolismeObatdanSenyawaOrganikAsing
Reaksi metabolisme obat dan senyawa organik asing ada
duatahap,yaitu:
1. ReaksifasaIataureaksifungsionalisme
2. ReaksifasaIIataureaksikonjugasi

a. ReaksifasaI
1. Reaksioksidasi:

Oksidasi gugus aromatik,ikatanrangkap,atomCbenzilikdanalilik,


atomCdariguguskarbonildanimin.

OksidasiatomCalifatikdanalisiklik

OksidasisistemCN,COdanCS

Oksidasialkoholdanaldehid

Reaksioksidasilainlain

2. Reaksireduksi

Reduksialdehiddanketon

Reduksisenyawaazodannitro

Reaksireduksilainlain

ReaksifasaIdapatdicapaidengan:
1. Secara langsung memasukkan gugus fungsional, contoh :
hidroksilasisenyawaaromatikdanalifatik
2. Memodifikasi gugusgugus fungsional yang ada dalam struktur
molekul,contoh: reduksigugusketonatau aldehidmenjadialkohol

15
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

Fasa I dapat menghasilkan suatu gugus fungsional yang mudah


terkonjugasi atau mengalami reaksi fasa II. Tujuan reaksi fasa II
adalah mengikat gugus fungsional hasil metabolit reaksi fasa I
dengan senyawa endogen yang mudah terionisasi dan bersifat
polar.

b. ReaksifasaII
1.Reaksikonjugasi:

Konjugasiasamglukuronat

Konjugasisulfat

Kinjugasidenganglisindanglutamin

Konjugasidenganglutationatauasammerkapturat

c. Reaksiasetilasi
d. Reaksimetilasi

4.HubunganStruktur,IkatanKimiadanAktivitasBiologis
Respons biologis merupakan akibat interaksi molekul obat
dengan gugus fungsional molekul reseptor. Interaksi ini dapat
berlangsungkarenakekuatanikatankimiatertentu.

Tipe ikatan kimia yang terlibatdalam interaksi obat reseptor


antara lain adalah ikatanikatan kovalen, ionion yang saling

16
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

memperkuat (reinforce ions),ion (elektrostatik), hidrogen, iondipol,


dipoldipol,vanderWaals,ikatanhidrofobdantransfermuatan.
a. IkatanKovalen
Ikatan kovalen terbentuk bila ada dua atom saling
menggunakan sepasang elektron secara bersamasama. Ikatan
kovalen merupakan ikatankimia yangpalingkuatdengan ratarata
kekuatan ikatan1000 kkal/mol. Dengankekuatanikatanyangtinggi
ini, pada suhu normal ikatan bersifat ireversibel dan hanya dapat
pecah bila ada pengaruh katalisator enzim tertentu. Interaksi
obatkatalisator melalui ikatan kovalen menghasilkan kompleks
yang cukup stabil dan sifat ini dapat digunakan untuk tujuan
pengobatantertentu.

b. Ikatanion
Ikatan ion adalah ikatan yag dihasilkan oleh daya tarik
menarik elektrostatik antara ionion yang muatannya berlawanan.
Kekuatan tarikmenarik akan makin berkurang bila jarak antar ion
makin jauh dan pengurangan tersebut berbanding terbalik dengan
jaraknya.

c. InteraksiIonDipoldandipolDipol
Adanya perbedaan keelektronegatifan atom Cdengan atom
yanglainsepertiOdanN,akanmembentukdistribusielektrontidak
simetrik atau dipol, yang mampu membentuk ikatan dengan ion
atau dipol lain, baik yang mempunyai daerah kerapatan elektron
tinggimaupunyangrendah.
Contoh:turunanmetadon
d. Ikatanhidrogen

17
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

Ikatan hidrogen adalah suatu ikatan antara atom H yang


mempunyai muatan positif parsial dengan atom lain yang bersifat
elektronegatif dan mempunyai sepasang elektron bebas dengan
oktet lengkap seperti O, N, F.Atom yangbermuatan positif parsial
dapat berinteraksi dengan atom negatif parsial dari molekul atau
atomlainyangberbedaikatankovalennyadalamsatumolekul.
Contoh:H2O

e. IkatanVanDerWaals
Ikatan van der waals merupakan kekuatan tarikmenarik
antar molekul atau atom yang tidak bermuatan dan letaknya
berdekatan atau jaraknya 46 . Ikatan ini terjadi karena sifat
kepolarisasian molekul atauatom.Meskipun secara individu lemah
tetapi hasil penjumlahan ikatan van del waals merupakan faktor
pengikat yang cukup bermakna terutama untuk senyawasenyawa
yangmempunyai beratmolekul tinggi.Ikatan vanderwaalsterlibat
pada interaksi cincin benzen dengan daerahbidangdatar reseptor
danpada interaksirantaihidrokarbondenganmakromolekulprotein
ataureseptor.

f.

Ikatanhidrofob
Ikatanhidrofobmerupakansalahsatukekuatanpentingpada
proses penggabungan daerah non polar molekul obat dengan
daerah non polar reseptorbiologis. Daerah nonpolar molekul obat
yang tidak larut dalam air dan molekulmolekul air disekelilingnya
akan bergabung melalui ikatan hidrogen membentuk struktur
quasicrystalline(icebergs).

g. TransferMuatan

18
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

Kompleks yang terbentuk antara duamolekulmelaluiikatan


hidrogen merupakan kasus khususdari fenomenaumum kompleks
donoraseptor, yang distabilkan melaui daya tarikmenarik
elektrostatis antara molekul donor elektron dan molekul aseptor
elektron.
Contoh:komplektransfermuatanNmetilpiridinumiodida
5.HubunganStrukturdanInteraksiObatReseptor

Reseptorobatadalahsuatumakromolekuljaringanselhidup,
mengandung gugus fungsional atau atomatom terorganisasi,
reaktif secara kimia danbersifat spesifik,dapat berinteraksisecara
reversibel dengan molekul obat yang mengandung gugus
fungsional spesifik, menghasilkan respons biologis yang spesifik
pula.
Interaksiobatreseptorterjadimelaluiduatahap,yaitu:
a. Interaksi molekul obat dengan reseptor spesifik Interaksi ini
memerlukanafinitas
b. Interaksi yang dapat menyebabkan perubahan konformasi
makromolekulproteinsehinggatimbulresponsbiologis.

19
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI


A. TeoriKlasik
Crum, Brown dan Fraser (1869), mengatakan bahwa
aktivitas biologis suatu senyawa merupakan fungsi daristruktur
kimianya dan tempat obat berinteraksi pada sistem biologis
mempunyaisifatyangkarakteristik.
Langley(1878),daristudiefekantagonisdariatropindan
pilokarpin, memperkenalkankonsep reseptor yangpertama kali
dankemudiandikembangkanolehEhrlich.
Ehrlich (1907), memperkenalkan istilah reseptor dan
membuat konsep sederhana tentang interaksi obatreseptor
yaitu corpora non agunt nisi fixata atau obat tidak dapat
menimbulkanefektanpamengikatreseptor.

B. TeoriPendudukan
Clark (1926), memperkirakan bahwa satu molekul obat
akan menempati satu sisi reseptor dan obat harus diberikan
dalam jumlah yang berlebih agar tetap efektif selama proses
pembentukankompleks.
Obat akan berinteraksi dengan reseptor membentuk
kompleksobatreseptor. Clark hanyameninjaudari segiagonis
saja yang kemudian dilengkapi oleh Gaddum (1937), yang
meninjaudarisegiantagonis.
Respons biologis yang terjadi setelah pengikatan
obatreseptordapatmerupakan:
1. Rangsanganaktivitas(efekagonis)
2. Penguranganaktivitas(efekantagonis)

20
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

Ariens (1954) dan Stephenson (1956), memodifikasi


danmembagiinteraksiobatreseptormenjadiduatahap,yaitu:
1. Pembentukankompleksobatreseptor
2. Menghasilkanresponsbiologis
Setiap struktur molekul obat harus mengandung bagian
yang secara bebas dapat menunjang afinitas interaksi
obatreseptor dan mempunyai efisiensi untuk menimbulkan
respons biologis sebagai akibat pembentukan kompleks obat
reseptor.

AfinitasEfikasi

O+R>KompleksOR>Responsbiologis

O+R>OR>Respons(+):Senyawaagonis

<

O+R>OR>Respons():Senyawaantagonis

<
C. TeoriKecepatan
Croxatto dan Huidobro (1956), memberikan postulat
bahwa obat hanya efisien pada saat berinteraksi dengan
reseptor.
Paton (1961), mengatakan bahwa efekbiologisdariobat
setara dengan kecepatan ikatan obatreseptor dan bukan dari
jumlahreseptoryangdidudukinya.

AsosiasiDisosiasi

O+R>KompleksOR>Responsbiologis

<

21
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

Senyawa dikatakan agonis bila mempunyai kecepatan


asosiasi atau sifat mengikat reseptor besar dan disosiasi yang
besar.
Senyawa dikatakn antagonis bila mempunyai kecepatan
asosiasisangatbesarsedangdisosiasinyasangatkecil.
Senyawa dikatakan agonis parsial bila kecepatan
asosiasidandisosiasinyatidakmaksimal.

D. TeoriKesesuaianTerimbas
Menurut Koshland (1958), ikatan enzim (E) dengan
substrat

(S) dapat menginduksi terjadinya

perubahan

konformasi struktur enzim sehingga menyebabkan orientasi


gugusgugusaktifenzim.

(E)+(S)>KompleksES>Responsbiologis

<

E. TeoriGanguanMakromolekul
Belleau (1964), memperkenalkan teori model kerja obat
yang disebut teori gangguan makromolekul. Menurut Belleau,
interaksi mikromolekul obat dengan makromolekul protein
(reseptor) dapat menyebabkan terjadinya perubahan bentuk
konformasireseptorsebagaiberikut:
1. Gangguan konformasi spesifik (Specific Conformational
Perturbation=SCP)
2. Gangguan

konformasi

tidak

spesifik

(Non

Specific

ConformationalPerturbation=NSCP.
Obat agonis adalah obat yang mempunyai aktivitas
intrinsik dan dapat mengubahstruktur reseptormenjadibentuk
SCPsehinggamenimbulkanresponsbiologis.

22
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

Obat antagonis adalah obat yang tidak mempunyai


aktivitasintrinsikdandapatmengubahstrukturreseptormenjadi
bentukNSCPsehinggamenimbulkanefekpemblokan.
Pada teori ini ikatan hidrofob merupakan faktor
penunjangyangpentingpadaprosespengikatanobatreseptor.

F. TeoriPendudukanAktivasi
Ariens

dan

Rodrigues

de

Miranda

(1979),

mengemukakan teori pendudukanaktivasi dari model dua


keadaan yaitu bahwa sebelum berinteraksi dengan obat,
reseptor berada dalam kesetimbangan dinamik antara dua
keadaanyangberbedafungsinya,yaitu:
1.

Bentukteraktifkan(R*):dapatmenunjangefekbiologis

2.

Bentukistirahat(R):tidakdapatmenunjangefekbiologis

Agonis

R>R*

<

Antagonis

G. KonsepKurirKedua
Reseptor dari banyak hormon berhubunganerat dengan
sistem adenil siklase. Sebagai contoh katekolamin, glukagon,
hormon paratiroid, serotonin dan histamin telah menunjukkan
pengaruhnya terhadap kadar siklikAMP dalam intrasel,
tergantung pada hambatan atau rangsanganadenilsiklase.Bila
rangsangan tersebut meningkatkan kadar siklikAMP, hormon
dianggap sebagai kurir pertama (first messenger), sedang
siklikAMPsebagaikurirkedua(secondmessenger).

23
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI


H. TeoriMekanismedanFarmakoforsebagaidasarRancangan
Obat
Teori mekanisme dan farmakofor sebagai dasar
rancangan obat dapat diilustrasikan oleh obat antihipertensi
penghambat

kompetitif

enzim

pengubah

angiotensin

(Angiotensinconvertingenzyme=ACE).

6.HUBUNGANKUALITATIFSTRUKTURAKTIVITAS
A. AktivitasObat
Dasar dari aktivitas obat adalah prosesproses kimia
yangkompleks mulai dari saat obatdiberikan sampaiterjadinya
responsbiologis.
Fasafasayangmempengaruhiaktivitasobat,yaitu:

Fasafarmakokinetik

Meliputi proses fasa II dan fasa III. Fasa II adalah proses


absorpsi molekul obat yang menghasilkan ketersediaan biologis

24
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

obat,yaitu senyawaaktifdalam cairan darah (pH= 7,4)yang akan


didistribusikan ke jaringan atau organ tubuh. Fasa III adalah fasa
yang melibatkan proses distribusi, metabolisme dan ekskresiobat,
yang menentukan kadar senyawa aktif pada kompartementempat
reseptorberada. FasaI,IIdanIIImenentukankadarobataktifyang
dapatmencapaijaringantarget.

Fasafarmakodinamik
Meliputi proses fasa IV dan fasa V. Fasa IV adalah tahap

interaksi molekul senyawa aktif dengan tempat aksi spesifik atau


reseptor pada jaringan target, yang dipengaruhi oleh ikatan kimia
yang terlibat seperti ikatan kovalen , ion van der waals, hidrogen,
hidrofob, iondipol atau dipoldipol, keserasian bentuk dan ukuran
molekul obat dengan reseptor. Fasa V adalah induksi ransangan,
dengan melalui proses biokimia, menyebabkan terjadinya respons
biologis.RancanganobatdalaptdilakukanpadafasaIsampaiIV.

1. AktivitaspadaFaseFarmakokinetik
Untuk memberikan efek biologis, obat dalam bentuk
aktifnya harus berinteraksi dengan reseptor atau tempat aksi
atau sel target, dengan kadar yang cukup tinggi. Sebelum
mencapai reseptor, obat terlebih dulu harus melalui proses
farmakokinetik.
Faktorfaktorpenentudalamprosesfarmakokinetikadalah:
a. Sistem kompartemen dalam cairan tubuh, seperti : cairan
intrasel, cairan ekstrasel dan berbagai fasa lipofil dalam
tubuh.
b. Protein plasma, protein jaringan dan berbagai senyawa
biologisyangmungkindapatmengikatobat.

25
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

c. Distribusi obat dalam berbagai sistem kompartemen


biologis, terutama hubungan waktu dan kadar obat dalam
berbagai sistem tersebut yang sangat menentukan kinetika
obat.
d. Dosis dan sediaan obat, transpor antar kompartemen
seperti proses absorpsi, bioaktivasi, biodegradasi dan
ekskresiyangmenentukannlamaobatdalamtubuh.
Metabolisme obat mempunyai peranan penting dalam
proses farmakokinetik. Sistem enzim metabolisme obat, terutama
enzim oksidase di hati serta enzim hidrolase di hati dan plasma,
berperan dalammengubah senyawa lipofilikmenjadisubstratuntuk
sistem konjugasi. Selanjutnya senyawa mengalami konjugasi
menghasilkan konjugat glukuronida, sulfat dan glisin yang bersifat
sangat mudah larut dalam air dan kemudian diekskresikan melalui
ginjal atau hati. Senyawa lipofilik yang tahan terhadap proses
metabolismeakandiakumulasikanpadajaringanlemak.
Pengikatan obat dengan protein plasma terutama albumin
juga berperan penting dalam proses farmakokinetik. Hanya fraksi
obat yang bebas (bentuk tidak terikat) dalam plasma yang
dipandang

sebagai

indikator

untuk

kadar

obat

dalam

kompartemenkompartemenlain,bukankadarobatdalamplasma.
2. AktivitasyangTerjadipadaProsesFarmakokinetikLingkungan
Farmakokinetik lingkungan mempelajari tentang interaksi
antara makhluk hidup, manusia, hewan dan tumbuhtumbuhan
dengansenyawasenyawakimiayangtersebardilingkungan.
Studifarmakokinetiklingkunganmeliputi:
a.

Ekosistemataupopulasidalamlingkungan

26
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

Bagian utama sistem kompartemen lingkungan adalah


udara, tanah, air tanah dan air permukaan serta populasi
berbagaispesiestanamandanhewanataubiomasa.
b.

Polutan
Tingkat akumulasi polutan atau senyawa radioaktif perlu
ditentukandengan satuan unit per waktu, jugawaktu paro (t1/2)
dankecepataneliminasibiologisnya.

c.

Senyawaanorganik.
Ditentukan waktu beradanya, lama senyawa berubah,
kadar senyawa dan kecepatan peningkatan senyawa dengan
satuan unit per waktu, waktu eliminasi senyawa sampai
tercapaikeadaankeseimbangandanwaktuparosenyawa.

3.AktivitasolehInduksidariEfek
Kekuatanresponsbiologisobattergantungpada:
a. Jumlahtempatreseptoryangdiduduki
b. Ratarata lama pendudukan, yang tergantung pada kecepatan
disosiasikompleksobatreseptor
c. Kemampuan atau kapasitas molekul obat untuk menginduksi
perubahan bentuk konformasi biopolimer, yang dibutuhkan
sebagaipemicurangsangantimbulnyaresponsbiologis.

4.AfinitasdanAktivitasInstrinsik
Setiap struktur molekul obat harus mengandung bagian
yang secara bebas dapat menunjang afinitas interaksi
obatreseptor dan mempunyai efisiensi untuk menimbulkan

27
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

respons biologis sebagai akibat pembentukan kompleks obat


reseptor.
Parameter induksi efek pada reseptor spesifik adalah sebagai
berikut:
a.

Afinitas molekul obat dengan reseptor, yang ditentukan oleh


kekuatanikatanobatreseptor.

b. Kompleks obatreseptor yang memungkinkan terjadinya


perubahan transformasi dan distribusi muatan reseptor sehingga
timbul rangsangan atau respons yang sesuai. Kemampuan untuk
menimbulkanresponsbiologisdisebutaktivitasintrinsik.
Afinitas adalah ukuran kemampuan obat untuk mengikat
reseptor. Afinitassangattergantung padastrukturmolekulobatdan
sisireseptor.
Aktivitas intrinsik adalah ukuran kemampuan obat untuk
dapat memulai timbulnya respons biologis. Aktivitas intrinsik
merupakankarakteristikdarisenyawasenyawaagonis.

5.AktivitaspadaPercobaaninvivodaninvitro
Aktivitas biologis pada percobaan in vivo adalah satu
integrasi dan keseimbangan yang kompleks dari sifat kimia fisika
senyawa yang ditentukan oleh berbagai kondisi biologis atau
biokimiadanbiofisikapadaberbagaifasadariaktivitasobat.
Studi obat secara in vitro pada pecobaan dengan
menggunakan organ yang terisolasi, pengaruh dari transpor,
perubahan kimia, metabolisme dan ekskresi obat menjadi minimal
dan distribusi menjadi lebih sederhana, sehingga diharapkan
hubungan strukturaktivitas menjadi lebih jelas dan mendapatkan
informasitentang sifatkimia obat yangberperanterhadapaktivitas,

28
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

bagian struktur molekul obat yang berinteraksi dengan reseptor


(gugusfungsi)danpenyebabdariefek.

6.AktivitasdariSenyawaMultipoten
Beberapa senyawa dalam satu turunan obat dapat
menunjukkanaktivitasbiologisyangbermacammacam.
Hubungan antara komponen yang bervariasi dalam spektrum
aktivitas senyawa multipoten mempunyai kemungkinan bervariasi,
yaitu:
a. Komponen yangbervariasidalamaktivitasbiologisdisebabkanoleh
interaksiobatdengantipereseptoryangberbeda
b. Komponen yang bervariasi dalam spektrum aktivitaskemungkinan
disebabkan oleh tipe molekul yang berbeda. Molekul obat sendiri
dapat menimbulkan satu efek sedang metabolitnya menimbulkan
efekyanglain
c. Komponen yang bervariasi dalam spektrum aktivitaskemungkinan
merupakan aspek yang mendasar dari satu tipe unit aksi
farmakologis
d. Hilangnya satu komponen aktivitas dalam spektrum aktivitas dari
turunan obat tertentu kemungkinan disebabkan oleh perbedaan
distribusi, tidak oleh pemisahan yang mendasar dari aktivitas
komponen.

7.EfekTerapetikdanEfekSamping
Spektrum efek dari senyawa multipoten dapat dibedakan
dalam efek terapetik dan efek samping atau efek yang diinginkan
dan efek yang tidak diinginkan. Kualifikasi efek terapetikatauefek
sampingdapatrelatifsubyektif.

29
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

Untukmencapai tujuanpengembanganobatdapatdilakukan
dengan menghilangkan salah satu komponen aktivitas dari
spektrum aktivitas obat atau memisahkan dua komponen aktivitas
dari satu obat menjadi dua senyawa yang berbeda, melalui
manipulasimolekul.

B.HubunganStrukturAktivitas
1.

Faktor

yang

Kurang

Mendukung

Hubungan

StrukturAktivitas
a. Perbedaan keadaan pengukuran parameter kimia fisika dan
aktivitasbiologis
b. Senyawa yang digunakan ternyata bentuk praobat, yang terlebih
dahuluharusmengalamibioaktivasimenjadimetabolitaktif.
c. Aktivitas obat dipengaruhi oleh banyak keadaan in vivo, seperti
distribusi obat yang melibatkan proses transpor, pengikatan oleh
protein, proses metabolisme yaitu bioaktivasi dan biodegradasi
sertaprosesekskresi.
d. Senyawamempunyaipusatatomasimetris,sehinggakemungkinan
merupakan campuran rasemat dan masingmasing isomer
mempunyaiderajataktivitasyangberbeda.
e. Senyawamempunyaiaktivitas biologisyangmiripdengansenyawa
laintetapiberbedamekanismeaksinya.
f. Pengaruhbentuksediaanterhadapaktivitas
Formulasi farmasetis dapat menyebabkan kegagalan studi
hubungan strukturaktivitas. Faktor seperti ukuran partikel dan
bentuk kristal obat dalam sediaan farmasi kemungkinan dapat
mempengaruhipotensiobat.
g. Obatbersifatmultipoten

30
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

Struktur kimia yangdiperlukanuntukmenimbulkanaktivitasbiologis


yang berbeda mungkin serupa atau tuumpang tindih, sedikit atau
banyakdaninipadaumumnyaterdapatpadasenyawamultipoten
h. Perbedaanspesies
Terutama pada obat yang memberikan perbedaan aktivitas
yang besar oleh adanya perbedaan spesies. Perbedaan ini pada
umumnya terjadi pada obat bersifat lipofilik yang kemungkinan
disebabkanoleh perbedaan proses perubahanmetabolik(oksidatif
atauhidrolitik)dihatidanprosesekskresiobatdiginjal.

2.FaktoryangMendukungHubunganStrukturAktivitas
a. HubunganstrukturaktivitasempirisyangsifatnyaInsidental
Untuktipeobattertentu hukum empirisyang diperlukan untuk
terjadinya aktivitas biologis dapat digunakan untukmembuatturunan
obatberdasarkandatapercobaanyangtersedia.
b. Strukturobatsimetrik
Beberapa tipe obattertentuadayangmengandungduagugus
fungsi yang simetrik yang berhubungan dan mungkin diperlukan
untukaktivitasataumempunyaikeuntungantertentu.
3. Hubunganstrukturaktivitasyangsebenarnya
Aktivitas biologis merupakan refleksi sifat kimia fisika dari
senyawa bioaktif, sehingga hubungan strukturaktivitassebenarnya
adahukumyangtertentu.
a.

Hubungansifatkimiafisikadanaktivitas

b.

Hubungan struktur kimia dan aktivitas biologis obat


dengantempataksiyangsama

c.

Hubunganstrukturaktivitastaklangsung

d.

Hubunganstrukturaktivitasuntukstereoisomer

C.PengukuranKuantitatifAktivitasBiologis

31
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

1. Efekindividu
2. Efekbertingkat
3. Efekkuantal

7.HubunganKuantitatifStrukturAktivitas

Konsep

bahwa

aktivitas

biologis

suatu

senyawa

berhubungan denganstrukturkimia,pertamakalidikemukakanoleh
Crum, Brown,Fraser (1869). Hubungan kuantitatif struktur kimia
dan aktivitas biologis obat (HKSA) merupakan bagian penting
rancangan obat, daalam usaha mendapatkan suatu obat baru
dengan aktivitas yang lebih besar, keseltifan yang lebih tinggi,
toksistasatauefeksampingsekecilmungkindankenyamananyang
lebih besar, akan lebih menghemat biaya atau lebih ekonomis
karena untuk mendapatkan obat baru dengan aktivitas yang
dikehendaki , faktor cobacoba ditekan sekecil mungkin sehingga
jalursintesismenjadilebihpendek.
Ada beberapa model pendekatan hubungan kuantitatif
strukturaktivitas,antaralain:

A. ModelPendekatanHKSAFreeWilson

32
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

Free dan Wilson (1964), mengemukakan suatu konsep


hubungan struktur dan aktivitas biologis obat, yang dinamakan
model de novo atau model matematik FreeWilson. Mereka
mengemukakan bahwa respons biologis merupakan sumbangan
aktivitas dari gugusgugus substituen terhadap aktivitas biologis
senyawainduk,yangdinyatakanmelaluipersamaanberikut:
Log1/C=S+

Log1/C=Logaritmaaktivitasbiologis
S = Total sumbangan substituen terhadap aktivitas biologis
senyawainduk
=aktivitasbiologissenyawainduk

Model de novo ini kurang berkembang karena tidak dapat


digunakan bila efek substituen bersifat tidak linier atau bila ada
interaksi antar substituen. Selain itu model ini memerlukan banyak
senyawa dengankombinasisubstituen yang bervariasiuntukdapat
menarik kesimpulan yang benar. Namun model ini juga memiliki
keuntungan karena dapat menghubungkan secara kuantitatif
antara struktur kimia dan aktivitas biologis dari turunan senyawa
denganbermacammacamgugussubstitusipadaberbagaizona.

B. ModelPendekatanHKSAHansch
Hansch (1963), mengemukakan suatu konsep bahwa
hubungan struktur kimia dengan aktivitas biologis (log 1/C) suatu
turunan senyawa dapat dinyatakan secara kuantitatif melalui
parameterparameter sifat kimia fisika dari substituen yaitu
parameter hidrofobik (), elektronik (), dan sterik (Es). Model
pendekatan inidisebut juga modelhubunganenergi bebas linier

33
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

(linier free energy relationship = LFER) atau pendekatan


ekstratermodinamik.

Pendekatan

ini

menggunakan

dasar

persamaan Hammet yang didapatdari kecepatan hidrolisis turunan


asambenzoat,sebagaiberikut:
Log(kx/kh)=
kx dan kh : tetapan keseimbangan reaksi dari senyawa
tersubstitusidansenyawainduk
:tetapan yangtergantung padatipedan kondisi reaksi
sertajenissenyawa
: tetapan yang tergantung pada jenis dan kedudukan
substituen

1. ParametersifatkimiafisikadalamHKSAmodelHansch
Parameteryangseringdigunakanyaitu:
a. Parameterhidrofobik
Parameter hidrofobik (lipofilik) yang sering digunakan
adalah logaritma koefisien partisi (log P), tetapan Hansch,
tetapan

fragmentasi

RekkerMannhold

dan

tetapan

kromatografiRm.
b. Parameterelektronik
Adatigajenissifatelektronikyangdigunakan,yaitu:

Pengaruh berbagai substituen terhadap reaktivitas bagian


molekul yang tidak mengalami perubahan. Penetapannya
menggunakanperhitunganorbitalmolekul.

Sifat elektronik yangberkaitandengantetapanionisasi(pKa)


dan berhubungan dengan bentuk terionkan dan tak
tterionkan dari suatu senyawa pada pH yang tertentu.
Penetapannya

menggunakan

persamaan

HendersonHasselbach.

34
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

Sifat

oksidasireduksi

Penetapannya

atau

menggunakan

reaktivitas

senyawa.

perhitungan

mekanika

kuantumdarienergiorbital.
Tetapan elektronik yang sering digunakan dalam hubungan
strukturaktivitas adalah tetapan Hammet, tetapan i Charton,
tetapan*Taft,dantetapanF,RSwainLupton.
Tetapanelektroniklainlain:

Tetapanreaksi,contoh: pKa(tetsapan disosiasi),K(Tetapan


reaksi),t(waktuparobiologis)

Sifat organik fisik, contoh: E(potensial redoks),v(spektra


inframerah)danppm(spektraNMR)

Totalenergi elektron dalammolekul, contoh:Etot,EHOMOdan


ELEMO

c. Parametersterik
Tetapan sterik substituen dapat diukur berdasarkan sifat
meruah gugusgugusdan efekgugus padakontak obatdengan
sisireseptoryangberdekatan.
Tetapan sterik yang sering digunakan dalam hubungan
strukturaktivitas adalah tetapan Es Taft, tetapan Esc Hancock,
tetapan dimensi van der waals, tetapanU Charton dantetapan
sterimol Verloop. Karena data tetapan sterik tersebut tidak
tersedia untuk banyak tipe substituen, parameter sterik yang
dihitung secara teoritis juga digunakan dalam hubungan
strukturaktivitas yaitu berat molekul (BM = Mw), refraksimolar
danparakor.

2. AnalisisStatistikdalamHKSAModelHansch

35
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

Perhitungan statistik yang banyak digunakan dalam


hubungan struktur dan aktivitas melalui parameterparameter
kimiafisikaadalahregresilinierdannonnlinier.
a. RegresiLinier
Perhitungan regresilinierdigunakanuntukmencari
hubungan antara aktivitas biologis dengan satu
parameterkimiafisikaataulebih.

Y=aX+b

Y:aktivitasbiologis(variabeltergantung)
X:parameterkimiafisika(variabeltidaktergantung)
A,b:koefisienregresi

Regresi linier untuk dua dan tiga parameter kimia


fisika, dapat dinyatakan melalui parameterparameter
sebagaiberikut:
Y=aX1+bX2+cX3+d

X1,X2danX3:parameterparameterkimiafisika1,2dan3

b. RegresiNonLinier
Regresinonlinieruntuksatuparameterkimiafisika
dapat dinyatakan melalui persamaanpersamaansebagai
berikut:

Y=a(X)2+bX+c
Regresi non linier untuk dua dan tiga parameter
kimia

fisika,

dapat

dinyatakan

melalui

parameterparametersebagaiberikut:

36
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

Y=a(X1)2+bX1+cX2+dX3+e

c. KriteriaStatistik
Keabsahan persamaan yang diperoleh dan arti
perbedaan parameter yang digunakan dalam hubungan
strukturaktivitas model Hansch, dapat dilihat dengan
beberapakriteriastatistiksepertir,r2,F,tdans.
Artikriteriastatistik:

Nilair(koefisienkorelasi)
Menunjukkan tingkat hubungan antara data aktivitas
biologis pengamatan percobaan dengan data hasil
perhitungan berdasarkan persamaan yang diperoleh dari
analisis regresi. Semakin tinggi nilainya semakin baik
hubungannya.

Nilair2
menunjukkan berapa % aktivitas biologis yang dapat
dijelaskan hubungannya dengan parameter sifatkimia fisika
yangdigunakan.

NilaiF
menunjukkan

kemaknaan

hubungan

bila

dibandingkan dengan tabel F. Makin besar nilai F semakin


besarderajatkemaknaanhubungan.

Nilait
menunjukkan perbedaan koefisienregresia, b, c dan
ddaripersamaanregresibiladibandingkandengantabelt.

Nilais(simpanganbaku)
Menunjukkan

nilai

variasi

kesalahan

dalam

percobaan.

37
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

BABIII
PENUTUP

A. KESIMPULAN

Hubungan Struktur, Sifat Kimia Fisika dengan Proses


Absorpsi,DistribusidanEkskresiObat

38
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI

TigaFasayangmenentukanterjadinyaaktivitasbiologisobat
adalah:
1. Fasafarmasetik
Meliputi proses pabrikasi, penganturan dosis, formulasi,
bentuk sediaan, pemecahan bentuk sediaan dan terlarutnya obat
aktif. Fasa ini berperan dalam ketersediaan obat untuk dapat
diabsorpsiketubuh.

2. FasaFarmakokinetik
Meliputi proses absorpsi, distribusi, metabolisme dan
ekskresiobat(ADME). Fasainiberperandalamketersediaan obat
untuk mencapai jaringan sasaran (target) atau reseptor sehingga
dapatmenimbulkanresponsbiologis.
3. FasaFarmakodinamik
Fasa terjadinya interaksi obatreseptor dalam jaringan
sasaran.Fasainiberperandalamtimbulnyaresponsbiologisobat.

DAFTARPUSTAKA

Siswandono danBambang,S.2000. Kimia Medisinal.AirlanggaUniversity

Press:Surabaya.

39
HUBUNGANSTRUKTURDenganAKTIFITASOBATKIMIAFARMASI KIMIA FARMASI