Anda di halaman 1dari 428

.

id

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

://

tp

ht

Buku Guru

MATEMATIKA

SMP/MTs

VIII

Kelas

Hak Cipta 2014 pada Kementerian Pendidikan dan Kebudayaan


Dilindungi Undang-Undang.

MILIK NEGARA
TIDAK DIPERDAGANGKAN

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Disklaimer: Buku ini merupakan buku guru yang dipersiapkan Pemerintah dalam rangka
implementasi Kurikulum 2013. Buku guru ini disusun dan ditelaah oleh berbagai pihak
di bawah koordinasi Kementerian Pendidikan dan Kebudayaan, dan dipergunakan dalam
tahap awal penerapan Kurikulum 2013. Buku ini merupakan dokumen hidup yang
senantiasa diperbaiki, diperbaharui, dan dimutakhirkan sesuai dengan dinamika kebutuhan
dan perubahan zaman. Masukan dari berbagai kalangan diharapkan dapat meningkatkan
kualitas buku ini.
Katalog Dalam Terbitan (KDT)

Indonesia. Kementerian Pendidikan dan Kebudayaan.



Matematika / Kementerian Pendidikan dan Kebudayaan.-- Jakarta : Kementerian
Pendidikan dan Kebudayaan, 2014.

x, 418 hlm : ilus. ; 25 cm.


Untuk SMP/MTs Kelas VIII


ISBN 978-602-282-083-3 (jilid lengkap)
ISBN 978-602-282-085-7 (jilid 2)

510

ht

tp

://


1. Matematika -- Studi dan Pengajaran
I. Judul

II. Kementerian Pendidikan dan Kebudayaan

Kontributor Naskah

: Abdur Rahman Asari, Mohammad Tohir, Erik Valentino, Zainul


Imron, Ibnu Taufiq, Nuniek Slamet Hariarti, dan Dana Arief
Lukmana.

Penelaah

: Agung Lukito, Turmudi, dan Dadang Juandi.

Penyelia Penerbitan

: Pusat Kurikulum dan Perbukuan, Balitbang, Kemdikbud.

Cetakan ke-1, 2014


Disusun dengan huruf Times New Roman, 11 pt.
ii

Kata Pengantar

ht

tp

://

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Matematika adalah bahasa universal dan karenanya kemampuan matematika siswa


suatu negara sangat mudah dibandingkan dengan negara lain. Selain dari itu, matematika
juga dipakai sebagai alat ukur untuk menentukan kemajuan pendidikan di suatu negara.
Kita mengenal PISA (Program for International Student Assessment) dan TIMSS (The
International Mathematics and Science Survey) yang secara berkala mengukur dan
membandingkan antara lain kemajuan pendidikan matematika di beberapa negara.
Standar internasional semacam ini memberikan arahan dalam merumuskan pembelajaran
matematika di SMP/MTs. Hasil pembandingan antara yang kita ajarkan selama ini dengan
yang dinilai secara internasional menunjukkan adanya perbedaan, baik terkait materi maupun
kompetensi. Perbedaaan ini menjadi dasar dalam merumuskan pembelajaran Matematika
dalam Kurikulum 2013.
Buku Matematika Kelas VIII SMP/MTs Kurikulum 2013 ini ditulis dengan berdasarkan
pada materi dan kompetensi yang disesuaikan dengan standar internasonal tersebut. Terkait
materi misalnya, sebagai tambahan, sejak kelas VII telah diajarkan antara lain tentang data
dan peluang; pola dan barisan bilangan, aljabar, dan bangun; serta transformasi geometri.
Keseimbangan antara matematika angka dan matematika pola dan bangun selalu dijaga.
Kompetensi pengetahuan bukan hanya sampai memahami secara konseptual tetapi sampai
ke penerapan melalui pengetahuan prosedural dalam pemecahan masalah matematika.
Kompetensi keterampilan berfikir juga diasah untuk dapat memecahkan masalah yang
membutuhkan pemikiran order tinggi seperti menalar pemecahan masalah melalui
permodelan, pembuktian dan perkiraan/pendekatan.
Walaupun demikian, pembahasan materi selalu didahului dengan pengetahuan
konkret yang dijumpai siswa dalam kehidupan sehari-hari. Permasalahan konkret tersebut
dipergunakan sebagai jembatan untuk menuju ke dunia matematika abstrak melalui
pemanfaatan simbol-simbol matekatika yang sesuai melalui permodelan. Sesampainya
pada ranah abstrak, metode-metode matematika diperkenalkan untuk menyelesaikan model
permasalahan yang diperoleh dan mengembalikan hasilnya pada ranah konkret.
Buku ini menjabarkan usaha minimal yang harus dilakukan siswa untuk mencapai
kompetensi yang diharapkan. Sesuai dengan pendekatan yang dipergunakan dalam Kurikulum
2013, siswa diberanikan untuk mencari dari sumber belajar lain yang tersedia dan terbentang
luas di sekitarnya. Peran guru sangat penting untuk meningkatkan dan menyesuaikan daya
serap siswa dengan ketersedian kegiatan pada buku ini. Guru dapat memperkayanya dengan
kreasi dalam bentuk kegiatan-kegiatan lain yang sesuai dan relevan yang bersumber dari
lingkungan sosial dan alam.
Implementasi terbatas pada tahun ajaran 2013/2014 telah mendapat tanggapan yang
sangat positif dan masukan yang sangat berharga. Pengalaman tersebut dipergunakan
semaksimal mungkin dalam menyiapkan buku untuk implementasi menyeluruh pada tahun
ajaran 2014/2015 dan seterusnya. Walaupun demikian, sebagai edisi pertama, buku ini
sangat terbuka dan terus dilakukan perbaikan untuk penyempurnaan. Oleh karena itu, kami
mengundang para pembaca memberikan kritik, saran dan masukan untuk perbaikan dan
penyempurnaan pada edisi berikutnya. Atas kontribusi tersebut, kami mengucapkan terima
kasih. Mudah-mudahan kita dapat memberikan yang terbaik bagi kemajuan dunia pendidikan
dalam rangka mempersiapkan generasi seratus tahun Indonesia Merdeka (2045).
Januari 2014
Jakarta,
Menteri Pendidikan dan Kebudayaan
Mohammad Nuh
iii

1...
2...
3...

DAFTAR ISI

Kata Pengantar..................................................................................................................... iii


Daftar Isi.............................................................................................................................. iv
Petunjuk Pengunaan buku....................................................................................................vii

ht

tp

://

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Semester 1
Bab 1 Sistem Koordinat......................................................................................................1

Narasi Tokoh Matematika Sistem Koordinat ......................................................... 3

Membelajarkan 1.1 Memahami Posisi Titik terhadap Sumbu x

dan Sumbu y ........................................................................ 5

Membelajarkan 1.2 Memahami Posisi Titik terhadap Titik Asal (0, 0)

dan Titik Tertentu (a, b) ..................................................... 12

Membelajarkan 1.3 Memahami Posisi Garis terhadap Sumbu x

dan Sumbu y ...................................................................... 23

Soal Pengayaan...................................................................................................... 35
Bab 2 Operasi Aljabar ..................................................................................................... 39

Narasi Tokoh Aljabar ............................................................................................ 41

Membelajarkan 2.1 Mengenal Bentuk Aljabar .................................................. 42

Membelajarkan 2.2 Memahami Penjumlahan dan Pengurangan Bentuk

Aljabar ............................................................................... 50

Membelajarkan 2.3 Memahami Perkalian Bentuk Aljabar ............................... 54

Membelajarkan 2.4 Memahami Pembagian Bentuk Aljabar ............................. 61

Membelajarkan 2.5 Memahami Cara Menyederhanakan Bentuk Aljabar ........ 67

Soal Pengayaan...................................................................................................... 79
Bab 3 Fungsi .................................................................................................................... 81

Narasi Tokoh Fungsi ........................................................................................... 83

Membelajarkan 3.1 Memahami Ciri-ciri Fungsi ................................................. 84

Membelajarkan 3.2 Memahami Bentuk Penyajian Fungsi .................................. 99

Soal Pengayaan.................................................................................................... 110
Bab 4 Persamaan Garis Lurus ....................................................................................... 113

Narasi Tokoh Persamaan Garis Lurus ................................................................ 115

Membelajarkan 4.1 Memahami Grafik Persamaan Garis lurus ......................... 116

Membelajarkan 4.2 Menentukan Kemiringan Persamaan Garis Lurus ............. 128

Membelajarkan 4.3 Menentukan Persamaan Garis Lurus ................................. 138

Soal Pengayaan.................................................................................................... 153
iv

Buku Guru Kelas VIII SMP/MTs

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Bab 5 Teorema Pythagoras ..........................................................................................



Narasi Tokoh Pythagoras ....................................................................................

Membelajarkan 5.1 Memahami Teorema Pythagoras .....................................

Membelajarkan 5.2 Menemukan Hubungan antar Panjang Sisi pada

Segitiga Khusus ...............................................................

Membelajarkan 5.3 Menyelesaikan Permasalahan Nyata dengan

Pythagoras .......................................................................

Soal Pengayaan....................................................................................................
Bab 6 Statistika .............................................................................................................

Narasi Tokoh Persamaan Statistika ....................................................................

Membelajarkan 6.1 Menyajikan Data dalam Bentuk Diagram Batang ...........

Membelajarkan 6.2 Menyajikan Data dalam Bentuk Diagram Garis .............

Membelajarkan 6.3 Menyajikan Data dalam Bentuk Diagram Lingkaran ......

Soal Pengayaan....................................................................................................

157
159
160
170
175
182
187
189
190
198
201
209

ht

tp

://

Semester 2
Bab 1 Persamaan Linear Dua Variabel ......................................................................... 211

Narasi Tokoh Matematika Persamaan Linear Dua Variabel............................... 213

Membelajarkan 1.1 Membuat Persamaan Linear Dua Variabel ...................... 214

Membelajarkan 1.2 Menentukan Selesaian Persamaan Linear

Dua Variabel .................................................................... 221

Membelajarkan 1.3 Membuat Model dari Sistem Persamaan Linear

Dua Variabel .................................................................... 226

Membelajarkan 1.4 Menyelesaikan Masalah yang berkaitan dengan

Sistem Persamaan Linear Dua Variabel ........................... 232

Soal Pengayaan.................................................................................................... 248
Bab 2 Persamaan Kuadrat...............................................................................................251

Narasi Tokoh Persamaan Kuadrat ...................................................................... 253

Membelajarkan 2.1 Menentukan Akar Persamaan Kuadrat dengan

Memfaktorkan ................................................................. 254

Membelajarkan 2.2 Menentukan Akar Persamaan Kuadrat dengan

Melengkapkan Kuadrat Sempurna .................................. 264

Membelajarkan 2.3 Menerapkan Persamaan Kuadrat dalam Masalah Nyata.....271

Soal Pengayaan.................................................................................................... 275
Bab 3 Lingkaran............................................................................................................. 279

Narasi Tokoh Lingkaran ..................................................................................... 281

Membelajarkan 3.1 Mengidentifikasi Unsur-unsur Lingkaran ........................ 282

Membelajarkan 3.2 Memahami Hubungan antara Sudut Pusat dengan
MATEMATIKA

://

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id


Sudut Keliling yang Menghadap Busur Sama ................. 291

Membelajarkan 3.3 Memahami Hubungan antara Sudut Pusat dengan

Panjang Busur dan Luas Juring ....................................... 297

Soal Pengayaan.................................................................................................... 312
Bab 4 Bangun Ruang Sisi Datar ................................................................................... 319

Narasi Tokoh Bangun Ruang .............................................................................. 321

Membelajarkan 4.1 Menentukan Luas Permukaan Kubus dan Balok ............. 323

Membelajarkan 4.2 Menentukan Luas Permukaan Prisma ............................. 328

Membelajarkan 4.3 Menentukan Luas Permukaan Limas................................334

Membelajarkan 4.4 Menentukan Volume Kubus dan Balok ........................... 338

Membelajarkan 4.5 Menentukan Volume Prisma..............................................344

Membelajarkan 4.6 Menentukan Volume Limas ............................................. 349

Membelajarkan 4.7 Menaksir Luas Permukaan dan Volume Bangun

Ruang Sisi Datar tidak Beraturan .................................... 355

Soal Pengayaan.................................................................................................... 361
Bab 5 Perbandigan..........................................................................................................365

Narasi Tokoh Perbandingan dalam Hukum Ohm ............................................... 367

Membelajarkan 5.1 Menerapkan Perbandingan Senilai .................................. 368

Membelajarkan 5.2 Menerapkan Perbandingan Berbalik Nilai ...................... 374

Soal Pengayaan.................................................................................................... 386
Bab 6 Peluang.................................................................................................................389

Narasi Tokoh Peluang ......................................................................................... 391

Membelajarkan 6.1 Memahami Peluang Teoretik ........................................... 392

Membelajarkan 6.2 Membandingkan Peluang Empirik dengan

Peluang Teoretik .............................................................. 398

Soal Pengayaan.................................................................................................... 409

ht

tp

Daftar Pustaka .................................................................................................................. 413


Glosarium ......................................................................................................................... 415

vi

Buku Guru Kelas VIII SMP/MTs

Petunjuk
Penggunaan Buku

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Untuk menyiapkan sebuah buku yang digunakan dalam proses pembelajaran, maka
buah pikiran pengarang harus diturunkan dari Kompetensi Dasar yang tertuang dalam
kurikulum sehingga buku akan memberi makna kepada siswa yang mempelajarinya.
Buku Siswa Matematika kelas VIII kurikulum 2013 terdiri tidak hanya memuat definisi ,
rumus, atau soal saja, tetapi juga berisi aktifitas yang memandu siswa untuk membangun
pengetahuannya. Pada buku ini disajikan masalah-masalah yang membutuhkan
pemikiran tingkat tingghi (high order thinking). Beberapa dari masalah tersebut
sudah diberikan beserta prosedur penyelesaiannya, beberapa disajikan petunjuk untuk
memcahkannya saja yang diharapkan akan dipecahkan oleh siswa. Pada setiap Bab
disajikan minimal satu tugas projekyang menuntut siswa bekerja dalam kelompok dalam
waktu yang relatif tidak sebentar untuk menyelesaikannya.
Konsep umum pada setiap bab terdiri dari (1) Pengantar Bab, (2) Peta Konsep, (3) Tokoh
matematika, (4) Isi materi, dan (5) Merangkum.
Segi Empat
Bab 1kunci, Kompetensi
Dasar, deskripsi materi, dan
1. Pengantar Bab terdiri dari kata
dan Segitiga
Segi
Empat
pengalaman belajar yang diharapkan
akan didapatkan
siswa setelah pembelajaran
Bab 11
Segi Empat
Bab
Bab 11
Kata Bab
Kunci

Keliling
Luas
Segitiga
ata Kunci
ata Kunci
Persegipanjang
ata Kunci
ata Kunci
Keliling
Persegi
Keliling
Luas
Jajargenjang
Keliling
Luas
Segitiga
Belah
Ketupat
Keliling
Segitiga
Luas
Persegipanjang
Segitiga
Persegipanjang
Luas
Layang-Layang
Persegi
Persegipanjang
Persegi
Trapesium.

Segi
SegiEmpat
Empat
dan
Segitiga
dan
Segitiga
dan
danSegitiga
Segitiga

K KK

Segitiga
Jajargenjang
Persegi
Jajargenjang
Persegipanjang
Belah Ketupat
Jajargenjang
Belah
Ketupat
Layang-Layang
Persegi
Belah
Ketupat
ompetensi
Layang-Layang
Trapesium.
Jajargenjang
Layang-Layang
asar
Trapesium.
Ketupat
Trapesium.
Belah
Layang-Layang
1. Memahamiompetensi
sifat-sifat
bangun datar
dan
asar
Trapesium.
ompetensi
ompetensi
menggunakannya
untuk
asarasar
menentukan
keliling dan

K
D

K KD
DD
1.

Memahami sifat-sifat

luas.bangun datar dan


2. 1.Menaksir
dan menghitung
menggunakannya
untuk
Memahami
sifat-sifat
1. Memahami
sifat-sifat
luasbangun
permukaan
menentukan
keliling dan
bangun
datar datar
dan dan
luas.datar yang untuk
bangun
menggunakannya
menggunakannya
untuk
2. menentukan
Menaksir
dan
menghitung
tidak
beraturan
dengan
keliling
dan
menentukan
keliling
dan
luas permukaan
menerapkan
prinsipluas.
bangun
datar yang
luas.
1. Memahami
sifat-sifat
geometri.
2.prinsip
Menaksir
dan menghitung
tidak
beraturan
dengan
2. bangun
dan
menghitung
3.Menaksir
Menyelesaikan
datar
dan
luas
permukaan
menerapkan prinsipluaspermasalahan
permukaan
nyata
bangun
yangyang
menggunakannya
untuk
prinsipdatar
geometri.
bangun
datar
yang sifatterkait
penerapan
beraturan
dengan
3. tidak
Menyelesaikan
menentukan
keliling
dan
tidak
beraturan
dengan
menerapkan
prinsipsifat
persegipanjang,
permasalahan
nyata yang
luas.
prinsip
geometri.
persegi,
trapesium,
terkait
penerapanjajar
sifatmenerapkan
prinsip2. Menaksir
danpersegipanjang,
menghitung
3.genjang,
Menyelesaikan
sifat
belah
ketupat,
prinsip
geometri.
persegi, trapesium,
nyatajajar
yang
permukaan
danpermasalahan
layang-layang.
3. luas
Menyelesaikan
genjang,
belah ketupat,
terkait
penerapan
sifatbangun
datar
yang
permasalahan
nyata
yang
danpersegipanjang,
layang-layang.
sifat
terkait
penerapan
sifattidak
beraturan
dengan
persegi,
trapesium,
jajar
engalaman
sifat
persegipanjang,
menerapkan
prinsipgenjang,
belah ketupat,
elajar
persegi,
trapesium,
jajar
engalaman
dan
layang-layang.
prinsip
geometri.

Perhatikan dengan teliti gambar di atas. Jika kita amati pada


gambar tersebut sebagian besar bahan dasarnya terdiri dari
bangun segi empat dan segitiga.
Perhatikan dengan teliti gambar di atas. Jika kita amati pada
Adakah
bangun lain yang bahan dasarnya berbentuk daerah
gambar tersebut sebagian besar bahan dasarnya terdiri dari
segi
empat
dan
segitiga?
Coba Amatilah lingkungan sekitarmu.
bangun
segi
empat
dan segitiga.

Perhatikan
dengan
teliti gambar
atas.
Jikabenda-benda
padadi
Bentuk
bangun
manakah
yang di
ada
pada
Perhatikan
dengan
teliti
gambar
di
atas.
Jikakita
kitaamati
amati
pada
Adakah
lain
yang
dasarnya
berbentuk
gambarbangun
tersebut
sebagian
besar
bahan
dasarnya
terdiri
dari
sekitarmu?Apakah
setiapbahan
bangun
yang
kaliandaerah
temukan
gambar
tersebut
sebagian
besar
bahan
dasarnya
terdiri
dari
segi
empat
danempat
segitiga?
Amatilah
lingkungan
bangun
segi
danCoba
segitiga.
sebagian
besar
terdiri
bangun
segitiga
dansekitarmu.
segi empat?
bangun
empat
dandari
segitiga.
Bentuksegi
bangun
manakah
yang ada pada benda-benda di
Adakah bangun lain
yangbangun
bahan dasarnya
berbentuk
daerah
sekitarmu?Apakah
setiap
yang kalian
temukan

Untuk memahami
lebih
jauhbahan
mengenai
segi empat
dan segitiga
Adakah
bangun
lain
yang
dasarnya
berbentuk
daerah
segi empat
danterdiri
segitiga?
Coba Amatilah
lingkungan
sekitarmu.
sebagian
besar
dan segi
empat?
pelajarilah
uraian
babdari
inibangun
dengansegitiga
saksama.
Perhatikan
dengan
teliti
gambar
di
atas.
Jika
kitadiamati pada
segi
empat bangun
dan
segitiga?
Coba
Amatilah
lingkungan
sekitarmu.
Bentuk
manakah
yang
ada pada
benda-benda
Untuk
memahami lebihsetiap
jauh mengenai
segiyang
empatkalian
dan segitiga
sekitarmu?Apakah
bangun
temukanterdiri
Bentuk
bangun
manakah
yang
ada
pada
di
gambar
besar
bahanbenda-benda
dasarnya
dari
pelajarilahtersebut
uraian babsebagian
ini dengan saksama.
sebagiansegi
besarempat
terdiri
dari
segi empat?
sekitarmu?Apakah
setiap
bangunsegitiga
yangdan
kalian
temukan
bangun
danbangun
segitiga.
sebagian
besar terdiri
dari
segitiga
dan dan
segisegitiga
empat?
Untuk memahami
lebih
jauhbangun
mengenai
segi empat

Adakah bangun lain yang bahan dasarnya berbentuk daerah

pelajarilah
uraian
babjauh
ini dengan
saksama.
Untuk
memahami
lebih
mengenai
segi empat dan segitiga

segi empat dan segitiga? Coba Amatilah lingkungan sekitarmu.


pelajarilah uraian bab ini dengan saksama.
P
Bentuk bangun manakah yang ada pada benda-benda di
Pelajar
sekitarmu?Apakah setiap bangun yang kalian temukan
B
genjang, belah ketupat,
sebagian besar terdiri dari bangun segitiga dan segi empat?
Menyelesaikan
B
1.danTerlatih
berpikir kritis dan berpikir kreatif.
layang-layang.
permasalahan
nyata
yang
2. Menemukan
ilmu pengetahuan
dari
pemecahan
masalah nyata.
Untuk
memahami
lebih jauh mengenai segi empat dan segitiga
P
engalaman
terkait
penerapan
sifat3. Mengajakelajar
untuk melakukan penelitian
dasar dalam
membangun
konsep.
pelajarilah
uraian
bab ini
dengan saksama.
B
4. P
Dilatih
bekerjasama dalam tim untuk menemukan solusi permasalahan.
sifat
persegipanjang,
engalaman

3.

1.
2.
3.
4.

ht

tp

://

K ompetensi
D asar

Terlatih berpikir kritis dan berpikir kreatif.


Menemukan ilmu pengetahuan dari pemecahan masalah nyata.
Mengajak untuk melakukan penelitian dasar dalam membangun konsep.
Dilatih bekerjasama dalam tim untuk menemukan solusi permasalahan.

5. 1.Dilatih
mengajukan
ide-ide
secara bebas
dan terbuka.
persegi,
trapesium,
jajar
Terlatih
kritis
dan berpikir
kreatif.
5.elajar
Dilatih berpikir
mengajukan
ide-ide
secara bebas
dan terbuka.
6. 2.Merasakan
matematika dalam
kehidupanmasalah
sehari-hari.
ilmu pengetahuan
pemecahan
nyata.
genjang,
belahmanfaat
ketupat,
6. Menemukan
Merasakan
manfaat
matematikadari
dalam
kehidupan sehari-hari.
3.
Mengajak untuk melakukan penelitian dasar dalam membangun konsep.
layang-layang.
1. dan
Terlatih
berpikir kritis dan berpikir kreatif.

2.
3.
4.
5.
6.

4.

Dilatih bekerjasama dalam tim untuk menemukan solusi permasalahan.

Menemukan
pengetahuan
pemecahan
5. Dilatihilmu
mengajukan
ide-idedari
secara
bebas dan masalah
terbuka. nyata.
MATEMATIKA 1
MATEMATIKA
Mengajak
untuk melakukan
penelitian
dasar
dalam membangun
6. Merasakan
manfaat matematika
dalam
kehidupan
sehari-hari. konsep.
Dilatih
bekerjasama dalam tim untuk menemukan solusi permasalahan.
engalaman
Dilatih
mengajukan ide-ide secara bebas dan terbuka.
elajar
Merasakan manfaat matematika dalam kehidupan sehari-hari.
MATEMATIKA

P keterkaitan antar materi pada Bab.


2. Peta konsep berisi diagram
B
3. Tokoh matematika dipilih sesuai dengan materi yang akan dibahas pada Bab. Selain
menjelaskan sejarah dan keterkaitan tokoh tersebut terhadap materi yang akan
dibahas, juga membahas hikmah yang bisa dicontoh dari tokoh tersebut.
4. Isi materi berupa kegiatan-Membelajarkan yang menuntut siswa secara aktif
untuk terlibat dalam pembelajaran sehingga siswa akan mendapatkan pengalaman
yang diharapkan. Pada setiap awal Membelajarkan berisi konteks atau masalah
1.
2.
3.
4.
5.
6.

Terlatih berpikir kritis dan berpikir kreatif.


Menemukan ilmu pengetahuan dari pemecahan masalah nyata.
MATEMATIKA
Mengajak untuk melakukan penelitian dasar dalam membangun konsep.
Dilatih bekerjasama dalam tim untuk menemukan solusi permasalahan.
Dilatih mengajukan ide-ide secara bebas dan terbuka.
Merasakan manfaat matematika dalam kehidupan sehari-hari.

MATEMATIKA

vii

terkait dengan kegiatan. Masalah yang disajikan ada yang diberikan beserta
pemecahannya, ada yang dilengkapi dengan petunjuk pemecahan masalah,
dan ada yang dibiarkan berupa masalah untuk dipecahkan siswa. Pada setiap
Membelajarkan mengikuti pendekatan ilmiah, yaitu mengamati, menanya,
menggali informasi, menalar, dan mngkomunikasikan yang disajikan dengan
ikon-ikon tertentu. Berikut penjelasan dari setiap ikon tersebut.
a.

Pengalaman belajar pada Membelajarkan Ayo Kita Amati mengamati


dapat dilakukan dengan cara membaca, mendengar, menyimak, melihat
(tanpa atau dengan alat) objek-objek matematika tertentu terkait
masalah atau topik kegiatan. Hasil pengamatan dapat berupa definisi,
aksioma, postulat, teorema, sifat, grafik dan lain sebagainya. Pengalaman
belajar mengamati ini diharapkan dapat memfasilitasi siswa dalam
mengembangkan dan melatih kesungguhan, ketelitian, dan kemampuan
mencari informasi.

b.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Ayo
Kita Amati

Ayo Kita
Menanya

viii

Menggali
Informasi

ht

=+

c.

tp

://

Setelah terjadi proses mengamati, pengalaman belajar peserta


didik berikutnya yang difasilitasi guru adalah pengalaman belajar
menanya. Pengalaman belajar tersebut dimaknai sebagai menanya
dan mempertanyakan terhadap hal-hal yang diamati. Terjadinya
kegiatanmenanya oleh peserta didik dapat disebabkan oleh karena
belum dipahaminya hal-hal yang diamati, atau dapat pula karena ingin
mendapatkan informasi tambahan tentang hal-hal yang diamati. Agar
proses menanya oleh peserta didik semakin hari berjalan semakin
lancar dan berkualitas, guru dapat memfasilitasi dengan pancingan
pertanyaan-pertanyaan yang berfungsi menggiring peserta didik untuk
mempertanyakan hal-hal yang diamati.

Setelah terjadi proses menanya, pengalaman belajar siswa berikutnya


adalah menggali informasi. Pada buku siswa disajikan dua jenis informasi,
yaitu informasi langsung dan tidak langsung. Pertama, informasi
disajikan secara langsung, sehingga menuntut siswa untuk cermat dalam
memahami informasi yang disajikan. Kedua, informasi disajikan dengan
mengajak siswa melakukan suatu aktivitas yang mengarh pada informasi
yang ingin dicapai, untuk itu siswa harus aktif dalam mengikuti panduan
buku siswa dan guru. Selain informasi yang diperoleh dari buku siswa,
diharapkan siswa juga aktif membaca informasi sumber lain, mengamati

objek/kejadian/aktivitas, atau melakukan wawancara dengan nara


sumber. Dari Membelajarkan mengumpulkan informasi ini data-data
yang selanjutnya siap diolah, dihubungkan antara data yang satu dengan
yang lainnya (diasosiasikan), dianalisis, dan dinalar.
d.

Setelah mengalami proses mengamati, menanya, dan menggali informasi


maka pengalaman belajar pokok berikutnya adalah mengolah informasi
atau mengasosiasikan. Membelajarkan mengolah informasi dimaknai
sebagai mengolah informasi yang sudah dikumpulkan baik terbatas
dari hasil Membelajarkan mengumpulkan/eksperimen mau pun hasil
dari Membelajarkan mengamati dan Membelajarkan mengumpulkan
informasi. Sedangkan proses pengolahan informasi dapat terjadi dari
yang bersifat menambah keluasan dan kedalaman sampai kepada yang
bersifat mencari solusi dari berbagai sumber yang memiliki pendapat
yang berbeda atau bahkan bertentangan. Pada buku siswa Membelajarkan
menalar disajikan dalam bentuk pertanyaan-pertanyaan yang diharapkan
akan terjawab oleh siswa setelah melalu Membelajarkan mengamati
hingga menggali informasi. Hasil dari Membelajarkan menalar ini berupa
jawaban, pernyataan, atau kesimpulan.

e.

Ayo Kita
Berbagi

Setelah mengalami proses mengamati, menanya, mengumpulkan,


dan mengolah informasi maka pengalaman belajar pokok berikutnya
adalah mengkomunikasikan yang dimaknai sebagai Membelajarkan
menyampaikan hasil pengamatan, atau kesimpulan yang diperoleh
berdasarkan hasil analisis secara tertulis, lisan, ataupun dengan media.
Tujuan dari Membelajarkan berbagi adalah melatih siswa untuk berani
menyampaikan ide kepada orang lain. Dengan adanya Membelajarkan
berbagi, diharapkan akan tumbuh pada diri siswa sikap empati, saling
menghargai, dan menghormati perbedaan orang lain.

5.

ht

tp

://

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Ayo Kita
Menalar

Merangkum
Berisi pertanyaan-pertanyan yang mengarahkan siswa untuk membuat
rangkuman tentang materi yang telah dipelajari dalam satu bab.

Buku ini tentunya jauh dari kesempurnan. Oleh karena itu, penulis mengharapkan
komentar dan saran untuk perbaikan buku ini, baik dari siswa, guru maupun
maupun pihak lain terkait dalam Membelajarkan pembelajaran.
ix

Pedoman
Penilaian
No
1

Aspek Penilaian
Keterselesaian Buku
Siswa

Capaian

Portofolio:
a) Uji Kompetensi
b) Soal dari tempat
lain

Keterangan
Bila Buku Siswa terselesaikan dengan baik

< B

Bila ada bagian dari Buku Siswa yang tidak


terselesaikan

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan mampu menyelesaikannya
dengan baik

.id

Bila memilih soal dari Uji Kompetensi


dengan kategori Sangat Sulit dan mampu
menyelesaikannya dengan baik

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Bila memilih soal dari Uji Kompetensi


dengan kategori Sedang dan mampu
menyelesaikannya dengan baik

B+

Bila memilih soal dari Uji Kompetensi


dengan kategori Mudah dan mampu
menyelesaikannya dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan kurang mampu
menyelesaikannya dengan baik

B , B
B+, B,
B

Bila memilih soal dari Uji Kompetensi


A, B+ , dengan kategori Mudah dan kurang mampu
B, B menyelesaikannya dengan baik
Bila Proyek terselesaikan dan manpu
A
mempresentasikan dengan Baik
A, B+, Bila ada bagian dari Proyek yang tidak
terselesaikan atau kurang mampu
B
mempresentasikan

://

ht

tp

Tugas Projek

Bila memilih soal dari Uji Kompetensi


dengan kategori Sulit dan kurang mampu
menyelesaikannya dengan baik
Bila memilih soal dari Uji Kompetensi
dengan kategori Sedang dan kurang mampu
menyelesaikannya dengan baik

Bila Proyek tidak terselesaikan samasekali

Keterangan: - Nilai KKM = B




- Aspek penilaian Nomor 1 adalah syarat nilai yang


harus terpenuhi, sedangkan Aspek penilaian Nomor 2
adalah penambahan nilai.

Bab 1

Sistem Koordinat
Kata Kunci

.id

Titik Asal
Sumbu-x
Sumbu-y
Garis-garis sejajar
Garis-garis tegak lurus
Garis-garis berpotongan

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

K ompetensi
D asar

Menggunakan koordinat
Kartesius dalam
menjelaskan posisi relatif
benda terhadap acuan
tertentu.

Pengalaman
Belajar

Menggunakan bidang
koordinat Kartesius untuk
menentukan posisi:
a. titik terhadap sumbu-x
b. titik terhadap sumbu-y
c. titik terhadap titik asal (0 , 0)
d. titik terhadap titik tertentu (a, b)
Menggunakan koordinat Kartesius untuk menentukan posisi:
a. garis yang sejajar dengan sumbu-x
b. garis yang sejajar dengan sumbu-y
c. garis yang berpotongan dengan sumbu-x
d. garis yang berpotongan dengan sumbu-y
e. garis yang tegak lurus dengan sumbu-x
f. garis yang tegak lurus dengan sumbu-y

ht

2.

tp

://

1.

Jika kalian melihat denah peta perumahan di atas, kalian akan


melihat rumah sudah diatur sedemikian rupa sehingga tertata
rapi dan dengan jalan yang tersambung satu dengan lainnya
seperti garis vertikal dan garis horizontal. Tentu semuanya itu
mempunyai maksud dan tujuan agar lahan yang ada dapat
dimanfaatkan dengan seesien mungkin dan semua rumah
dapat memiliki akses jalan yang cukup memadai. Nah jika
kalian cermati, peta perumahan tersebut menunjukkan bahwa
setiap rumah memiliki posisi yang berbeda-beda terhadap
titik tertentu yang biasanya disebut sitem koordinat. Nah agar
kalian lebih mengerti apa sih sistem koordinat tersebut, ayo
kita pelajari sistem koordinat dengan baik

MATEMATIKA

MATEMATIKA

Peta
Konsep

.id

Sistem
Koordinat

Posisi Garis

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Posisi Titik

Garis Sejajar

Sumbu-x
-

Garis
Berpotongan

Sumbu-y
-

Garis
Tegak Lurus

ht

tp

://

Titik Asal

Kelas VIII SMP/MTs

2
Buku
Guru Kelas VIII SMP/MTs

Semester 1

Semester 1

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Descartes dikenal sebagai Renatus


Cartesius dalam literatur berbahasa
Latin, merupakan seorang lsuf dan
matematikawan
Perancis.
Beliau
mempersembahkan
sumbangan
yang
penting yaitu penemuannya
tentang geometri analitis, yang
akhirnya dkenal sebagai pencipta
Sistem koordinat Cartesius, yang
memengaruhi perkembangan kalkulus
modern dan menyediakan jalan buat
Newton menemukan Kalkulus. Beliau
memberikan kontribusi yang besar
dalam kemajuan di bidang matematika,
sehingga dipanggil sebagai "Bapak
Matematika Modern".

Descartes, adalah salah satu pemikir


paling penting dan berpengaruh dalam
Rene Descartes
sejarah barat modern. Metodenya
1956 - 1650
ialah dengan meragukan semua
pengetahuan yang ada, yang kemudian
mengantarkannya pada kesimpulan
bahwa pengetahuan yang ia kategorikan ke dalam tiga bagian dapat diragukan, yaitu
pengetahuan yang berasal dari pengalaman inderawi dapat diragukan, fakta umum
tentang dunia semisal api itu panas dan benda yang berat akan jatuh juga dapat
diragukan, dan prinsip-prinsip logika dan matematika juga ia ragukan. Dari keraguan
tersebut, Descartes hendak mencari pengetahuan apa yang tidak dapat diragukan yang
akhirnya mengantarkan pada premisnya Cogito Ergo Sum yang artinya aku berpikir
maka aku ada.
Hikmah yang dapat dipetik antara lain:

ht

tp

://

1. Keyakinan yang sempurna dan mutlak terhadap keberadaan adanya Tuhan, dan
semua obyek di dunia ini adalah ciptaan Tuhan.
2. Tidak mudah puas terhadap sesuatu yang sudah didapatkan, sehingga terus berkir
melakukan inovasi untuk menemukan sesuatu yang baru.
3. Manusia diciptakan oleh Tuhan dengan bentuk yang sempurna, oleh karena itu
manusia harus menggunakan akal dan pikirannya untuk memanfaatkan lingkungan
dengan sebaik-baiknya.
4. Saling membantu dan kerja sama sesama manusia agar terjadi interaksi yang positif
dalam melakukan aktitas dan belajar.

MATEMATIKA
3

.id

1. Siapkan papan tulis bergaris dan buku berpetak.


2. Siapkan format penilaian sikap dan keterampilan.
3. Siapkan alat peraga yang dapat membantu membuat bidang koordinat (penggaris,
kertas karton berpetak) atau sediakan bidang koordinat pada kertas karton.
4. Siapkan gambar aliran sungai yang tidak beraturan pada bidang koordinat Kartesius
yang melewati beberapa titik pada kudran I, II, III, dan IV.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

6LVWHP
.RRUGLQDW

3HUKDWLNDQ*DPEDUEHULNXW

P

6HNRODK

P

P

P

P

://

1. Sebelum Kegiatan
1.1, ajak siswa untuk
melihat peta pada
Gambar 1.1 di buku
siswa. Jelaskan
manfaat belajar
bidang koordinat
dalam kehidupan
sehari-hari. Salah
satunya adalah untuk
mencari koordinat
alamat rumah seperti
di pengantar buku
siswa.
2. Beri contoh lain
permasalahan tentang
manfaat belajar
bidang koordinat.

P

P

P

-O6XGLUPDQ

Apersepsi

P

P

P

P

P

P

-O'LSRQHJRUR

ht

tp

P

*DPEDU3HWDDODPDWUXPDK%X%DGLDK

8GLQGDQ6LWLLQJLQEHUNXQMXQJNHUXPDKJXUXQ\D%X%DGLDK1DPXQPHUHNDEHOXPWDKXDODPDW
UXPDKJXUXQ\DVHFDUDSDVWL,EX%DGLDKKDQ\DPHPEHULNDQLQIRUPDVLEDKZDUXPDKQ\DEHUMDUDN
NPGDUL-DODQ'LSRQHJRURGDQEHUMDUDNNPGDUL-DODQ6XGLUPDQ8GLQGDQ6LWLEHUDQJNDWEHUVDPD
GDUL VHNRODK PHUHND PHQHPSXK MDODQ \DQJ EHUEHGD ZDUQD PHUDK DGDODK UXWH SHUMDODQDQ  \DQJ
GLODOXL 8GLQ ZDUQD ELUX DGDODK UXWH SHUMDODQDQ \DQJ GLODOXL 6LWL  VHSHUWL \DQJ GLWXQMXNNDQ GDODP
*DPEDU7HUQ\DWD8GLQEHUKDVLOPHQHPXNDQUXPDK%X%DGLDKWHUOHELKGDKXOXPHQJDSD6LWL
OHELKODPEDWPHQHPXNDQUXPDK%X%DGLDK"
8QWXN GDSDW PHQ\HOHVDLNDQ SHUPDVDODKDQ WHUVHEXW VHEDLNQ\D NDOLDQ EHODMDU NHJLDWDQNHJLDWDQ
EHULNXWLQL

.HODV9,,,60307V

Buku Guru Kelas VIII SMP/MTs

6HPHVWHU

Semester 1

Membelajarkan 1.1
Memahami Posisi Titik Terhadap Sumbu-x dan Sumbu-y

0DVDODK 

7LWLWLWLN SDGD ELGDQJ NRRUGLQDW &DUWHVLXV XQWXN VHODQMXWQ\D GLVHEXW ELGDQJ NRRUGLQDW  PHPLOLNL
MDUDNWHUKDGDSVXPEX[GDQVXPEX\&REDVHNDUDQJDPDWLSRVLVLWLWLN$%&'()*GDQ+
WHUKDGDSVXPEX[GDQVXPEX\SDGD*DPEDU6HWHODKLWXWHQWXNDQNRRUGLQDWWLWLNWLWLNWHUVHEXW

\

'

.id

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

0HPDKDPL3RVLVL7LWLNWHUKDGDS
6XPEX[GDQ6XPEX\

.HJLDWDQ 

Masalah 1.1
1. Minta siswa untuk
mencermati bidang
koordinat, tunjukkan
beberapa titik yang
memiliki jarak sama
dan jarak yang
berbeda terhadap
sumbu-x dan
sumbu-y.
2. Minta siswa
mencermati titiktitik yang memiliki
jarak yang sama dan
jarak yang berbeda
terhadap sumbu-x
dan sumbu-y pada
kuadran yang
berbeda.

&












         

tp

://

         


(



)






*DPEDU.RUGLQDWWLWLNWLWLNSDGDELGDQJNRUGLQDWNDUWHVLXV

ht

'DUL*DPEDUGDSDWGLWXOLVSRVLVLWLWLNWLWLN\DLWX
 7LWLN$EHUMDUDNVDWXDQWHUKDGDSVXPEX[GDQEHUMDUDNVDWXDQWHUKDGDSVXPEX\
 7LWLN%EHUMDUDNVDWXDQWHUKDGDSVXPEX[GDQEHUMDUDNVDWXDQWHUKDGDSVXPEX\
 7LWLN&EHUMDUDNVDWXDQWHUKDGDSVXPEX[GDQEHUMDUDNVDWXDQWHUKDGDSVXPEX\
 7LWLN'EHUMDUDNVDWXDQWHUKDGDSVXPEX[GDQEHUMDUDNVDWXDQWHUKDGDSVXPEX\
 7LWLN(EHUMDUDNVDWXDQWHUKDGDSVXPEX[GDQEHUMDUDNVDWXDQWHUKDGDSVXPEX\
 7LWLN)EHUMDUDNVDWXDQWHUKDGDSVXPEX[GDQEHUMDUDNVDWXDQWHUKDGDSVXPEX\
 7LWLN*EHUMDUDNVDWXDQWHUKDGDSVXPEX[GDQEHUMDUDNVDWXDQWHUKDGDSVXPEX\
 7LWLN+EHUMDUDNVDWXDQWHUKDGDSVXPEX[GDQEHUMDUDNVDWXDQWHUKDGDSVXPEX\
6HNDUDQJNDOLDQVXGDKPHQJHWDKXLMDUDNWLWLNWLWLNWHUKDGDSVXPEX[GDQVXPEX\$GDWLWLN\DQJ
PHPLOLNLMDUDN\DQJVDPDGDQDGDSXOD\DQJPHPLOLNLMDUDNEHUEHGDWHUKDGDSVXPEX[GDQVXPEX\
6HNDUDQJWXOLVODKNRRUGLQDWWLWLNWLWLN$%&'()*GDQ+WHUVHEXW

0$7(0$7,.$

MATEMATIKA

$OWHUQDWLI3HPHFDKDQ0DVDODK
$\R
.LWD$PDWL
8QWXNPHQXOLVNDQNRRUGLQDWWLWLNWLWLNWHUVHEXWFREDDPDWLNHPEDOLMDUDNWLWLNWLWLN$%&'(
)*GDQ+WHUKDGDSVXPEX[GDQVXPEX\SDGD*DPEDU%HUGDVDUNDQMDUDNWLWLNWLWLNWHUKDGDS
VXPEX[GDQVXPEX\NRRUGLQDWWLWLNWLWLNWHUVHEXWDGDODKVHEDJDLEHULNXW
7DEHO.RRUGLQDWWLWLN$%&'()*GDQ+
-DUDNWHUKDGDSVXPEX[

-DUDNWHUKDGDSVXPEX\

.RRUGLQDWWLWLN

$
%
&
'
(
)
*
+

VDWXDQ
VDWXDQ
VDWXDQ
VDWXDQ
VDWXDQ
VDWXDQ
VDWXDQ
VDWXDQ

VDWXDQ
VDWXDQ
VDWXDQ
VDWXDQ
VDWXDQ
VDWXDQ
VDWXDQ
VDWXDQ

$ 
% 
& 
' 
( 
) 
* 
+ 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

7LWLN

Dengan demikian kalian dapat menuliskan koordinat titik " #  $ % & ' (, dan )pada bidang
koordinat sebagai berikut.
\

Ayo
Kita Amati

         

(  




) 





$ 

% 

         

* 

+ 

*DPEDU.RRUGLQDWWLWLNWLWLNSDGDELGDQJNRRUGLQDW

.HODV9,,,60307V

6HPHVWHU

ht

tp

://

1. Amati kembali titiktitik pada bidang


koordinat.
2. Minta siswa untuk
mengamati jarak
titik-titik A, B, C,
D, E, F, G, dan H
terhadap sumbu-x
dan sumbu-y dan
hubungannya dengan
koordinat titik-titik
tersebut.
3. Minta siswa untuk
men
cermati titik-titik
yang memiliki
jarak yang sama
terhadap sumbu-x
atau sumbu-y tetapi
memiliki koordinat
yang berbeda, karena
titik-titik tersebut
berada pada kuadran
yang berbeda.





'  



&  



Buku Guru Kelas VIII SMP/MTs

Semester 1

"

$\R.LWD
0HQDQ\D

1. Minta siswa untuk


menuliskan pertanyaan
yang terkait dengan jarak
titik-titik dari sumbu-x
dan sumbu-y.
2. Munculnya pertanyaan
karena siswa belum
mengerti atau memahami
pada saat kegiatan
mengamati.
3. Sebagai pertanyaan
pancingan, dapat
menggunakan kata-kata
yang ada di buku siswa.

%HUGDVDUNDQKDVLOSHQJDPDWDQFREDEXDWODKSHUWDQ\DDQ\DQJPHPXDWNDWDNDWDEHULNXW
 7LWLNWLWLN$%&'()*+GDQMDUDNVDPDWHUKDGDSVXPEX[
 7LWLNWLWLN$%&'()*+GDQMDUDNVDPDWHUKDGDSVXPEX\
7XOLVODKSHUWDQ\DDQNDOLDQGLEXNXWXOLV
6HGLNLW
,QIRUPDVL

.XDGUDQ,

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

6XPEX[GDQVXPEX\PHPEDJLELGDQJNRRUGLQDWPHQMDGLNXDGUDQ\DLWX
 .XDGUDQ,NRRUGLQDW[SRVLWLIGDQNRRUGLQDW\SRVLWLI
 .XDGUDQ,,NRRUGLQDW[QHJDWLIGDQNRRUGLQDW\SRVLWLI
 .XDGUDQ,,,NRRUGLQDW[QHJDWLIGDQNRRUGLQDW\QHJDWLI
 .XDGUDQ,9NRRUGLQDW[SRVLWLIGDQNRRUGLQDW\QHJDWLI

.XDGUDQ,,

Ayo Kita
Menanya

NRRUGLQDW[

4 

NRRUGLQDW\

3 











Sedikit
Informasi




.XDGUDQ,,,




.XDGUDQ,9

*DPEDU(PSDWNXDGUDQELGDQJNRRUGLQDW

tp

://

'DODPELGDQJNRRUGLQDWGLDWDV
7LWLN3PHPLOLNLNRRUGLQDW  NRRUGLQDW[NRRUGLQDW\
7LWLN4PHPLOLNLNRRUGLQDW  NRRUGLQDW[NRRUGLQDW\

ht



0$7(0$7,.$

1. Mintalah siswa untuk


mencermati sedikit informasi yang berkaitan
dengan koordinat titik
pada bidang koordinat
Cartesius yang berada
pada empat kuadran.
2. Berilah penjelasan
secukupnya perbedaan
koordinat titik yang
berada di masing-masing kuadran.
3. Penjelasan sedikit informasi dapat dilakukan oleh siswa yang
sudah memahami
koordinat Kartesius.

MATEMATIKA

&REDSHUKDWLNDQNHPEDOLSRVLVLWLWLNWLWLNSDGDELGDQJNRRUGLQDW.DUWHVLXVSDGD*DPEDU'DUL
*DPEDUWHUVHEXWDGDWLWLNWLWLN\DQJPHPLOLNLMDUDN\DQJVDPDGDQDGDWLWLNWLWLN\DQJPHPLOLNL
MDUDN\DQJEHUEHGDWHUKDGDSVXPEX[GDQVXPEX\6HNDUDQJFREDDPDWLWLWLNWLWLN\DQJPHPLOLNL
MDUDN\DQJVDPDGDQEHUEHGDWHUKDGDSVXPEX[GDQVXPEX\VHUWDWHQWXNDQNRRUGLQDWWLWLNWLWLN\DQJ
PHPLOLNLMDUDNVDPDGDQEHUEHGDWHUKDGDSVXPEX[GDQVXPEX\SDGD7DEHOEHULNXW
7DEHO-DUDNWLWLNWLWLNWHUKDGDSVXPEX[GDQVXPEX\
1R

-DUDNWLWLNWLWLNWHUKDGDSVXPEX[GDQVXPEX\

7LWLNWLWLN

7LWLNWLWLNEHUMDUDNVDPDWHUKDGDSVXPEX[NDUHQDWLWLN
WLWLNWHUVHEXWEHUMDUDNVDWXDQNHVXPEX[

$'GDQ





$%&GDQ*
GDQ

7LWLNWLWLNEHUMDUDNWLGDNVDPDWHUKDGDSVXPEX\NDUHQD
WLWLNWLWLNWHUVHEXWPHPSXQ\DLMDUDN\DQJEHUEHGDEDLN
NHVXPEX[PDXSXQNHVXPEX\

7LWLNWLWLNEHUMDUDNVDPDWHUKDGDSVXPEX[

7LWLNWLWLNEHUMDUDNWLGDNVDPDWHUKDGDSVXPEX[

7LWLNWLWLNEHUMDUDNVDPDWHUKDGDSVXPEX\

7LWLNWLWLNEHUMDUDNWLGDNVDPDWHUKDGDSVXPEX\

$%&GDQ(
     GDQ 
   GDQ 
     GDQ 
   GDQ 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

1. Minta siswa untuk


mencermati apa
perbedaan koordinat
titik-titik yang berada
di sebelah kanan dan
sebelah kiri sumbu
y dan mencermati
pula apa perbedaan
titik-titik yang berada
di sebelah atas dan
bawah sumbu-x.
2. Minta siswa untuk
mencermati koordi
nat titik-titik yang
memiliki jarak yang
sama dan tidak sama
dengan sumbu-x dan
sumbu-y.

7LWLNWLWLNEHUMDUDNWLGDNVDPDWHUKDGDSVXPEX[NDUHQD
WLWLNWLWLNWHUVHEXWPHPSXQ\DLMDUDN\DQJEHUEHGDEDLN
NHVXPEX[PDXSXQNHVXPEX\
7LWLNWLWLN  EHUMDUDN VDPD WHUKDGDS VXPEX\ NDUHQD
WLWLNWLWLNWHUVHEXWEHUMDUDNVDWXDQNHVXPEX[

.id

Ayo Kita
Menalar

&REDSHUKDWLNDQNHPEDOLELGDQJNRRUGLQDWEHULNXW
\




&  




( 

       


) 







$ 

' 

% 

       

* 

+ 

*DPEDU7LWLNWLWLNSDGDELGDQJNRRUGLQDW

://

- Titik F berjarak
5 satuan dari
sumbu-y dan
berada di sebelah
kiri sumbu-y dan
berjarak 3 satuan
dari sumbu-x dan
berada di bawah
sumbu-x.

$\R.LWD
0HQDODU

.HODV9,,,60307V

6HPHVWHU

ht

tp

- Titik G berjarak
5 satuan dari
sumbu-y dan
berada di sebelah
kanan sumbu-y dan
berjarak 4 satuan
dari sumbu-xdan
berada di awah
sumbu-x.
8

Buku Guru Kelas VIII SMP/MTs

Semester 1

.RRUGLQDWWLWLN
$ 

& 

) 
* 

.HWHUDQJDQ
7LWLN $ EHUMDUDN  VDWXDQ GDUL VXPEX\ GDQ EHUDGD GL VHEHODK
NDQDQVXPEX\
7LWLN$EHUMDUDNVDWXDQGDULVXPEX[GDQEHUDGDGLDWDVVXPEX[
7LWLN&EHUMDUDNVDWXDQGDULVXPEX\GDQEHUDGDGLVHEHODK
NLULVXPEX\
7LWLN & EHUMDUDN  VDWXDQ GDUL VXPEX[  GDQ EHUDGD GL DWDV
VXPEX[
7LWLN)
7LWLN)
7LWLN*
7LWLN*

%HUGDVDUNDQ7DEHOMDZDEODKSHUWDQ\DDQEHULNXW
D   %DJDLPDQDFDUDPHQHQWXNDQDSDNDKVXDWXWLWLNEHUDGDGLVHEHODKNDQDQDWDXGLVHEHODK
NLULVXPEX\"
E   %DJDLPDQDFDUDPHQHQWXNDQVXDWXWLWLNEHUDGDGLDWDVDWDXGLEDZDKVXPEX["
F   $SD\DQJNDOLDQNHWDKXLWHQWDQJWLWLN%  WLWLN'  WLWLN(  GDQWLWLN+  "
G   $SDFLULWLWLNWLWLN\DQJEHUDGDSDGDVXPEX["
H   $SDFLULWLWLNWLWLN\DQJEHUDGDSDGDVXPEX\"
 *DPEDUODK WLWLNWLWLN          GDQ    SDGD ELGDQJ NRRUGLQDW  %DQJXQ
DSDNDK\DQJWHUEHQWXNDSDELODWLWLNWLWLNWHUVHEXWGLKXEXQJNDQ"

$\R.LWD
%HUEDJL

Mintalah siswa
untuk menukar kan
jawabannya dengan
temannya dan berilah
sedikit penguatan dan
bimbingan jika terjadi
perbedaan jawaban
siswa.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 *DPEDUODKWLWLNWLWLN      GDQ  SDGDELGDQJNRRUGLQDW%DQJXQ


DSDNDK\DQJWHUEHQWXNDSDELODWLWLNWLWLNWHUVHEXWGLKXEXQJNDQ"

Ayo Kita
Berbagi

.id

7DEHO .RRUGLQDWWLWLNWLWLNSDGDELGDQJNRRUGLQDWGDQMDUDNWHUKDGDSVXPEX[GDQVXPEX\

 -LNDNDOLDQVXGDKPHQMDZDEEHEHUDSDSHUWDQ\DDQGLDWDVFREDVHNDUDQJWXNDUNDQMDZDEDQPX
GDQGLVNXVLNDQGHQJDQWHPDQPXVHEDQJNX
 6HWHODK NDOLDQ EHUGLVNXVL GHQJDQ WHPDQPX VHEDQJNX WXOLVODK KDO SHQWLQJ GDUL KDVLO GLVNXVL
WHUVHEXW
 3UHVHQWDVLNDQKDVLOGLVNXVLWHUVHEXWNHSDGDWHPDQPX\DQJODLQGLGHSDQNHODV
&RQWRK 

-LND NRRUGLQDW WLWLN $    %    &    GDQ '   7HQWXNDQ MDUDN WLWLNWLWLN WHUVHEXW
WHUKDGDSVXPEX[GDQWHUKDGDSVXPEX\"

0$7(0$7,.$

ht

tp

://

1. Berdasarkan Tabel 1.3, berikut alternatif jawaban.


a. Titik-titik yang memiliki jarak yang sama dengan sumbu-y jika titik tersebut
koordinat x-nya sama dan tidak memperdulikan positif dan negatif
b. Titik-titik yang memiliki jarak yang sama dengan sumbu- x jika titik tersebut
koordinat y-nya sama,dan tidak memperdulikan positif dan negatif
c. Titik-titik yang berada di sebelah kanan sumbu-y jika koordinat x-nya bernilai
positif, dan berada di sebelah kiri sumbu-y, jika koordinat x-nya bernilai negatif.
Titik-titik yang berada di sebelah atas sumbu- x, jika koordinat y -nya bernilai
positif, dan berada di bawah sumbu- x, jika koordinat y -nya bernilai negatif.
Titik B(3,0) artinya titik tersebut memiliki jarak 3 satuan dari sumbu-y, berada
di sebelah kanan sumbu-y dan memiliki jarak 0 satuan dari sumbu-x serta berada
pada sumbu-x.
Titik D(0,4) artinya titik tersebut memiliki jarak 0 satuan dari sumbu-y, berada
pada sumbu-y (dan memiliki jarak 4 satuan dari sumbu-x berada di atas sumbu-x.
Titik E(-5,0) artinya titik tersebut memiliki jarak 5 satuan dari sumbu-y, berada di
sebelah kiri sumbu-y dan memiliki jarak 0 satuan dari sumbu-x serta berada pada
sumbu-x.
Titik H(0,-5) artinya titik tersebut memiliki jarak 0 satuan dari sumbu-y, berada
pada sumbu-y dan memiliki jarak 5 satuan dari sumbu-x berada di bawah sumbu-x.
d. Titik-titik yang berada pada sumbu-x jika koordinat-x nya 0.
e. Titik-titik yang berada pada sumbu-y jika koordinat-y nya 0.
2. Jika 4 titik tersebut dihubungkan akan membentuk bangun datar persegi
3. Jika 4 titik tersebut dihubungkan akan membentuk bangun datar persegi panjang
MATEMATIKA

$OWHUQDWLI
3HQ\HOHVDLDQ





.RRUGLQDWWLWLN$  DUWLQ\DWLWLN$PHPLOLNLMDUDNVDWXDQWHUKDGDSVXPEX\GDQPHPLOLNL


MDUDNVDWXDQWHUKDGDSVXPEX[
.RRUGLQDWWLWLN%  DUWLQ\DWLWLN$PHPLOLNLMDUDNVDWXDQWHUKDGDSVXPEX\GDQPHPLOLNL
MDUDNVDWXDQWHUKDGDSVXPEX[
.RRUGLQDWWLWLN&  DUWLQ\DWLWLN$PHPLOLNLMDUDNVDWXDQWHUKDGDSVXPEX\GDQPHPLOLNL
MDUDNVDWXDQWHUKDGDSVXPEX[
.RRUGLQDWWLWLN'  DUWLQ\DWLWLN$PHPLOLNLMDUDNVDWXDQWHUKDGDSVXPEX\GDQPHPLOLNL
MDUDNVDWXDQWHUKDGDSVXPEX[
&RQWRK 

.id

*DPEDUODK WLWLNWLWLN SDGD ELGDQJ NRRUGLQDW \DQJ PHPLOLNL MDUDN  VDWXDQ WHUKDGDS VXPEX[ GDQ
PHPLOLNLMDUDNVDWXDQWHUKDGDSVXPEX\

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

$OWHUQDWLI
3HQ\HOHVDLDQ

8QWXNPHQJJDPEDUWLWLN\DQJPHPLOLNLMDUDNVDWXDQWHUKDGDSVXPEX[GDQPHPLOLNLMDUDNVDWXDQ
WHUKDGDSVXPEX\SDGDELGDQJNRRUGLQDWNDOLDQODNXNDQSURVHGXUVHEDJDLEHULNXW
/DQJNDK

0HQHQWXNDQVDWXNRRUGLQDWWLWLNSDGDNXDGUDQVDWX\DQJPHPLOLNLMDUDNVDWXDQWHUKDGDSVXPEX[
GDQPHPLOLNLMDUDNVDWXDQWHUKDGDSVXPEX\
.RRUGLQDWWLWLN\DQJPHPLOLNLMDUDNVDWXDQWHUKDGDSVXPEX[GDQPHPLOLNLMDUDNVDWXDQWHUKDGDS
VXPEX\DGDODKWLWLN$  
/DQJNDK

0HQHQWXNDQNRRUGLQDWWLWLNODLQSDGDNXDGUDQ,,,,,GDQ,9\DQJPHPLOLNLMDUDNVDWXDQWHUKDGDS
VXPEX[GDQPHPLOLNLMDUDNVDWXDQWHUKDGDSVXPEX\\DLWX
\

 3DGD NXDGUDQ ,, DGDODK WLWLN

% 
$ 
% 

 3DGD NXDGUDQ ,,, DGDODK WLWLN

% 

 3DGD NXDGUDQ ,9 DGDODK WLWLN

[
% 
/DQJNDK

ht

tp

://

0HQJJDPEDUHPSDWWLWLN\DLWXWLWLN
$  %  &  GDQ
'  SDGDELGDQJNRRUGLQDW
VHEDJDLEHULNXW



.HODV9,,,60307V

       



& 




       

' 

6HPHVWHU

Ajak siswa untuk mengamati


dan memahami Contoh 1.2 dalam
menentukan kooordinat titik
terhadap sumbu-x dan sumbu y
10

Buku Guru Kelas VIII SMP/MTs

Semester 1

"

/DWLKDQ 

3HUKDWLNDQELGDQJNRRUGLQDWEHULNXW

% 

$ 
) 
( 
          [

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

         



& 


+  





.id

* 












* 

, 

*DPEDU7LWLNWLWNSDGDELGDQJNRRUGLQDW

 6HEXWNDQWLWLNWLWLN\DQJPHPSXQ\DLMDUDN\DQJVDPDGHQJDQVXPEX[
 6HEXWNDQWLWLNWLWLN\DQJPHPSXQ\DLMDUDN\DQJVDPDGHQJDQVXPEX\

 6HEXWNDQWLWLNWLWLN\DQJEHUDGDGLVHEHODKNDQDQGDQVHEHODKNLULVXPEX\
 6HEXWNDQWLWLNWLWLN\DQJEHUDGDGLEDZDKGDQGLDWDVVXPEX[

 %HUDSDMDUDNWLWLN(WHUKDGDSVXPEX[GDQVXPEX\GDQWHUOHWDNGLVHEHODKPDQDWHUKDGDS
VXPEX[GDQVXPEX\"

://

 *DPEDUNDQWLWLN\DQJMDUDNQ\DNHVXPEX[VDPDGHQJDQWLWLN*GDQMDUDNNHVXPEX\VDPD
GHQJDQWLWLN%$GDEHUDSDWLWLN\DQJNDOLDQWHPXNDQ"
 6HEXWNDQWLWLNWLWLN\DQJEHUDGDGLNXDGUDQ,GDQNXDGUDQ,,

ht

tp

 %HUDGDGLNXDGUDQPDQDNDKWLWLN(GDQ)"-HODVNDQ

0$7(0$7,.$



Intruksikan siswa
untuk mengerjakan soalsoal Latihan 1.1
MATEMATIKA

11

Membelajarkan 1.2
Memahami Posisi Titik terhadap
Titik Asal O(0, 0) dan Terhadap Titik Tertentu (a, b)

Ayo
Kita Amati

.id

1. Siapkan peta perkemahan di kertas karton agar mudah dilihat oleh seluruh siswa
atau cukup di buku siswa
2. Siapkan papan tulis berpetak atau kertas karton yang sudah diberi bidang koordinat
3. Bentuklah kelompok sebelum pembelajaran dimulai

0HPDKDPL3RVLVL7LWLNWHUKDGDS
7LWLN$VDO  GDQ7LWLN7HUWHQWX DE

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.HJLDWDQ 

6HWHODKNDOLDQGDSDWPHQHQWXNDQNRRUGLQDWVXDWXWLWLNGDQMDUDNWLWLNWHUVHEXWWHUKDGDSVXPEX[
GDQVXPEX\GDODPELGDQJNRRUGLQDWVHNDUDQJNDOLDQDNDQPHPSHODMDULEDJDLPDQDNRRUGLQDWWLWLN
WHUVHEXWWHUKDGDSWLWLNWHUWHQWX DE 8QWXNOHELKMHODVQ\DFREDSHUKDWLNDQPDVDODKEHULNXW
0DVDODK 

3HUQDKNDKNDOLDQEHUNHPDK"'DODPSHUNHPDKDQDGDSRVXWDPDWHQGDSDVDUSRVSRVNRODPGDQ
ODLQODLQ&REDVHNDUDQJSHUKDWLNDQGHQDKSHUNHPDKDQGLEDZDKLQL

+XWDQ

3RV

7DQDK/DSDQJ

7HNDWHNL
7HUVHPEXQ\L

tp

ht

12

7HQGD






3RV



 7HQGD


3HUXPDKDQ

3DVDU

3RV8WDPD 7HQGD

         
         


7HQGD
3HPDNDPDQ

3RV
.RODP








://

1. Ajak siswa utuk meng


amati semua tempat
terhadap titik asal
O(0,0) dan fokuskan
pada koordinat masingmasing tempat.
2. Suruh siswa untuk
mengamati semua
tempat terhadap tanah
lapang dan kolam dan
fokuskan koordinat
masing-masing tempat
terhadap tanah lapang.
3. Minta siswa untuk men
cermati langkah demi
langkah Alternatif
penyelesaian untuk
menentukan koordinat
beberapa tempat
terhadap pos utama.
4. Minta siswa untuk
membandingkan posisi
titik terhadap titik
pusat dan terhadap titik
tertentu dan keterangan
yang menunjukkan
jarak tempat tertentu
terhadap titik pusat
dan tanah lapang serta
kolam.

*DPEDU'HQDK3HUNHPDKDQGDODPELGDQJNRRUGLQDW

%HUGDVDUNDQGHQDKSHUNHPDKDQ*DPEDUFREDWHQWXNDQ
 3RVLVLSHUXPDKDQSHPDNDPDQSDVDUWHNDWHNLWHQGDGDQSRVWHUKDGDSSRVXWDPD"
 3RVLVLSHUXPDKDQSHPDNDPDQSDVDUWHNDWHNLWHQGDGDQSRVWHUKDGDSWDQDKODSDQJGDQ
NRODP"



.HODV9,,,60307V

Buku Guru Kelas VIII SMP/MTs

6HPHVWHU

Semester 1

$OWHUQDWLI3HPHFDKDQ0DVDODK
8QWXNPHQHQWXNDQSRVLVLSHUXPDKDQSHPDNDPDQSDVDUWHNDWHNLWHQGDGDQSRVWHUKDGDSSRV
XWDPDNDOLDQODNXNDQSURVHGXUEHULNXW
/DQJNDK
.DOLDQWHQWXNDQGXOXSRVLVLSRVXWDPDSDGDELGDQJNRRUGLQDW
3RVLVLSRV8WDPDGDODPELGDQJNRRUGLQDWSDGDWLWLN2  
/DQJNDK
*XQDNDQSRVXWDPDVHEDJDLWLWLNDFXDQGDODPPHQHQWXNDQSRVLVLSHUXPDKDQSHPDNDPDQSDVDU
WHNDWHNLWHQGDGDQSRV

7HPSDW
3HUXPDKDQ
3HPDNDPDQ
3DVDU
+XWDQ
7HQGD
3RV

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

7HQWXNDQNRRUGLQDW[GDQNRRUGLQDW\GDULSHUXPDKDQSHPDNDPDQSDVDUWHNDWHNLWHQGDGDQSRV
WHUKDGDSWLWLN2  VHSHUWLEHULNXW

.id

/DQJNDK

3RVLVLWHPSDWWHUKDGDS3RV8WDPD

.RRUGLQDW

.HWHUDQJDQ



VDWXDQNHNDQDQGDQVDWXDQNHDWDV



VDWXDQNHNLULGDQVDWXDQNHEDZDK



VDWXDQNHNDQDQGDQVDWXDQNHDWDV



VDWXDQNHNLULGDQVDWXDQNHDWDV



VDWXDQNHNDQDQGDQVDWXDQNHDWDV



VDWXDQNHNDQDQGDQVDWXDQNHDWDV

8QWXNPHQHQWXNDQSRVLVLSHUXPDKDQSHPDNDPDQSDVDUWHNDWHNLWHUVHPEXQ\LWHQGDGDQSRV
WHUKDGDSWDQDKODSDQJGDQNRODPNDOLDQODNXNDQSURVHGXUEHULNXW
/DQJNDK

/DQJNDK

tp

://

.DOLDQWHQWXNDQGXOXSRVLVLWDQDKODSDQJGDQNRODPSDGDELGDQJNRRUGLQDW
3RVLVLWDQDKODSDQJDGDODKNRRUGLQDW  GDQSRVLVLNRODPDGDODKNRRUGLQDW  

ht

*XQDNDQ NRRUGLQDW    GDQ NRRUGLQDW    VHEDJDL WLWLN DFXDQ GDODP PHQHQWXNDQ SRVLVL
SHUXPDKDQ SHPDNDPDQ SDVDU WHNDWHNL WHQGD  GDQ SRV $QJJDS VDMD NRRUGLQDW    GDQ
NRRUGLQDW  VHEDJDLWLWLN2  

0$7(0$7,.$



Ajak siswa untuk memahami


Alternatif Pemecahan Masalah 1.2
MATEMATIKA

13

Ayo Kita
Menalar

7HQWXNDQNRRUGLQDW[GDQNRRUGLQDW\GDULSHUXPDKDQSHPDNDPDQSDVDUWHNDWHNLWHQGDGDQSRV
WHUKDGDSNRRUGLQDW  GDQNRRUGLQDW  VHSHUWLEHULNXW

7HPSDW

3RVLVLWHPSDWWHUKDGDSWDQDKODSDQJ
.RRUGLQDW

3HUXPDKDQ



3HPDNDPDQ



3DVDU



7HNDWHNL
7HUVHPEXQ\L



7HQGD



3RV



.HWHUDQJDQ
VDWXDQNHNDQDQ
VDWXDQNHDWDV
VDWXDQNHNLUL
VDWXDQNHEDZDK
VDWXDQNHNDQDQ
VDWXDQNHDWDV
VDWXDQNHNLUL
VDWXDQNHEDZDK
VDWXDQNHNDQDQ
VDWXDQNHEDZDK
VDWXDQNHNDQDQ
VDWXDQNHDWDV

$\R
.LWD$PDWL

3RVLVLWHPSDWWHUKDGDSNRODP
.RRUGLQDW







.HWHUDQJDQ
VDWXDQNHNDQDQ
VDWXDQNHDWDV
VDWXDQNHNLUL
VDWXDQNHDWDV
VDWXDQNHNDQDQ
VDWXDQNHDWDV
VDWXDQNHNLUL
VDWXDQNHDWDV
VDWXDQNHNDQDQ
VDWXDQNHDWDV
VDWXDQNHNDQDQ
VDWXDQNHDWDV

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

1. Minta siswa untuk


membuat pertanyaan
berdasarkan kasus
yang ada di buku
siswa.
2. Siswa juga boleh
membuat pertanyaan
lain, misalnya
Berapakah koordinat dari perumahan
terhadap tenda 2
yang benar
Mengapa tenda 1
dan tenda 3 tidak
memiliki koordinat
x atau koordinat xnya nol
Mengapa koordinat
x tenda 3 terhadap tanah lapang
bernilai positif,
padahal tenda 3 berada di sebelah kiri
sumbu-y

/DQJNDK

.id

Ayo Kita
Menanya

$PDWLODK GHQDK SHUNHPDKDQ SDGD *DPEDU  )RNXVNDQ SHQJDPDWDQ NDOLDQ SDGD SURVHGXU
PHQHQWXNDQSRVLVLDWDXNRRUGLQDWEHEHUDSDWHPSDWWHUKDGDSSRVXWDPDDWDXWLWLNSXVDW  GDQ
SURVHGXU PHQHQWXNDQ SRVLVL DWDX NRRUGLQDW EHEHUDSD WHPSDW WHUKDGDS WDQDK ODSDQJ    GDQ
NRODP  

"

$\R.LWD
0HQDQ\D

&REDDPDWLNHPEDOL*DPEDUGDQMLND(GR/DQLGDQ6LWLGLPLQWDSDN6XWHGRXQWXNPHQHQWXNDQ
SRVLVLSHUXPDKDQWHUKDGDSWHQGD(GRPHQMDZDE  /DQLPHQMDZDE  GDQ6LWLPHQMDZDE
   GDQ WHUQ\DWD SDN 6XWHGR PHPSXQ\DL MDZDEDQ \DQJ EHUEHGD GHQJDQ NHWLJD VLVZD WHUVHEXW
6HDQGDLQ\D NDOLDQ PHOLKDW NRQGLVL VHPDFDP LWX 7XOLVODK SHUWDQ\DDQ  \DQJ EHUKXEXQJDQ GHQJDQ
NHEHQDUDQSRVLVLSHUXPDKDQWHUVHEXWWHUKDGDSWHQGDNRRUGLQDWEHEHUDSDWHPSDWWHUKDGDSWHQGD
GDQWHQGDSRVLVLSHUXPDKDQWHUKDGDSWHQGDGDQVHEDJDLQ\D
$\R.LWD
0HQDODU

6HNDUDQJ SHUKDWLNDQ NHPEDOL GHQDK SHUNHPDKDQ SDGD *DPEDU  &RED WHQWXNDQ SRVLVL WHPSDW
WHUWHQWXWHUKDGDSWLWLNDVDO2  GDQWHUKDGDSWHQGDSRVGDQSDVDUVHSHUWLSDGD7DEHO
EHULNXW



.HODV9,,,60307V

6HPHVWHU

ht

tp

://

1. Bentuklah siswa dalam


beberapa kelompok
untuk mengerjakan Ayo
Menalar
2. Mintalah siswa untuk
menggambar bidang
koordinat Cartesius
agar lebih mudah
menentukan koordinat
beberapa tempat
terhadap tempat
tertentu.
3. Berilah bimbingan bagi
siswa yang belum bisa
menentukan koordinat
suatu titik tertentu
terhadap titik tertentu
14

Buku Guru Kelas VIII SMP/MTs

Semester 1

Alternatif
Jawaban
Alternatif jawaban pada kegiatan Ayo Kita Menalar

Pemakaman

Pasar

Hutan

Tenda 1

Tenda 2

Pos 1

Tenda 1 (2, 0)
4 satuan ke
kanan dan 5
satuan ke atas

Pos 1 (2, 5)
4 satuan ke
kanan dan 0
satuan ke atas

Pasar (4, 3)
2 satuan ke
kanan dan 2
satuan ke atas

7 satuan ke kiri
dan 2 satuan ke
bawah

7 satuan
ke kiri dan
7 satuan ke
bawah

9 satuan
ke kiri dan
5 satuan ke
bawah

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

(-5, -2)

Posisi dari

.id

Posisi dari titik asal


O(0, 0)
Tempat
Koordinat
Perumahan
(6, 5)

(4, 3)

(-8, 5)

tp

ht

2 satuan ke
0 satuan ke
kanan dan
kanan dan 0 ke
2 satuan ke
atas
bawah
10 satuan ke kiri
10 satuan
12 satuan
dan 5 satuan ke
ke kiri dan 0
ke kiri dan
atas
satuan ke atas
2 satuan ke
bawah
2 satuan ke
kanan dan 3
satuan ke atas

(2, 0)

0 satuan ke
kanan dan 0
satuan ke atas

(0, 2)

2 satuan ke kiri
dan 2 satuan ke
atas

://

No

(2, 5)

0 satuan ke
kanan dan 5
satuan ke bawah

0 satuan
ke kiri dan
5 satuan ke
bawah
2 satuan
ke kiri dan
3 satuan ke
bawah
0 satuan ke
kanan dan 0
satuan ke atas

2 satuan
ke kiri dan
3 satuan ke
bawah
4 satuan
ke kiri dan
3 satuan ke
bawah
2 satuan
ke kiri dan 2
satuan ke atas

MATEMATIKA

15

7DEHO3RVLVLWHPSDWWHUWHQWXWHUKDGDSWLWLNDVDOWHQGDSRVGDQNRODP
3RVLVLGDULWLWLNDVDO 
7HPSDW

3RVLVLWHUKDGDS

.RRUGLQDW

7HQGD 
VDWXDQNHNDQDQ
GDQVDWXDQNH
DWDV

3HUXPDKDQ



3HPDNDPDQ



3DVDU



+XWDQ



7HQGD



7HQGD



3RV



3RV



.RODP 

VDWXDQNHNLUL
GDQVDWXDQNH
EDZDK
VDWXDQNHNDQDQ
GDQVDWXDQNH
EDZDK
VDWXDQNHNLUL
GDQVDWXDQNH
DWDV

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3RV 

VDWXDQNHNDQDQ VDWXDQNH
GDQVDWXDQNH
NDQDQGDQ
DWDV
VDWXDQNHDWDV

.id

1R

VDWXDQNHNDQDQ
GDQVDWXDQNH
DWDV

$\R.LWD
%HUEDJL

 &REDODKEXDWSURVHGXUXQWXNPHQJLVL7DEHO

 &RFRNNDQMDZDEDQPXGHQJDQWHPDQVHEDQJNXGDQGLVNXVLNDQDSDELODDGDSHUEHGDDQ

Ayo Kita
Berbagi

$JDUNDOLDQOHELKPHPDKDPLSRVLVLWLWLNWHUWHQWXWHUKDGDSWLWLN\DQJVXGDKGLWHQWXNDQ DE FRED


SHUKDWLNDQFRQWRKEHULNXW
&RQWRK 

*DPEDUODKWLWLN$  %  &  GDQ'  SDGDELGDQJNRRUGLQDW

0$7(0$7,.$

ht

tp

://

1.
1. Informasikan
kepada siswa untuk
mendikusikan dengan
kelompok lain, dalam
kegiatan ini: minta
siswa untuk menukarkan jawabannya dan
mendiskusikan dengan
teman sebangku
2. Agar lebih jelas, minta
siswa untuk mencermati langkah-langkah
untuk menggambar
titik-titik pada bidang
koordinat dan beri
penjelasan bagi siswa
yang mengalami
kesulitan

 3UHVHQWDVLNDQKDVLOGLVNXVLWHUVHEXWNHSDGDWHPDQPX\DQJODLQGLGHSDQNHODV

16

Buku Guru Kelas VIII SMP/MTs

Semester 1



$OWHUQDWLI
3HQ\HOHVDLDQ
8QWXNPHQJJDPEDUWLWLN$  %  &  GDQ'  SDGDELGDQJNRRUGLQDWODNXNDQ
SURVHGXUEHULNXW
/DQJNDK
*DPEDUODKELGDQJNRRUGLQDWGHQJDQNXDGUDQ
/DQJNDK
*XQDNDQWLWLN2  VHEDJDLWLWLNDFXDQXQWXNPHQJJDPEDUWLWLN$%&GDQ'
/DQJNDK

$ 

       





' 




&RQWRK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o










.id

*DPEDUODKWLWLN$  %  &  GDQ'  SDGDELGDQJNRRUGLQDWVHSHUWLEHULNXW

% 

& 

       

tp

$OWHUQDWLI
3HQ\HOHVDLDQ

://

-LNDGLNHWDKXLWLWLN3  .  /  0  GDQ1  WHQWXNDQNRRUGLQDWWLWLN./
0GDQ1WHUKDGDSWLWLN3

ht

8QWXNPHQHQWXNDQNRRUGLQDW./0GDQ1WHUKDGDSWLWLN3ODNXNDQSURVHGXUVHEDJDLEHULNXW



.HODV9,,,60307V

6HPHVWHU

Ajak siswa untuk me mahami


Alternatif Penyelesaian Contoh
1.3 dan mengamati
Contoh 1.4
MATEMATIKA

17

/DQJNDK
*DPEDUODKELGDQJNRRUGLQDWGHQJDQNXDGUDQ
/DQJNDK
*DPEDUODKWLWLN.  /  0  GDQ1  SDGDELGDQJNRRUGLQDWVHSHUWLEHULNXW



1  






       



3  

. 
/ 
         

0 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id








/DQJNDK

*XQDNDQWLWLN3  VHEDJDLWLWLNDFXDQGDODPPHQHQWXNDQNRRUGLQDWWLWLN./0GDQ1GDQ


EXDWODKVXPEX[GDQVXPEX\GHQJDQWLWLN3  VHEDJDLWLWLN2  
/DQJNDK

7HQWXNDQNRRUGLQDWWLWLN./0GDQ1GHQJDQVXPEX[GDQVXPEX\\DQJEDUXVHSHUWLEHULNXW
\




1 

       

Ayo
Kita Amati




 3  



















/DQJNDK

.RRUGLQDWWLWLNWLWLN./0GDQ1WHUKDGDS
WLWLN3DGDODK
 NRRUGLQDWWLWLN. 

. 

/ 

 NRRUGLQDWWLWLN/ 

         

0 

 NRRUGLQDWWLWLN0 

 NRRUGLQDWWLWLN1 

[

 

0$7(0$7,.$

ht

tp

://

1. Minta siswa untuk


mencermati kembali
langkah-langkah
dalam menentukan
kordinat titik terhadap
titik tertentu dalam
Contoh 1.4

2. Beri penjelasan
kepada siswa yang
masih mengalami
kesulitan dalam
memahami langkahlangkah tersebut.
18

Buku Guru Kelas VIII SMP/MTs

Semester 1



0DVDODK 

.id

' 

& 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3HUKDWLNDQ*DPEDUELGDQJNRRUGLQDWEHULNXW
'LNHWDKXL
3HUVHJLDGHQJDQVDODKVDWXWLWLNNRRUGLQDWDGDODK$  
3HUVHJLDGHQJDQVDODKVDWXWLWLNNRRUGLQDWDGDODK%  
3HUVHJLDGHQJDQVDODKVDWXWLWLNNRRUGLQDWDGDODK&  
3HUVHJLDGHQJDQVDODKVDWXWLWLNNRRUGLQDWDGDODK'  
3HUVHJLDGHQJDQVDODKVDWXWLWLNNRRUGLQDWDGDODK( 

\




7HQWXNDQVDODKVDWXWLWLNNRRUGLQDW=

SDGDSHUVHJLD








% 


$ 



             

$OWHUQDWLI3HPHFDKDQ0DVDODK
$\R
.LWD$PDWL

&RED DPDWL NHPEDOL NRRUGLQDW WLWLN


$%&GDQ'SDGDELGDQJNRRUGLQDW
EHULNXW 3HUKDWLNDQ SROD \DQJ WHUMDGL
GDULNRRUGLQDWWLWLN$%&VDPSDL'

















' 

% 

$ 

ht

tp

.HODV9,,,60307V

://

             



Ayo
Kita Amati

& 

6HPHVWHU

1. Minta siswa untuk


membentuk kelompok
untukmenyelesaikan
Masalah 1.3
2. Beri penjelasan dan
bimbingan secukup
nya.
3. Minta masing-masing
kelompok untuk
mempresentasikan
jawabannya di
depan kelas secara
bergantian dan
kelompok lain
memberikan
tanggapan.
MATEMATIKA

19

"

$\R.LWD
0HQDQ\D

6HWHODK NDOLDQ PHQJDPDWL NRRUGLQDW WLWN $ % & GDQ ' EXDWODK SHUWDQ\DDQ FRQWRK EHUDSDNDK
NRRUGLQDWWLWLN("EHUDSDNRRUGLQDWWLWLN)"%DJDLPDQDNDOLDQPHQHQWXNDQNRRUGLQDWWLWLN(GDQ)"

0HQJJDOL
,QIRUPDVL

&RED FDULODK LQIRUPDVL SDGD EXNX EDJDLPDQD PHQHQWXNDQ NRRUGLQDW WLWLN WHUWHQWX GHQJDQ
PHQJJXQDNDQSROD

$\R.LWD
%HUQDODU

.id

%HUDSDNDKNRRUGLQDWWLWLNSDGDEDULVNH"

Ayo Kita
Menalar

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

$JDUNDOLDQPHQMDGLOHELK\DNLQEDJDLPDQDFDUDPHQHQWXNDQNRRUGLQDWWLWLN$%&GDQ'&RED
VDOLQGDQOHQJNDSLSHQ\HOHVDLDQEHULNXW
$   

 

%   

    

&   

    

'  

    

Z (x, y), karena x = y maka


cukup dicari koordinat x
saja

(  

    

)  

    

Karena Z adalah huruf ke26 maka koordinat titik Z


adalah

.DUHQD=DGDODKKXUXINHPDNDNRRUGLQDWWLWLN=DGDODK

= [(1+2+3+ ...+24+25+26)]
+1
sehingga diperoleh




= [\ NDUHQD[ \PDNDFXNXSGLFDULNRRUGLQDW[VDMD




  VHKLQJJDGLSHUROHK





.DUHQDDGDVHEDQ\DNPDND
 

 

 


-DGLNRRUGLQDWWLWLN=DGDODK 

0$7(0$7,.$

tp

://

= [(1+26)+(2+25)+(3+24)
+...+(13+14)]+1

ht

Karena ada 27 sebanyak 13,


maka
= 2713+1
= 351+1
=352
Jadi koordinat titik Z adalah
(352, 352)
20

Buku Guru Kelas VIII SMP/MTs

Semester 1



"

/DWLKDQ 









&




'
*


         

 



.id





D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o
.












*DPEDU$OLUDQ6XQJDLSDGD%LGDQJNRRUGLQDW

 *DPEDU GL DWDV PHQXQMXNNDQ DOLUDQ VXQJDL \DQJ PHOHZDWL EHEHUDSD WLWLN GDODP ELGDQJ
NRRUGLQDW
D &REDVHEXWNDQNRRUGLQDWWLWLNWLWLN\DQJGLODOXLROHKDOLUDQVXQJDLWHUVHEXW

E 6HEXWNDQWLWLNWLWLN\DQJGLOHZDWLDOLUDQVXQJDL\DQJEHUDGDSDGDNXDGUDQ,NXDGUDQ,,
NXDGUDQ,,,GDQNXDGUDQ,9
F 6HEXWNDQNRRUGLQDWWLWLN$%&GDQ'WHUKDGDSWLWLN*

tp

.HODV9,,,60307V

ht



://

G 6HEXWNDQNRRUGLQDWWLWLN()*GDQ+WHUKDGDSWLWLN-

6HPHVWHU

?!

Latihan 1.2

Minta siswa untuk menye


lesaikan soal latihan dan
di bahas di kelas dengan
menunjuk salah satu
siswa, sedang siswa yang
lain di minta menanggapi
dengan santun. Begitu
seterusnya untuk nomor
soal lainnya.
MATEMATIKA

21



D 7XOLVNDQNRRUGLQDWWLWLNWHUVHEXWVHFDUD
EHUXUXWGDULWLWLN$VDPSDLGHQJDQWLWLN*

\
*

)
&

E 7HQWXNDQNRRUGLQDWWLWLN-

%
[

F %DJDLPDQDNDOLDQPHQHQWXNDQWLWLN-"

$
'

 'DODPELGDQJNRRUGLQDWVHHNRUODODWEHUJHUDNGDULWLWLN  PHQJLNXWLSRODVDWXDQNHDWDV


GDQVDWXDQNHNLULVDWXDQNHEDZDKGDQVDWXDQNHNDQDQVDWXDQNHDWDVGDQVDWXDQNH
NLULVDWXDQNHEDZDKGDQVDWXDQNHNDQDQGDQVHWHUXVQ\D
7HQWXNDQNRRUGLQDWODODWVHWHODKEHUJHUDN
D NDOLFNDOL
E NDOLGNDOL

.id

 *DPEDUODKWLWLN\DQJEHUMDUDNVDWXDQWHUKDGDSVXPEX[GDQWHUKDGDSVXPEX\

 *DPEDUODKWLWLN\DQJMDUDNQ\DWHUKDGDSVXPEX[GXDNDOLMDUDNWHUKDGDSVXPEX\

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 $GDEHUDSDEDQ\DNWLWLN\DQJEHUMDUDNVDWXDQGDULVXPEX[GDQVDWXDQGDULVXPEX\"

%HULODKQDPDXQWXNVHWLDSWLWLNNRRUGLQDW\DQJKLODQJGDODPVHWLDSJDPEDUEHULNXW
D 3HUVHJL$%&'


E 3HUVHJLSDQMDQJ()*+
\

'

&

+ E

( 

) D

$ 

% D

6HJLWLJDVLNXVLNX456GLJDPEDUGDODPELGDQJNRRUGLQDWVHSHUWLEHULNXW


D -LND45 VDWXDQGDQ46 VDWXDQWHQWXNDQ


NRRUGLQDWWLWLNWLWLNVHJLWLJD456

E -LND45 DGDQ46 EWHQWXNDQNRRUGLQDW


WLWLN45GDQ6

0$7(0$7,.$

ht

tp

://

1. Lakukan penilaian pengetahuan dengan melihat hasil ayo bernalar.


2. Lakukan penilaian sikap saat diskusi dan mempresentasikan hasil bernalar.
3. Siswa yang masih belum tuntas berikan pembelajaran remedial dan berilah tugas
lain yang sejenis.

22

Buku Guru Kelas VIII SMP/MTs

Semester 1

[
5



Membelajarkan 1.3

Memahami Posisi Garis terhadap


Sumbu-x dan Sumbu-y

.id

1. Siapkan papan tulis bergaris dan buku petak


2. Siapkan format penilaian sikap dan keterampilan
3. Siapkan alat peraga yang dapat membantu membuat bidang koordinat (penggaris,
kertas karton berpetak) atau sediakan bidang koordinat pada kertas karton

0HPDKDPL3RVLVL*DULVWHUKDGDS
6XPEX[GDQ6XPEX\

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.HJLDWDQ 

3HUKDWLNDQ SRVLVL JDULV O JDULV P GDQ JDULV Q SDGD ELGDQJ NRRUGLQDW  EHULNXW 3HUKDWLNDQ SXOD
NHGXGXNDQJDULVOJDULVPGDQJDULVQWHUKDGDSVXPEX[GDQVXPEX\











         











O

O

O












tp

         











ht

         











P

Q

Ayo
Kita Amati

://

O

         

1. Fokuskan pengamatanpada garis yang


sejajar, tegak lurus dan
berpotongan dengan
sumbu-x dan sumbu-y.
2. Minta siswa untuk
menemukan apa ciriciri dari garis yang
sejajar, tegak lurus dan
berpotongan dengansumbu-x dan sumbu-y.












P

Q

[
         

P

P

[
         

F
*DPEDU*DULVJDULVSDGDELGDQJNRRUGLQDW

$\R
.LWD$PDWL
)RNXVNDQSHQJDPDWDQNDOLDQSDGDJDULV\DQJVHMDMDUWHJDNOXUXVGDQEHUSRWRQJDQGHQJDQVXPEX[
GDQVXPEX\7DEHOEHULNXWPHQXQMXNNDQJDULVJDULV\DQJVHMDMDUWHJDNOXUXVGDQPHPRWRQJ
VXPEX[GDQVXPEX\



.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

23

7DEHO*DULVJDULV\DQJVHMDMDUWHJDNOXUXVGDQPHPRWRQJVXPEX[GDQVXPEX\
*DPEDUD

*DPEDUE

*DPEDUF

*DULVJDULV\DQJ *DULVJDULV\DQJ
*DULVJDULV
*DULVJDULV
*DULVJDULV\DQJ
VHMDMDUGHQJDQ
VHMDMDUGHQJDQ \DQJWHJDNOXUXV \DQJWHJDNOXUXV PHPRWRQJVXPEX[
VXPEX[
VXPEX\
GHQJDQVXPEX[ GHQJDQVXPEX\
GDQVXPEX\
PPPP

OOOO

PPPP

OOOO

QQ

*DULVOPGDQQSDGD*DPEDUPHODOXLWLWLNWLWLNVHSHUWLSDGD7DEHOEHULNXW
7DEHO7LWLNWLWLN\DQJGLODOXLJDULVOPGDQQ

.RRUGLQDWWLWLNWLWLN\DQJGLODOXL

O

                 

O

                 

O

                

O

                

P

                

P

                

P

                

P

                

Q

            

Q

            

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

D

*DULV

.id

*DPEDU

E

Ayo Kita
Menanya

F

-LNDNDOLDQFHUPDWLJDULVOPGDQQDGD\DQJPHODOXLWLWLNWLWLNGHQJDQNRRUGLQDW\DQJVDPDGDQDGD
SXOD\DQJPHODOXLWLWLNWLWLNGHQJDQNRRUGLQDW\DQJEHUEHGDNHVLPSXODQDSD\DQJGDSDWNDOLDQDPELO
GDULSHQJDPDWDQGLDWDV"

"

$\R.LWD
0HQDQ\D

%HUGDVDUNDQKDVLOSHQJDPDWDQGLDWDVFREDEXDWODKSHUWDQ\DDQ\DQJPHPXDWNDWDNDWDEHULNXW
 VXPEX[VXPEX\GDQWHJDNOXUXV

 VDWXWLWLNWLGDNVHMDMDUGDQVXPEXW[VXPEX\
7XOLVODKSHUWDQ\DDQSDGDEXNXWXOLVNDOLDQ

0$7(0$7,.$

ht

tp

://

1. Siswa dapat membuat


pertanyaan dengan
menggunakan kata-kata
yang ada di buku siswa.
2. Berilah pancingan per
tanyaan dan contoh per
tanyaan yang membuat
siswa termotivasi untuk
membuat pertanyaan.
a. Apakah garis yang
sejajar dengan sumbux pasti tegak lurus
sumbu-y?
b. Apakah garis yang
tegak lurus dengan
sumbu-x pasti sejajar
sumbu-y?
c. Apakah mungkin
membuat garis yang
melalui satu titik yang
tidak sejajar sumbux dan tidak sejajar
sumbu-y?
24

Buku Guru Kelas VIII SMP/MTs

Semester 1



0HQJJDOL
,QIRUPDVL

&REDFDULODKLQIRUPDVLWHQWDQJ
 $SDNDKJDULV\DQJVHMDMDUGHQJDQVXPEX[SDVWLJDULVLWXWHJDNOXUXVGHQJDQVXPEX\"
 $SDNDKJDULV\DQJVHMDMDUGHQJDQVXPEX\SDVWLJDULVLWXWHJDNOXUXVGHQJDQVXPEX["
 $SDELODVXDWXJDULVPHPRWRQJWLGDNWHJDNOXUXVGHQJDQVXPEX[EDJDLPDQDSHUSRWRQJDQ
JDULVWHUVHEXWGHQJDQVXPEX\"
6HEHOXPNDOLDQPHQJJDOLLQIRUPDVLFREDSHUKDWLNDQ&RQWRKEHULNXW

&RQWRK 

.id

*DPEDUODKJDULVO\DQJPHODOXLWLWLN$  \DQJWLGDNVHMDMDUGHQJDQVXPEX[GDQWLGDNVHMDMDU


GHQJDQVXPEX\

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

$OWHUQDWLI
3HQ\HOHVDLDQ
*DULVO\DQJPHODOXLWLWLN$  WLGDNVHMDMDUGHQJDQVXPEX[GDQWLGDNVHMDMDUGHQJDQVXPEX\
DGDODKVHEDJDLEHULNXW
O

         











=+












         

$ 

$SDNDKPDVLKDGDJDULVODLQ\DQJ\DQJPHODOXLWLWLN$  \DQJWLGDNVHMDMDUGHQJDQVXPEX[GDQ


WLGDNVHMDMDUGHQJDQVXPEX\"

ht

tp

.HODV9,,,60307V

://

-LNDDGDEHUDSDEDQ\DNJDULVODLQ\DQJPHODOXLWLWLN$  \DQJWLGDNVHMDMDUGHQJDQVXPEX[GDQ


WLGDNVHMDMDUGHQJDQVXPEX\"



Menggali
Informasi

6HPHVWHU

1. Minta siswa untuk


mencermati dan
memahami Contoh 1.5
dan Contoh 1.6 dengan
baik.
2. Mintalah siswa untuk
mencermati kembali
langkah demi langkah
yang ada pada
penyelesaian
Contoh 1.7
3. Beri siswa soal yang
sejenis, dan minta
siswa untuk membuat
prosedur dalam
menyelesaikan soal
tersebut.
4. Minta siswa yang sudah
memahami informasi
dan contoh untuk
menjelaskan kepada
temannya.
MATEMATIKA

25

&RQWRK 
*DPEDUODKJDULVPGDQQ\DQJVDOLQJVHMDMDUWDSLWLGDNWHJDNOXUXVGHQJDQVXPEX[GDQVXPEX\
P

3HQ\HOHVDLDQ

[
         

6DODKVDWXJDULVPGDQQ\DQJVHMDMDUWDSLWLGDN
WHJDN OXUXV GHQJDQ VXPEX[ GDQ VXPEX\
VSHUWL SDGD JDPEDU GL VDPSLQJ .DOLDQ GDSDW
PHQJJDPEDUJDULVPGDQ\DQJEHUEHGDGHQJDQ
JDPEDUGLVDPSLQJ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

         











.id












&RQWRK 

'LNHWDKXLWLWLN$  %  GDQ&  

D -LNDGLEXDWJDULV\DQJPHODOXLWLWLN$GDQ%EDJDLPDQDNDKNHGXGXNDQJDULVWHUVHEXWWHUKDGDS
VXPEX[GDQVXPEX\
E -LNDGLEXDWJDULV\DQJPHODOXLWLWLN$GDQ&EDJDLPDQDNDKNHGXGXNDQJDULVWHUVHEXWWHUKDGDS
VXPEX[GDQVXPEX\
F -LNDGLEXDWJDULV\DQJPHODOXLWLWLN%GDQ&EDJDLPDQDNDKNHGXGXNDQJDULVWHUVHEXWWHUKDGDS
VXPEX[GDQVXPEX\
$OWHUQDWLI
3HQ\HOHVDLDQ

8QWXNPHQMDZDESHUWDQ\DDQWHUVHEXWODNXNDQSURVHGXUEHULNXW
/DQJNDK

*DPEDUODKELGDQJNRRUGLQDW\DQJ\DQJPHPXDWNXDGUDQ
/DQJNDK

://

*DPEDUODKWLWLN$  %  GDQ&  SDGDELGDQJNRRUGLQDW


/DQJNDK

ht

tp

%XDWODKJDULVPHODOXLWLWLN$GDQ%PHODOXLWLWLN$GDQ&GDQPHODOXLWLWLN%GDQ&VHSHUWLJDPEDU
EHULNXW

0$7(0$7,.$

Ajak siswa untuk memahami


Contoh 1.6 serta alternatif
penyelesaiannya
26

Buku Guru Kelas VIII SMP/MTs

Semester 1



& 












         











$ 

[
         

Ayo Kita
Menalar

% 

.id

/DQJNDK
'DULJDPEDUWHUVHEXWWDPSDNEDKZD

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

D *DULV\DQJPHODOXLWLWLN$GDQ%WHJDNOXUXVWHUKDGDSVXPEX[GDQVHMDMDUWHUKDGDSVXPEX\

E *DULV\DQJPHODOXLWLWLN$GDQ&VHMDMDUWHUKDGDSVXPEX[GDQWHJDNOXUXVWHUKDGDSVXPEX\

F *DULV \DQJ PHODOXL WLWLN % GDQ & WLGDN VHMDMDU GDQ WLGDN WHJDN OXUXV WHUKDGDS VXPEX[ GDQ
VXPEX\
$\R.LWD
0HQDODU

 3HUKDWLNDQ*DPEDUEHULNXWLQL

D $SDNDKDGDJDULVPHODOXLWLWLN$\DQJ
WHJDNOXUXVGHQJDQVXPEX[GDQVHMDMDU
VXPEX\"-LNDDGDWXQMXNNDQMLNDWLGDN
DGDFREDMHODVNDQDODVDQQ\D

E $GDNDKDGDJDULVPHODOXLWLWLN%\DQJ
WLGDN VHMDMDU GHQJDQ VXPEX[ GDQ
WLGDN VHMDMDU GHQJDQ VXPEX\ WHWDSL
PHPRWRQJ VXPEX[ GDQ VXPEX\ "
-LNDDGDWXQMXNNDQMLNDWLGDNDGDFRED
MHODVNDQ

ht

tp

.HODV9,,,60307V

://

F $SDNDK DGD JDULV \DQJ PHODOXL WLWLN &


GDQ  VHMDMDU GHQJDQ VXPEX[ VHNDOLJXV
VHMDMDU GHQJDQ VXPEX\" -LND DGD
WXQMXNNDQMLNDWLGDNDGDFREDMHODVNDQ



1. Garis yang melalui


titik A sangatlah banyak, termasuk garis
yang melalui titik
(0,0).
2. Garis yang melalui
titik B yang tegak
lurus sumbu-x dan
sejajar sumbu-y
hanya ada satu.
3. Tidak ada garis
yang sejajar dengan
sumbu-x dan sekaligus sejajar dengan
sumbu-y.
4. Garis yang melalui
titik B yang sejajar
sumbu-x dan tegak
lurus sumbu-y hanya
ada satu.
5. Garis yang melalui
titik D yang memotong sumbu-x dan
sumbu-y pada satu
titik yaitu garis yang
melalui titik pusat
(0,0).
6. Jika keempat titik
tersebut dihubungkan akan membentuk bangun persegi.












         











&

         

'

*DPEDU7LWLNWLWLNSDGDELGDQJNRRUGLQDW

6HPHVWHU

MATEMATIKA

27

G $SDNDK DGD JDULV \DQJ PHODOXL WLWLN & GDQ  VHMDMDU GHQJDQ VXPEX[ VHNDOLJXV VHMDMDU GHQJDQ
VXPEX\"-LNDDGDWXQMXNNDQMLNDWLGDNDGDFREDMHODVNDQ
H $SDNDK DGD JDULV \DQJ PHODOXL WLWLN ' GDQ  VHMDMDU GHQJDQ VXPEX[ GDQ WHJDN OXUXV  GHQJDQ
VXPEX\"-LNDDGDWXQMXNNDQMLNDWLGDNDGDFREDMHODVNDQ
I $SDNDKDGDJDULV\DQJPHPRWRQJVXPEX[GDQVXPEX\SDGDVDWXWLWLN"-LNDDGDEXNWLNDQMLND
WLGDNDGDFREDMHODVNDQ
J -LNDWLWLN$%&GDQ'GLKXEXQJNDQEDQJXQGDWDUDSDNDK\DQJWHUEHQWXN"
K *DPEDUODK WLWLNWLWLN SDGD ELGDQJ .DUWHVLXV \DQJ MLND GLKXEXQJNDQ PHPEHQWXN EDQJXQ MDMDU
JHQMDQJGDQOD\DQJOD\DQJ
$\R.LWD
%HUEDJL
 %HUGDVDUNDQ JDPEDU \DQJ VXGDK NDOLDQ KDVLONDQ WDGL WXNDUNDQ GHQJDQ KDVLO WHPDQPX GDQ
EDQGLQJNDQODKDSDNDKDGD\DQJEHUEHGD"-LNDDGDFREDGLVNXVLNDQPHQJDSDWHUMDGLSHUEHGDDQ"

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

 $SDNHVLPSXODQNDOLDQWHQWDQJJDULVJDULV\DQJVHMDMDUWHJDNOXUXVGDQEHUSRWRQJDQGHQJDQ
VXPEX[GDQVXPEX\SDGDELGDQJNRRUGLQDW"

0DVDODK 

'LNHWDKXLVHJPHQDEFGDQGVHSHUWLSDGDELGDQJNRRUGLQDWEHULNXW*DULVDPHODOXLWLWLN$  
GDQ$  JDULVEPHODOXLWLWLN%  GDQ%  JDULVFPHODOXLWLWLN&  GDQ&  
GDQJDULVGPHODOXLWLWLN'   GDQ'   7HQWXNDQNRRUGLQDWGDULWLWLN-   GDQ
-   GDQ3   GDQ3   
















://

Ayo Kita
Berbagi

& 

%  

$ 
D

' 

& 

%  

$ 

             

*DPEDU*DULVJDULVVHMDMDUSDGDELGDQJNRRUGLQDW

0$7(0$7,.$

ht

tp

1. Mintalah siswa men


diskusikan dengan
teman sebangku
tentang menggambar
beberapa garis.
2. Buatlah kesimpulan
bersama tentang garis
sejajar, garis tegak
lurus dan garis yang
memotong sumbu-x
dan sumbu-y.

' 

28

Buku Guru Kelas VIII SMP/MTs

Semester 1



$OWHUQDWLI3HPHFDKDQ0DVDODK
$\R
.LWD$PDWL
&REDDPDWLNHPEDOLNRRUGLQDWWLWLN$%&GDQ'VHUWDWLWLN$%&GDQ'SDGD*DPEDU
3HUKDWLNDQSROD\DQJWHUMDGLGDULNRRUGLQDWWLWLNWLWLNWHUVHEXWVHEDJDLEHULNXW
 $  %  &  GDQ' 
3HUKDWLNDQWLWLNNRRUGLQDW[ VHPXDELODQJDQDGDODKJHQDSGDQEHUVHOLVLK
3HUKDWLNDQWLWLNNRRUGLQDW\ VHPXDELODQJDQDGDODKJDQMLOGDQEHUVHOLVLK
 $  %  &  GDQ' 
3HUKDWLNDQWLWLNNRRUGLQDW[ VHPXDELODQJDQDGDODKJDQMLOGDQEHUVHOLVLK
3HUKDWLNDQWLWLNNRRUGLQDW\ VHPXDELODQJDQDGDODKJHQDSGDQEHUVHOLVLK

"

$\R.LWD
0HQDQ\D

&RED FDULODK LQIRUPDVL SDGD EXNX WHUWHQWX DWDX LQWHUQHW  DWDX NDOLDQ WHPXNDQ VHQGLUL EDJDLPDQD
PHQHQWXNDQMXPODKGDULELODQJDQJHQDSGDQMXPODKGDULELODQJDQJDQMLO
0LVDONDQ
 7HQWXNDQELODQJDQJHQDSNH
 7HQWXNDQELODQJDQJDQMLONH
0HQJJDOL
,QIRUPDVL

$JDUNDOLDQPHQMDGLOHELK\DNLQEDJDLPDQDFDUDPHQHQWXNDQNRRUGLQDWWLWLN-  GDQ-  


VHUWD3  GDQ3  &REDVDOLQGDQOHQJNDSLSHQ\HOHVDLDQEHULNXW
3HUKDWLNDQNHPEDOLSDGDNHJLDWDQ$\R.LWD$PDWL

0LVDONDQNLWDJXQDNDQ\DQJQRPRUPDNDSRODQ\DVHEDJDLEHULNXW
     
     
     
     

tp

.HODV9,,,60307V

ht



  
  
  
  

://

$  
%  
&  
'  

.id

Ayo
Kita Amati

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

%LODQJDQELODQJDQ GL WLWLN NRRUGLQDW[ SDGD QRPRU  VDPD GHQJDQ ELODQJDQELODQJDQ GL WLWLN
NRRUGLQDW\SDGDQRPRU%HJLWXMXJDVHEDOLNQ\D$UWLQ\DNLWDFXNXSPHQFDULSRODELODQJDQSDGD
VDODKVDWXQRPRUVDMD
&RED SLNLUNDQ EHUDSD NRRUGLQDW WLWLN SDGD VHJPHQ JDULV H GDQ FRED EXDWODK SHUWDQ\DDQ GHQJDQ
PHQJJXQDNDQNDWDNRRUGLQDWGDQJDULV

6HPHVWHU

1. Untuk memecahkan
Masalah 1.5 bentuklah
siswa dalam beberapa
kelompok.
2. Mintalah mereka untuk
berdiskusi untuk memahami dan me mecahkan
Masalah 1.5 tersebut
Penyelesaian
J1 (x, y) = [211, 20 1)]
= [2(10 + 1), (2101)]
= (22, 19)
P1 (x, y) = [217, 321)]
= [2(16 + 1), (2161)]
= (34, 31)
Karena nilai x pada J1 sama
dengan nilai y pada J2,
maka cukup ditulis sebagai
berikut:
J1 (x, y) = (22, 19) dan
J2 (y, x) = (19, 22)
P1 (x, y) = (34, 31) dan
P2 (y, x) = (31, 34)
Jadi, koordinat titik J1
adalah (22, 19) dan J2 adalah (19, 22) dan koordinat
titik P1 adalah (34, 31) dan
P2 adalah (31, 34).
MATEMATIKA

29



- [\ 

          

3 [\ 

           

.DUHQDQLODL[SDGD-VDPDGHQJDQQLODL\SDGD-PDNDFXNXSGLWXOLVVHEDJDLEHULNXW
- [\    GDQ- \[   
3 [\    GDQ3 \[   
-DGLNRRUGLQDWWLWLN-GDQ-DGDODK  GDQNRRUGLQDWWLWLN3GDQ3DGDODK 

6DMLNDQ KDVLO SHQDODUDQ NDOLDQ GL GHSDQ NHODV 3HULNVD GDQ VHFDUD VDQWXQ VLODNDQ VDOLQJ PHPEHUL
NRPHQWDUGDQPHQDQJJDSLNRPHQWDUWHPDQPX

"

/DWLKDQ 

 *DPEDUODKJDULVO\DQJWHJDNOXUXVGHQJDQVXPEX[EHUDGDGLVHEHODKNDQDQGDQEHUMDUDN
VDWXDQGDULVXPEX\
 *DPEDUODKJDULVP\DQJWHJDNOXUXVGHQJDQVXPEX\EHUDGDGLEDZDKGDQEHUMDUDNVDWXDQ
GDULVXPEX[
 *DPEDUODKJDULVQ\DQJWLGDNVHMDMDUGHQJDQVXPEX[GDQVXPEX\

 -LNDDGDJDULVDPHODOXLWLWLN%  GDQWLWLN&  EDJDLPDQDNDKNHGXGXNDQJDULVWHUVHEXW


WHUKDGDSVXPEX[GDQVXPEX\"

 *DPEDUODKJDULVN\DQJPHODOXLWLWLN3  \DQJWLGDNVHMDMDUGHQJDQVXPEX\GDQWLGDN


VHMDMDUGHQJDQVXPEX[
 $SDELODGXDJDULVOGDQPPHPRWRQJVXPEX[GDQVXPEX\WLGDNWHJDNOXUXVEDJDLPDQDNDK
SRVLVLJDULVOWHUKDGDSJDULVP"-HODVNDQNHPXQJNLQDQQ\DGDQWXQMXNNDQGHQJDQJDPEDU
 'LNHWDKXLWWLWLN$  %  GDQ&  

D -LND GLEXDW JDULV \DQJ PHODOXL WLWLN $ GDQ % EDJDLPDQDNDK NHGXGXNDQ JDULV WHUVHEXW
WHUKDGDSVXPEX[GDQVXPEX\
E -LND GLEXDW JDULV \DQJ PHODOXL WLWLN $ GDQ & EDJDLPDQDNDK NHGXGXNDQ JDULV WHUVHEXW
WHUKDGDSVXPEX[GDQVXPEX\

://

F -LND GLEXDW JDULV \DQJ PHODOXL WLWLN % GDQ & EDJDLPDQDNDK NHGXGXNDQ JDULV WHUVHEXW
WHUKDGDSVXPEX[GDQVXPEX\

Latihan 1.3

tp

?!

$\R.LWD
%HUEDJL

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

1.
1. Mintalah setiap
kelompok untuk
mempresen tasikan
hasil kerjanya di
depan kelas secara
bergantian.
2. Berilah penjelasan
secukupnya bila
ada kelompok yang
belum mengerti.
3. Jika memungkinkan berilah soal
lain yang sejenis
untuk dikerja kan
berkelompok pula.

.id

Ayo Kita
Berbagi

0$7(0$7,.$

ht

Minta siswa untuk


menyelesaikan soal
latihan dan dibahas di
kelas dengan menunjuk
salah satu siswa,
sedang siswa yang lain
diminta menanggapi
dengan santun. Begitu
seterusnya untuk nomor
soal lainnya.
30

Buku Guru Kelas VIII SMP/MTs

Semester 1



 3HUKDWLNDQ*DPEDUEHULNXWLQL
O











    

O

O

.id

         

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o










O

'LNHWDKXLJDULVOPHODOXLWLWLN$  JDULVOPHODOXLWLWLN%  JDULVOPHODOXLWLWLN


&  GDQJDULVOPHODOXLWLWLN'  7HQWXNDQNRRUGLQDWWLWLN-SDGDJDULVO

 3ROLJRQ,-./GLJDPEDUGDODPELGDQJNRRUGLQDWVHKLQJJD,EHUDGDSDGDWLWLNDVDOGDQ,-EHUDGD
SDGDVXPEX[7LWLNNRRUGLQDW,-GDQ/GLNHWDKXL7HQWXNDQNRRUGLQDWWLWLN.GDODPYDULDEHO
DEGDQF$SDNDK,/GDQ-.VHMDMDU"-HODVNDQEDJDLPDQDNDOLDQPHQJHWDKXLQ\D
\

, 

[
- D

ht

tp

://

/ EF

3HUVHJLSDQMDQJ$%&'PHPLOLNLSDQMDQJ$% VDWXDQGDQ$' VDWXDQ7HQWXNDQWLWLN


WLWLNNRRUGLQDWSHUVHJLSDQMDQJXQWXNVHWLDSV\DUDWEHULNXW
D$%EHUDGDSDGDVXPEX[GDQVXPEX\DGDODKVXPEXVLPHWULQ\D
EVXPEX[GDQVXPEX\DGDODKVXPEXVLPHWULQ\D



.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

31

7XJDV
3URMHN

 %HQWXNODKNHORPSRN\DQJWHUGLULGDULVLVZD
 &DULODK SHWD NRWD \DQJ GLOHQJNDSL GHQJDQ GHQDK SHUXPDKDQ \DQJ GLDQWDUDQ\D UXPDK
WHPSDWLEDGDKVHNRODKSXVNHVPDVSRVNDPOLQJWRNRODSDQJDQUXPDKNHWXD57GDQODLQ
ODLQ7HQWXNDQVXDWXREMHNWLWLNDVDO  
 %XDWODKVRDOGDQNXQFLQ\DWHQWDQJSRVLVLVXDWXREMHNWHUKDGDSWLWLNDVDO  GDQSRVLVL
REMHNWHUWHQWX DE WHUKDGDSSXVNHVPDVWHPSDWLEDGDKGDQVHNRODK

 &REDNHUMDNDQVRDO\DQJEHUDVDOGDULNHORPSRNODLQ

.id

 %HULNDQVRDONHSDGDNHORPSRNODLQGDQNDOLDQMXJDDNDQPHQHULPDVRDOGDULNHORPSRNODLQ
MXJD

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 -DZDEDQGDULNHORPSRNNDOLDQGDQNXQFLMDZDEDQGDULNHORPSRNDZDO \DQJPHPEXDWVRDO 


GLSDMDQJEHUMDMDUGLWHPSDWWHUWHQWX
 0LQWDODK NHORPSRN NHWLJD  XQWXN PHPHULNVD GDQ PHPEDQGLQJNDQ GXD MDZDEDQ WHUVHEXW
GDQPHPEHULNDQNRPHQWDUWHQWDQJNHGXDMDZDEDQWHUVHEXW
 %HULWDKXNDQNHSDGDNHORPSRNWHQWDQJSUHVHQWDVLSURMHN

0HUDQJNXP

3HQJDODPDQ EHODMDU WHQWDQJ ELGDQJ NRRUGLQDW  WHODK NDOLDQ ODOXL 6HNDUDQJ FRED MDZDEODK
EHEHUDSDSHUWDQ\DDQGLEDZDKLQL
 %DJDLPDQDFDUDNDOLDQPHQHQWXNDQMDUDNWLWLNWHUWHQWX DE GDULVXPEX[GDQVXPEX\
SDGDELGDQJNRRUGLQDW"

://

 -LNDVXDWXJDULVVHMDMDUGHQJDQVXPEX[EDJDLPDQDSRVLVLJDULVWHUVHEXWWHUKDGDSVXPEX\"

tp

 -LND VXDWX JDULV WHJDN OXUXV GHQJDQ VXPEX[ EDJDLPDQD SRVLVL JDULV WHUVHEXW WHUKDGDS
VXPEX\"

ht

 -LNDVXDWXJDULVPHPRWRQJWLGDNWHJDNOXUXVVXPEX[EDJDLPDQDSHUSRWRQJDQJDULVLWX
GHQJDQVXPEX\"

0$7(0$7,.$

32

Buku Guru Kelas VIII SMP/MTs



Semester 1

Penjelasan Tugas Projek 1

Tugas
Projek

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

1. Pembelajaran projek memerlukan waktu seminggu untuk menyelesaikannya.


2. Siapkan buku-buku matematika di perpustakaan agar siswa tidak mengalami ke
sulitan untuk mencari buku tersebut.
3. Buatlah alur kerja yang sistematis, sehingga siswa bekerja sesuai dengan alur yang
sudah ditentukan, namun tetap memperhatikan kreativitas siswa.
4. Identifikasi kembali siswa-siswa yang masih belum mencapai ketuntasan dalam
belajar, untuk dilakukan pembelajaran remidi dan pengayaan.
5. Pada saat pembelajaran projek, mencari informasi dan referensi di perpustakaan
dan dilaksanakan selama 2 jam pelajaran.
6. Pastikan setiap siswa dalam kelompok mempunyai peran masing-masing yang
saling mendukung.
7. Siswa diminta membuat laporan tertulis dan dikumpulkan minggu depan.
8. Berilah petunjuk yang jelas tentang sistematika laporan.

Alternatif Merangkum 1

Merangkum

ht

tp

://

Minta siswa untuk menjawab pertanyaan-pertanyaan untuk merangkum bab ini. Beri
penguatan kepada siswa tentang pembelajaran yang dilakukan sebelumnya.
1. Jika suatu titik memiliki koordinat (a, b), maka a adalah jarak titik tersebut dari
sumbu-y dan b adalah jarak titik tersebut dari sumbu-x.
2. Jika suatu titik memiliki koordinat (a, b), maka a adalah jarak titik tersebut dari
sumbu-y `dan b adalah jarak titik tersebut dari sumbu-x. Jika berada di kuadran I
maka a dan b positif, jika di kuadran II, nilai a negatif dan b positif, jika di kuadran III nilai a dan b negatif, dan jika di kuadran IV, nilai a positif dan b negatif.
3. Titik tertentu (x, y) dipandang sebagai titik asal O(0, 0), sehingga
untuk menentukan posisi titik tertentu (a, b) sama dengan menentukan posisi
titik tersebut terhadap titik asal O(0, 0).
4. Jika suatu garis sejajar dengan sumbu-x, pasti garis tersebut tegak lurus terhadap
sumbu-y.
5. Jika suatu garis sejajar dengan sumbu-y, pasti garis tersebut tegak lurus terhadap
sumbu-x.
6. Jika suatu garis memotong tidak tegak lurus terhadap sumbu-x, pasti garis tersebut akan memotong tidak tegak lurus terhadap sumbu-y.

MATEMATIKA

33

"

8ML
.RPSHWHQVL

 *DPEDUODKWLWLN$  %  &  GDQ'  SDGDNRRUGLQDW.DUWHVLXV


D 7HQWXNDQWLWLNWLWLN\DQJEHUDGDSDGDNXDGUDQ,,,,,,GDQ,9

E 7HQWXNDQMDUDNVHWLDSWLWLNGHQJDQVXPEX[

F 7HQWXNDQMDUDNVHWLDSWLWLNGHQJDQVXPEX\

 *DPEDUODKWLWLN$  %  &  GDQ'  SDGDNRRUGLQDW.DUWHVLXV
D 7HQWXNDQMDUDNVHWLDSWLWLNGHQJDQVXPEX[

E 7HQWXNDQMDUDNVHWLDSWLWLNGHQJDQVXPEX\

F 7HQWXNDQMDUDNDQWDUDWLWLN$GHQJDQWLWLN%

G 7HQWXNDQMDUDNDQWDUDWLWLN&GHQJDQWLWLN'

.id

 *DPEDUODKWLWLNSDGDELGDQJNRRUGLQDW\DQJEHUMDUDNVDPDWHUKDGDSWLWLN$ 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 $GDEHUDSDWLWLN\DQJEHUMDUDNGDULVXPEX[GDQGDULVXPEX\"7XQMXNNDQ

 *DPEDUODKJDULVOPHODOXLWLWLN3  \DQJVHMDMDUGHQJDQVXPEX[GDQWHJDNOXUXVGHQJDQ


VXPEX\

 *DPEDUODKJDULVPPHODOXLWLWLN4  \DQJWLGDNVHMDMDUGHQJDQVXPEX[GDQVXPEX\


 *DPEDUODKJDULVW\DQJPHODOXLWLWLN'  \DQJWLGDNWHJDNOXUXVWHUKDGDSVXPEX[GDQ
WLGDNWHJDNOXUXVWHUKDGDSVXPEX\
 *DPEDUODKJDULVK\DQJPHODOXLWLWLN3  \DQJWLGDNVHMDMDUGHQJDQVXPEX\GDQWLGDN
VHMDMDUGHQJDQVXPEX[

 *DPEDUODKWLWLN\DQJPHPLOLNLMDUDN\DQJVDPDWHUKDGDSJDULV\DQJPHODOXLWLWLN$  


GDQ%  GDQWHQWXNDQNRRUGLQDWGDULNHHPSDWWLWLNWHUVHEXW
 *DPEDUODKJDULV\DQJEHUSRWRQJDQGHQJDQVXPEX[GDQVXPEX\GDQPHODOXLWLWLN4 
 -LND JDULV N VHMDMDU GHQJDQ JDULV P GDQ NHGXDQ\D WHJDN OXUXV WHUKDGDS VXPEX\ DSDNDK
NHGXDJDULVWHUVHEXWPHPLOLNLMDUDN\DQJVDPDGHQJDQVXPEX["-HODVNDQMDZDEDQPX"

 *DPEDUODKGXDJDULV\DQJVDOLQJWHJDNOXUXVWDSLWLGDNVHMDMDUGHQJDQVXPEX[GDQVXPEX\
.HPXGLDQ KXEXQJNDQ EHEHUDSD WLWLN \DQJ PHODOXL NHGXD JDULV WHUVHEXW GDQ PHPEHQWXN
EDQJXQGDWDU$GDEHUDSDEDQ\DNEDQJXQGDWDU\DQJNDOLDQWHPXNDQ"

://

'XDEXDKWLWLNNRRUGLQDWVXDWXEDQJXQDGDODK  GDQ  


D 7HQWXNDQWLWLNNRRUGLQDWNHWLJD\DQJEHUDGDGLDWDVVXPEX[VXSD\DPHPEHQWXNVHJLWLJD
VDPDVLVL
E 7HQWXNDQ GXD WLWLN NRRUGLQDW ODLQ \DQJ EHUDGD GL DWDV VXPEX[ VXSD\D PHPEHQWXN
SHUVHJL

ht

tp

'LNHWDKXLVHJLWLJDVDPDNDNL;<=GHQJDQ;< <=;= VDWXDQGDQJDULVWLQJJLGDUL<PHPLOLNL


SDQMDQJVDWXDQ7HQWXNDQWLWLNWLWLNNRRUGLQDWVHJLWLJD;<=XQWXNVHWLDSV\DUDWEHULNXW



D ;EHUDGDSDGDWLWLNDVDO;=EHUDGDGLVXPEX[GDQ<EHUDGDGLNXDGUDQ,
E ;= EHUDGD GL VXPEX[ VXPEX\ DGDODK JDULV VLPHWUL GDQ NRRUGLQDW \ WLWLN < DGDODK
SRVLWLI

.HODV9,,,60307V

6HPHVWHU

Minta siswa untuk menyelesaikan


soal-soal pada Uji Kompetensi 1
34

Buku Guru Kelas VIII SMP/MTs

Semester 1

=+

SoalPengayaan

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

1. Gambarlah titik A(2, -3), B(-4, 5), C(3, 6), dan D(-4,-6) pada bidang koordinat.
Penyelesaian.

ht

tp

://

2. Gambarlah garis l yang melalui titik B(-4, -1) dan tegak lurus sumbu y.
3. Gambarlah garis m yang melalui titik C(3, -5) dan tegak lurus sumbu x .
4. Gambarlah garis n yang melalui titik D(-2, 5) yang tidak tegak lurus terhadap sumbu
x dan tidak tegak lurus terhadap sumbu y.
5. Gambarlah titik yang melalui titik A(4, -3) dan melalui titik B(4, 3), apakah garis
tersebut sejajar atau tegak lurus terhadap sumbu x? Jelaskan jawabanmu.
6. Gambarlah titik A(2, 1), B(2, 5), C(4, 1), dan D(4, 5), pada koordinat kartesius dan
bila 4 titik dihubungkan bangun apakah yang terbentuk?.
Penyelesaian.

7. Gambarlah 4 titik K, L, M, dan N yang berjarak sama terhadap titik asal O(0, 0).
8. Gambarlah 4 titik P, Q, R, S yang berjarak sama terhadap titik A(2, 3).
9. Gambarlah garis k yang melalui titik A(3, 5) dan tegak lurus sumbu x.

MATEMATIKA

35

.id

10. Gambarlah garis m yang melalui titik B(4, 3) dan tegak lurus terhadap garis yang
melalui titik P(3, 2) dan Q(2, 5).

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

11. Gambarlah 4 titik yang memiliki jarak yang sama terhadap garis yang melalui titik
A(3, 5) dan tegak lurus terhadap sumbu y, dan tentukan koordinat dari keempat titik
tersebut.
12. Gambarlah 4 titik yang memiliki jarak yang sama terhadap garis yang melalui titik
A(5, 3) dan B(3, 5) dan tentukan koordinat dari keempat titik tersebut.
13. Gambarlah garis k yang tegak lurus terhadap garis m yang melalui titik A(4, 5) dan
B(5, 4).
14. Gambarlah titik A(6, 5), B( 6, 6), C(5, 6), dan D(3, 4) pada bidang koordinat.

a. Coba hubungkan keempat titik tersebut, apa yang terjadi?

b. Coba gambar kembali keempat titik itu dengan syarat semua titik koordinat-x-nya
dikurangi 2 dan koordinat-y-nya ditambah 2.

ht

tp

://

15. Gambarlah titik A(2, 3), B(4, 3), C(1, 2), dan D(5, 2).
a. Hubungkan keempat titik itu dan bangun apa yang terbentuk?
b. Jika koordinat x titik A ditambah 3 dan koordinat y titik A ditambah 1,
koordinat x titik B dikurangi 3 dan koordinat y titik B ditambah 2, titik C
koordinat x ditambah 2 dan koordinat y dikurangi 2, dan titik D koordinat x di
kurangi 4 dan koordinat y ditambah 1 maka akan ada 4 titik baru, jikake 4 titik
dihubungkan bangun apakah yang terbentuk?.
16. Diketahui titik-titik pada koordinat di samping ini
Gambarlah titik sebanyak-banyakya yang
berjarak sama terhadap titik A dan B

36

Buku Guru Kelas VIII SMP/MTs

Semester 1

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

17. Gambarlah garis sebanyak-banyaknya pada koordinat kartesius yang memiliki jarak
yang sama terhadap titik P(4, 5) dan tegak lurus terhadap sumbu x.

ht

tp

://

18. Gambarlah 3 garis yang berpotongan dengan sumbu x dan sumbu y dan melalui titik
Q (3, 5).

19. Gambarlah garis l yang melalui titik K (6, 3) dan tegak lurus dengan sumbu x, apakah
garis tersebut sejajar dengan sumbu y? Mengapa? Jelaskan alasanmu.
20. Jika garis k sejajar dengan garis m, dan keduanya tegak lurus terhadap sumbu y, apakah kedua garis tersebut memiliki jarak yang sama dengan sumbu x? Jelaskan
jawabanmu.

MATEMATIKA

37

Pedoman
Penilaian
No
1

Capaian
B

Keterangan
Bila Buku Siswa terselesaikan dengan baik

<B

Bila ada bagian dari Buku Siswa yang tidak


terselesaikan

Portofolio:
a) Uji Kompetensi
b) Soal dari tempat
lain

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan mampu menyelesaikannya dengan
baik

.id

Aspek Penilaian
Keterselesaian Buku
Siswa

Bila memilih soal dari Uji Kompetensi dengan


kategori Sedang dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Mudah dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan kurang mampu
menyelesaikannya dengan baik

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o
B+

B , B
B+, B,
B

Bila memilih soal dari Uji Kompetensi


A, B+ , dengan kategori Mudah dan kurang mampu
B, B menyelesaikannya dengan baik
Bila Proyek terselesaikan dan manpu
A
mempresentasikan dengan Baik
A, B+, Bila ada bagian dari Proyek yang tidak terselesaikan
atau kurang mampu mempresentasikan
B

://

ht

tp

Tugas Projek

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan kurang mampu menyelesaikannya
dengan baik
Bila memilih soal dari Uji Kompetensi
dengan kategori Sedang dan kurang mampu
menyelesaikannya dengan baik

Bila Proyek tidak terselesaikan samasekali

Keterangan: - Nilai KKM = B




38

- Aspek penilaian Nomor 1 adalah syarat nilai yang


harus terpenuhi, sedangkan Aspek penilaian Nomor 2
adalah penambahan nilai.

Buku Guru Kelas VIII SMP/MTs

Semester 1

Bab 2

Operasi Aljabar
Kata Kunci

.id

Koesien
Variabel
Konstanta
Suku
Suku sejenis

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

K ompetensi
D asar

Menerapkan operasi aljabar


yang melibatkan bilangan
rasional

Pengalaman
Belajar

Pak Idris mempunyai kebun apel berbentuk persegi dan


Pak Halim mempunyai kebun semangka berbentuk persegi
panjang. Ukuran panjang kebun semangka Pak Halim 10 m
lebihnya dari panjang sisi kebun apel Pak Idris. Sedangkan
lebarnya, 3 lebihnya dari panjang sisi kebun apel Pak Idris.
Jika diketauhi luas kebun Pak Halim adalah 450 m2, Tentukan
luas kebun apel Pak Idris?
Permasalahan di atas dapat diselesaikan dengan model
matematika yang dinyatakan dalam bentuk aljabar.

tp

://

1. Menerapkan operasi
aljabar yang melibatkan
bilangan rasional pada
masalah yang berbentuk simbolik.

ht

2. Menerapkan operasi aljabar yang melibatkan bilangan rasional pada masalah


yang berbentuk verbal.

MATEMATIKA
33
MATEMATIKA

39

Peta
Konsep

.id

Operasi
Aljabar

Bentuk Verbal

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Bentuk Simbolik

Pengurangan

Perkalian

Pembagian

Penyederhanaan
Bentuk Aljabar

ht

tp

://

Penjumlahan

40

KelasKelas
VIII SMP/MTs
34 Guru
Buku
VIII SMP/MTs

Semester
1 1
Semester

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Muhammad bin Musa al-Khawarizmi


biasa disebut Al-Khawaritzmi adalah
seorang ahli matematika, astronomi,
astrologi. Beliau lahir sekitar tahun 780
Masehi di Khwarizm (sekarang Khiva,
Uzbekistan) dan wafat sekitar tahun
850 Masehi di Baghdad Irak. Selama
hidupnya, Al-Khawarizmi bekerja
sebagai dosen di Sekolah Kehormatan
di Baghdad, yang didirikan oleh
Khalifah Bani Abbasiyah Al-Ma'mun,
tempat beliau belajar ilmu alam dan
matematika, termasuk mempelajari
terjemahan manuskrip Sanskerta dan
Yunani..
Kontribusi Al-Khawarizmi tidak hanya
berdampak pada matematika saja, tetapi
juga dalam kebahasaan. Kata algoritma
diambil dari kata Algorismi, pelatinan
Muhammad bin
dari nama Al-Khawarizmi. Nama AlMusa al-Khawarizmi
Khawarizmi juga di serap dalam bahasa
(780 - 850)
Spanyol Guarismo dan dalam bahasa
Portugis, Algarismo yang berarti
digit. Di Inggris menggunakan istilah algoritm, sedangkan di Spanyol guarismo, dan
algarismo di Portugal.

tp

://

Kata Aljabar berasal dari kata al-Jabr, satu dari dua operasi dalam matematika untuk
menyelesaikan notasi kuadrat, yang tercantum dalam buku beliau yang berjudul alKitab al-mukhtasar hisab al-jabr wa'l-muqabala atau "Buku Rangkuman untuk
Kalkulasi dengan Melengkapakan dan Menyeimbangkan yang ditulis pada tahun 820
Masehi. Buku pertama Al-Khawarizmi yang kemudian diterjemahkan ke dalam bahasa
Latin dikenal sebagai Liber algebrae et almucabala oleh Robert dari Chester (Segovia,
1145) dan juga oleh Gerardus dari Cremona pada abad ke-12.
Karena pengaruhnya yang besar di bidang aljabar, Al Khawarizmi dijuluki sebagai
Bapak Aljabar. Namun, julukan itu diberikan pula pada Diophantus, seorang ilmuwan
dari Yunani kuno. Al-Khawarizmi diperkirakan meninggal sekitar 850 Masehi. Namun,
karya-karya besarnya masih terus berkembang dan banyak dipelajari hingga saat ini.

ht

Tauladan yang bisa diambil dari seorang Al Khawarizmi antara lain:


1. Memiliki rasa ingin tahu yang tinggi tentang ilmu pengetahuan, sehingga bisa
menemukan karya-karya yang dikenal dan bermanfaat bagi banyak orang.
2. Masalah yang rumit bisa diselesaikan asalkan kita mau berusahan dengan sungguhsungguh. Seperti Al Khawarizmi yang memecahkan masalah aljabar dengan
menyederhanakannya.
Meskipun beliau sudah meninggal, namun karya-karya beliau, khususnya tentang
aljabar masih dikenal hingga saat ini. Apakah itu aljabar? Untuk mempelajari lebih
lanjut tentang materi aljabar, ikuti kegiatan pemebelajaran berikut.

MATEMATIKA
35
41

41

Membelajarkan 2.1

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Mengenal Bentuk Aljabar

ht

tp

://

1. Ingatkan kembali tentang macam-macam bilangan:


bilangan bulat, bilangan asli, bilangan cacah,
bilangan prima, dan lain lain
2. Bentuklah kelompok-kelompok kecil siswa (3 4
orang) yang memungkinkan belajar secara efektif
3. Sediakan beberapa bola kecil atau lainnya, kotak, dan
tabung (jika ada). Benda-benda ini digunakan pada
saat kegiatan Ayo Kita Amati
4. Sediakan juga gelas dan keranjang atau lainnya.
Benda-benda ini digunakan pada saat kegiatan Ayo
kita Menalar
5. Pancinglah para siswa untuk membuat/mengajukan
pertanyaan tentang barang/benda yang disedian oleh
Guru
6. Perhatikan siswa yang kurang aktif dalam membuat/
mengajkan pertayaan, kemudian berilah motivasi
untuk mereka agar ikut berperan aktif

42

Buku Guru Kelas VIII SMP/MTs

Semester 1

Apersepsi
2SHUDVL%HQWXN
$OMDEDU

.HJLDWDQ 

0HQJHQDO%HQWXN$OMDEDU

.id

%X<HVVLPHPSXQ\DLVHNHUDQMDQJDSHO.DUHQDKDWLQ\DVHGDQJ
EDKDJLD%X<HVVLLQJLQPHPEDJLNDQDSHO\DQJEHOLDXPLOLNL
WHUVHEXW NHSDGD VHWLDS RUDQJ \DQJ EHOLDX WHPXL 6HWHQJDK
NHUDQMDQJGLWDPEDKVDWXDSHOXQWXNRUDQJSHUWDPD.HPXGLDQ
VHWHQJDK GDUL VLVDQ\D GLWDPEDK VDWX GL EHULNDQ NHSDGD RUDQJ
NHGXD \DQJ EHOLDX WHPXL 6HODQMXWQ\D VHWHQJDK GDUL VLVDQ\D
GLWDPEDK VDWX GLEHULNDQ NHSDGD RUDQJ NHWLJD \DQJ EHOLDX
WHPXL 6HNDUDQJ %X <HVVL KDQ\D PHPLOLNL VDWX DSHO XQWXN
EHOLDXPDNDQVHQGLUL7HQWXNDQEHUDSDNDKEDQ\DNDSHOVHPXOD

1. Berikan motivasi
pengantar kepada siswa
untuk mempelajari
aljabar. Contohnya
tentang masalah apel
yang ada di buku siswa.
2. Untuk selanjutnya,
masalah apel ini bisa
dijadikan projek setelah
siswa mendapatkan
pemahaman tentang
operasi bentuk aljabar.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.DOLDQ PXQJNLQ ELVD PHPHFDKNDQ SHUPDVDODKDQ WHUVHEXW


GHQJDQ FDUD PHQFREDFRED GHQJDQ VXDWX ELODQJDQ 1DPXQ
EHUDSD ELODQJDQ \DQJ KDUXV NDOLDQ FRED WLGDN MHODV &DUD
WHUVHEXWWHUODOXODPDWLGDNHIHNWLIGDQWHUNHVDQNHEHWXODQ

.DOLDQ ELVD PHPHFDKNDQ SHUVRDODQ WHUVHEXW GHQJDQ FDUD


PHPLVDONDQEDQ\DNDSHOPXODPXODGDODPNHUDQMDQJGHQJDQ
*DPEDU6HNHUDQMDQJ$SHO
VXDWXVLPERO/DOXNDOLDQELVDPHPEXDWEHQWXNPDWHPDWLVQ\D
XQWXN PHPHFDKNDQ SHUPDVDODKDQ WHUVHEXW %HQWXN WHUVHEXW XQWXN VHODQMXWQ\D GLVHEXW GHQJDQ
EHQWXNDOMDEDUGDQRSHUDVL\DQJGLJXQDNDQXQWXNPHPHFDKNDQGLVHEXWRSHUDVLDOMDEDU8QWXNOHELK
PHQJHQDOWHQWDQJEHQWXNGDQRSHUDVLDOMDEDUPDULPHQJLNXWLSHPEDKDVDQEHULNXW
$\R
.LWD$PDWL
0DVDODK 

6XDWXNHWLNDWHUMDGLSHUFDNDSDQDQWDUD3DN$JXVGDQ3DN%XGL0HUHNDEHUGXDEDUXVDMDPHPEHOL
EXNXGLVXDWXWRNRJURVLU
3DN$JXV 3DN%XGLNHOLKDWDQQ\DEHOLEXNXWXOLVEDQ\DNVHNDOL

3DN%XGL ,\D3DN,QLSHVDQDQGDULVHNRODKVD\D6D\DEHOLGXDNDUGXVGDQEXNX3DN$JXVEHOL
DSDVDMD"
3DN$JXV 6D\DKDQ\DEHOLEXNXVDMD3DNXQWXNDQDNVD\D\DQJNHODV9,,,603

tp

.HODV9,,,60307V

ht



://

'DODPSHUFDNDSDQWHUVHEXWWHUOLKDWGXDRUDQJ\DQJ\DQJPHQ\DWDNDQEDQ\DNEXNXGHQJDQVDWXDQ
\DQJEHUEHGD3DN$JXVPHQ\DWDNDQMXPODKEXNXGDODPVDWXDQNDUGXVVHGDQJNDQ3DN%XGLODQJVXQJ
PHQ\HEXWNDQEDQ\DNEXNX\DQJLDEHOLGDODPVDWXDQEXNX

6HPHVWHU

Ayo
Kita Amati
1. Minta siswa untuk
mengamati permasalahan
yang yang ada di buku
siswa. Tujuannya adalah
siswa mampu memahami
bagaimana menyajikan
permasalahan tentang
pembelian buku menjadi
bentuk aljabar.
MATEMATIKA

43

Ajak siswa untuk memahami makna simbol x dan


simbol y pada bentuk aljabar yang disajikan pada
Tabel 2.1.

$OWHUQDWLI3HPHFDKDQ0DVDODK
$OWHUQDWLISHPHFDKDQPDVDODKGLVDMLNDQGDODP7DEHOEHULNXW
7DEHO%HQWXNDOMDEDUGDULPDVDODKVHKDULKDUL
3HPEHOL

3DN%XGL

3DN$JXV

.DUGXVEXNXGDQ%XNX

%XNX

%HQWXN$OMDEDU

[

3DGD7DEHO[PHQ\DWDNDQEDQ\DNEXNX\DQJDGDGDODPNDUGXV

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Ajak siswa untuk memahami tentang nilai bentuk


aljabar dengan mensubtitusi variabel x dengan suatu
bilangan.

.id

0HPEHOL

6LPERO[ELVDPHZDNLOLVHEDUDQJELODQJDQ

-LND[ PDND[   


-LND[ PDND[   
-LND[ PDND[   
-LND[ PDND[   

-LND[ PDND[   

1LODLEHQWXNDOMDEDUGLDWDVEHUJDQWXQJSDGDQLODL['DODPNRQWHNVGLDWDV[PHQ\DWDNDQEDQ\DN
EXNXGDODPVDWXNDUGXV
%HQWXNDOMDEDUGDODP7DEHO[PHQ\DWDNDQEDQ\DNEXNX\DQJDGDGDODPNDUGXV
6HDQGDLQ\D3DN$JXVPHPEHOLODJLNDUGXVEXNX%DJDLPDQDNDKEHQWXNDOMDEDUQ\D"

'L VHNLWDU NLWD MXJD EDQ\DN RUDQJ PHQ\DWDNDQ EDQ\DN VXDWX EHQGD GHQJDQ EXNDQ VDWXDQ EHQGD
WHUVHEXWWHWDSLPHQJJXQDNDQVDWXDQNXPSXODQGDULMXPODKEHQGDWHUVHEXW0LVDOVDWXNDUXQJEHUDV
VDWX NHUDQMDQJ DSHO VDWX NHUDQMDQJ MHUXN GDQ ODLQODLQ 8QWXN OHELK PHPDKDPL EHQWXNEHQWXN
DOMDEDUPDULNLWDDPDWLEHQWXNEHQWXNDOMDEDU7DEHO
'DODPVXDWXNRWDNWHUGDSDWVHNLDQERODVHGDQJNDQGDODPVXDWXWDEXQJWHUGDSDWVHNLDQERODGDODP
MXPODK\DQJODLQ
[PHQ\DWDNDQEDQ\DNERODGDODPVDWXNRWDN

\PHQ\DWDNDQEDQ\DNERODGDODPVDWXWDEXQJ
7LDSNRWDNEHULVLERODGHQJDQMXPODKVDPD

://

Berikan pertanyaan
kepada siswa untuk menguji pemahaman siswa
tentang bentuk aljabar
(lanjutan dari konteks kardus buku dan buku). Misal
Seandainya Pak Agus
membeli lagi 4 kardus
buku. Bagaimana bentuk
aljabarnya?

ht

tp

7LDSWDEXQJEHULVLERODGHQJDQMXPODKVDPD

0$7(0$7,.$

Ayo
Kita Amati

1. Minta siswa untuk mengamati Tabel 2.1 di buku


siswa. Tujuannya mengenalkan beberapa bentuk
aljabar tentang jumlah bola.
2. Asumsi yang perlu disepakati di awal adalah,
jumlah bola pada setiap kotak adalah sama, dan
jumlah bola dalam setiap tabung adalah sama.
44

Buku Guru Kelas VIII SMP/MTs

Semester 1



*DPEDU

%HQWXN$OMDEDU

.HWHUDQJDQ

EROD

NRWDNEROD

[[
$WDX
[

NRWDNEROD

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

1R

.id

7DEHO%HQWXN$OMDEDU

NRWDNERODGDQ
EROD

[\

NRWDNEROD
WDEXQJERODGDQ
EROD

.HODV9,,,60307V

ht



tp

://

[

6HPHVWHU

Ajak siswa untuk memahami bentuk aljabar


yang disajikan pada Tabel 2.2 buku siswa.
Tekankan kepada siswa makna variabel x dan y
yang dimaksud.
x menyatakan banyak bola dalam satu kotak
y menyatakan banyak bola dalam satu tabung
Tiap kotak berisi bola dengan jumlah sama
Tiap tabung berisi bola dengan jumlah sama

MATEMATIKA

45





D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

0XQJNLQNDKNLWDPHPEXDWJDPEDU\DQJPHQ\DWDNDQ["

Ayo Kita
Menanya

"

$\R.LWD
0HQDQ\D

%XDWODKSHUWDQ\DDQ\DQJEHUNDLWDQGHQJDQEHQWXNDOMDEDU\DQJGLVDMLNDQSDGDNHJLDWDQPHQJDPDWL
&RQWRKSHUWDQ\DDQ
$SDNDKVLPERO YDULDEHO \DQJEROHKGLJXQDNDQKDQ\D[GDQ\"
%HUDSDNDKQLODL[GDQ\\DQJELVDGLVXEWLWXVLNDQSDGDEHQWXNDOMDEDUVRDOGLDWDV"

0$7(0$7,.$

ht

tp

://

Minta siswa untuk


menuliskan pertanyaan
tentang hal yang masih
belum dipahami dari
kegiatan pengamatan.
Contoh:
Bagaimana bentuk
aljabarnya ketika bolabola tersebut berada
didalam kotak atau
tabung?

3DN7RKLUPHPLOLNLGXDMHQLVKHZDQWHUQDN\DLWXVDSLGDQD\DP%DQ\DNQ\DVDSLGDQD\DP\DQJ
GLPLOLNL3DN7RKLUVHFDUDEHUWXUXWWXUXWDGDODKVDSLGDQD\DP6HOXUXKVDSLGDQD\DP
WHUVHEXWDNDQGLMXDONHSDGDVHRUDQJSHGDJDQJWHUQDN-LNDKDUJDVDWXVDSLGLQ\DWDNDQGHQJDQ
[UXSLDKGDQKDUJDVDWXD\DPGLQ\DWDNDQGHQJDQ\UXSLDKWXOLVNDQEHQWXNDOMDEDUKDUJDKHZDQ
WHUQDN3DN7RKLU

Contoh pertanyaan:
Apakah simbol x dan y pada Tabel 2.2 bisa diganti
dengan massa bola?
Mengapa harus disepakati di dalam kotak maupun
tabung harus berisi bola dalam
jumlah yang sama?

46

Buku Guru Kelas VIII SMP/MTs

Semester 1



$\R.LWD
0HQJJDOL,QIRUPDVL

=+

[

6XNX

6XNX

[
.RHVLHQ

9DULDEHO


.RQVWDQWD

$\R.LWD
0HQDODU

3DGDNHJLDWDQSHQJDPDWDQNLWDPHQJJXQDNDQYDULDEHO[XQWXNPHQ\DWDNDQEDQ\DNERODGDODPNRWDN
GDQYDULDEHO\XQWXNPHQ\DWDNDQEDQ\DNERODGDODPWDEXQJ$QGDLNDQERODGDQWDEXQJWHUVHEXWWLGDN
PHPLOLNLPDVVD1\DWDNDQEHQWXNDOMDEDUGDULNHVHWLPEDQJDQEHULNXW
8QWXN QRPRU   GDQ   NRWDN EROD \DQJ GLPDNVXG DGDODK NRWDN \DQJ EHULVL EROD 6HGDQJNDQ
WDEXQJERODEHUPDNQDWDEXQJ\DQJEHULVLEROD
  /HQJNDSLODK *DPEDU E %HUGDVDUNDQ LQIRUPDVL \DQJ NDOLDQ GDSDWNDQ GDUL *DPEDU D
EXDWODKVNHWVDERODDJDUVHWLPEDQJGHQJDQGHQJDQPDVVDGXDNRWDNEROD-HODVNDQSURVHGXUPX

"

*DPEDU6NHWVDNHVHWLPEDQJDQERODGDQNRWDN

6HPHVWHU

tp

://

.HODV9,,,60307V

ht




Suku adalah bagian dari
bentuk aljabar yang
dipisahkan oleh tanda
tambah atau kurang

Koefisien adalah faktor
konstan pada suatu suku

Variabel adalah suatu
simbol yang mewakili
suatu nilai tertentu

Konstanta suku pada
bentuk aljabar yang
berupa bilangan/nilai
tertentu.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

'DULLOXVWUDVLWHUVHEXWXQJNDSNDQGHQJDQEDKDVDPX MDQJDQWDNXWVDODK $SDNDK\DQJGLPDNVXG


GHQJDQ
D .RHVLHQ"
E 9DULDEHO"
F .RQVWDQWD"

Minta siswa untuk


memahami sedikit
informasi. Tujuan
informasi tersebut
untuk memperkenalkan
klasifikasi bentuk aljabar
berdasakan sukunya, suku.
koefisien, variabel, dan
konstanta.

.id

'DODP NHJLDWDQ SHQJDPDWDQ NDOLDQ WHODK PHQJDPDWL EHEHUDSD LOXVWUDVL EHQWXNEHQWXN DOMDEDU
-XPODKEXNXGLQ\DWDNDQGHQJDQVLPERO[GDQ\%HQWXNEHQWXNWHUVHEXWGLQDPDNDQEHQWXNDOMDEDU
.DOLDQEROHKPHQJJXQDNDQVLPERO\DQJODLQXQWXNPHQ\DWDNDQEHQWXNDOMDEDU
3DGDNHJLDWDQSHQJDPDWDQNLWDPHQJHQDOEHEHUDSDEHQWXNDOMDEDUVHSHUWL[[[[\
%HQWXNEHQWXN\DQJGLSLVDKNDQROHKWDQGDSHQMXPODKDQGLVHEXWGHQJDQVXNX%HULNXWQDPDQDPD
EHQWXNDOMDEDUEHUGDVDUNDQEDQ\DNQ\DVXNX
 [GDQ[GLVHEXWVXNXVDWXDWDXPRQRPLDO
 [GLVHEXWVXNXGXDDWDXELQRPLDO
 [\GLVHEXWVXNXWLJDDWDXWULQRPLDO
 8QWXNEHQWXNDOMDEDU\DQJWHUVXVXQDWDVOHELKGDULWLJDVXNXGLQDPDNDQSROLQRPLDO
3DGDEHQWXN[ELODQJDQGLVHEXWNRHVLHQ[GLVHEXWYDULDEHOVHGDQJNDQGLVHEXWGHQJDQ
NRQVWDQWD

Menggali
Informasi

Ayo Kita
Menalar

Minta siswa untuk


menyelesaikan
permasalahan yang
disajikan dalam kegiatan
menalar. Dalam
memecahkan masalah,
siswa diminta untuk
membuat bentuk aljabar
dari permasalahan.
Misal :
x = Banyak bola dalam
kotak
y = Banyak bola dalam
tabung
Asumsi massa kotak
saat kosong tidak
mempengaruhi
kesetimbangan massa setiap
bola sama.
x = 9 dan y = 16.
MATEMATIKA

47

  'DULLQIRUPDVL\DQJNDOLDQGDSDWNDQGDULQRPRU  GDQDEXDWODKVNHWVDERODGDQNRWDNDJDU
VHWLPEDQJGHQJDQGHQJDQPDVVDGXDWDEXQJEROD-HODVNDQSURVHGXUNDOLDQ

"

*DPEDU6NHWVDNHVHWLPEDQJDQERODWDEXQJGDQNRWDN

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

"

.id

  'DULLQIRUPDVL\DQJNDOLDQGDSDWNDQGDULQRPRU  GDQ  EXDWODKVNHWVDERODDJDUVHWLPEDQJ


GHQJDQGHQJDQPDVVDVDWXWDEXQJGDQVDWXNRWDN-HODVNDQSURVHGXUNDOLDQ

*DPEDU6NHWVDNHVHWLPEDQJDQERODWDEXQJGDQNRWDN

$\R.LWD
%HUEDJL

ht

tp

://

6HWHODKVHOHVDLPHQMDZDEEDQGLQJNDQMDZDEDQWHUVHEXWGHQJDQMDZDEDQWHPDQVHEDQJNX3HULNVD
DSDNDKSHUPDVDODKDQGDQMDZDEDQ\DQJGLWHPXNDQVXGDKEHQDU

0$7(0$7,.$

Ayo Kita
Berbagi

Minta siswa untuk


menyajikan jawabannya
di depan kelas.
48

Buku Guru Kelas VIII SMP/MTs

Semester 1



"

/DWLKDQ 

8QWXNVRDOQRPRUVDPSDLVDMLNDQSHUPDVDODKDQWHUVHEXWGDODPEHQWXNDOMDEDU-HODVNDQPDNQD
YDULDEHO\DQJNDOLDQJXQDNDQ
 6XDWX NHWLND 3DN 9HUL PHPEHOL GXD NDUXQJ EHUDV XQWXN NHEXWXKDQ KDMDWDQ GL UXPDKQ\D
6HWHODKGLEDZDSXODQJLVWUL3DN9HULPHUDVDEHUDV\DQJGLEHOLNXUDQJ.HPXGLDQ3DN9HUL
PHPEHOLODJLVHEDQ\DNNJ1\DWDNDQEHQWXNDOMDEDUGDULEHUDV\DQJGLEHOL3DN9HUL

 %X1LOXKVHRUDQJSHQJXVDKDNXH6XDWXNHWLND%X1LOXKPHQGDSDWSHVDQDQXQWXNPHPEXDW
EHUEDJDLPDFDPNXHGDODPMXPODK\DQJEDQ\DN%DKDQ\DQJKDUXVGLEHOL%X1LOXKDGDODK
GXDNDUXQJWHSXQJVHNDUXQJNHODSDGDQOLPDNUDWWHOXU1\DWDNDQEHQWXNDOMDEDUKDUJDVHPXD
EDKDQ\DQJGLEHOLROHK%X1LOXK

 3HUKDWLNDQGHQDKEHULNXW

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 ,EXPHPEHULNDQXDQJNHSDGD$QJJLVHEHVDU5S6HWLDSKDULVL$QJJLPHQJHOXDUNDQ
XDQJQ\D VHEHVDU 5S %DJDLPDQDNDK EHQWXN $OMDEDU GDUL VLVD XDQJ $QJJL VHWLDS
KDULQ\D"

.id

 3DN 'HQL PHPEHOL WLJD JHORQGRQJ NDLQ XQWXN NHSHUOXDQ PHQMDKLW EDMX VHUDJDP SHVDQDQ
VHNRODK 603 6HPDQJDW  6HWHODK VHPXD VHUDJDP EHUKDVLO GLMDKLW WHUQ\DWD NDLQ PDVLK
WHUVLVDPHWHU1\DWDNDQEHQWXNDOMDEDUNDLQ\DQJGLJXQDNDQXQWXNPHQMDKLW

'HQDKWHUVHEXW
PHQXQMXNNDQMDOXU
DQJNXWDQXPXPGDODP
VXDWXNRWD1\DWDNDQUXWH
EHULNXWGDODPEHQWXN
DOMDEDU
D 
E 
$SDNDKNHGXDUXWHWHUVHEXW
VDPD"-HODVNDQ
&DULODKGDQFHULWDNDQ
FRQWRKQ\DWDGDODP
NHKLGXSDQVHKDULKDUL\DQJ
VHUXSDGHQJDQPDVDODK
WHUVHEXW

 %XDWODKVXDWXFHULWD\DQJEHUPDNQDEHQWXNDOMDEDU[3HUMHODVPDNQDYDULDEHOGDULFHULWD
\DQJNDOLDQEXDW

://

 %XDWVXDWXEHQWXNDOMDEDU\DQJPHPLOLNLNRHVLHQGDQNRQVWDQWD%XDWVXDWXFHULWD\DQJ

.HODV9,,,60307V

ht



tp

KDVLOQ\DDGDODKEHQWXNDOMDEDUWHUVHEXW

6HPHVWHU

1. Ajak siswa untuk melakukan refleksi terhadap kegiatan pembelajaran yang sudah
dilalui.
2. Periksalah apakah semua kelompok sudah mencatat hal-hal yang penting pada
kegiatan kali ini.
3. Jika dipandang perlu, minta siswa mengerjakan soal latihan di rumah
4. Berikan penilaian terhadap proses dan hasil karya siswa dengan menggunakan
rubrik penilaian.
MATEMATIKA

49

Membelajarkan 2.2
Memahami Penjumlahan Dan
Pengurangan Bentuk Aljabar

.id

1. Ajak siswa untuk mengingat kembali operasi penjumlahan dan pengurangan pada
bilangan bulat
2. Rencanakan pembentukan kelompok yang terdiri dari 4 siswa untuk berdiskusi
secara efektif

0HPDKDPL3HQMXPODKDQGDQ
3HQJXUDQJDQ%HQWXN$OMDEDU

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o
.HJLDWDQ 
$\R
.LWD$PDWL

(QWDKNDOLDQVDGDULDWDXWLGDNEDQ\DNPDVDODKVHKDULKDUL\DQJEHUNDLWDQGHQJDQSHQMXPODKDQGDQ
SHQJXUDQJDQEHQWXNDOMDEDU0LVDOGDODPGXQLDSHUEDQNDQSHUGDJDQJDQGLSDVDUGDQSURGXNVLVXDWX
SHUXVDKDDQ%HULNXWGLVDMLNDQVDODKVDWXFRQWRKWHQWDQJSHUPDVDODKDQGDODPGXQLDSHUGDJDQJDQ
0DVDODK 

3DN6ULDQWRVHRUDQJWHQJNXODNEHUDV\DQJVXNVHVGLGHVD6XPEHU0DNPXU6XDWXNHWLND3DN6ULDQWR
PHQGDSDWNDQSHVDQDQGDULSDVDU$GDQ%GLKDUL\DQJEHUVDPDDQ3DVDU$PHPHVDQNDUXQJEHUDV
VHGDQJNDQSDVDU%PHPHVDQNDUXQJEHUDV%HUDV\DQJVHNDUDQJWHUVHGLDGLJXGDQJ3DN6ULDQWR
DGDODKNDUXQJEHUDV
0LVDO[DGDODKPDVVDWLDSNDUXQJEHUDV
1\DWDNDQGDODPEHQWXNDOMDEDU

tp

Ayo
Kita Amati

://

D 7RWDOEHUDV\DQJGLSHVDQNHSDGD3DN6ULDQWR
E 6LVDEHUDV\DQJDGDGLJXGDQJ3DN6ULDQWRMLNDPHPHQXKLSHVDQDQSDVDU$VDMD
F .HNXUDQJDQEHUDV\DQJGLEXWXKNDQ3DN6ULDQWRMLNDPHPHQXKLSHVDQDQSDVDU%VDMD

ht

Ajak siswa untuk


memahami Masalah 2.2
serta alternatif pemecahan
masalahnya. Ajak
siswa untuk memahami
konteks penjumlahan
dan pengurangan bentuk
aljabar yang disajikan
Keterangan:
x adalah massa tiap karung
beras
50

$OWHUQDWLI3HPHFDKDQ0DVDODK

D 7RWDOEHUDV\DQJGLSHVDQNHSDGD3DN6ULDQWRDGDODK [  [ DWDX [ NLORJUDPEHUDV


E -LND3DN6ULDQWRPHPHQXKLSHVDQDQSDVDU$VDMDPDNDVLVDEHUDVDGDODKNDUXQJEHUDVDWDX[
NLORJUDPEHUDV
F .HNXUDQJDQ EHUDV \DQJ GLEXWXKNDQ 3DN 6ULDQWR XQWXN PHPHQXKL SHVDQDQ SDVDU % DGDODK 
NDUXQJEHUDVDWDX[NLORJUDPEHUDV WDQGDQHJDWLIPHQ\DWDNDQNHNXUDQJDQ
3DGDFHULWDSHQJDQWDUWHUVHEXWWHUGDSDWRSHUDVLDQWDUDGXDEHQWXNDOMDEDU\DLWX
 3HQMXPODKDQ [  [  [
 3HQJXUDQJDQ [  [  [
 3HQJXUDQJDQ [  [  [
%HQWXN[[ELVDMXJDGLWXOLVSHQMXPODKDQGXDEHQWXNDOMDEDU [  [
8QWXN PHPSHODMDUL OHELK ODQMXW WHQWDQJ SHQMXPODKDQ GDQ SHQJXUDQJDQ EHQWXN DOMDEDU PDUL DPDWL
EHEHUDSDSHQMXPODKDQGDQSHQJXUDQJDQEHQWXNDOMDEDUSDGD7DEHO

Buku Guru Kelas VIII SMP/MTs

0$7(0$7,.$

Semester 1



7DEHO3HQMXPODKDQGDQ3HQJXUDQJDQ%HQWXN$OMDEDU
$

[

[

[

$%

%$

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

"

1R

[

[

[

[

[

[

[

[

[

[

[





[

[

[

[





[



[

$\R.LWD
0HQDQ\D

Minta siswa untuk


menuliskan hal yang belum
dipahami dari kegiatan
mengamati.
Alternatif pertanyaan:
1. Bagaimana proses
menjumlahkan bentuk
aljabar?
2. Bagaimana proses
mengurangkan bentuk
aljabar?
3. Bentuk yang bagaimana
yang bisa dijumlahkan
atau dikurangkan?

.id

Ajak siswa untuk memahami penjumlahan


bentuk aljabar dengan mengamati dan
melengkapi sel yang masih kosong pada
Tabel 2.3.

Ayo Kita
Menanya

6HWHODKPHQJDPDWLWXOLVNDQSDGDEXNXWXOLVPXSHUWDQ\DDQ\DQJEHUNDLWDQGHQJDQSHQMXPODKDQGDQ
SHQJXUDQJDQEHQWXNDOMDEDU
3HUWDQ\DDQPXVHEDLNQ\DPHPXDWNDWDEHQWXNDOMDEDUSHQMXPODKDQDWDXSHQJXUDQJDQ

$\R.LWD
0HQJJDOL,QIRUPDVL

=+

.HWHUDQJDQ

tp

://

:DPHPLOLNLNRWDNPHUDKGDQNRWDNSXWLK.RWDNNRWDNWHUVHEXWGLLVLGHQJDQNHOHUHQJ
-LNDEDQ\DNNHOHUHQJGLNRWDNPHUDKGLQ\DWDNDQGHQJDQ[GDQEDQ\DNQ\DNHOHUHQJGLNRWDNSXWLK
GLQ\DWDNDQGHQJDQ\PDNDEDQ\DNNHOHUHQJGLNHGXDNRWDNGLQ\DWDNDQGHQJDQ[\

ht

%DQ\DNNHOHUHQJGDODPVHWLDSNRWDNPHUDKVDPD
%DQ\DNNHOHUHQJGDODPVHWLDSNRWDNSXWLKVDPD
:D GLEHUL NDNDNQ\D  NRWDN PHUDK GDQ  NRWDN SXWLK 6HKLQJJD:D PHQGDSDWNDQ WDPEDKDQ
NHOHUHQJVHEDQ\DN[\'HQJDQGHPLNLDQ:DVHNDUDQJPHPLOLNL [\  [\ 
NHOHUHQJ %HQWXN  [  \   [  \  VDPD GHQJDQ [  \ \DQJ GLSHUROHK GHQJDQ FDUD
PHQMXPODKNDQ NRWDNNRWDN \DQJ ZDUQDQ\D VDPD %HQWXN [  \   [  \   [  \
GLVHEXWSHQMXPODKDQEHQWXNDOMDEDU
.HPXGLDQ:DPHPEHULNDQNRWDNPHUDKGDQNRWDNSXWLKNHSDGDDGLNQ\DVHKLQJJDNHOHUHQJ
\DQJGLPLOLNL:DVHNDUDQJEHUNXUDQJVHEDQ\DN[\NHOHUHQJ
'HQJDQNDWDODLQNHOHUHQJ\DQJGLPLOLNL:DVHNDUDQJDGDODK [\  [\ NHOHUHQJ
%HQWXNLQLVDPDGHQJDQ[\\DQJGLSHUROHKGHQJDQFDUDPHQJXUDQJNDQNRWDNNRWDN\DQJ
ZDUQDQ\DVDPD%HQWXN [\  [\  [\GLVHEXWSHQJXUDQJDQEHQWXNDOMDEDU



.HODV9,,,60307V

6HPHVWHU

Menggali
Informasi

Setelah memahami
informasi yang diberikan,
mintalah siswa untuk
menggali informasi sesuai
dengan intruksi di buku
siswa. Informasi yang
diberikan adalah tentang
suku sejenis dan contohcontoh penjumlahan
dan pengurangan bentuk
aljabar.
MATEMATIKA

51

7DEHO6XNXVXNXVHMHQLV
1R

%HQWXN$OMDEDU

6XNXVXNXVHMHQLV

[\[\




[GDQ[
\GDQ\

[\[\




[GDQ[
\GDQ\

%HULNXWGLVDMLNDQEHEHUDSDFRQWRKSHUPDVDODKDQWHQWDQJSHQMXPODKDQGDQSHQJXUDQJDQEHQWXNDOMDEDU
&RQWRK 

.id

7HQWXNDQSHQMXPODKDQDEGHQJDQDE
3HQ\HOHVDLDQ
DED E  
DDE E  
D E  

DE



MDEDUNDQ
NXPSXONDQVXNXVHMHQLV
RSHUDVLNDQVXNXVHMHQLV
VHGHUKDQDNDQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

DE  DE 











&RQWRK 

7HQWXNDQSHQJXUDQJDQDEROHKDE
3HQ\HOHVDLDQ

DE  DE 








DED E  
DDEE 
DE



MDEDUNDQ
NXPSXONDQVXNXVHMHQLV
RSHUDVLNDQVXNXVHMHQLV

&RQWRK 

7HQWXNDQSHQMXPODKDQDEROHKDEF
3HQ\HOHVDLDQ

MDEDUNDQ
NXPSXONDQVXNXVHMHQLV
RSHUDVLNDQVXNXVHMHQLV

ht

tp

://

DE  DEF  DED E F 






DDEEF 




DEF 


0$7(0$7,.$

Ajak siswa untuk memahami tentang suku-suku


sejenis yang disajikan pada Tabel 2.4 buku siswa.
Ajak siswa untuk memahami Contoh 2.1, Contoh
2.2, dan Contoh 2.3, serta alternatif penyelesaiannya.
Minta siswa untuk memahami beserta prosedur pada
tiap tahap
penyelesaian.
52

Buku Guru Kelas VIII SMP/MTs

Semester 1



&REDWHPXNDQGXDEHQWXNDOMDEDU\DQJKDVLOSHQMXPODKDQDWDXSHQJXUDQJDQQ\DDGDODK [ 

Minta siswa untuk


menjawab soal-soal
pada kegiatan Ayo Kita
Menalar. Instruksikan
kepada siswa untuk
membuat prosedur tiap
langkah.

$\R.LWD
0HQDODU

 7HQWXNDQSHQMXPODKDQEHQWXNDOMDEDUEHULNXW
D PQGHQJDQQP
E DEFGHQJDQDEG
 7HQWXNDQSHQJXUDQJDQEHQWXNDOMDEDUEHULNXW
D PQGHQJDQQP
E DEFGHQJDQDEG
 7HQWXNDQKDVLOGDUL
[\]  []  \]
7XOLVNDQNDQSURVHGXUSHQMXPODKDQGDQSHQJXUDQJNDQEHQWXNDOMDEDU\DQJNDOLDQODNXNDQ
-HODVNDQPHQJDSDKDVLOQ\DVHSHUWLLWX











b. 4a-5b-5c+13d

2. a.5m-3n-16

/DWLKDQ 

b.26a+19b-5c-13d

3. a.12x-8y-10z+10

DE  DE  


LEN  LMN  
7HQWXNDQKDVLOSHQMXPODKDQ [] GDQ [\ 
QP  PQ  
7HQWXNDQKDVLOSHQJXUDQJDQ [ ROHK [
7HQWXNDQKDVLOSHQJXUDQJDQ \ GDUL \]
7HQWXNDQKDVLOSHQJXUDQJDQ]ROHK]
7HQWXNDQKDVLOSHQJXUDQJDQ[GDUL[\
1\DWDNDQNHOLOLQJEDQJXQGDWDUEHULNXWGDODPEHQWXNDOMDEDU
D
F
E

ht

tp

.HODV9,,,60307V

://



1.a. -11m+11n+4

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3UHVHQWDVLNDQ SURVHGXU GDQ SHQMHODVDQ \DQJ NDOLDQ EXDW .HPXGLDQ EDQGLQJNDQ GHQJDQ KDVLO
WHPDQNDOLDQ\DQJODLQ6LODNDQVDOLQJEHUNRPHQWDUPHQDQJJDSLNRPHQWDUPHPEHULNDQXVXOGDQ
PHQ\HSDNDWLLGHLGH\DQJSDOLQJWHSDW

.id

Alternatif
Jawaban

$\R.LWD
%HUEDJL

"

Ayo Kita
Menalar

6HPHVWHU

Kegiatan

1. Ajak siswa untuk


melakukan refleksi
terhadap kegiatan
belajar yang sudah
dilalui
2. Periksalah apakah
semua kelompok sudah
mencatat hal-hal yang
penting pada kegiatan
kali ini
3. Mintalah siswa untuk
mengerjakan soal
latihan yang ada di
buku siswa.
MATEMATIKA

53

Membelajarkan 2.3
Memahami Perkalian
Bentuk Aljabar

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3HUNDOLDQ
%HQWXN$OMDEDU

.id

1. Gali ingatan siswa tentang bagaimana membuat bentuk aljabar dari suatu cerita.
2. Cek ingatan siwa tentang makna variabel, konstanta, dan koefisien pada suatu
bentuk aljabar.

.HJLDWDQ 

0HPDKDPL3HUNDOLDQ
%HQWXN$OMDEDU

$\R
.LWD$PDWL

0DVDODK 

3DN ,GULV PHPSXQ\DL NHEXQ DSHO EHUEHQWXN SHUVHJL GDQ 3DN +DOLP PHPSXQ\DL NHEXQ VHPDQJND
EHUEHQWXNSHUVHJLSDQMDQJ8NXUDQSDQMDQJNHEXQVHPDQJND3DN+DOLPPOHELKQ\DGDULSDQMDQJ
VLVLNHEXQDSHO3DN,GULV6HGDQJNDQOHEDUQ\DPOHELKGDULSDQMDQJVLVLNHEXQDSHO3DN,GULV-LND
GLNHWDXKLOXDVNHEXQ3DN+DOLPDGDODKP7HQWXNDQOXDVNHEXQDSHO3DN,GULV

ht

tp

Ayo
Kita Amati

://

$OWHUQDWLI3HPHFDKDQ0DVDODK

Masalah 2.3
Ajak siswa untuk
memahami Masalah 2.3
serta alternatif pemecahan
nya. Ajak siswa untuk
memahami cara
mengalikan bentuk aljabar
dengan cara bersusun.
54

8QWXNPHPHFDKNDQSHUVRDODQWHUVHEXWELVDGHQJDQPHPLVDONDQSDQMDQJVLVLNHEXQDSHO3DN,GULV
GHQJDQVXDWXYDULDEHOPLVDOYDULDEHO[3DQMDQJNHEXQVHPDQJND3DN+DOLPPHWHUOHELKSDQMDQJ
GDULSDQMDQJVLVLNHEXQDSHOELVDGLWXOLV[6HGDQJNDQOHEDUQ\DPHWHUOHELKQ\DGDULSDQMDQJ
VLVLNHEXQDSHO3DN,GULVELVDGLWXOLV[6HSHUWL\DQJNLWDNHWDKXLEDKZDOXDVSHUVHJLSDQMDQJ
DGDODKSDQMDQJOHEDU1DPXQGDODPSHUPDVDODKDQPHQHQWXNDQSDQMDQJVLVLNHEXQWHUVHEXWNLWD
VHGLNLWPHQJDODPLNHVXOLWDQNDUHQD\DQJGLNDOLNDQDGDODKEHQWXNDOMDEDU'DODPSHUPDVDODKWHUVHEXW
OXDVNHEXQ3DNKDOLPDGDODKKDVLONDOLGDUL[GHQJDQ[
/XDVNHEXQ3DN+DOLPGDSDWGLWXOLVGDODPEHQWXNDOMDEDU
/XDV SDQMDQJOHEDU

 [ u [

[[[

[[VDWXDQOXDV
6HODLQ GHQJDQ FDUD WHUVHEXW NLWD ELVD PHQHQWXNDQ OXDV NHEXQ 3DN +DOLP GHQJDQ FDUD SHUNDOLDQ
EHUVXVXQVHSHUWLEHULNXW
[
[ u
[
[[


[[

-DGLOXDVNHEXQ3DN+DOLPDGDODK[[VDWXDQOXDV
'DULNHGXDFDUDWHUVHEXWVLODNDQPHQJJXQDNDQFDUD\DQJPHQXUXWNDOLDQSDOLQJPXGDK

Buku Guru Kelas VIII SMP/MTs

0$7(0$7,.$

Semester 1



[

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

8QWXN OHELK MHODVQ\D EDJDLPDQD PHQJDOLNDQ EHQWXN DOMDEDU WHUVHEXW PDUL DPDWL LOXVWUDVL EHULNXW
3HUKDWLNDQLOXVWUDVL*DPEDU
[

.id

Ajak siswa untuk memahami ilustrasi


pemecahan masalah 2.3 yang disajikan
pada Gambar 2.3 di buku siswa.

[[
DWDX
[

[
DWDX
[

[DWDX[

DWDX



*DPEDU0RGHOSHUNDOLDQEHQWXNDOMDEDU

8QWXNOHELKPHPDKDPLWHQWDQJSHUNDOLDQEHQWXNDOMDEDUDPDWLSHUNDOLDQEHQWXNEHQWXNDOMDEDUSDGD
7DEHOEHULNXW
7DEHO3HUNDOLDQ%HQWXN$OMDEDU
1R

$%

[

[

[

[

[[

[

[

[[

[

[

[

.HWHUDQJDQ

[

[    [

[

[     [

tp

://

[[  [  [  


[[[
[[
[[  [   [  
[[[
[[

ht

[[

[ [ [   [  


[[[
[[

[

[[

[ [  [    [   


[[[
[[

[

[

[[

[  [ [     [


[[[
[[

[[

[

[[[

[ [  [   [ [  [ 


[[[[
[[[

DE

[\





.HODV9,,,60307V



6HPHVWHU

Ajak siswa untuk


memahami Tabel 2.6
di buku siswa. Tabel
tersebut berisi tentang
perkalian bentuk aljabar
disertai dengan langkah
demi langkah.

MATEMATIKA

55

6HFDUDXPXPKDVLOSHUNDOLDQEHQWXNDOMDEDU DE  FG PHQJLNXWLSURVHVEHULNXW




DE  FG


"

%HUGDVDUNDQKDVLOSHQJDPDWDQNDOLDQEXDWODKSHUWDQ\DDQ\DQJEHUNDLWDQGHQJDQSHUNDOLDQEHQWXN
DOMDEDU
%XDWODKSHUWDQ\DDQ\DQJPHPXDWNDWDSHUNDOLDQGDQGXDVXNX


0HQJHQDOIDNWRUEHQWXNDOMDEDU
&RQWRK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Minta siswa menuliskan


pertanyaan tentang hal
yang belum dipahami
dari kegiatan mengamati.

$\R.LWD
0HQJJDOL,QIRUPDVL

.id

Ayo Kita
Menanya

$\R.LWD
0HQDQ\D

Alternatif pertanyaan:

1. Bagaimana
mengalikan bentuk
aljabar?
2. Apakah setiap
bentuk aljabar bisa
dikalikan?

[GDSDWGLWXOLV [

GDQ [ GLNDWDNDQIDNWRUGDULEHQWXODOMDEDU[


&RQWRK 

[[GDSDWGLWXOLV [ u [

[ GDQ [ GLVHEXWIDNWRUGDULEHQWXNDOMDEDU[[


&RQWRK 

[[[GDSDWGLWXOLV [ u [ u [

[  [ GDQ [ GLVHEXWIDNWRUGDULEHQWXNDOMDEDU[[[


2SHUDVLSHQMXPODKDQGDQSHUNDOLDQEHQWXNDOMDEDUPHPLOLNLEHEHUDSDVLIDWDQWDUDODLQ
 6LIDW.RPXWDWLI

DE ED

DE ED

Menggali
Informasi

0$7(0$7,.$

ht

tp

=+

://

 6LIDW$VRVLDWLI

D EF   DE F

D EF   DE F

Ajak siswa untuk


memahami tentang faktor
dari bentuk aljabar serta
Contoh 2.4, Contoh 2.5,
dan Contoh 2.6.
Ajak siswa untuk
memahami sifat komutatif,
asosiatif, dan distributif
bentuk aljabar.
56

Buku Guru Kelas VIII SMP/MTs

Semester 1








6LIDW'LVWULEXWLI SHUNDOLDQWHUKDGDSSHQMXPODKDQ
D EF  DEDF
DWDX
D EF  DEDF

EF
D

D EF

DE

DF

'HQJDQPHPDKDPLSHUNDOLDQEHQWXNDOMDEDUNDOLDQGDSDWPHQ\HOHVDLNDQPDVDODK\DQJUXPLW
6HSHUWLPDVDODK\DQJDNDQNLWDFREDFDULDOWHUQDWLISHQ\HOHVDLDQQ\DGHQJDQSHQGHNDWDQLOPLDK

.id

$\R.LWD
0HQDODU

 7HQWXNDQKDVLOGDUL


D DE  

E DE  

F D[E  F[G  

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 7HQWXNDQKDVLONDOLEHQWXNDOMDEDU DE  DE

 'LNHWDKXLDE GDQDE %HUDSDNDKQLODLDE"

 -XPODKGXDEXDKELODQJDQ\DQJEHUEHGDDGDODKGDQKDVLONDOLNHGXDELODQJDQWHUVHEXWDGDODK
%HUDSDNDKMXPODKNXDGUDWNHGXDELODQJDQLWX"
 $PDWLEHQWXNEHULNXW



















u









u   

u 






6HPHVWHU

tp

.HODV9,,,60307V

ht



://

&HNNHEHQDUDQGDULSHUVDPDDQWHUVHEXW
'HQJDQPHOLKDWSRODQ\DNLWDELVDPHPEXDWEHQWXNXPXPGDULSHUVDPDDQWHUVHEXW
%XNWLNDQEDKZDEHQWXNXPXP\DQJNLWDEXDWMXJDEHUODNXXQWXNVHEDUDQJELODQJDQ$VOL
8QWXNOHELKMHODVQ\DEXDWODKEHQWXNYLVXDOPHQJJXQDNDQNHUWDV

Ayo Kita
Menalar
Minta siswa untuk
menjawab pertanyaan yang
ada pada kegiatan Ayo Kita
Menalar
MATEMATIKA

57

Alternatif
Jawaban
1.

2.

(a + b) (a b) =

a 2 b2

a.(a + b) 2 = (a + b)(a + b) = a 2 + 2ab + b 2


b.(a b) 2 = (a b)(a b) = a 2 2ab + b 2

c.( ax + b)(cx + d )= acx + adx + bcx + bd



2
3.
( a b ) = a 2 + b2 2ab

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

2
4=
40 2ab
16
= 40 2ab

.id

2ab = 40 16 = 24

(a + b) 2 = a 2 + b 2 + 2ab
(a + b) 2 =40 + 2ab
(a + b) 2 =40 + 24
a +=
b

64= 8

4.

a+b =
6
ab =
4

(a + b)

=a 2 + 2ab + b 2

://

tp

62 = a 2 + 2 4 + b 2

ht

36 = a 2 + 8 + b 2
a 2 + b 2 = 36 8 = 28
5.

58

1
1
1
(a + ) 2 = a 2 + a + = a ( a + 1) +
2
4
4

Buku Guru Kelas VIII SMP/MTs

Semester 1

$\R.LWD
%HUEDJL
3UHVHQWDVLNDQ KDVLO EHUQDODU NDOLDQ VHPHQDULN PXQJNLQ 'LVNXVLNDQ GDODP NHORPSRN NDOLDQ MLND
PDVLKWHUGDSDWNHVLPSXODQEHUEHGD

"

/DWLKDQ 

Ayo Kita
Berbagi
Minta siswa untuk
menyajikan hasil dari
bernalarnya.

 1\DWDNDQOXDVEDQJXQGDWDUEHULNXWGDODPEHQWXNDOMDEDU

D

E

D

D
E

V

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

V

F

.id

 7HQWXNDQKDVLONDOLGDULEHQWXNEHQWXNDOMDEDUEHULNXW


D  \  

E [  [  

F [  [  

 7HQWXNDQQLODLUSDGDSHUVDPDDQEHQWXNDOMDEDU [\ S[T\  U[[\\


 7HQWXNDQGXDEHQWXNDOMDEDU\DQJELODGLNDOLNDQKDVLOQ\DDGDODK


D [[\

E \\

 7DQSDPHQJJXQDNDQDODWKLWXQJWHQWXNDQ


D 
E 

F 

G 

ht

tp

://

0$7(0$7,.$



?!

Latihan

Minta siswa untuk menyelesaikan soal latihan dan


di bahas di kelas dengan
menunjuk salah satu siswa,
sedang siswa yang lain
diminta menanggapi dengan
santun. Begitu seterusnya
untuk nomor soal lainnya.
MATEMATIKA

59

 7HQWXNDQFDUDWHUFHSDWXQWXNPHQJKLWXQJ


D 

E 

F 

 6L$GDQVL%PDVLQJPDVLQJPHQ\LPSDQVHEXDKELODQJDQ-LNDNHGXDELODQJDQ\DQJPHUHND
PLOLNLGLNDOLNDQKDVLOQ\DDGDODK6HWHODKGLKLWXQJKLWXQJWHUQ\DWDVHOLVLKELODQJDQVL$
GDQVL%DGDODK%HUDSDNDKMXPODKGDULELODQJDQELODQJDQ\DQJGLPLOLNLNHGXDQ\D"
D 1\DWDNDQEHQWXNDOMDEDUXQWXN\DQJGLNHWDKXL
E 1\DWDNDQEHQWXNDOMDEDUXQWXN\DQJGLWDQ\D
F 1\DWDNDQEHQWXNDODMDEDU\DQJGLWDQ\DGDODPEHQWXNDOMDEDU\DQJGLNHWDKXL

D 6HGHUKDQDNDQELODQJDQ\DQJGLGDODPNXUXQJ
E $PDWLSRODSHUNDOLDQEHEHUDSDELODQJDQDZDO

.id






 'LNHWDKXL EDKZD             %HUDSDNDK QLODL Q \DQJ
    Q
PHPHQXKL"

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

F 'HQJDQPHQJDPDWLWHQWXNDQQLODLQ\DQJ\DQJPHPHQXKLSHUVDPDDQGLDWDV

 .HWLND WXDQ )HOL[ GLKDGDSNDQ GHQJDQ VRDO EHUEHQWXN  u  u  u    
GLD WLGDN PHQJDOLNDQ VDWX SHUVDWX ELODQJDQELODQJDQ \DQJ DGD \DQJ GLD ODNXNDQ DGDODK
PHQMXPODKNDQGHQJDQNXDGUDWGDUL%HQDUNDKMDZDEDQQ\D"%LVDNDKMDZDEDQQ\D
GLSHUWDQJJXQJMDZDENDQXQWXNVHWLDSEHQWXNGHQJDQSRODVHSHUWLLWX"

 3LNLUNDQVHEXDKELODQJDQGDQMDQJDQEHULWDKXVD\D6D\DDNDQPHQHEDNQ\D7DSLODNXNDQ
GXOXSHULQWDKVD\DEHULNXW D NDOLNDQELODQJDQGDODPSLNLUDQNDOLDQ E WDPEDKNDQSDGD
KDVLOQ\D F NDOLNDQKDVLOQ\D G WDPEDKNDQSDGDKDVLOQ\D H EDJLODKKDVLOQ\DGHQJDQ
 I NXUDQJNDQKDVLOWHUDNKLUQ\DGHQJDQ0DNDDNXELVDPHQHEDNELODQJDQNDPX\DLWX
NXUDQJQ\DGDULELODQJDQWHUDNKLU\DQJNDPXVLPSDQGLRWDNNDOLDQ%XNWLNDQEDKZDWHEDNDQ
WHUVHEXWEHUODNXXQWXNVHPXDELODQJDQ\DQJPXQJNLQGLSLOLKROHKWHPDQWHPDQNDOLDQ
 3HUVHJLSDQMDQJ$%&'EHULNXWGLEDQJXQGDULSHUVHJLNHFLO\DQJNRQJUXHQ/XDVSHUVHJL
SDQMDQJ$%&'DGDODKFP7HQWXNDQNHOLOLQJGDULSHUVHJL$%&'WHUVHEXW
D

ht

tp

://

 7HQWXNDQVROXVLPDVDODKDSHO\DQJWHUGDSDWSDGDSHPEXNDDQ%DE2SHUDVL$OMDEDU



.HODV9,,,60307V

6HPHVWHU

1. Ajak siswa untuk melakukan refleksi terhadap kegiatan belajar yang sudah dilalui
2. Periksalah apakah semua kelompok sudah mencatat hal-hal yang penting pada
kegiatan kali ini
3. Mintalah siswa untuk mengerjakan soal latihan yang ada di buku siswa. (jika
perlu)
60

Buku Guru Kelas VIII SMP/MTs

Semester 1

Membelajarkan 2.4
Memahami Pembagian Bentuk Aljabar

1. Ingatkan kembali tentang perkalian bentuk aljabar.

.HJLDWDQ 
$\R
.LWD$PDWL

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3HPEDJLDQ
%HQWXN$OMDEDU

.id

2. Ingatkan kembali tentang konteks perhitungan luas kebun pada Kegiatan 2.3
memahami perkalian bentuk aljabar.

0HPDKDPL3HPEDJLDQ
%HQWXN$OMDEDU

3DGD WLJD NHJLDWDQ VHEHOXPQ\D NDOLDQ WHODK PHPEDKDV RSHUDVL SHQMXPODKDQ SHQJXUDQJDQ GDQ
SHUNDOLDQSDGDEHQWXNDOMDEDU3DGDNHJLDWDQLQLDNDQNLWDSHODMDULRSHUDVLSHPEDJLDQEHQWXNDOMDEDU
2SHUDVL SHPEDJLDQ EHQWXN DODMDEDU DGDODK ODZDQ GDUL RSHUDVL SHUNDOLDQ EHQWXN DOMDEDU 6HEHOXP
PHQJLNXWLNHJLDWDQOHELKMDXKVLODNDQNDOLDQEDFDNHPEDOLPDVDODKOXDVNHEXQ3DN,GULVGDQ3DN
+DOLP\DQJGLVDMLNDQGLSHQJDPDWDQNHJLDWDQ
0DVDODK 

-LNDLQIRUPDVLSDGDSHUPDVDODKDQWHUVHEXWGLXEDK\DQJGLNHWDKXLDGDODKOXDV [[VDWXDQ
OXDVGDQSDQMDQJQ\D [VDWXDQSDQMDQJNDOLDQGLPLQWDXQWXNPHQHQWXNEHQWXNDOMDEDUGDUL
OHEDUQ\D%DJDLPDQDODQJNDKNDOLDQXQWXNPHQHQWXNDQOHEDUQ\D"
$OWHUQDWLI3HPHFDKDQ0DVDODK

/XDV
SDQMDQJ

tp

OHEDU 

://

6HSHUWL\DQJNLWDNHWDKXL/XDV SDQMDQJOHEDU'DSDWNLWDWXOLV

ht

/HEDU WDQDK 3DN +DOLP GDSDW GLWHQWXNDQ GHQJDQ PHPEDJL EHQWXN DOMDEDU GDUL OXDV WDQDK GHQJDQ
EHQWXNDOMDEDUGDULSDQMDQJ

[    [  
[   [   z 
[  
3DGDNHJLDWDQWHUVHEXWNLWDWHODKPHQHQWXNDQKDVLOEDJL[[ROHK[DGDODK[
%DJDLPDQDGHQJDQEHQWXN\DQJODLQ
0LVDO

+DVLOEDJL[[ROHK[

+DVLOEDJL[[ROHK[
OHEDU 

%HULNXWSURVHVPHPEDJLEHQWXNDOMDEDUGLVDMLNDQGDODP7DEHO

0$7(0$7,.$



Apersepsi

Minta siswa mengingat


kembali Masalah 2.3
perhitungan luas kebun
yang melibatkan perkalian
bentuk aljabar.
Ayo
Kita Amati

Ajak siswa untuk


memahami Masalah
2.4 serta alternatif
pemecahannya. Konteks
dari Masalah 2.4 adalah
untuk memahamkan
kepada siswa tentang
pembagian bentuk aljabar.
Ketika menuliskan hasil
bagi bentuk aljabar harus
menuliskan syarat bahwa
penyebut tidak boleh sama
dengan nol.
MATEMATIKA

61

7DEHOD3HPEDJLDQ%HQWXN$OMDEDU
&RQWRK
+DVLOEDJL[[ROHK[
%HULNXWDOWHUQDWLISHQ\HOHVDLDQQ\DGLVDMLNDQGDODPEHQWXN
SHPEDJLDQEHUVXVXQ\DQJGLVDMLNDQODQJNDKGHPLODQJNDK

[   [   [  

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

[   [   [  

[   [   [  
[    [

[

[   [   [  

 [    [
 [  
[  

[   [   [  

 [    [
 [  
 [  
[  

[   [   [  

 [    [

-DGLKDVLOEDJLGDUL[[ROHK[DGDODK[

ht

tp

://

 [  
 [  
 



.HODV9,,,60307V

6HPHVWHU

Ajak siswa untuk memahami Tabel 27a tentang menentukan hasil bagi bentuk aljabar yang disajikan tahap
demi tahap.
62

Buku Guru Kelas VIII SMP/MTs

Semester 1

7DEHOE3HPEDJLDQ%HQWXN$OMDEDU
&RQWRK

&RQWRK

7HQWXNDQKDVLOEDJLGDUL
[[ROHK[

7HQWXNDQKDVLOEDJLGDUL
[[ROHK[

[  

 [    [    [  
 [    [
 [  
 [  


 [    [
 [  
 [  


-DGLKDVLOEDJL[[ROHK[
DGDODK[

$\R.LWD
0HQDQ\D

0HQJJDOL
,QIRUPDVL

3DGDSHPEDJLDQEHQWXNDOMDEDUKDVLOEDJLQ\DWLGDNVHODOXEHUVLVD%HULNXWFRQWRKSHPEDJLDQ
EHQWXNDOMDEDU\DQJVLVDQ\DEXNDQ
&RQWRK 

7HQWXNDQKDVLOEDJL[[ROHK[
3HQ\HOHVDLDQ

Minta siswa untuk


menuliskan pertanyaan
tentang hal yang belum
dipahami dalam proses
membagi bentuk aljabar
yang disajikan dalam Tabel
2.7a dan 2.7b.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

'DUL KDVLO SHQJDPDWDQ NDOLDQ WHUKDGDS NHWLJD FRQWRK SDGD NHJLDWDQ D\R NLWD DPDWL DGDNDK \DQJ
PDVLK EHOXP NDOLDQ SDKDPL GDUL SURVHV PHPEDJL EHQWXN DOMDEDU GHQJDQ EHQWXN DOMDEDU 7XOLVNDQ
SHUWDQ\DDQNDOLDQ
6HEDLNQ\DSHUWDQ\DDQNDOLDQPHPXDWNDWDPHPEDJLGDQEHQWXNDOMDEDU

Ayo Kita
Menanya

.id

-DGLKDVLOEDJLGDUL[[ROHK[
DGDODK[

"

Ajak siswa untuk


memahami Tabel 2.7b
tentang menentukan hasil
bagi bentuk aljabar.

[  

[    [    [  

Contoh pertanyaan:

[  

[    [   [  

[  [
 [  
[  

-DGLKDVLOEDJL[[ROHK[DGDODK[VLVD



=+

ht

tp

://

0$7(0$7,.$

1. Bagaimana jika pada


pembagian bentuk
aljabar sisanya tidak
nol?
2. Apakah setiap bentuk
aljabar bisa dibagi
dengan bentuk aljabar
yang lain

Menggali
Informasi

Ajak siswa untuk


memahami Contoh 2.7 serta
alternatif penyelesaiannya.
Contoh yang disajikan
adalah pembagian bentuk
aljabat yang tidak habis
(sisanya tidak nol).
MATEMATIKA

63

3HPEDJLDQEHQWXNDOMDEDUELVDNDOLDQPHQIDDWNDQXQWXNPHQHQWXNDQIDNWRUVXDWXEHQWXNDOMDEDU
&DWDWDQ%XNDNHPEDOLNHJLDWDQSDGD%DELQLXQWXNPHPDKDPLSHQJHUWLDQIDNWRU
GDULEHQWXNDOMDEDU

0DVDODK 
'LNHWDKXL [ DGDODKVDODKVDWXIDNWRUGDUL[[7HQWXNDQIDNWRU\DQJODLQQ\D
$OWHUQDWLI3HPHFDKDQ0DVDODK

[

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

[   [   [  

.id

'HQJDQ FDUD PHPEDJL EHQWXN [  [   GHQJDQ [    NDOLDQ ELVD PHQHQWXNDQ IDNWRU ODLQ
WHUVHEXW

[   [
[  
[  


-DGLIDNWRU\DQJODLQWHUVHEXWDGDODK [ 

0DVDODK 

7HQWXNDQIDNWRUIDNWRUGDULEHQWXNDOMDEDU[[

$OWHUQDWLI3HPHFDKDQ0DVDODK

8QWXN PHQ\HOHVDLNDQ SHUPDVDODKDQ VHSHUWL LQL NDOLDQ KDUXV PHPDKDPL EDJDLPDQD WHNQLN
SHPIDNWRUDQEHQWXNDOMDEDU

[  [   

tp
ht

/DQJNDK

  [   [   [    /DQJNDK


://


  [  [   [   

 [  [      [    /DQJNDK
 [     [   

/DQJNDK

-DGLIDNWRUGDUL  [    [   DGDODK [   GDQ  [   



.HODV9,,,60307V

6HPHVWHU

Ajak siswa untuk memahami Masalah 2.5


dan 2.6 serta alternatif penyelesaiannya
64

Buku Guru Kelas VIII SMP/MTs

Semester 1

3HQMHODVDQ
/DQJNDK
0HQMDEDUNDQEHQWXN[PHQMDGLSHQMXPODKDQGXDEHQWXNDOMDEDUD[E[VHGHPLNLDQDuE 
GHQJDQDGDQEDGDODKELODQJDQEXODWDGDODKKDVLONDOLGDULNRHVLHQ[\DLWXGHQJDQNRQVWDQWD
1LODLDGDQEDGDODKIDNWRUGDULPDNDNHPXQJNLQDQQ\DDGDODK^
`6DODKVDWXFDUDXQWXNPHQHQWXNDQQLODLDGDQEDGDODKGHQJDQPHPEXDWWDEHOEDQWXDQ
VHEDJDLEHULNXW
D

DuE

DE























'DULVHNLDQNHPXQJNLQDQWHUVHEXWWHUQ\DWD\DQJPHPHQXKLDGDODKGDQ-DGLNLWDPHQMDEDUNDQ
[PHQMDGL[[8QWXNVHODQMXWQ\DWDEHOWLGDNKDUXVVHODOXGLJXQDNDQ

0HQJDVRVLDVLNDQ PHQJXPSXONDQ PDVLQJPDVLQJGXDVXNXQ\DPHQMDGL [[  [ 

/DQJNDK

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

/DQJNDK
0HPIDNWRUNDQPDVLQJEHQWXN\DQJGLNHORPSRNNDQPHQMDGL[ [  [ 

.id

/DQJNDK

,QJDWNHPEDOLVLIDWGLVWULEXWLISHUNDOLDQWHUKDGDSSHQMXPODKDQ DWDXSHQJXUDQJDQ SDGDNHJLDWDQ

$\R.LWD
0HQDODU

Ayo Kita
Menalar

7HQWXNDQKDVLOEDJLEHQWXNDOMDEDUEHULNXW
 [[ROHK
 [[[ROHK[

 [[[ROHK[[
 [[[ROHK[

 7HQWXNDQIDNWRUGDUL[[

 6XDWXEHQWXNDOMDEDUPHPLOLNLGXDIDNWRU[GDQ[7HQWXNDQEHQWXNDOMDEDUWHUVHEXW

 %HQWXNDOMDEDU[ [MLNDGLEDJLVXDWXEHQWXNDOMDEDUKDVLOQ\DDGDODK[7HQWXNDQ


EHQWXNDOMDEDUSHPEDJLWHUVHEXW
 6XDWXEHQWXNDOMDEDUPHPLOLNLWLJDIDNWRU[D[EGDQ[F7HQWXNDQKDVLOQ\DMLNDGLEDJL[D



Alternatif
Jawaban

ht

tp

://

0$7(0$7,.$

Minta siswa untuk


menjawab pertanyaan
pada kegiatan Ayo Kita
Menalar. Minta siswa
untuk menuliskan
prosedurnya.

1.
2.
3.
4.
5.
6.
7.
8.
MATEMATIKA

65

$\R.LWD
%HUEDJL
3UHVHQWDVLNDQKDVLOEHUQDODUPXGLGHSDQNHODV7DQJJDSLMDZDEDQGDQNHVLPSXODQ\DQJGLSHUROHK
NHORPSRNODLQMLNDEHUEHGDGHQJDQMDZDEDQGDQNHVLPSXODQNHORPSRNNDOLDQ

"

/DWLKDQ 

 7HQWXNDQKDVLOEDJL
D [[ROHK[
E [[ROHK[
F [[[ROHK[
G [[[ROHK[
 7HQWXNDQIDNWRUGDUL

.id

D [[
E [[

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 7HQWXNDQVXDWXEHQWXNDOMDEDU\DQJPHQXUXWPXELVDGLEDJLROHK[.HPXGLDQWHQWXNDQ
KDVLOEDJLQ\D
 7HQWXNDQVXDWXEHQWXNDOMDEDUGHQJDQSDQJNDWWHUWLQJJLQ\D\DQJPHQXUXWPXELVDGLEDJL
ROHK[.HPXGLDQWHQWXNDQKDVLOEDJLQ\D

 7HQWXNDQKDVLOEDJL[ROHK[

Ayo Kita
Berbagi
Minta siswa untuk
menyajikan jawaban
dari kegiatan bernalar
semenarik mungkin.

 1LODL UDWDUDWD XMLDQ  RUDQJ VLVZD DGDODK  $QGL \DQJ NHPXGLDQ PHQ\XVXO LNXW XMLDQ
PHQJDWDNDQEDKZD1LODLUDWDXMLDQNLWDEHUHQDPVHNDUDQJPHQMDG$SDNDKXFDSDQ$QGL
LWXPDVXNDNDONDODXPDNVLPDOQLODLXMLDQ\DQJPXQJNLQGLFDSDLDGDODK"0HQJDSD"

 %HQWXNDOMDEDU[[MLNDGLEDJLVXDWXEHQWXNDOMDEDUKDVLOQ\DDGDODK[7HQWXNDQ
EHQWXNDOMDEDUSHPEDJLWHUVHEXW

 7HQWXNDQEHQWXNDOMDEDU\DQJELODGLEDJL[KDVLOQ\DDGDODK[

 6XDWXEHQWXNDOMDEDUPHPLOLNLWLJDIDNWRU[[GDQ[7HQWXNDQEHQWXNDOMDEDU
WHUVHEXWMLNDGLEDJL[

.HODV9,,,60307V

6HPHVWHU

ht

tp

://



1. Ajak siswa untuk melakukan refleksi terhadap kegiatan belajar yang sudah dilalui
2. Periksalah apakah semua kelompok sudah mencatat hal-hal yang penting pada
kegiatan kali ini
3. Mintalah siswa untuk mengerjakan soal latihan yang ada di buku siswa.
66

Buku Guru Kelas VIII SMP/MTs

Semester 1

Membelajarkan 2.5
Memahami Cara Menyederhanakan Bentuk Aljabar

Ajak siswa untuk mengingat kembali tentang penjumlahan dan pengurangan bilangan
pecahan, contoh:

.HJLDWDQ 
0DVDODK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

0HQ\HGHUKDQDNDQ
%HQWXN$OMDEDU

Sederhanakan 5 4
6 3

.id

3 2
+ : yaitu
4 5
5 4 2 5 8 5 8 3
1
= =
= =

yaitu
6 3 2 6 6
6
6
2
Sederhanakan

0HPDKDPL&DUD0HQ\HGHUKDQDNDQ
%HQWXN$OMDEDU

'DODPEHQWXNDOMDEDUMXJDDGDEHQWXNDOMDEDUSHFDKDQPLVDOEHQWXNDOMDEDUSDGDODWLKDQVRDO
QRPRU.HWLNDNDOLDQPHPEDJL[GHQJDQ[NDOLDQWLGDNPHQGDSDWNDQKDVLOVHSHUWLSDGD
QRPRU'DODPKDOLQLKDVLOEDJLQ\DELVDGLVDMLNDQGDODPEHQWXNDOMDEDUSHFDKDQ
SHFDKDQ

[  
%HQWXN
[  

[  
 ELVD NLWD XEDK PHQMDGL EHQWXN \DQJ OHELK VHGHUKDQD GHQJDQ FDUD PHPEDJL GXD
[  

SHPELODQJ GDQ SHQ\HEXWQ\D PHQMDGL

[  
[  
 %HQWXN
 GLNDWDNDQ OHELK VHGHUKDQD NDUHQD
[
[

PHQJDQGXQJELODQJDQELODQJDQ\DQJOHELKVHGHUKDQDGDULEHQWXNVHEHOXPQ\DQDPXQPHPLOLNLQLODL

[  
6HODLQLWXVXDWXEHQWXNDOMDEDUGLNDWDNDQOHELKVHGHUKDQDMLND
[  

://

\DQJVDPDGHQJDQEHQWXN

D  [   [\
u
[
D

F

[    [  
 [    [  

Ayo
Kita Amati

ht

E

tp

PHQJDQGXQJRSHUDVL\DQJOHELKVHGLNLW
0LVDODGDSHUPDVDODKVHSHUWLEHULNXW6HGHUKDQDNDQEHQWXNDOMDEDUEHULNXW


D

 [    [    [  

8QWXNPHPDKDPLSHQ\HGHUKDQDDQEHQWXNDOMDEDUGLDWDVPDULNDOLDQDPDWLEHEHUDSDSHQ\HGHUKDQDDQ
EHQWXNDOMDEDUEHULNXW
$OWHUQDWLI3HPHFDKDQ0DVDODK
$\R
.LWD$PDWL
3HUKDWLNDQ EHEHUDSD FRQWRK SHQ\HGHUKDQDDQ EHQWXN DOMDEDU EHULNXW 8QWXN PHPDKDPL SURVHV
SHQ\HGHUKDQDDQ EHULNXW VHEDLNQ\D LQJDW NHPEDOL VLIDWVLIDW SHQMXPODKDQ GDQ SHUNDOLDQ EHQWXN
DOMDEDU

0$7(0$7,.$



Ajak siswa untuk


memahami Masalah
2.7. Untuk menentukan
alternatif pemecahan
Masalah 2.7, ajak
siswa untuk mengamati
contoh-contoh yang
disajikan.
MATEMATIKA

67

&RQWRK 
6HGHUKDQDNDQEHQWXNDOMDEDU

[
[  

$OWHUQDWLI
3HQ\HOHVDLDQ

[

[  

[

  [  

IDNWRUNDQSHQ\HEXWGDQSHPELODQJ

[

[  

VHGHUKDQDNDQ SHPELODQJGDQSHQ\HEXWGLEDJL

.id

&RQWRK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

6HGHUKDQDNDQEHQWXNDOMDEDU  [   \
 [  
$OWHUQDWLI
3HQ\HOHVDLDQ

[   \ 
 [  

 [   \

  [  

IDNWRUNDQSHQ\HEXWGDQSHPELODQJ

[  \

[  

VHGHUKDQDNDQ SHPELODQJGDQSHQ\HEXWGLEDJL

&RQWRK 

6HGHUKDQDNDQEHQWXNDOMDEDU

D   DE
D  E

$OWHUQDWLI
3HQ\HOHVDLDQ

://

D   DE

D  E

D D  E

 D  E

IDNWRUNDQSHPELODQJGDQSHQ\HEXW

D



VHGHUKDQDNDQ SHPELODQJ GDQ SHQ\HEXW GLEDJL D  E 

ht

tp



V\DUDWDE

.HODV9,,,60307V

6HPHVWHU

Ajak siswa untuk memahami Contoh 2.7, Contoh 2.8,


dan Contoh 2.9, serta alternatif penyelesaiannya. Ajak
siswa untuk memahami keterangan pada setiap langkah
penyederhanaan bentuk aljabar.
68

Buku Guru Kelas VIII SMP/MTs

Semester 1

&RQWRK 
6HGHUKDQDNDQEHQWXNDOMDEDU [  [
$OWHUQDWLI
3HQ\HOHVDLDQ
 [  [ 















[    [   


[[ 

[[ 

[ 








GLVWULEXWLI
MDEDUNDQ
DVRVLDWLIVXNXVHMHQLV
VHGHUKDQDNDQ

&RQWRK 




[
[

6HGHUKDQDNDQEHQWXNDOMDEDU



 
[
[



[

 u   
 u [

IDNWRUNDQSHQ\HEXWGDQSHPELODQJ


[

VHGHUKDQDNDQ

&RQWRK 
6HGHUKDQDNDQEHQWXNDOMDEDU

$OWHUQDWLI
3HQ\HOHVDLDQ


[  

 
[
[

MXPODKNDQSHPELODQJ NDUHQDSHQ\HEXWVXGDKVDPD

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

$OWHUQDWLI
3HQ\HOHVDLDQ


[  

[
[




u
[
[

NDOLNDQDQWDUSHPELODQJGDQDQWDUSHQ\HEXW

[   u [   u  
[ u [  

IDNWRUNDQ [

[   u  

VHGHUKDQDNDQV\DUDW[

 [   
[

://

GLVWULEXWLI

ht

tp

0$7(0$7,.$



Ajak siswa untuk memahami Contoh 2.10, Contoh


2.11, dan Contoh 2.12, serta alternatif penyelesaiannya.
Ajak siswa untuk memahami keterangan pada setiap
langkah penyederhanaan bentuk aljabar.

MATEMATIKA

69

&RQWRK 

6HGHUKDQDNDQEHQWXNDOMDEDU




[     

$OWHUQDWLI
3HQ\HOHVDLDQ

[   [  


 
[

   u [  
 
[   [  

[   [  

[   [  

  [  
 [  

PHPIDNWRUNDQEHQWXN[

PHQ\DPDNDQSHQ\HEXW

 

GLVWULEXWLI

 

PHQJRSHUDVLNDQVXNXVHMHQLV

PHPIDNWRUNDQSHPELODQJ

VHGHUKDQDNDQV\DUDW[

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

  [  

[   [  

.id



 

[     



[  



&RQWRK 


6HGHUKDQDNDQEHQWXNDOMDEDU [   y [  
[
[
$OWHUQDWLI3HQ\HOHVDLDQ
[     [
[    [   


u
y
[
[
[
[

[   [   u

[   [   u [ 
[ u [  

NDOLNDQDQWDUSHPELODQJGDQDQWDUSHQ\HEXW

[   u [   u  u [ 
[ u [  

IDNWRUNDQSHPELODQJGDQSHQ\HEXW

[  [

VHGHUKDQDNDQV\DUDW[

://
tp
ht

PHQJXEDKRSHUDVLSHPEDJLDQPHQMDGLSHUNDOLDQ



.HODV9,,,60307V

[

[  

IDNWRUNDQ [

6HPHVWHU

Ajak siswa untuk memahami Contoh 2.13 dan


Contoh 2.14, serta alternatif penyelesaiannya. Ajak
siswa untuk memahami keterangan pada setiap
langkah penyederhanaan bentuk aljabar.

70

Buku Guru Kelas VIII SMP/MTs

Semester 1

&RQWRK 

6HGHUKDQDNDQEHQWXNDOMDEDU

[   [  
[ 

$OWHUQDWLI
3HQ\HOHVDLDQ

[   [  

[ 



"

[   [   

IDNWRUNDQSHPELODQJ

[

VHGHUKDQDNDQV\DUDW [ 

[ 


$\R.LWD
0HQDQ\D

%HUGDVDUNDQ KDVLO SHQJDPDWDQ NDOLDQ WXOLVNDQ SHUWDQ\DDQ WHQWDQJ KDO \DQJ PDVLK EHOXP NDOLDQ
SDKDPLGDULNHJLDWDQSHQJDPDWDQ
3HUWDQ\DDQNDOLDQVHEDLNQ\DPHPXDWNDWDPHQ\HGHUKDQDNDQGDQEHQWXNDOMDEDU

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

%HULNXWGLVDMLNDQEHEHUDSDFRQWRKVRDOPHQ\HGHUKDQDNDQEHQWXNDOMDEDU
&RQWRK 


 \
7HQWXNDQEHQWXNVHGHUKDQDGDULEHQWXNDOMDEDUEHULNXW [

\ 
[

$OWHUQDWLI
3HQ\HOHVDLDQ

 \
[


\ 
[

Minta siswa untuk


menuliskan pertanyaan
tentang hal yang belum
dipahami dari kegiatan
mengamati.
Contoh pertanyaan:
1. Bagaimana cara
menyederhanakan
bentuk aljabar yang
lebih rumit?
2. Bagaimana kita
bisa tahu langkah
demi langkah pada
penyederhanaan
bentuk aljabar?

.id

0HQJJDOL
,QIRUPDVL

Ayo Kita
Menanya

   [\
[

 [\  
[

PHQ\DPDNDQSHQ\HEXWGDULEHQWXNDOMDEDUSHPELODQJ

   [\
[
u

[
 [\  

PHQJXEDKSHPEDJLDQPHQMDGLSHUNDOLDQ

   [\ u [
 
[ u  [\  

PHQJDOLNDQDQWDUSHPELODQJGDQDQWDUSHQ\HEXW

   [\

 [\  

SHPELODQJGDQSHQ\HEXWGLEDJL[V\DUDW[

=+

ht

tp

://

0$7(0$7,.$



Menggali
Informasi

Ajak Siswa untuk


memahami beberapa
contoh beserta langkah
untuk menyederhanakan
bentuk aljabar.
Ajak siswa untuk
memahami Contoh
2.16 serta alternatif
pemecahnnya. Contoh
yang disajikan pada
kegiatan Ayo Kita
Menggali Informasi
relatif lebih rumit dari
pada yang disajikan di
kegiatan Ayo Kita Amati.
MATEMATIKA

71

  [\  

 [\  

NRPXWDWLI

  [\  

 [\  

PHPIDNWRUNDQSHPELODQJGDQSHQ\HEXW





SHPELODQJGDQSHQ\HEXWGLEDJL [\ V\DUDW [\ 




SHPELODQJGDQSHQ\HEXWGLEDJL

DE DE

D
E
D E
DE

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

7HQWXNDQEHQWXNVHGHUKDQDGDULEHQWXNDOMDEDUEHULNXW

.id

&RQWRK 

$OWHUQDWLI
3HQ\HOHVDLDQ

DE DE

D
E 
D E
DE

E D  E  D D  E
DE


D E
DE

PHQ\DPDNDQSHQ\HEXWGDULEHQWXNSHPELODQJ

E  D D  E

  D  E D  E u D  E  PHPIDNWRUNDQEHQWXN ED
DE
DE

://

tp

ht

DE
D E
DE



GLVWULEXWLI

E  D D  E u D  E
DE

DE

 PHQJXEDKSHPEDJLDQPHQMDGLSHUNDOLDQ

E  D D  E D  E 
DE D  E

 D  E D  E

DE

PHQJDOLNDQDQWDUSHPELODQJGDQDQWDUSHQ\HEXW

SHPELODQJGDQSHQ\HEXWGLEDJL DE V\DUDW DE 

.HODV9,,,60307V

6HPHVWHU

Ajak siswa untuk memahami Contoh 2.17 serta alternatif penyelesainnya. Jelaskan kepada siswa tentang mengapa harus diberi syarat
ketika menyederhanakan (membagi bentuk aljabar pembilangan dan
penyebut yang sama) bentuk aljabar tidak boleh sama dengan nol.

72

Buku Guru Kelas VIII SMP/MTs

Semester 1

$\R.LWD
0HQDODU

Ayo Kita
Menalar

%HUGDVDUNDQSDGDSHQJDPDWDQGLDWDVGDQKDVLOLQIRUPDVL\DQJNDOLDQGDSDWNDQVHGHUKDQDNDQGDUL
EHQWXNDOMDEDUEHULNXW
D




[   [ 

E




 [    [    [  

F

D  [   [\
u
[
D

Minta siswa untuk menjawab pertanyaan pada ke


giatan Ayo Kita Menalar.
Alternatif
Jawaban

H

  [    [  
[    [  

I

  [    [  
 [   

J



y
[   [  

K




[ \ [ \



[ \ [ \

a.
b.
c.

%XDWODKNHVLPSXODQWHQWDQJEDJDLPDQDVXDWXEHQWXNDOMDEDUGLNDWDNDQVHGHUKDQDGDQEDJDLPDQD
PHQ\HGHUKDQDNDQQ\D"
$\R.LWD
%HUEDJL

.id

[   [  
 [    [  

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

G

6DMLNDQMDZDEDQNDOLDQVHPHQDULNGDQVHMHODVPXQJNLQ%DQGLQJNDQGHQJDQMDZDEDQWHPDQNDOLDQ
/DOXSUHVHQWDVLNDQGLGHSDQNHODV

d.
e.
f.



g.

h.

ht

tp

://

0$7(0$7,.$

Ayo Kita
Berbagi
Minta siswa untuk
menyajikan jawabannya
di depan kelas.
MATEMATIKA

73

"

/DWLKDQ 

[\[\



[    [  [   [



 D   E  E   D



E  E[
F[  F






[  [ 



[
\

[ \ [ \

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o



.id

6HGHUKDQDNDQEHQWXNEHQWXNDOMDEDUEHULNXW



[   [  
[ 



 [   
[  [  



 [   [  
[  [  



 [    [  
[   



 [    [  
[   

ht

tp

://



[  \
[ \
[ \

\ [



.HODV9,,,60307V

6HPHVWHU

1. Ajak siswa untuk melakukan refleksi terhadap kegiatan belajar yang sudah dilalui
2. Periksalah apakah semua kelompok sudah mencatat hal-hal yang penting pada
kegiatan kali ini
3. Mintalah siswa untuk mengerjakan soal latihan yang ada di buku siswa.
74

Buku Guru Kelas VIII SMP/MTs

Semester 1

7XJDV
3URMHN

Merangkum

3DGDSHUWHPXDQDZDO%DELQLJXUXNDOLDQWHODKPHPEHULSHUPDLQDQWHEDNDQWDQJJDOODKLU*XUX
PHPLQWDNDOLDQXQWXNPHQJLNXWLLQVWUXNVLEHULNXW

Minta siswa untuk


membuat rangkuman
materi dari kegiatan
pembelajaran yang telah
didapatkan.

 0HQJDOLNDQWDQJJDODKLUGHQJDQ
 0HQDPEDKNDQKDVLOQ\DGHQJDQ
 0HQJDOLNDQKDVLOQ\DGHQJDQ
 0HQDPEDKNDQKDVLOQ\DGHQJDQ
 0HQJDOLNDQKDVLOQ\DGHQJDQ
 0HQDPEDKNDQGHQJDQEXODQODKLU
3URMHN
D &DULWDKXEDJDLPDQDFDUDJXUXNDOLDQPHQHEDNWDQJJDODKLUNDOLDQGHQJDQWHSDW
E %XDWODK WHEDNDQ ODLQ GHQJDQ DWXUDQ EHUEHGD LWX PLVDO WHQWDQJ WDQJJD ODKLU QRPRU KS
VHEDUDQJELODQJDQDWDX\DQJODLQ

. Untuk menjumlahkan/
mengurangkan bentuk
aljabar dengan bentuk
aljabar, jika terdapat
suku sejenis, maka
hasil penjumlahan/
pengurangannya bisa
disederhanakan dengan
menjumlahkan koefisien
dari suku sejenis tersebut.
Untuk perkalian, pada
suku yg dikalikan ada
variabel yang sama maka
ditulis dalam bentuk
pangkat.
Untuk pembagian, seperti
pada langkah-langkah
membagikan pada
kegiatan menalar.
Menjumlahkan/
mengurangkan suku-suku
sejenis, membagi bentuk
aljabar yang bisa dibagi.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

F 7HUDSNDQ WHEDNDQ \DQJ NDOLDQ EXDW XQWXN PHQJXML NHEHQDUDQ DWXUDQ WHEDNDQ \DQJ NDOLDQ
EXDW

0HUDQJNXP 

7XOLVNDQKDOKDOSHQWLQJ\DQJWHODKNDOLDQGDSDWNDQSDGD%DE2SHUDVL$OMDEDU
0LQLPDOUDQJNXPDQNDOLDQDGDODKMDZDEDQGDULSHUWDQ\DDQEHULNXW

 $SD \DQJ GL PDNVXG GHQJDQ YDULDEHO NRHVLHQ GDQ NRQVWDQWD" %XDWODK FRQWRK XQWXN
PHQMHODVNDQMDZDEDQNDOLDQ

 %DJDLPDQD FDUD PHQMXPODKNDQ PHQJXUDQJNDQ PHQJDOLNDQ PHPEDJL EHQWXN DOMDEDU"


-HODVNDQ
 %DJDLPDQDFDUDPHQ\HGHUKDQDNDQEHQWXNDOMDEDU"-HODVNDQ



ht

tp

://

0$7(0$7,.$

Suku adalah bagian dari bentuk aljabar yang dipisakan oleh tanda tambah atau
kurang.
Koefisien adalah faktor konstan pada suatu suku
Variabel adalah suatu simbol yang mewakili suatu nilai tertentu
Konstanta suku pada bentuk aljabar yang berupa bilangan/nilai tertentu.
2x +

suku

2 x +
suku

Koefisien

Variabel

4
Konstanta

MATEMATIKA

75

"

8ML
.RPSHWHQVL

 7HQWXNDQKDVLOSHQMXPODKDQEHQWXNDOMDEDU


D  [   GHQJDQ   [  

E  [   \   ] GHQJDQ   [   \   ]

F   [    [   GHQJDQ   [    [  

D  [   \ GDUL  [   \

E  [   \   GDUL  \   [  

F  [    [\   \  GDUL  [    [\   \ 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

 7HQWXNDQKDVLOSHQJXUDQJDQ

 WHQWXNDQKDVLOSHUNDOLDQGDUL


D   [   [   \

E   [   [  


F  [   [   [  

 7XOLVNDQEHQWXNDOMDEDU\DQJKLODQJGLVHWLDSOLQJNDUDQNRVRQJEHULNXW

P

P

ht

tp

://

P

 7HQWXNDQKDVLOEDJL


D  [    [   ROHK  [  



E  [   [  [   ROHK [  




F  [   [  [   ROHK  [   [  



76

.HODV9,,,60307V

Buku Guru Kelas VIII SMP/MTs

6HPHVWHU

Semester 1

 1\DWDNDQNHOLOLQJGDQOXDVEDQJXQEHULNXWGDODPEHQWXNDOMDEDU DGDVRDO\DQJPHQ\X


UXKPHQJKLWXQJNHOLOLQJGDODPEHQWXNDOMDEDUGLEDZDKLQLWOJGLKLODQJNDQKLODQJNDQ 
D
E
D
E
D
[
E
D
\
\

F

G

U
T

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

 6HGHUKDQDNDQEHQWXNDOMDEDUEHULNXW




D  [  [  [  

E DE  EF  ED  FE

F    [    [  

 7HQWXNDQEHQWXNSDOLQJVHGHUKDQDGDULEHQWXNDOMDEDUEHULNXW


D

E

F

[    [  


[  




[   [  

 6HGHUKDQDNDQEHQWXNDOMDEDUEHULNXW


D [      [ 

[ \

E \ [ 
 \ [

[
\

D   D

F E   E 
E   D

D   E

ht

tp

://

[   [  

0$7(0$7,.$



MATEMATIKA

77

 6HGHUKDQDNDQEHQWXNDOMDEDUEHULNXW

 D [   [   
[   

E  [  

[  [

F  [   [  
 [  [  

 %X 0DUKDZL PHPEHOL  NJ WHSXQJ  NJ ZRUWHO GDQ  NJ WRPDW .DUHQD WHUODOX ODPD
GLVLPSDQNJWHSXQJNJZRUWHOGDQNJWRPDWWHUQ\DWDUXVDNEXVXN7HQWXNDQWHSXQJ
ZRUWHOGDQWRPDW\DQJWHUVLVD-LNDKDUJDWHSXQJZRUWHOGDQWRPDWVHFDUDEHUXUXWDQDGDODK[
UXSLDK\UXSLDKGDQ]UXSLDKQ\DWDNDQKDUJDEDUDQJ\DQJGLEHOL%X0DUKDPLWHUVHEXWGDODP
EHQWXNDOMDEDU

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 7HQWXNDQNHOLOLQJGDQOXDVGDHUDKEHULNXWMLNDGLNHWDKXL[\ 

.id

 $UPDQPHPSXQ\DLEXDKURERWGDQEXDKPRELOPRELODQ-LND$UPDQGLEHULEXDKURERW
ROHKLEXGDQPRELOPRELODQQ\DLDEHULNDQNHSDGD$ULIEHUDSDVLVDURERWGDQPRELO$UPDQ
1\DWDNDQGDODPEHQWXNDOMDEDU

 6NHWVDODKVXDWXEDQJXQGDWDU\DQJNHOLOLQJQ\DGLQ\DWDNDQGDODPEHQWXNDOMDEDUEHULNXW
 D DE
 E [\
 F [\]

 6HRUDQJ DQDN PHUDKDVLDNDQ WLJD ELODQJDQ 'LD KDQ\D PHPEHUL WDKX MXPODK GDUL PDVLQJ GXD
ELODQJDQWHUVHEXWVHFDUDEHUWXUXWWXUXWDGDODK7HQWXNDQMXPODKNHWLJDELODQJDQWHUVHEXW
  
1LODL P   Q  
 0LVDONDQPGDQQDGDODKELODQJDQEXODWSRVLWLI\DQJPHPHQXKL 
P Q 
DGDODK

tp

://

 'LNHWDKXLELODQJDQEXODWSRVLWLIQPHPLOLNLVLIDWVLIDWEHULNXWPHPEDJLQPHPEDJLQ
PHPEDJLQPHPEDJLQPHPEDJLQPHPEDJLQGDQPHPEDJL
Q%LODQJDQEXODWSRVLWLISHUWDUQD\DQJPHPLOLNLVLIDWVLIDWLQLDGDODK7HQWXNDQELODQJDQ
EXODWSRVLWLINH\DQJPHPHQXKLVLIDWVLIDWWHUVHEXW

ht

 -LND ELODQJDQ EXODW [ GDQ \ GLEDJL  PDND EHUVLVD  -LND ELODQJDQ [\ GLEDJL  PDND
EHUVLVD
 'XD ELODQJDQ MXPODKQ\D  +DVLO NDOLQ\D  $NDQ GLFDUL VHOLVLKQ\D WDQSD PHQJKLWXQJ
ELODQJDQWHUVHEXW
D 1\DWDNDQ\DQJGLNHWDKXLGDODPEHQWXNDOMDEDU
E 1\DWDNDQ\DQJGLWDQ\DGDODPEHQWXNDOMDEDU
F 1\DWDNDQKXEXQJDQEHQWXNDOMDEDU\DQJGLWDQ\DGHQJDQEHQWXNDOMDEDU\DQJGLNHWDKXL



78

.HODV9,,,60307V

Buku Guru Kelas VIII SMP/MTs

6HPHVWHU

Semester 1

=+

SoalPengayaan

y x3
b. +
2
3y

c.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

aljabar dari:
a. 4x2 + x x2 + 2
c.
2(2x2 + 3x 4)
b. 2ab - 3bc + 5ba - 4cb
2. Jumlahkan bentuk aljabar dari:
a. 6x +5 dan 3x 6
c.
3 (2x2 4x + 5) dan 2 (4x2 + 3 x 7)
b. 6x 5y 2z dan 8x + 6y +9z
3. Kurangkanlah:
a. 5x 9y dari 7x + 15y
c.
x2 + 6xy + 3y2 dari 5x2 9xy 4y2
b. 5x 3y + 7 dari 5y 3x 4
4. Tentukan hasil perkalian dari:
a. 5x2 (6x 3y) c.
(x 5) (x2 4x + 20)
b. (2x 2)(x +5)
5. Sederhanakan bentuk aljabar berikut:
a.
10p8 q5 : 5 p7 q3

ht

tp

://

6. Usia Pak Abdul sekarang sama dengan 3 kali usia anak pertamanya, Udin. Pada 10
tahun mendatang jumlah usia mereka adalah 76 tahun. Berapakah usia Pak Abdul
saat Udin lahir?
7. Pak Tohir memiliki sebidang tanah berbentuk persegi dengan sisi-sisinya

Di tanah tersebut ia akan membuat kolam ikan berbentuk persegi dengan sisi-sisinya
. Jika ia menyisakan tanah itu seluas 28 m2, maka berapakah luas
tanah Pak
Tohir sebenarnya?
8. Diketahui suatu segitiga dengan alas
cm dan
cm2 luasnya .
a. Tentukan tinggi segitiga dalam variabel .
b. Jika
, tentukan ukuran segitiga tersebut.
9. Selisih 2 bilangan positif adalah 5. Jumlah kuadratnya sama dengan 2.100 kurangnya dari kuadrat jumlah kedua bilangan itu. Jumlah kedua bilangan itu adalah .
10. Bilangan 45 dapat dinyatakan sebagai selisih dari bilangan kuadrat, yakni,
dengan a dan b adalah bilangan asli. Semua pasangan bilangan asli a dan b

yang memenuhi persamaan a2 b2 adalah....
11. Diketahui a dan b adalah digit-digit pada bilangan ab dan ba, sehingga. Berapakah
nilai dari a2 + b2 ?
12. Diketahui a dan b adalah digit-digit pada bilangan dua digit ab dan ba,
sehingga (ab)2 (ba)2 = 1.089. Berapakah nilai dari a2 + b2 ?
MATEMATIKA

79

Pedoman
Penilaian
Capaian
B

Keterangan
Bila Buku Siswa terselesaikan dengan baik

<B

Bila ada bagian dari Buku Siswa yang tidak


terselesaikan

Portofolio:
a) Uji Kompetensi
b) Soal dari tempat
lain

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan mampu menyelesaikannya dengan
baik

B+

Bila memilih soal dari Uji Kompetensi dengan


kategori Sedang dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Mudah dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan kurang mampu
menyelesaikannya dengan baik

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Aspek Penilaian
Keterselesaian Buku
Siswa

.id

No
1

B , B
B+, B,
B

Bila memilih soal dari Uji Kompetensi


A, B+ , dengan kategori Mudah dan kurang mampu
B, B menyelesaikannya dengan baik
Bila Proyek terselesaikan dan manpu
A
mempresentasikan dengan Baik
A, B+, Bila ada bagian dari Proyek yang tidak terselesaikan
atau kurang mampu mempresentasikan
B

://

ht

tp

Tugas Projek

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan kurang mampu menyelesaikannya
dengan baik
Bila memilih soal dari Uji Kompetensi
dengan kategori Sedang dan kurang mampu
menyelesaikannya dengan baik

Bila Proyek tidak terselesaikan samasekali

Keterangan: - Nilai KKM = B




80

- Aspek penilaian Nomor 1 adalah syarat nilai yang


harus terpenuhi, sedangkan Aspek penilaian Nomor 2
adalah penambahan nilai.

Buku Guru Kelas VIII SMP/MTs

Semester 1

Bab 3

Fungsi

Relasi
Fungsi
Diagram Panah
Tabel
Grak
Rumus
Fungsi

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Kata Kunci

K ompetensi
D asar

Menyajikan fungsi dalam


berbagai bentuk relasi,
pasangan terurut, rumus
fungsi, tabel, grak, dan
diagram.

Sumber: Dokumen Kemdikbud

Pengalaman
Belajar

://

tp

2.
3.
4.

Menjelaskan dengan kata-kata dan menyatakan masalah sehari-hari yang berkaitan dengan
relasi dan fungsi.
Menyatakan suatu fungsi dengan notasi dan rumus.
Menyusun tabel pasangan nilai peubah dengan nilai fungsi.
Menggambar grak fungsi pada koordinat Cartesius.

ht

1.

Perhatikan gambar sekelompok siswa yang sedang menerima


pelajaran di suatu kelas. Setiap siswa menempati kursinya
masing-masing. Tidak mungkin seorang siswa menempati lebih
dari satu kursi. Demikian pula tidak mungkin satu kursi ditempati
oleh lebih dari satu siswa. Dengan demikian, ada keterkaitan
antara siswa dengan kursi yang ditempati. Menurutmu, apakah
hal ini termasuk fungsi?

Kurikulum 2013

Kelas VIII Semester


I
71
MATEMATIKA

81

Peta
Konsep

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Operasi
Aljabar

Bentuk Simbolik

Pengurangan

Perkalian

Pembagian

Penyederhanaan
Bentuk Aljabar

ht

tp

://

Penjumlahan

Bentuk Verbal

82

Buku Guru Kelas VIII SMP/MTs


34

Kelas VIII SMP/MTs

Semester 1
Semester 1

Revisi Total Setting 6


Galileo

Secara kasat mata, banyaknya titik


pada lingkaran pertama mestinya lebih
banyak bahkan mungkin dua kali
lebih banyak dari banyaknya titik pada
lingkaran kedua. Tapi, dia mampu
membuat pemetaan atau fungsi yang
menunjukkan bahwa banyaknya titik
pada kedua lingkaran itu sama.

.g
o

Galileo
(1564 - 1642)

.id

d
:// D e
bs iu r
n
e
Su .ke bduhSe
hamdy da ttin
rnikbu ri g
od

Galileo dipandang sebagai salah seorang


pakar awal tentang Fungsi. Karyanya
juga menunjukkan bahwa beliau orang
yang mula-mula mengangkat konsep
pemetaan antar himpunan. Pada tahun
1638, beliau mempelajari masalah
tentang dua lingkaran yang konsentris
(memiliki pusat yang sama) dengan
pusat di O. Diameter lingkaran pertama
dua kali lebih panjang dari diameter
lingkaran kedua.

Un

Galileo termasuk orang yang tidak mau begitu saja menerima suatu kenyataan. Dia
selalu mempertanyakan kebenaran suatu fenomena. Bahkan dia berani mengambil
sikap yang berlainan dengan sikap kebanyakan orang pada jamannya. Bahkan dia juga
berani berbeda pendapat dengan para pemimpin yang berkuasa. Dia mengenalkan teori
Heliosentrisnya yang mengatakan bumilah yang mengitari matahari, bukan matahari
yang mengitari bumi. Sayangnya, dia tidak mampu meyakinkan secara ilmiah kebenaran
pendapatnya sehingga dia dihukum.
Beberapa hikmah yang mungkin bisa kita petik antara lain:

Kita harus jeli melakukan pengamatan terhadap fenomena yang ada di sekitar kita.

2.

Kita harus mau dan mampu mempertanyakan kebenaran fenomena yang ada. Kita
tidak boleh hanya diam diri menerima kenyataan yang ada. Kita harus membiasakan
diri kita untuk selalu menanya, misalnya: Mengapa begini? Mengapa bukan
Begitu? Kalau dikondisikan begini apa jadinya? Bagaimana kalau dibuat begini?
Apa yang terjadi kalau diubah ininya?

3.

4.

ht

tp

1.

Kita harus teguh pada pendirian, kalau diyakini itu memang benar, tak terbantahkan.
Tetapi, kita harus tetap terbuka dengan segala kritik dan saran demi perbaikan
kesimpulan kita.
Kalau kita ingin selamat, di samping pandai, kita juga harus pintar
mengkomunikasikan ide dengan justikasi yang lengkap, serta dilakukan secara
sopan, santun, dan meyakinkan.

MATEMATIKA
73
83

83

Membelajarkan 3.1

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Memahami Ciri-Ciri Fungsi

Sebelum Pelaksanaan Kegiatan

1. Amati dan kenali lebih duhulu contoh pesan yang teridiri dari kode
sandi, berikut kegunaannya
2. Bentuk siswa menjadi kelompok kecil (3-4 orang) yang
memungkinkan belajar secara efektif

3. Siapkan contoh-contoh pertanyaan, misalnya bagaimana cara untuk


mengetahui kode sandi?
4. Identifikasi siswa-siswa yang biasanya agak sulit membuat pertanyaan
5. Identifikasi pula bentuk bantuan apa yang perlu diberikan agar siswa
akhirnya mampu membuat pertanyaan

tp

://

6. Sediakan tabel-tabel yang diperlukan bagi siswa untuk mengisikan


hasil kerjanya

ht

7. Sediakan kertas HVS secukupnya


8. Mungkin perlu diberikan contoh kritik, komentar, saran, atau
pertanyaan terhadap suatu karya agar siswa bisa meniru dan
mengembangkan lebih jauh sesuai dengan materinya

84

Buku Guru Kelas VIII SMP/MTs

Semester 1

.DUDNWHULVWLN
)XQJVL
%LVDNDKNDOLDQPHPDKDPLSHVDQEHULNXW

EG
IOT
T

[

Q
GZ
RON
JO

GETOIT[Q
ZGNOR
OJ
MG]GN
ZUV
XG]GS

.id

Apersepsi

Kenalkan siswa contoh


pesan yang terdiri dari kode
sandi.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

GN
HG]
VUZ
GX
SG]

*DPEDU6HVHRUDQJVHGDQJPHPEDFDVDQGL

Diberitahukan bahwa sandi


tersebut akan bisa ditebak
jika ada pola bentuk sandi
seperti pada tabel

7DQSDPHQJHWDKXLNRGHVDQGLQ\DSHVDQGLDWDVWHQWXWLGDNELVDGLPHQJHUWL/DLQKDOQ\DMLNDNLWD
SXQ\DNRGHSHVDQGLEHULNXW
$

&

'

0 1

: ;

<

$UWLQ\DKXUXI$GLWXOLVVHEDJDLGKXUXI%GLWXOLVVHEDJDLHKXUXI&GLWXOLVVHEDJDLIGOOPDNDVDQGL
VDQGLGLDWDVDUWLQ\DDGDODK
.81&,1<$/,+$7',%$:$+3270$:$5

0DNDVHNDUDQJSHVDQLWXPHPLOLNLPDNQD\DQJMHODV
'LGDODPNHKLGXSDQVHKDULKDULVHVHRUDQJNDGDQJNDODPHUDKDVLDNDQSHVDQ\DQJLQJLQGLVDPSDLNDQ
'LDWLGDNLQJLQSHVDQQ\DGHQJDQPXGDKELVDGLEDFDROHKRUDQJODLQDSDODJLROHKRUDQJ\DQJWLGDN
GLLQJLQNDQ

6HPHVWHU

.HODV9,,,60307V

://



W X

ht

tp

Guru meminta siswa untuk memahami kode sandi dengan model seperti tabel berikut:
a

Tabel-tebel tersebut mempunyai arti bahwa huruf A ditulis sebagai d, huruf B ditulis
sebagai e, huruf C ditulis sebagai f dan seterusnya, sehingga sandi-sandi di atas artinya
adalah:
KUNCINYA LIHAT DI BAWAH POT MAWAR
Dengan demikian pesan-pesan di atas sudah memiliki makna yang jelas, karena
aturannya sudah diketahui. Kode sandi seperti ini seringkali kita jumpai pada kegiatan
pramuka. Contohnya adalah sandi morse, sandi semaphore, sandi rumput, sandi abjad,
sandi angka, sandi baca silang, sandi lingkaran, sandi balik, sandi jam, sandi kompas,
sandi gambar, sandi tanggal, dan lain-lain.
MATEMATIKA

85

.HJLDWDQ 

0HPDKDPL&LULFLUL)XQJVL

)XQJVL PHUXSDNDQ VDODK VDWX NRQVHS SHQWLQJ GDODP PDWHPDWLND 'HQJDQ PHQJHQDOL IXQJVL DWDX
KXEXQJDQ IXQJVLRQDO DQWDU XQVXUXQVXU PDWHPDWLND NLWD ELVD OHELK PXGDK PHPDKDPL VXDWX
SHUPDVDODKDQ GDQ PHQ\HOHVDLNDQQ\D .DUHQD LWX PHPDKDPL IXQJVL PHUXSDNDQ KDO \DQJ VDQJDW
GLKDUDSNDQGDODPEHODMDUPDWHPDWLND
3HUWDPDNDOLPDULNLWDSHODMDULFLULFLULGDULVXDWXIXQJVL
3HUKDWLNDQDWXUDQPHPEXDWVDQGLVHEDJDLEHULNXW
$WXUDQ
$

&

'

0 1

: ;

<

$WXUDQ
$

&

'

0 1

: ;

<

$WXUDQ
$

&

'

0 1

: ;

<

&

'

0 1

: ;

<

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

$WXUDQ

3HUKDWLNDQSXODNDWDNDWDEHULNXW
 6HOLGLNL
 6LDSD
 6HEHQDUQ\D
 6L8GLQ

&REDOHQJNDSLWDEHOEHULNXW EROHKGLNHUWDVNHUMDWHUSLVDK GHQJDQNDWDNDWDVDQGL\DQJPXQJNLQ


WHUWDPSDNNDQ
.DWD$VOL

'DIWDU6HPXD.DWD6DQGL\DQJ0XQJNLQ'LKDVLONDQ%LOD0HQJJXQDNDQ
$WXUDQ

$WXUDQ

$WXUDQ

$WXUDQ

6HOLGLNL
6LDSD

6HEHQDUQ\D
6L8GLQ

Apersepsi

3HUKDWLNDQGHQJDQVHNVDPDDSDNDKNDWDVDQGLVHWLDSNDWDEHUVLIDWWXQJJDO0DNVXGQ\D$SDNDK
VHWLDSNDWDGLVDQGLNDQKDQ\DGHQJDQVDWXVDQGLVDMD"

0$7(0$7,.$

ht

tp

://

1. Informasikan tugas yang


akan mereka kerjakan
(yaitu akan mempelajari
aturan membuat pesan),
maksimal 20 menit dan
aturan mainnya sejelas
mungkin sebelum
mereka mengamati.
2. Minta siswa untuk
memperhatikan dengan
teliti pada modelmodel sandi yang ada
pada tabel, kemudian
melengkapi isi tabel
dengan pendampingan
terbimbing.
86

Buku Guru Kelas VIII SMP/MTs

Semester 1



.DODXNDOLDQPHQJHUMDNDQGHQJDQVXQJJXKVXQJJXKEHEHUDSDVDQGL\DQJPXQJNLQGLKDVLONDQGDSDW
GLOLKDWSDGDWDEHOEHULNXW
'DIWDU6HPXD.DWD6DQGL\DQJ0XQJNLQ'LKDVLONDQ%LOD0HQJJXQDNDQ

.DWD$VOL

$WXUDQ

$WXUDQ

$WXUDQ

$WXUDQ

YKROJOQO

6HOLGLNL

GGDDD

6LDSD

KY\YP]LPE]

6HEHQDUQ\D


6L8GLQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

6HEDJDLRUDQJ\DQJNULWLVGDQNUHDWLINLWDELVDPHQJDMXNDQEHEHUDSDSHUWDQ\DDQ6HEDJDLFRQWRK
 0DQDNDK GDUL DWXUDQ  VDPSDL GHQJDQ DWXUDQ  WHUVHEXW \DQJ SDOLQJ EDLN GLJXQDNDQ XQWXN
PHPEXDWNDWDVDQGL"0HQJDSD"
 'HQJDQDWXUDQNDWD6,$3$GLVDQGLNDQPHQMDGLGGDDD$SDNHXQJJXODQGDQNHNXUDQJDQ
GDULDWXUDQSHQ\DQGLDQLQL"

.id

&REDOHQJNDSLWDEHOGLDWDV

&REDNDOLDQUXPXVNDQVHGLNLWQ\DSHUWDQ\DDQODLQWHUNDLWGHQJDQDWXUDQSHQ\DQGLDQGLDWDV.DODX
ELVDXSD\DNDQSHUWDQ\DDQNDOLDQPHPXDWNDWDNDWDVDQGLGDQSLOLKDQPX
0DVDODK 

$WXUDQ\DQJPHQJKXEXQJNDQKLPSXQDQ^$%&=`NHKLPSXQDQ^DEF]`PHUXSDNDQ
IXQJVLGDULKLPSXQDQ^$%&=`NHKLPSXQDQ^DEF]`'HPLNLDQSXODGHQJDQDWXUDQ
\DQJ PHQJKXEXQJNDQ KLPSXQDQ^$ % &  =` NH KLPSXQDQ ^D E F G` GDQ DWXUDQ \DQJ
PHQJKXEXQJNDQKLPSXQDQ^$%&=`NHKLPSXQDQ^`
$NDQWHWDSLVHEDOLNQ\DDWXUDQ\DQJPHQJKXEXQJNDQKLPSXQDQ^DEFG`NHKLPSXQDQ^$%&
=`DGDODKEXNDQIXQJVLGDULKLPSXQDQ^DEFG`NHKLPSXQDQ^$%&=`$WXUDQ\DQJ
PHQJKXEXQJNDQKLPSXQDQ^`NHKLPSXQDQ^$%&=`MXJDEXNDQ
PHUXSDNDQIXQJVL
6HEDJDLJHQHUDVLPXGD\DQJNULWLVGDQNUHDWLIWHQWXNDOLDQKDUXVPHPSHUWDQ\DNDQ6HEDJDLFRQWRK
NDOLDQELVDPHQJDMXNDQSHUWDQ\DDQ

://

 $JDUVXDWXDWXUDQELVDGLVHEXWIXQJVLGDULKLPSXQDQ$NHSDGDKLPSXQDQ%DSDVDMDV\DUDW\DQJ
KDUXVGLSHQXKL"
 -LNDVXDWXDWXUDQPHUXSDNDQIXQJVLGDULKLPSXQDQ$NHSDGDKLPSXQDQ%DSDNDKNHEDOLNDQQ\D
MXJDPHUXSDNDQIXQJVLGDULKLPSXQDQ%NHSDGDKLPSXQDQ$"

ht

tp

1DK FRED EXDWODK PLQLPDO WLJD SHUWDQ\DDQ ODJL WHQWDQJ IXQJVL 8SD\DNDQ SHUWDQ\DDQ NDOLDQ
PHPXDWVHGLNLWQ\DNDWDNDWDVHPXDDQJJRWDKLPSXQDQ$VHPXDDQJJRWDKLPSXQDQ%GDQDWDX
IXQJVLGDULKLPSXQDQ$NHSDGDKLPSXQDQ%



.HODV9,,,60307V

6HPHVWHU

Ajak siswa untuk memahami Masalah


3.1 mengenai fungsi dan bukan fungsi

MATEMATIKA

87

$OWHUQDWLI3HPHFDKDQ0DVDODK
$\R
.LWD$PDWL
$WXUDQ\DQJPHQJKXEXQJNDQDQWDUDXQVXUXQVXUGDULGXDKLPSXQDQVHFDUDPDWHPDWLVELDVDGLVHEXW
GHQJDQLVWLODKUHODVL.DUHQDLWXDWXUDQDWXUDQVDPSDLGHQJDQWHUVHEXWDGDODKUHODVL
$NDQWHWDSLDWXUDQDWXUDQSHQ\DQGLDQWHUVHEXWEXNDQKDQ\DVHNHGDUUHODVL$WXUDQLWXOHELKWHSDWGLVHEXW
VHEDJDLIXQJVLGDULKLPSXQDQ^$%&'=`NHKLPSXQDQ^DEFG]`DWDXGDULKLPSXQDQ^$
%&'=`NHKLPSXQDQ^`DWDXGDULKLPSXQDQ^$%&'=`NHKLPSXQDQ
^DEFG`
1DKXQWXNPHPDKDPLNRQVHSIXQJVLSHUKDWLNDQGHQJDQVHNVDPDNDVXVNDVXVEHULNXW
0LVDONDQNLWDPHPSXQ\DLGXDKLPSXQDQ\DLWX$ ^`GDQKLPSXQDQ% ^DE`%HULNXW
EHEHUDSDUHODVL\DQJPXQJNLQWHUMDGLDQWDUDDQJJRWDDQJJRWDKLPSXQDQ$GHQJDQDQJJRWDDQJJRWD
KLPSXQDQ%
 ^ D `
 ^ E `
 ^ E `
 ^ D `
 ^ E `

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 ^ D  E `

.id

 ^ D `

 ^ D  E `


 ^ E  D `
 ^ E  D `
 ^ D  E `

Ayo
Kita Amati

 ^ E  D `

 ^ D  D  D `

 ^ D  D  E `


 ^ D  E  D `

 ^ D  E  E `

 ^ E  E  E `


 ^ E  E  D `
 ^ E  D  E `
 ^ E  D  D `

'DULUHODVLGLDWDV\DQJELVDGLNDWHJRULNDQVHEDJDLIXQJVLGDULKLPSXQDQ$NHKLPSXQDQ%DGDODK
UHODVLQRPRUGDQ-DGLKDQ\DDGDVHEDQ\DNIXQJVL
6HOHELKQ\DGDULFRQWRKGLDWDVWLGDNPHPHQXKLV\DUDWXQWXNGLNDWDNDQVHEDJDLIXQJVLGDUL$NH%

0$7(0$7,.$

ht

tp

://

1. Ajak siswa untuk


memperhatikan dan
memahami Masalah 3.1
2. Himbaulah siswa
untuk memperhatikan
tentang aturan yang
memasangkan suatu
himpunan.
3. Ajak siswa untuk
memahami beberapa
contoh tentang daerah
asal dan daerah hasil
serta rumus suatu fungsi.
4. Minta siswa untuk
mengamati aturan yang
menghubungkan antara
unsur-unsur dari dua
himpunan dan untuk
memahami konsep
fungsi melalui kasuskasus yang diberikan
pada buku siswa.
5. Minta siswa untuk
memahami beberapa
contoh tentang daerah
asal dan daerah hasil
serta rumus suatu fungsi.
88

Buku Guru Kelas VIII SMP/MTs

Semester 1



8QWXNPHPDKDPLFLULFLULGDULVXDWXIXQJVLVHEDLNQ\DSHUKDWLNDQXUDLDQEHULNXW
<DQJELVDPHQMDGLIXQJVLGDUL% ^DE`NH$ ^`DGDODK
 ^ D  E `
 ^ D  E `
 ^ D  E `
 ^ D  E `
 ^ D  E `
 ^ D  E `
 ^ D  E `
 ^ D  E `
 ^ D  E `

.id

3HUOXNDOLDQNHWDKXLGDODPNRQWHNVIXQJVLGDUL+LPSXQDQ$NH+LPSXQDQ%PDND+LPSXQDQ$
GLVHEXW'DHUDK$VDODWDX'RPDLQGDQ+LPSXQDQ%GLVHEXWGHQJDQ'DHUDK.DZDQDWDX.RGRPDLQ
GDULIXQJVLWHUVHEXW

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

&RQWRK 
.DODXKLPSXQDQSDVDQJDQEHUXUXWDQ^ D  D  D `PHUXSDNDQIXQJVLGDUL^`NH^DE`
PDND'RPDLQGDQ.RGRPDLQGDULIXQJVLLQLEHUWXUXWWXUXWDGDODK^`GDQ^DE`
&RQWRK 

.DODXKLPSXQDQSDVDQJDQEHUXUXWDQ^ D  E `PHUXSDNDQIXQJVLGDUL^DE`NH^`


PDND'RPDLQGDQ.RGRPDLQGDULIXQJVLLQLEHUWXUXWWXUXWDGDODK^DE`GDQ^`

0XQJNLQNDOLDQEHUWDQ\DOKRSDGDIXQJVL^ D  D  D `VHSHUWLSDGD&RQWRKGLDWDV


VDPDVHNDOLWLGDNGLVHEXWKXUXIE0HQJDSD.RGRPDLQQ\DWHWDS^DE`"0HQJDSDWLGDN^D`VDMD"
3HUWDQ\DDQNDOLDQLQLSHQWLQJ

'DODPNRQWHNVIXQJVL^ D  D  D `GDUL^`NH^DE`KLPSXQDQVHPXDDQJJRWD


.RGRPDLQ \DQJ PHQMDGL SDVDQJDQ GDUL DQJJRWDDQJJRWD KLPSXQDQ 'RPDLQ PHPLOLNL LVWLODK
WHUVHQGLUL\DLWX'DHUDK+DVLODWDX5DQJH

://

-LNDI ^ D  E  F  E `DGDODKIXQJVLGDUL^`NHKLPSXQDQ^DEF`PDND


I   D
%HQWXNWHUDNKLULQLGLEDFDGHQJDQED\DQJDQGDULROHKIXQJVLIDGDODKDDWDXQLODLGDULI  
DGDODKD

tp

-LNDNLWDFDULQLODLGDULVHWLDSDQJJRWDGRPDLQGLSHUROHKI   DI   EI   FGDQI   E.DODX


GLNXPSXONDQVHPXDQ\DLQL^I  I  I  I  ` ^DEF`

ht

+LPSXQDQVHPXDQLODLIXQJVLDWDXKLPSXQDQVHPXDED\DQJDQLQLODK\DQJGLVHEXWGHQJDQ'DHUDK
+DVLODWDX5DQJH



.HODV9,,,60307V

6HPHVWHU

Ajak siswa untuk memahami Contoh 3.1


dan 3.2 serta alternatif penyelesaiannya

MATEMATIKA

89

.DUHQDLWXSDGDNRQWHNVIXQJVL^ D  E `GDUL^DE`NH^`'RPDLQQ\DDGDODK^DE`


.RGRPDLQQ\DDGDODK^`GDQ5DQJHQ\DDGDODK^`
3HPDKDPDQDNDQQLODLIXQJVLLQLVHULQJNDOLGLSHUOXNDQXQWXNPHUXPXVNDQEHQWXNIXQJVL
&RQWRK 
6XDWX IXQJVL OLQLHU I PHPLOLNL QLODL  SDGD ZDNWX [   GDQ PHPLOLNL QLODL  SDGD ZDNWX [  
7HQWXNDQUXPXVIXQJVLQ\D
$OWHUQDWLI
3HQ\HOHVDLDQ
8QWXNPHQHQWXNDQUXPXVIXQJVLGDULVXDWXIXQJVLOLQLHUIPHPLOLNLQLODLSDGDZDNWX[ GDQ
PHPLOLNLQLODLSDGDZDNWX[ ODNXNDQSURVHGXUEHULNXW

.id

/DQJNDK

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

'DULVRDOWHUVHEXWGLNHWDKXLEDKZDIXQJVLIDGDODKIXQJVLOLQLHU.DUHQDLWXIXQJVLIELVDGLQ\DWDNDQ
GHQJDQUXPXVI [  D[E
/DQJNDK

'LNHWDKXLOHELKODQMXWEDKZDI   GDQI   
I [  D[EPDNDI   D  E
DE





I   D  E 


DE



/DQJNDK

GDULSHUVDPDDQ  GDQ  GLSHUROHK








DE



DE



D



D



/DQJNDK

GDULD GLVXEVWLWXVLNDQNHVDODKVDWXSHUVDPDDQPLVDONDQSHUVDPDDQ 


DE



E





E





E



://

tp

'HQJDQGHPLNLDQQLODLD GDQE 
[

ht

-DGLUXPXVIXQJVLQ\DDGDODKI [ 

0$7(0$7,.$

Ajak siswa untuk memahami Contoh 3.3 serta alternatif


penyelesaiannya
90

Buku Guru Kelas VIII SMP/MTs

Semester 1



3HPDKDPDQDNDQQLODLIXQJVLMXJDDNDQPHPEDQWXNLWDPHQHQWXNDQ'DHUDK+DVLODWDX5DQJHGDUL
IXQJVL\DQJGLGHQLVLNDQSDGDKLPSXQDQELODQJDQUHDO
&RQWRK 
'DHUDKDVDOIXQJVLIGDUL[NH[DGDODK^[_[[5`7HQWXNDQODKGDHUDKKDVLOQ\D
.HWHUDQJDQ[5[DQJJRWDKLPSXQDQEDJLDQGDUL%LODQJDQ5HDO
$OWHUQDWLI
3HQ\HOHVDLDQ
8QWXNPHQHQWXNDQGDHUDKKDVLOGDULGDHUDKDVDOIXQJVLIGDUL[NH[DGDODK^[_[[5`
ODNXNDQSURVHGXUEHULNXW
/DQJNDK
'LNHWDKXLGDHUDKDVDO[IGDUL[NH[
/DQJNDK
0HQJXEDKEHQWXN[NHGDODPEHQWXN[\DLWXVHEDJDLEHLNXW

GLNDOLNDQ

[

GLWDPEDK

[
/DQJNDK

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

[

.id

[

'DULEHQWXN[GLNHWDKXLUXPXVIXQJVLI [  [VHKLQJJD
I [ 
-DGLGDHUDKKDVLOQ\DDGDODK

"

$\R.LWD
0HQDQ\D

^I [ _I [ `

6HNDUDQJFREDODKXQWXNPHPEXDWSHUWDQ\DDQ\DQJPHPXDWNDWDNDWDEHULNXW"
 )XQJVLGDUL$NH%$QJJRWD$VHODOXGLSDVDQJNDQDQJJRWD%
 )XQJVLGDUL$NH%DQJJRWD$WLGDNGLSDVDQJNDQDQJJRWD%

 )XQJVLGDUL$NH%DQJJRWD$GLSDVDQJNDQOHELKGDULVDWXDQJJRWD%

6HPHVWHU

tp

://

.HODV9,,,60307V

ht



Ayo Kita
Menanya

1. Jelaskan tugas
berikutnya, yaitu
membuat pertanyaan
kalau perlu modelkan
salah satu pertanyaan
2. Beri kesempatan
kepada mereka
untuk menuliskan
pertanyaannya
3. Sepakati satu atau dua
pertanyaan dan tuliskan
di papan, Suruh siswa
menjalankan rencana
yang telah disepakati.
Contoh:
Jika f adalah fungsi
dari A ke B, apakah ada
anggota dari A yang tidak
dipasangkan dengan
anggota B?

MATEMATIKA

91

Ayo Kita
Menalar

$\R.LWD
0HQJJDOL,QIRUPDVL

'DULVHNLDQSHUWDQ\DDQ\DQJNDOLDQEHUKDVLOEXDWPXQJNLQDGDGLDQWDUDQ\DSHUWDQ\DDQSHUWDQ\DDQ
EHULNXW
 -LNDIDGDODKIXQJVLGDUL$NH%DSDNDKVHWLDSDQJJRWDGDUL$VHODOXGLSDVDQJNDQGHQJDQWHSDW
VDWXDQJJRWD%"
 -LNDIDGDODKIXQJVLGDUL$NH%DSDNDKDGDDQJJRWD$\DQJWLGDNGLSDVDQJNDQGHQJDQVDWX
SXQDQJJRWDGDUL%"
 -LNDIDGDODKIXQJVLGDUL$NH%DSDNDKDGDDQJJRWD$\DQJGLSDVDQJNDQGHQJDQOHELKGDUL
VDWXDQJJRWD%"
8QWXNPHQMDZDESHUWDQ\DDQSHUWDQ\DDQWHUVHEXWFREDODKNDMLFRQWRKFRQWRKIXQJVL\DQJWHODK
GLEHULNDQGLDWDV
%XDWODKGXJDDQWHQWDQJFLULFLULGDULVXDWXIXQJVLGDQWXOLVNDQGXJDDQWHUVHEXWGLNHUWDVNDOLDQ
PDVLQJPDVLQJ
6HODQMXWQ\D FREDODK NDOLDQ GLVNXVLNDQ GHQJDQ WHPDQ VHEDQJNX NDOLDQ IXQJVLIXQJVL \DQJ
PXQJNLQGLEHQWXNGDUL
 ^`NH^FG`
 ^FG`NH^`

$\R.LWD
0HQDODU

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

1. Ajak siswa untuk


melakukan kegiatan
menggali informasi
tentang kemungkinankemungkinan
pertanyaan yang kalian
buat.
2. Himbaulah siswa untuk
membuat ciri-ciri
dari suatu fungsi dan
mencoba fungsi-fungsi
yang terbentuk dari dari
dua himpunan yang
sudah disediakan pada
buku siswa.

.id

Menggali
Informasi

=+

&RQWRKIXQJVL

&RQWRKEXNDQIXQJVL

 ^ D  D  D `

 ^ D  D  E `

 ^ E  E  E `

 ^ E  E  E `

 ^ D  D  E `

 ^ D  E  E `

 ^ D  E  D `

 ^ D  E  D `

 ^ D  E  E `

 ^ D  E  F `

 ^ E  D  D `

 ^ E  D  E `

 ^ E  E  D `

 ^ D  E  F `

 ^ E  D  E `

 ^ E  D  E `

&REDSXVDWNDQSHUKDWLDQNLWDNHSDGDGXDKDO

 DSDNDKVHWLDSDQJJRWD$GLSDVDQJNDQGHQJDQDQJJRWDGL%"GDQ
 EHUDSDDQJJRWD%\DQJGLKXEXQJNDQGHQJDQVDWXDQJJRWD$"

0$7(0$7,.$

ht

tp

://

1. Ajak siswa berdiskusi


untuk memahami
contog fungsi dan bukan
contoh fungsi dari dua
himpuanan yang telah
disediakan pada buku
siswa.
2. Informasikan kepada
siswa bahwa fokus
jawabannya pada dua
pertanyaan yang telah
disediakan

3HUKDWLNDQ&RQWRKGDQ%XNDQ&RQWRKIXQJVLIXQJVLGDULKLPSXQDQ$ ^`NHKLPSXQDQ% 
^DE`EHULNXW

Apakah setiap anggota A dihubungkan dengan anggota di B?


Iya, untuk contoh fungsi: bahwa setiap anggota A dihubungkan dengan anggota B
Tidak, untuk contoh bukan fungsi: Karena contoh 1 sampai dengan contoh 8 ada
anggota dari himpunan A tidak dihubugkan dengan anggota himpuan di B.
Berapa anggota B yang dihubungkan dengan satu anggota A?
Untuk contoh fungsi; ada sebanyak 2, yaitu nomor 5 dan 7
untuk contoh bukan fungsi; ada sebanyak 2, yaitu nomor 5 dan 7
92

Buku Guru Kelas VIII SMP/MTs

Semester 1



&RQWRK)XQJVL

^ D  D  D `

^ E  E  E `

^ D  D  E `

^ D  E  D `

^ D  E  E `

^ E  D  D `

^ E  E  D `

^ E  D  E `

1R

&RQWRK%XNDQ)XQJVL

$SDNDKVHWLDSDQJJRWD$
VHODOXGLSDVDQJNDQGHQJDQ
DQJJRWD%"
<$7,'$.

$SDNDKSDVDQJDQGDULVHWLDS
DQJJRWDGRPDLQKDQ\DVDWX
VDMDGL.RGRPDLQ
<$7,'$.

$SDNDKVHWLDSDQJJRWD$
VHODOXGLSDVDQJNDQGHQJDQ
DQJJRWD%"
 <$7,'$.

$SDNDKSDVDQJDQGDULVHWLDS
DQJJRWDGRPDLQKDQ\DVDWX
VDMDGL.RGRPDLQ
<$7,'$.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

1R

.id

.HPXGLDQOHQJNDSLODKWDEHOEHULNXW

^ D  D  E `

^ E  E  E `

^ D  E  E `

^ D  E  D `

^ D  E  F `

^ E  D  E `

^ D  E  F `

^ E  D  E `

7XOLVNDQVLPSXODQNDOLDQSDGDOHPEDUSHQJDPDWDQNDOLDQ



.HODV9,,,60307V

6HPHVWHU

Himpunan B ke himpunan A
{(a, p),(b, p)}
{(a, p),(b, q)}
{(a, p),(b, r)}
{(a, q),(b, s)}
{(a, q),(a, r)}
{(a, r),(b, t)}
{(b, s),(b, r), (a, p)}
{(a, p),(b, q), (a, t)}

ht

No.
1
2
3
4
5
6
7
8

tp

://

Berikut kemungkinan jawaban yang merupakan fungsi atau bukan fungsi dari himpunan B
= {a, b} ke himpunan A = {p, q, r, s}

Fungsi/Bukan Fungsi
Fungsi
Fungsi
Fungsi
Fungsi
Bukan Fungsi
Fungsi
Bukan Fungsi
Bukan Fungsi
MATEMATIKA

93

Alternatif
Jawaban
Berikut kemungkinan jawaban yang terdapat pada tabel, berdasarkan aturan pemasangan
dari himpunan A = {1, 2, 3} ke himpunan B = {a, b}.

1
2
3
4
5
6
7
8

{(1, a), (2, a), (3, a)}


{(1, b), (2, b), (3, b)}
{(1, a), (2, a), (3, b)}
{(1, a), (2, b), (3, a)}
{(1, a), (2, b), (3, b)}
{(1, b), (2, a), (3, a)}
{(1, b), (2, b), (3, a)}
{(1, b), (2, a), (3, b)}

No. Contoh Bukan Fungsi

tp

://

{(1, a), (2, a), (2, b)}


{(1, b), (2, b), (2, b)}
{(1, a), (1, b), (3, b)}
{(2, a), (2, b), (3, a)}
{(2, a), (2, b), (2, c)}
{(1, b), (2, a), (2, b)}
{(3, a), (3, b), (3, c)}
{(1, b), (2, a), (3, b)}

ht

1
2
3
4
5
6
7
8

Apakah setiap anggota


A selalu dipasangkan
dengan anggota B?
(Ya/Tidak)
Tidak
Tidak
Tidak
Tidak
Tidak
Tidak
Tidak
Tidak

Apakah pasangan dari


setiap anggota domain
hanya satu saja di
Kodomain (Ya/Tidak)

Ya
Ya
Ya
Ya
Ya
Ya
Ya
Ya

.id

Contoh Fungsi

Apakah pasangan dari


setiap anggota domain
hanya satu saja di
Kodomain (Ya/Tidak)

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

No.

Apakah setiap anggota


A selalu dipasangkan
dengan anggota B?
(Ya/Tidak)
Ya
Ya
Ya
Ya
Ya
Ya
Ya
Ya

Tidak
Tidak
Tidak
Tidak
Tidak
Tidak
Tidak
Tidak

Dengan demikian, fungsi adalah suatu aturan yang memasang


kan setiap anggota domain memasangkan tepat satu dengan anggota kodomain.

94

Buku Guru Kelas VIII SMP/MTs

Semester 1

6HNDUDQJ FRED NDOLDQ WHUDSNDQ VLPSXODQ WHUVHEXW XQWXN PHPHULNVD DSDNDK KLPSXQDQ SDVDQJDQ
EHUXUXWDQEHULNXWPHUXSDNDQIXQJVLGDULKLPSXQDQ% ^DE`NHKLPSXQDQ$ ^STUV`DWDXWLGDN"
 ^ DS  ES `
 ^ DS  ET `
 ^ DS  EU `
 ^ DT  EV `
 ^ DT  DU `
 ^ DU  EW `
 ^ EV  EU  DS `
 ^ DS  ET  DW `
$\R.LWD
%HUEDJL

6HGLNLW
,QIRUPDVL

5HODVLDGDODKDWXUDQ\DQJPHQJKXEXQJNDQDQJJRWDDQJJRWDGXDKLPSXQDQ$NDQWHWDSLVHSHUWL
GLXUDLNDQGLDWDVUHODVLGDULKLPSXQDQ$NHKLPSXQDQ%WLGDNVHODOXEHUXSDIXQJVL5HODVLWLGDN
PHPDNVDNDQVHPXDDQJJRWD'RPDLQGLSDVDQJNDQ5HODVLMXJDWLGDNPHPDNVDNDQEDKZDEDQ\DN
SDVDQJDQ GDUL VHWLDS XQVXUQ\D KDUXV WXQJJDO 5HODVL PHUXSDNDQ NRQVHS \DQJ OHELK ORQJJDU
GLEDQGLQJNDQIXQJVL.DUHQDLWXVHWLDSIXQJVLDGDODKUHODVLWHWDSWLGDNVHWLDSUHODVLPHUXSDNDQ
IXQJVL

&RQWRK 

0LVDONDQ$ ^`GDQ% ^`


5HODVL\DQJGLGHQLVLNDQDGDODKVDWXOHELKQ\DGDUL$SDNDKUHODVLGDUL$NH%WHUPDVXNIXQJVL"
$OWHUQDWLI
3HQ\HOHVDLDQ

1. Minta siswa untuk


membagi hasil
karyanya ke teman
sebangkunya, dan
pastikan temannya
yang menerima
hasil karya tersebut
memahami apa yang
harus dilakukan
2. Pantau bagaimana
siswa mengerjakan
tugasnya dan pastikan
bahwa kalimat-kalimat
yang digunakan sudah
sesuai dengan kaidah
budi pekerti yang baik

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3HUWXNDUNDQWXOLVDQWHUVHEXWGHQJDQWHPDQVHEDQJNX6HFDUDVDQWXQVLODKNDQVDOLQJEHUNRPHQWDU
PHQDQJJDSLNRPHQWDUPHPEHULNDQXVXOGDQPHQ\HSDNDWLLGHLGH\DQJSDOLQJWHSDW

Ayo Kita
Berbagi

.id

7XOLVODKNHVLPSXODQNDOLDQWHQWDQJFLULFLULGDULIXQJVL$NH%GDQKDVLOSHPHULNVDDQNDOLDQWHUKDGDS
VRDOGLDWDV

8QWXNPHQJHWDKXLDSDNDKUHODVLGDUL$NH%WHUPDVXNIXQJVLDWDXEXNDQODNXNDQSURVHGXUEHULNXW



ht

tp

://

0$7(0$7,.$

Sedikit
Informasi
Minta siswa untuk
memahami sedikit
informasi yang sudah
disedian pada buku
siswa beserta contoh dan
uraiannya.

MATEMATIKA

95

/DQJNDK
'LNHWDKXLUHODVLGDUL$NH%DGDODKVDWXOHELKQ\DGDUL
0DNDUHODVLLQLELVDGLWXOLVNDQGDODPEHQWXNKLPSXQDQSDVDQJDQEHUXUXWDQ^    `
/DQJNDK
&REDNLWDSHUKDWLNDQEHEHUDSDDQJJRWDQ$\DQJWLGDNELVDGLSDVDQJNDQNH%\DNQL
%HEHUDSDDQJJRWD$\DQJWLGDNELVDPHPDVDQJNDQNH%DGDODKGDQ
+DOLQLNDUHQDWLGDNDGDELODQJDQ[GL%GHPLNLDQVHKLQJJDLWXVDWXOHELKQ\DGDUL[GL%LWX
VDWXOHELKQ\DGDUL[GL%DWDXLWXVDWXOHELKQ\DGDUL[GL%
/DQJNDK

&RQWRK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

0LVDONDQ$ ^`% ^`

.id

'HQJDQGHPLNLDQUHODVLLQLEXNDQIXQJVLGDUL$NH%NDUHQDDGDDQJJRWD$\DQJWLGDNGLSDVDQJNDQGL%

5HODVL\DQJGLGHQLVLNDQDGDODKDQJJRWD$GXDNDOLDQJJRWD%$SDNDKUHODVLGDUL$NH%WHUPDVXN
IXQJVL"
$OWHUQDWLI
3HQ\HOHVDLDQ

8QWXNPHQJHWDKXLDSDNDKUHODVLGDUL$NH%WHUPDVXNIXQJVLDWDXEXNDQODNXNDQSURVHGXUEHULNXW
/DQJNDK

'LNHWDKXLUHODVLGDUL$NH%DGDODKDQJJRWD$GXDNDOLDQJJRWD%

0DNDGDSDWGLWXOLVNDQGDODPEHQWXNSDVDQJDQEHUXUXWDQVHEDJDLEHULNXW^    `


/DQJNDK

&REDNLWDSHUKDWLNDQNHPEDOLEHEHUDSDDQJJRWDQ$ODLQQ\D\DQJWLGDNPHPSXQ\DLSDVDQJDQNH%
\DNQL

://

%HEHUDSDDQJJRWD$\DQJWLGDNPHPSXQ\DLSDVDQJDQNH%DGDODKGDQ+DOLQL
NDUHQDWLGDNDGDELODQJDQ[GL%GHPLNLDQVHKLQJJDGXDNDOLDQJJRWD%GXDNDOLDQJJRWD%
GXDNDOLDQJJRWD%GXDNDOLDQJJRWD%GXDNDOLDQJJRWD%GDQGXDNDOLDQJJRWD%

tp

/DQJNDK

ht

'HQJDQ GHPLNLDQ UHODVL LQL MXJD EXNDQ IXQJVL GDUL $ NH % NDUHQD DGD EHEHUDSD DQJJRWD $ WLGDN
PHPSXQ\DLSDVDQJDQGL%



.HODV9,,,60307V

6HPHVWHU

Ajak siswa untuk memahami Contoh 3.6 serta alternatif


penyelesaiannya
96

Buku Guru Kelas VIII SMP/MTs

Semester 1

%HULNXWGLVDMLNDQEHEHUDSDFRQWRKIXQJVL\DQJODLQ\DQJPXQJNLQEHUPDQIDDWEDJLNDOLDQ
&RQWRK 
3DGD SHULQJDWDQ +DUL .HPHUGHNDDQ  $JXVWXV PLVDOQ\D VHULQJ RUDQJ PHPEXDW SROD SRWRQJDQ
NHUWDV \DQJ GLVXVXQ VHODQJ VHOLQJ PHUDK SXWLK PHUDK SXWLK GDQ VHWHUXVQ\D 2UDQJ PHQXOLVQ\D
GHQJDQPHUDKSXWLKPHUDKSXWLKPHUDKSXWLK
3ROD\DQJWHUMDGLLQLMXJDVHEHQDUQ\DPHUXSDNDQIXQJVLGDULKLPSXQDQELODQJDQ$VOLNH+LPSXQDQ
SRWRQJDQNHUWDVZDUQDPHUDKGDQZDUQDSXWLK6HFDUDIRUPDOEDULVDQLQLQDQWLQ\DGLWXOLVVHEDJDL
^ PHUDK  SXWLK  PHUDK  SXWLK  PHUDK `

&RQWRK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3DGDZDNWXEHODMDUWHQWDQJEDULVDQELODQJDQNLWDMXJDEDQ\DNEHODMDUWHQWDQJIXQJVLGHQJDQGRPDLQ
KLPSXQDQ VHPXD ELODQJDQ DVOL %DULVDQ ELODQJDQ NXDGUDW ELVD GLWXOLV GDODP EHQWXN KLPSXQDQ
SDVDQJDQEHUXUXW^        `

.id

&RQWRK 

.HWLND EHODMDU WHQWDQJ KXEXQJDQ DQWDUD KDUJD EDUDQJ GDQ EDQ\DNQ\D EDUDQJ \DQJ ODNX GLMXDO
WHUXWDPDNDODXGLQ\DWDNDQGDODPEHQWXNSHUVDPDDQOLQLHU\ P[QPLVDOQ\DVHEHQDUQ\DNLWD
MXJDEHODMDUIXQJVL

&RQWRK 

'DODP UDQJND PHQDULN SHODQJJDQ XQWXN EHULQYHVWDVL GL SHUXVDKDDQ ; PDQDJHU SHUXVDKDDQ LWX
PHQ\DPSDLNDQ UXPXV ODED \DQJ ELVD GLSHUROHK GDUL SHQMXDODQ EDUDQJQ\D GHQJDQ UXPXV VHEDJDL
EHULNXW PLVDOQ\D O  E   GHQJDQ E PHQ\DWDNDQ EDQ\DNQ\D EDUDQJ \DQJ ODNX GDQ
O EHVDU ODED \DQJ GLSHUROHK 0DND UXPXV LQL PHQ\DWDNDQ IXQJVL GDUL EDQ\DNQ\D EDUDQJ \DQJ
ODNX E GHQJDQEHVDUODED\DQJGLSHUROHK O 0DVLKEDQ\DNODJLFRQWRKODLQ\DQJELVDNLWDWHPXL
&REDODKWHPXNDQVHEDQ\DNPXQJNLQFRQWRKIXQJVLODLQQ\DGDODPNHKLGXSDQVHKDULKDULDWDXGDODP
PDWHPDWLND6HODQMXWQ\DVDMLNDQIXQJVLIXQJVLLWXGHQJDQEHUEDJDLPDFDPFDUD\DQJWHODKNLWDNHQDO
KLPSXQDQSDVDQJDQEHUXUXWGLDJUDPSDQDKWDEHOJUDNUXPXV VDPELOPHQHPXNDQNHNXDWDQGDQ
NHOHPDKDQFDUDPHQ\DMLNDQWHUVHEXWNDODXGLWHUDSNDQNHSDGDIXQJVLIXQJVLLWX
3XVDWNDQSHUKDWLDQNLWDNHSDGDGXDKDOEHULNXW\DLWX

://

  6DMLNDQFRQWRKFRQWRK\DQJGLDWDVJXQDNDQGHQJDQEHUEDJDLPDFDPPHQ\DMLNDQIXQJVL\DQJ
NDOLDQNHQDO

ht

tp

  7HQWXNDQFDUD\DQJPDQDNDK\DQJSDOLQJPXGDKXQWXNGLODNXNDQ

0$7(0$7,.$



Ajak siswa untuk memahami Contoh 3.7,


3.8, 3.9, dan 3.10.

MATEMATIKA

97

"

/DWLKDQ 

 3HUKDWLNDQDWXUDQVDQGL
$ %

&

'

<




7XOLVODKDUWLSHVDQVDQGLEHULNXW

D JNTIX][TD[TUTVTLX[N[D[DW]RDTURN[GTL

E X[N[D[TUTVTLJNTIX][TD[UROWDJVTL

6DQGLNDQSHVDQEHULNXW

F 6$<$$1$.,1'21(6,$

G 0$7(0$7,.$$'$/$+.(+,'83$1.8

 'LNHWDKXL3 ^`GDQ4 ^`

.id

D -LNDGDUL3NH4GLKXEXQJNDQUHODVLVHWHQJDKGDULWHQWXNDQKLPSXQDQDQJJRWD3\DQJ
PHPSXQ\DLSDVDQJDQGL4

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

E -LNDGDUL4NH3GLKXEXQJNDQUHODVLNXDGUDWGDULWHQWXNDQKLPSXQDQDQJJRWD4\DQJ
PHPSXQ\DLSDVDQJDQGL3
 'LNHWDKXLKLPSXQDQ$DGDODKKLPSXQDQNXDGUDWVHPSXUQDDQWDUDVDPSDLGHQJDQGDQ
KLPSXQDQ%DGDODKKLPSXQDQELODQJDQNHOLSDWDQWLJDDQWDUDVDPSDLGHQJDQ5HODVL
\DQJPHQJKXEXQJNDQKLPSXQDQ$NH%DGDODKDNDUGDUL


D 6HEXWNDQDQJJRWDDQJJRWDKLPSXQDQ$GDQDQJJRWDDQJJRWDKLPSXQDQ%

E 6HEXWNDQVHPXDSDVDQJDQEHUXUXWDQGDULUHODVLWHUVHEXW

F $SDNDKUHODVLGLDWDVPHUXSDNDQIXQJVL"

G 7HQWXNDQGRPDLQNRGRPDLQGDQGDHUDKKDVLO

 'LNHWDKXL. ^ST`GDQ/ ^`

D %XDWODKVHPXDSDVDQJDQEHUXUXWDQGDULKLPSXQDQ$NHKLPSXQDQ%\DQJPHPEHQWXN
IXQJVL
E 7HQWXNDQEDQ\DNQ\DIXQJVL\DQJPXQJNLQGDULKLPSXQDQ$NHKLPSXQDQ%

 %XDWODKGXDKLPSXQDQ\DQJUHODVLQ\DDGDODKIDNWRUGDUL



.HODV9,,,60307V

6HPHVWHU

ht

tp

://

1. Periksa apakah semua


kelompok sudah
mengumpulkan tugastugasnya dan apakah
identitas kelompok
sudah jelas
2. Beri penilaian
terhadap proses dan
hasil karya siswa
dengan menggunakan
rubrik penilaian
3. Beri Latihan
kepada siswa untuk
dikerjakan di rumah
98

Buku Guru Kelas VIII SMP/MTs

Semester 1

Membelajarkan 3.2
Memahami Bentuk Penyajian Fungsi

.id

1. Sediakan Kertas berpetak/papan berpetak/program komputer yang memuat


tentang grafik, contoh Fx Draw
2. Sediakan pula kertas HVS secukupnya
3. Pastikan setiap sudah ada yang mempunyai buku berpetak, penggaris, dan alat-alat
tulis lainnya

.HJLDWDQ 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

%HQWXN
3HQ\DMLDQ)XQJVL

0HPDKDPL%HQWXN3HQ\DMLDQ)XQJVL

Ayo
Kita Amati

0DVDODK 

TA KS I

TAKSI

6HEXDK SHUXVDKDDQ WDNVL PHQHWDSNDQ


NHWHQWXDQ EDKZD WDULI DZDO 5S
GDQ WDULI VHWLDS NLORPHWHUQ\D VHEDJDL
5S
D 'DSDWNDK NDOLDQ PHQHWDSNDQ WDULI
XQWXNNPNPNP"

6XPEHU.HPHQGLNEXG

E %HUDSDNDKWDULIXQWXNNPSHUMDODQDQ"

*DPEDU7DNVL

+LWXQJDQDULWPDWLND

F 8QWXN EHUDSD NLORPHWHU GHQJDQ XDQJ


\DQJEXWXKNDQDGDODK5S

1. Ajak siswa untuk


memperhatikan dan
memahami Masalah 3.2
2. Himbau siswa untuk
memeperhatikan tentang
tarif sebuah taksi

%LD\DNP  


%LD\DNP  
%LD\DNP  

tp

ht

6HGLNLW
,QIRUPDVL

://

%DJDLPDQDGHQJDQUXPXVIXQJVLQ\D"

6HEHOXP PHQHQWXNDQUXPXV IXQJVLQ\D PDULNLWDSHUKDWLNDQFDUDFDUD PHQ\DMLNDQ IXQJVL \DQJ


ELDVDGLJXQDNDQGLGDODP0DWHPDWLND
0LVDONDQ IXQJVL I GDUL 3  ^    ` NH 4  ^         ` 5HODVL \DQJ
GLGHQLVLNDQDGDODKGXDNDOLGDUL

Sedikit
Informasi

3HUPDVDODKDQLQLGDSDWGLQ\DWDNDQGHQJDQFDUD\DLWXVHEDJDLEHULNXW
&DUD+LPSXQDQ3DVDQJDQ%HUXUXWDQ
'LNHWDKXL IXQJVL I GDUL 3  ^    ` NH 4  ^         ` 5HODVL \DQJ
GLGHQLVLNDQDGDODKGXDNDOLGDUL
5HODVLLQLGDSDWGLQ\DWDNDQGHQJDQKLPSXQDQSDVDQJDQEHUXUXW\DLWXEHULNXW^     
     `

0$7(0$7,.$



Himbaulah kepada siswa


untuk memahami informasi
yang telah diberikan
kepada siswa tentang 5 cara
penyajian fungsi beserta
contoh dan uraiannya.
MATEMATIKA

99

&DUD'LDJUDP3DQDK
'LNHWDKXL IXQJVL I GDUL 3  ^    ` NH 4  ^         ` 5HODVL \DQJ
GLGHQLVLNDQDGDODKGXDNDOLGDUL
5HODVLLQLGDSDWGLQ\DWDNDQGHQJDQGLDJUDPSDQDK\DLWXEHULNXW
4
3












.id

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o


&DUD5XPXV)XQJVL

0DULNLWDOLKDWIXQJVLGDUL3 ^`NH4 ^`\DQJGLGHQLVLNDQ


GHQJDQKLPSXQDQSDVDQJDQEHUXUXWEHULNXW^          `
0DNDNLWDPHOLKDWSRODVHEDJDLEHULNXW
  
  
  
  

  

-DGLXQWXNVHWLDS[3 ^`PDND [[ PHUXSDNDQDQJJRWDGDULIXQJVLWHUVHEXW

%HQWXNLQLELDVDGLWXOLVGHQJDQI [  [XQWXNVHWLDS[3
,QLODK\DQJGLQ\DWDNDQGHQJDQEHQWXNUXPXVWHUVHEXW
&DUD7DEHO

I [



ht

tp

://

&DUD\DQJODLQODJLDGDODKGHQJDQPHQJJXQDNDQWDEHO8QWXNFRQWRKWHUDNKLULQLSHQ\DMLDQQ\D
DGDODKVHEDJDLEHULNXW



.HODV9,,,60307V

6HPHVWHU

Ajak siswa untuk memperhatikan cara-cara


menyajikan fungsi yang biasa digunakan dalam
matematika

100

Buku Guru Kelas VIII SMP/MTs

Semester 1

&DUD'HQJDQ*UDN
'LNHWDKXL IXQJVL I GDUL 3  ^    ` NH 4  ^         ` 5HODVL \DQJ
GLGHQLVLNDQDGDODKGXDNDOLGDUL
5HODVLLQLGDSDWGLQ\DWDNDQGHQJDQJUDN\DLWXEHULNXW
I [  [




         

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

         











.id












8UDLDQGLDWDVPHQXQMXNNDQPDFDPPDFDPFDUD\DQJELVDGLJXQDNDQXQWXNPHQ\DWDNDQIXQJVL
GDULKLPSXQDQ3NHKLPSXQDQ4

$\R.LWD
0HQDODU

6HSHUWL GLNHWDKXL KLPSXQDQ LWX EHUPDFDPPDFDP MHQLVQ\D $GD KLPSXQDQ \DQJ EHUDQJJRWDNDQ
ELODQJDQ DGD SXOD KLPSXQDQ \DQJ EHUDQJJRWDNDQ EXNDQ ELODQJDQ$GD \DQJ EDQ\DN DQJJRWDQ\D
WHUKLQJJDWHWDSLDGDSXOD\DQJEDQ\DNDQJJRWDQ\DWDNWHUKLQJJD
0XQJNLQPXQFXOSHUWDQ\DDQ0DQDNDKGDULFDUDPHQ\DMLNDQLWX\DQJSDOLQJWHSDW"

ht

tp

://

8QWXNPHQMDZDESHUWDQ\DDQGLDWDVFREDODKNHUMDNDQVRDOVRDOEHULNXWGDQDPDWLDSD\DQJWHUMDGL
6HVXGDKLWXJXQDNDQSHQDODUDQNDOLDQXQWXNPHQJDPELONHVLPSXODQ

0$7(0$7,.$



Ayo Kita
Menalar
Minta siswa untuk
menalar dengan mencoba
menyelesaikan soal-soal
yang telah disediakan pada
buku siswa berdasarkan dari
pertanyaan: Manakah dari
cara menyajikan itu yang
paling tepat?
MATEMATIKA

101

 IDGDODKIXQJVLGDULKLPSXQDQ$ ^`NHKLPSXQDQ; ^`\DQJGLGHQLVLNDQGHQJDQ


SDVDQJDQEHUXUXWI ^      `1\DWDNDQIGHQJDQFDUD
D GLDJUDPSDQDK
E WDEHO
F UXPXV
G JUDN

1\DWDNDQIXQJVLJGLDWDVGHQJDQFDUD
D SDVDQJDQEHUXUXWDQ
E WDEHO
F JUDN

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

 J DGDODK IXQJVL GDUL KLPSXQDQ $ NH KLPSXQDQ % \DQJ GLGHQLVLNDQ GHQJDQ GLDJUDP SDQDK
VHEDJDLEHULNXW
%
$

 KDGDODKIXQJVLGDUL+LPSXQDQ%LODQJDQ$VOL^`NH+LPSXQDQ%LODQJDQ5HDO5
GHQJDQUXPXVK Q  Q
1\DWDNDQIXQJVLGLDWDVGHQJDQFDUD
D SDVDQJDQEHUXUXWDQ
E GLDJUDPSDQDK
F WDEHO
G JUDN
 PDGDODKIXQJVLGDUL+LPSXQDQ%LODQJDQ$VOL^`NH+LPSXQDQ%LODQJDQ5HDO5
\DQJGLQ\DWDNDQGHQJDQWDEHOEHULNXW










://

ht

tp

1\DWDNDQIXQJVLGLDWDVGHQJDQFDUD
D SDVDQJDQEHUXUXWDQ
E GLDJUDPSDQDK
F JUDN
 )XQJVLQGDUL+LPSXQDQ%LODQJDQ5HDO5NH+LPSXQDQ%LODQJDQ5HDO5GLGHQLVLNDQGHQJDQ
JUDNVHEDJDLEHULNXW



102

.HODV9,,,60307V

Buku Guru Kelas VIII SMP/MTs

6HPHVWHU

Semester 1















.id



D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

1\DWDNDQIXQJVLGLDWDVGHQJDQFDUD
D SDVDQJDQEHUXUXWDQ
E GLDJUDPSDQDK
F WDEHO

$SD\DQJNDOLDQWHPXNDQ"$SDNDKDGDFDUD\DQJWHUEDLN"
7DPSDNQ\D PDVLQJPDVLQJ FDUD LWX PHPLOLNL NHNXDWDQ GDQ NHOHPDKDQ 7HPXNDQ NHNXDWDQ GDQ
NHOHPDKDQQ\D

$OWHUQDWLI3HPHFDKDQ0DVDODK

.HPEDOLNHSHUPDVDODKDQVHPXOD PDVDODK \DLWXPHQFDULUXPXVIXQJVLGDULPDVDODKWDULIWDNVL


GLDWDV
$\R
.LWD$PDWL

'LDZDOWHODKGLVDPSDLNDQSHUKLWXQJDQEHEHUDSDELD\DSHQ\HZDDQWDNVLVHEDJDLEHULNXW
%LD\DNP  
%LD\DNP  
%LD\DNP  

ht

tp

://

0$7(0$7,.$



Ayo
Kita Amati

Minta siswa untuk


mengamati langkah-langkah
bagaimana memperoleh
rumus fungsi dari
Masalah 3.2 dengan
memperhatikan bilangan
10 di ruas kiri dan
bilangan 10 di ruas
kanan. Apa kesamaan dan
perbedaannya? Kemudian
memperhatiakn juga pada
bilangan 6.000 pada ruas
kanan.
MATEMATIKA

103

&RED SHUKDWLNDQ GHQJDQ VHNVDPD ELODQJDQELODQJDQ \DQJ VHODOX PXQFXO SDGD VHWLDS SHUVDPDDQ
SHUVDPDDQEHULNXW
%LD\DNP 
%LD\DNP 
%LD\DNP 
3HUKDWLNDQELODQJDQGLUXDVNLULGDQELODQJDQGLUXDVNDQDQ$SDNHVDPDDQGDQSHUEHGDDQQ\D"
3HUKDWLNDQELODQJDQSDGDUXDVNDQDQ

"

$\R.LWD
0HQDQ\D

7HUNDLWGHQJDQIRNXVSHUKDWLDQGLDWDVFREDEXDWODKSHUWDQ\DDQ\DQJPHPXDWNDWDNDWDEHULNXW
[NPGLUXDVNLULGDQGLUXDVNDQDQ

$\R.LWD
0HQJJDOL,QIRUPDVL

$JDUNDOLDQPHQMDGLOHELK\DNLQFREDODKPHPEXDWWDEHOVHEDJDLEHULNXWGDQOHQJNDSLODK
-DUDN3HUMDODQDQ

&DUDPHQJKLWXQJELD\D

NP



D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

1. Jelaskan tugas
berikutnya, yaitu
membuat pertanyaan
tentang langkahlangkah menemukan
rumus fungsi
berdasarkan kata-kata:
x km di ruas kiri dan
di ruas kanan
2. Amati siswa yang
sedang bekerja, dan
kalau perlu berikan
pertanyaan pancingan.
Contoh: ketika x km di
ruas kiri, bagaimanakah
pola penyajian di ruas
kanan?

.id

Ayo Kita
Menanya



NP



NP



NP



NP



NP



[NP

[

-DGLMLND% [ PHUXSDNDQEHVDUELD\D\DQJKDUXVGLNHOXDUNDQXQWXNPHQJJXQDNDQWDNVLVHMDXK[NP
PDND% [ GDSDWGLWXOLVNDQGHQJDQUXPXV% [  

.HODV9,,,60307V

6HPHVWHU

://



tp

Menggali
Informasi

ht

=+

NP

1. Ajak siswa untuk


menggali informasi
dengan cara
memperhatikan pola
penyajian yang terdapat
pada tabel.
2. Suruh siswa untuk
membuat kesimpulan
dari kegiatan menggali
informasi.
104

Buku Guru Kelas VIII SMP/MTs

Semester 1

$\R.LWD
0HQDODU

Ayo Kita
Menalar

%HUGDVDUNDQ LQIRUPDVL \DQJ NDOLDQ GDSDWNDQ FRED MHODVNDQ EDJDLPDQD FDUD PHQHQWXNDQ UXPXV
IXQJVLMLNDGLNHWDKXLIXQJVLIGLQ\DWDNDQROHKI [  D[EGHQJDQI   GDQI   

7XJDV
3URMHN

3URMHN
3HUJLODKNHRSHUDWRURSHUDWRUWHOHSRQVHOXOHUDWDXFDULODKLQIRUPDVLGLLQWHUQHW0LQWDODKLQIRUPDVL
WHQWDQJEDJDLPDQDFDUDPHUHNDPHQHQWXNDQWDULIWHOHSRQGDODPUHQWDQJZDNWXWHUWHQWXNHPXGLDQ
WHPXNDQUXPXVQ\D6HODQMXWQ\DEXDWODKDQDOLVLVXQWXNPHQJHWDKXLPDQDNDKRSHUDWRU\DQJOD\DN
GLJXQDNDQXQWXNRUDQJDZDPGDQSHELVQLV7XOLVNDQKDVLODQDOLVLVNDOLDQXQWXNGLSUHVHQWDVLNDQ
NHVHOXUXKZDUJDVHNRODK

1. Minta siswa untuk


bernalar dengan
menjawab pertanyaan
yang telah tersedia pada
buku siswa
2. Perhatikan siswa yang
sedang melakukan
kegiatan bernalar

3URMHN

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

&REDODK WHPXNDQ EHQWXNEHQWXN 3(0%2526$1 GL GDODP NHKLGXSDQ GL UXPDK DWDX GL
VHNRODK PLVDOQ\DPHPELDUNDQNHUDQDLUWHWDSPHQHWHVPHVNLSXQVXGDKGLFREDGLWXWXSUDSDW
PHQ\DODNDQ ODPSX GL VLDQJ KDUL GDQ ODLQODLQ  &DULODK LQIRUPDVL XQWXN PHQHQWXNDQ UHVLNR
SHPERURVDQWHUVHEXWNHPXGLDQVXVXQEDKDQSUHVHQWDVL\DQJPHPXDWIXQJVL NDODXDGD XQWXN
PH\DNLQNDQEDKD\DGLELDUNDQQ\DSHPERURVDQWHUVHEXW

6HGLDNDQZDGDKDLUEHUEHQWXNNRWDNEHULODKWDQGDXNXUDQNHWLQJJLDQSHUPXNDDQDLU\DQJPXQJNLQ
WHUMDGL .DODXNHVXOLWDQPHPEXDWQ\DJXQDNDQJHODVSHQJXNXU\DQJELDVDGLMXDOGLDSRWLNDWDX
WRNRDODWDODWODERUDWRULXP .HPXGLDQEXDWODKNRRUGLQDWNDUWHVLXVGHQJDQVXPEX[PHQ\DWDNDQ
ODPD ZDNWX SHQXDQJDQ DLU NH GDODP NRWDN GDQ VXPEX\ PHQ\DWDNDQ WLQJJL SHUPXNDDQ DLU GL
GDODPNRWDN/DNXNDQSHUFREDDQDLU\DQJPHQHWHVGDULNUDQ GHQJDQNHFHSDWDQ\DQJVWDELO GDQ
EXDWODKJUDN\DQJPHPXDWKXEXQJDQDQWDUDODPDDLUPHQHWHVGDQWLQJJLSHUPXNDDQ %DJDLPDQD
NDODXNRWDNQ\DGLJDQWLEHQWXNODLQWLGDNWHJDNOXUXVWDSLPLULQJPHQJXQFXSGOO"

$\R.LWD
%HUEDJL

.id

3URMHN

Tugas
Projek

Suruh siswa untuk memilih


1 diantara 3 projek yang
telah di sediakan pada buku
siswa.

3UHVHQWDVLNDQ NDU\D NDOLDQ VHFDUD PHQDULN GDQ PH\DNLQNDQ NDODX DGD IDVLOLWDV ,7 JXQDNDQODK
PLFURVRIWSRZHUSRLQW GLGHSDQNHODV

ht

tp

://

0$7(0$7,.$



Ayo Kita
Berbagi

1. Minta siswa untuk


sharing hasil karyanya
kepada seluruh siswa.
2. Pantau bagaimana
mereka
mempresentasikan dan
pastikan bahwa kalimatkalimat yang digunakan
sudah sesuai dengan
kaidah budi pekerti yang
baik
MATEMATIKA

105

Alternatif
Jawaban

Berdasarkan informasi yang kalian dapatkan, coba jelaskan bagaimana cara


menentukan rumus fungsi jika diketahui fungsi f dinyatakan oleh
dan
.
dengan
Penyelesaian
Bentuk umum fungsi adalah

.id

dan
, maka

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

(1)

.(2)

dari persamaan (1) dan (2) diperoleh


ht

tp

://

Dengan menggantikan nilai a ke persamaan (1) diperoleh


sehingga, nilai
dan
Jadi, bentuk fungsinya adalah

106

Buku Guru Kelas VIII SMP/MTs

Semester 1

"







/DWLKDQ 

'LNHWDKXL$ ^`GDQ% ^`


D 7HQWXNDQUHODVL\DQJPHUXSDNDQIXQJVLGDUL$NH%
E 6DMLNDQUHODVLWHUVHEXWGHQJDQGLDJUDPSDQDK
F 6DMLNDQUHODVLWHUVHEXWGHQJDQUXPXV
G 6DMLNDQUHODVLWHUVHEXWGHQJDQWDEHO
H 6DMLNDQUHODVLWHUVHEXWGHQJDQJUDN






D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

 'LNHWDKXL VXDWX IXQJVL I GHQJDQ GDHUDK DVDO $  ^   ` GHQJDQ UXPXV IXQJVL
I [  [
 D 7HQWXNDQI  I  I  GDQI  .HVLPSXODQDSD\DQJGDSDWNDPXSHUROHK"
 E 1\DWDNDQIXQJVLWHUVHEXWGHQJDQWDEHO
 F 7HQWXNDQGDHUDKKDVLOQ\D
 G 1\DWDNDQIXQJVLWHUVHEXWGHQJDQJUDN
'LNHWDKXLVXDWXIXQJVLKGHQJDQUXPXVK [  D[1LODLIXQJVLKXQWXN[ DGDODK
D &REDWHQWXNDQQLODLIXQJVLKXQWXN[ 
E 7HQWXNDQUXPXVIXQJVLK-HODVNDQFDUDPX
F %HUDSDNDKNDKQLODLHOHPHQGRPDLQ\DQJKDVLOQ\DSRVLWLI

 )XQJVLQGDUL+LPSXQDQ%LODQJDQ5HDO5NH+LPSXQDQ%LODQJDQ5HDO5GLGHQLVLNDQGHQJDQ
JUDNVHEDJDLEHULNXW

ht

tp

://

1\DWDNDQIXQJVLGLVDPSLQJ
GHQJDQFDUD
D SDVDQJDQEHUXUXWDQ
E GLDJUDPSDQDK
F WDEHO



.HODV9,,,60307V












     











         

6HPHVWHU

MATEMATIKA

107

 3HUKDWLNDQJDPEDUEHULNXWLQL

6XPEHUPDWHPDWRKLUZRUGSUHVVFRP

*DPEDU7HOXUGDQ:DGDK

6XPEHUZZZDQHVWIRUDOOVHDVRQVFRP

*DPEDU7HOXUGDQ:DGDK

%HULNXWPHUXSDNDQFRQWRKIXQJVLGDQEXNDQFRQWRKIXQJVLGDULJDPEDUGLDWDV
D 5HODVLWHOXUNHZDGDKGLVHEXWGHQJDQIXQJVL *DPEDU 0HQJDSD"
E 6HGDQJNDQ UHODVL GDUL ZDGDK NH WHOXU GLVHEXW GHQJDQ EXNDQ IXQJVL *DPEDU  GDQ
 0HQJDSD"

&DULODKFRQWRKODLQ\DQJDGDGLVHNLWDUNDOLDQ\DQJPHUXSDNDQIXQJVLGDQEXNDQIXQJVL

 )XQJVLIGLGHQLVLNDQGHQJDQUXPXVI [  [GHQJDQGDHUDKDVDO^`
E *DPEDUODKJDUNIXQJVLQ\D

 

 'LNHWDKXLIXQJVLIGLUXPXVNDQGHQJDQI [  [

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

D 7HQWXNDQED\DQJDQGDULGDQ

.id

D %XDWODKWDEHOGDQKLPSXQDQSDVDQJDQEHUXUXWDQGDULIXQJVLWHUVHEXW

E -LNDI D  WHQWXNDQQLODLD

0HUDQJNXP

3HQJDODPDQEHODMDUWHQWDQJIXQJVLWHODKNDOLDQODOXL6HNDUDQJFREDODKWXOLVNDQKDOKDOSHQWLQJ
\DQJPHQXUXWNDOLDQVDQJDWEHUKDUJDGDQNLUDNLUDDNDQEHUPDQIDDWEDJLNDOLDQXQWXNEHODMDU
OHELKMDXKGHQJDQPHQMDZDESHUWDQ\DDQEHULNXWLQL
 $SDV\DUDWVXDWXUHODVLPHUXSDNDQIXQJVL"

Merangkum

 0XQJNLQNDKDGDIXQJVLGDULVXDWXKLPSXQDQNHKLPSXQDQLWXVHQGLUL"
 6HEXWNDQDGDEHUDSDEDQ\DNFDUDPHQ\DMLNDQIXQJVL
 %DJDLPDQDFDUDPHQHQWXNDQQLODLIXQJVL"

0$7(0$7,.$

://

Minta siswa untuk


menjawab pertanyaanpertanyaan pada buku
siswa. Arahkan siswa untuk
merangkum



ht

tp

Kalau f adalah fungsi dari himpunan A ke himpunan B, maka syarat yang harus
dipenuhi adalah sebagai berikut:
1. Setiap anggota A harus dipasangkan atau dihubungan dengan anggota dari B
(tidak boleh ada yang tertinggal)
2. Banyaknya pasangan dari setiap anggota himpunan A tersebut harus tunggal.
Selanjutnya, ada banyak cara menyatakan fungsi, yaitu:

(1) menggunakan diagram panah,

(2) menggunakan himpunan pasangan berurutan,

(3) menggunakan rumus,

(4) menggunakan grafik,

(5) menggunakan tabel.
Semua memiliki kekuatan dan kelemahan, sehingga kita harus bijak menggunakannya
108

Buku Guru Kelas VIII SMP/MTs

Semester 1

"

8ML
.RPSHWHQVL

 3DN0DKLUPHPSXQ\DLWLJDDQDNEHUQDPD%XGL$QLGDQ$QWRQ3DN5LGZDQPHPSXQ\DL
GXDDQDNEHUQDPD$OH[GDQ5LQL3DN5XGLPHPSXQ\DLVHRUDQJDQDNEHUQDPD6XFL
 D 1\DWDNDQGDODPGLDJUDPSDQDKUHODVLD\DKGDUL
 E $SDNDKUHODVLWHUVHEXWPHUXSDNDQIXQJVL"-HODVNDQ
 F 1\DWDNDQGDODPGLDJUDPSDQDKUHODVLDQDNGDUL
 G $SDNDKUHODVLSDGDVRDOFPHUXSDNDQIXQJVL"-HODVNDQ
 )XQJVLIGLGHQLVLNDQGHQJDQUXPXVI [  [GDQGLNHWDKXLGDHUDKDVDOQ\DDGDODK^
`
 D %XDWODKWDEHOGDQKLPSXQDQSDVDQJDQEHUXUXWDQGDULIXQJVLWHUVHEXW
 E *DPEDUODKJUDNIXQJVLQ\D
 'DHUDKDVDOIXQJVL\DQJGLGHQLVLNDQGHQJDQIXQJVLIGDUL[NH[DGDODK^[    [   [ 5`
7HQWXNDQODKGDHUDKKDVLOQ\D
 -LND$ ^`GDQ% ^`WHQWXNDQEDQ\DNQ\DSHPHWDDQ\DQJPXQJNLQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

 6XDWXIXQJVLGLGHQLVLNDQGHQJDQUXPXVI [  [GHQJDQGDHUDKDVDO^


`
 D %XDWODKWDEHOGDQKLPSXQDQSDVDQJDQEHUXUXWDQGDULIXQJVLWHUVHEXW
 E *DPEDUODKJUDNIXQJVLQ\D

 0LVDONDQDGDVXDWXIXQJVLIGDUL[NH[
  7HQWXNDQUXPXVIXQJVLQ\D
  7HQWXNDQED\DQJDQ GDHUDKKDVLO GDULGDQ
  -LNDDGDODKED\DQJDQGDULSWHQWXNDQODKQLODLS

 )XQJVLIGLWHQWXNDQROHKI [  D[E-LNDED\DQJDQGDULDGDODKGDQED\DQJDQGDUL


DGDODKWHQWXNDQQLODLGDULI  I  

 )XQJVLIGLWHQWXNDQROHKI [  D[E-LNDKLPSXQDQSDVDQJDQEHUXUXWDQQ\DDGDODK
S  T   GDQ  WHUOHWDNSDGDJUDILNIXQJVLWHUVHEXW7HQWXNDQ
QLODLSTGDQU
 'LNHWDKXLIXQJVLIGLUXPXVNDQGHQJDQI [  [
 D 7HQWXNDQED\DQJDQGDULGDQ
 E -LNDI D  WHQWXNDQQLODLD

 6HEXDKUXPDKPHPSXQ\DLEDNSHQDPSXQJDLU0HODOXLVHEXDKSLSDDLUGLDOLUNDQGDULEDN
SHQDPSXQJDQNHGDODPEDNPDQGL9ROXPHDLUGDODPEDNPDQGLVHWHODKPHQLWDGDODK
OLWHU GDQ VHWHODK  PHQLW DGDODK  OLWHU 9ROXPH DLU GDODP EDN PDQGL VHWHODK GLDOLUL DLU
VHODPDWPHQLWGLQ\DWDNDQVHEDJDL9 W   9DW OLWHUGHQJDQ9DGDODKYROXPHDLUGDODPEDN
PDQGLVHEHOXPDLUGLDOLUNDQGDQDDGDODKGHELWDLU YROXPHDLU \DQJGLDOLUNDQVHWLDSPHQLW
 D 7HQWXNDQYROXPHDLUGDODPEDNPDQGLVHEHOXPDLUGLDOLUNDQ
 E %HUDSDYROXPHDLUGDODPEDNPDQGLVHWHODKPHQLW"

6HPHVWHU

tp

://

.HODV9,,,60307V

ht



=+

Uji
Kompetensi

Beri uji kompetensi pada


siswa. Guru minta siswa
mengerjakan soal yang
sudah disediakan pada
buku siswa
MATEMATIKA

109

SoalPengayaan

=+

1. Suatu tulisan sandi

.id

Tulislah arti dari sandi berikut:


a. wioftaq zxfuuqs oaq
b. uqkxrq ro rqrqax
Tulis sandi dari kalimat berikut:
c. AKU CINTA INDONESIA
d. MATEMATIKA ADALAH RATUNYA ILMU PENGETAHUAN

ht

tp

://

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

2. Tuliskan sebuah contoh fungsi yang terjadi dalam kehidupan sehari-hari dan nyatakan
dalam diagram panah, dengan rumus fungsi, dengan tabel, dan dengan grafik.
3. Pak Mahir mempunyai tiga anak: bernama Budi, Ani, dan Anton. Pak Ridwan
mempunyai dua anak: bernama Alex dan Rani. Pak Rudi mempunyai seorang anak
bernama Suci.
a. Nyatakan dalam diagram panah, relasi ayah dari.
b. Apakah relasi tersebut merupakan fungsi ? Jelaskan.
c. Nyatakan dalam diagram panah, relasi anak dari.
d. Apakah relasi pada soal c merupakan fungsi ? Jelaskan.
4. Empat Siswa yang bernama Sulastri, Idris, Halim dan Tohir sedang membaca buku
diperpustakaan yang menyediakan jenis buku: ilmiah, fiksi, non fiksi, ensiklopedia
dan komik. Sulasti dan Halim membaca buku non fiksi, Idris asyik membaca komik
dan Tohir lagi serius membaca buku ilmiah.
a. Jika A adalah himpunan Siswa dan B adalah himpunan jenis buku, tulislah
himpunan A dan himpunan B dengan cara mendaftar anggotanya.
b. Buat diagram panah relasi dari himpunan A ke himpunan B dan tulis aturan
relasinya.
c. Relasi tersbut apakah termasuk fungis? Jelaskan.
d. Tulis Domain, kodomain dan Rangenya.
5. Diketahui P = {Malang , Surabaya , Semarang , Bandung , Jakarta , Denpasar ,
Sumenep} dan Q = {Jatim , Jateng , Jabar , Bali. } Nyatakan relasi R : P ke Q dalam
himpunan pasangan berurutan dengan aturan:
a. Ibu kota propinsi
b. Kota di propinsi
6. Diketahui K = {3 , 4 , 5 , 6} dan L = {4 , 5 , 6 , 7}. Jika adalah fungsi dari himpunan
K ke himpunan L, tentukan dua aturan yang mungkin untuk fungsi g kemudian
gambar diagram panahnya.
110

Buku Guru Kelas VIII SMP/MTs

Semester 1

7. Suatu fungsi f memetakan ke dari A ke B.

A = { 1, 2, 3, 5, 7 } dan B = { bilangan cacah kurang dari 25 }

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

a. Nyatakan fungsi f dengan notasi


c. Nyatakan range dari fungsi f
d. Tentukan bayangan dari A
b. Nyatakan fungsu f dengan rumus
dengan daerah asal
8. Apabila suatu fungsi f yang dirumuskan sebagai
adalah A = {2, 1, 0, 1, 2}.
a. Tentukanlah dareah hasil atau range dari fungsi
b. Tentukanlah letak titik-titik tersebut pada bidang koordinat.
c. Gambarlah suatu garis yang melalui titik-titik tersebut.
9. Diketahui fungsi f dirumuskan dengan f(x) = 2x + 3.
a. Tentukan bayangan dari 2 dan 3
, tentukan nilai !
b. Jika
10. Fungsi f ditentukan oleh f(x) = ax + b. Jika f(2) = 12 dan f(3) = 23, tentukanlah:
a. nilai a dan b,
b. rumus fungsi tersebut.
maka tentukan f(x) = ?
11. Diketahui fungsi dengan ,
12. Sebuah rumah mempunyai bak penampung air. Melalui sebuah pipa, air dialirkan
dari bak penampungan ke dalam bak mandi. Volume air dalam bak mandi setelah 3
menit adalah 23 liter dan setelah 7 menit adalah 47 liter. Volume air dalam bak mandi
setelah dialiri air selama t menit dinyatakan sebagai V(t) = (V0 + at) liter, dengan V0
adalah volume air dalam bak mandi sebelum air dialirkan dan a adalah debit air yang
dialirkan setiap menit.
a. Tentukan volume air dalam bak mandi sebelum air dialirkan.

b. Berapa volume air dalam bak mandi setelah 15 menit?

dan

://

13. Sebuah pemataan


. jika titik
terletak pada fungsi tersebut. Tentukan p,q, dan r
14. Misalkan f(x) adalah fungsi yang memenuhi
a) untuk setiap bilangan real x dan y maka f(x + y) = x + f(y) dan
b) f(0) = 2

Nilai dari f(2013) adalah

ht

tp

15. Misalkan f sebuah fungsi yang memenuhi f(x).f(y) f(xy) = x + y, untuk setiap
bilangan bulat x dan y. Berapakah nilai f(2014) ?
16. Jika f(2x + 1) = (x 12)(x + 13), maka nilai dari f(31) adalah ....
17. Diketahuifadalah suatu fungsi sehinggaf(x) + 2f(1/x)= 3xuntuk setiapx 0.
Carilah nilaixyang memenuhif(x) =f(x).
18. Misalkan f adalah fungsi untuk semua bilangan bulat x dan y yang memenuhi
dan
. Nilai dari
sama dengan
dan
, maka
=
19. Jika
untuk semua bilangan real
20. Misalkan f suatu fungsi yang memenuhi
maka
adalah
positif x dan y. Jika
MATEMATIKA

111

Pedoman
Penilaian
No
1

Capaian
B

Keterangan
Bila Buku Siswa terselesaikan dengan baik

<B

Bila ada bagian dari Buku Siswa yang tidak


terselesaikan

Portofolio:
a) Uji Kompetensi
b) Soal dari tempat
lain

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan mampu menyelesaikannya dengan
baik

.id

Aspek Penilaian
Keterselesaian Buku
Siswa

Bila memilih soal dari Uji Kompetensi dengan


kategori Sedang dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Mudah dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan kurang mampu
menyelesaikannya dengan baik

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o
B+

B , B
B+, B,
B

Bila memilih soal dari Uji Kompetensi


A, B+ , dengan kategori Mudah dan kurang mampu
B, B menyelesaikannya dengan baik
Bila Proyek terselesaikan dan manpu
A
mempresentasikan dengan Baik
A, B+, Bila ada bagian dari Proyek yang tidak terselesaikan
atau kurang mampu mempresentasikan
B

://

ht

tp

Tugas Projek

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan kurang mampu menyelesaikannya
dengan baik
Bila memilih soal dari Uji Kompetensi
dengan kategori Sedang dan kurang mampu
menyelesaikannya dengan baik

Bila Proyek tidak terselesaikan samasekali

Keterangan: - Nilai KKM = B




112

- Aspek penilaian Nomor 1 adalah syarat nilai yang


harus terpenuhi, sedangkan Aspek penilaian Nomor 2
adalah penambahan nilai.

Buku Guru Kelas VIII SMP/MTs

Semester 1

Persamaan
Garis Lurus

Bab 4

Kata Kunci
persamaan garis lurus
grak
kemiringan
titik potong

.id

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

K ompetensi
D asar

Menentukan persamaan
garis lurus dan graknya.

Sumber: www.yoyosuryosugiharto.wordpress.com

ht

tp

://

Pernahkah kalian naik gunung atau sekadar mendaki bukit di sekitar tempat tinggal kalian?
Kalian pasti mengira seberapa curam atau kemiringan gunung atau bukit yang kalian daki. Atau
pernahkah kalian melihat tanda rambu lalu lintas yang berarti tanjakan atau jalan menurun? Itu
merupakan beberapa contoh hubungan materi Persamaan Garis Lurus yang akan kita pelajari
dengan konteks di kehidupan nyata.
Seorang arsitek merancang tangga dan jalan titian, memperhatikan kemiringan untuk keamanan
dan kenyamanan pengguna. Jalan yang menanjak juga memiliki kemiringan. Jika terlalu curam,
kendaraan akan mengalami kesulitan untuk melintasinya. Tempat parkir pun demikian, jika
tempat parkir terlalu miring, tidak aman bagi pengendara maupun mobil. Kemiringan diukur
dengan melihat kemiringan garis.
Di Bab 4 ini, kalian akan mempelajari kemiringan, denisinya, dan berbagai cara dalam
penggunaannya.

Pengalaman
Belajar
1. Menentukan grak persamaan garis lurus
2. Menentukan persamaan garis lurus

MATEMATIKA
97
MATEMATIKA

113

Peta
Konsep
Persamaan
Garis Lurus

Persamaan
Garis

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Cara membuat
Grak

Kemiringan

.id

Grak
Persamaan

rumus

ht

tp

://

mengetahui

114

Buku
VIII SMP/MTs
KelasKelas
VIII SMP/MTs
98 Guru

Semester
Semester
1 1

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Ren Descartes (31 Maret 1596


- 11 Februari 1650). Kemiringan
menentukan posisi suatu garis
terhadap koordinat x dan koordinat
y. Perhitungan matematis ini adalah
salah satu materi dari geometri analitik
dengan bantuan aljabar. Jadi, untuk
pertanyaan siapakah yang menemukan
kemiringan? tentunya jawabannya
adalah Ren Decartes. Ren Decartes
adalah bapak geometri analitik.
Dia adalah seorang matematikawan
Perancis, sikawan, lsuf, dan teolog.
Banyak ahli matematika mengakui
dia sebagai orang yang menemukan
rumus kemiringan. Dia dikatakan
telah memberikan sebuah metode
untuk memecahkan masalah garis dan
kemiringan dalam masalah aljabar dan
geometri.

Ren Descartes
1596 1650

Rumus kemiringan dasar adalah y = mx + b sementara rumus kemiringan adalah


y 2 y1
. Dia adalah orang pertama yang memperkenalkan penyelesaian
m =
x 2 x1

://

untuk kemiringan dan persamaan linear. Meskipun tidak banyak tulisan yang
menunjukkan secara langsung bahwa dia sebagai penemu rumus kemiringan, banyak
matematikawan mengatakan bahwa rumus kemiringan tersebut adalah miliknya.
Descartes menonjol dalam Revolusi Ilmiah pada masanya. Dia meninggal pada Februari
1650 pada usia 54.
(Sumber: id.wikipedia.org)

tp

Beberapa hikmah yang bisa kita petik antara lain:


1. Kita harus mengembangkan ilmu kita, untuk kemajuan pendidikan

ht

2. Menuntut ilmu harus dengan rasa ikhlas, tanpa mengharapkan pujian dari orang
lain.
3. Segala sesuatu yang kita pelajari akan bermanfaat untuk orang lain.

MATEMATIKA
115
99

115

Membelajarkan 4.1

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Memahami Grafik Persamaan Garis Lurus

1. Amati dan kenali terlebih beberapa materi prasyarat atau pendukung


yang telah dipelajari oleh siswa sebagai bahan apersepsi sebelum
mempelajari materi Persamaan Garis Lurus, yaitu Fungsi dan Sistem
Koordinat.
2. Bentuk siswa menjadi kelompok-kelompok kecil (2-3 orang) yang
memungkinkan siswa belajar lebih efektif.
3. Identifikasi siswa yang biasanya kesulitan membuat pertanyaan.
4. Identifikasi bentuk bantuan apa yang perlu diberikan agar siswa
akhirnya produktif membuat pertanyaan.

ht

tp

://

5. Sediakan lembar kertas HVS untuk hasil kerja siswa.

116

Buku Guru Kelas VIII SMP/MTs

Semester 1

3HUVDPDDQ
*DULV/XUXV

0HPDKDPL*UDN
3HUVDPDDQ*DULV/XUXV

.HJLDWDQ 

6HEHOXP PHQJHQDO SHUVDPDDQ JDULV OXUXV VHEDLNQ\D NDOLDQ LQJDW NHPEDOL PDWHUL WHQWDQJ VLVWHP
NRRUGLQDWGDQIXQJVL0DVLKLQJDWNDKNDOLDQPHQHQWXNDQQLODLYDULDEHO"7DEHOEHULNXWPHQXQMXNNDQ
QLODLPDVLQJPDVLQJYDULDEHOXQWXNSHUVDPDDQ[\ 

\




Apersepsi

6HWLDSSDVDQJDQEHUXUXWDQ    GDQ  PHUXSDNDQSHQ\HOHVDLDQGDULSHUVDPDDQ

[ \ 1DPXQEHUDSDEDQ\DNSHQ\HOHVDLDQ\DQJPHPHQXKL [ \ "7HQWXQ\DVHOHVDLDQ

$\R
.LWD$PDWL

&RQWRK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

SHUVDPDDQWHUVHEXWPHPLOLNLSHQ\HOHVDLDQ\DQJWDNWHUKLQJJD
1DK%DJDLPDQDNLWDPHQ\DMLNDQVHOHVDLDQQ\D".LWDGDSDWPHQ\DMLNDQVHOHVDLDQSHUVDPDDQGHQJDQ
PHQJJXQDNDQJUDN\DQJEHUXSDJDULVOXUXV

/HQJNDSLWDEHOEHULNXWGDQJDPEDUJUDNSHUVDPDDQ[\ 

.HODV9,,,60307V













6HPHVWHU

Ayo
Kita Amati

ht

tp

://



1. Kemukakan ulasan
tentang sistem
koordinat dan fungsi
yang telah dipelajari
siswa sebelumnya
sebagai bahan
apersepsi untuk
mengenal persamaan
garis lurus.
2. Ajak siswa untuk
mencermati pasangan
terurut yang disajikan
dalam tabel.

.id

[




1. Minta siswa untuk mengamati cara menentukan titik yang dilalui persamaan garis
lurus pada tabel dan cara menggambar grafiknya.
2. Berikan beberapa pertanyaan pancingan agar mereka mengamati dengan seksama
setiap titik yang dilalui garis dan hubungannya dengan cara menggambarnya.
3. Minta siswa untuk mengamati beberapa contoh dan penyelesaian grafik persamaan
garis lurus yang disajikan pada bidang koordinat Cartesius dengan cermat,
sehingga siswa dapat melihat dengan jelas langkah-langkah menggambar grafik
persamaan garis lurus.

MATEMATIKA

117

$OWHUQDWLI
3HQ\HOHVDLDQ
8QWXN[ NLWDSHUROHK[\

  \

\

\ 






\ 













WXOLVSHUVDPDDQ
VXEVWLWXVL[ 
VHGHUKDQDNDQ
MXPODKNDQNHGXDUXDVROHK
NDOLNDQNHGXDUXDVROHK





WXOLVSHUVDPDDQ
VXEVWLWXVL\ 
VHGHUKDQDNDQ

EDJLNHGXDUXDVROHK



8QWXN\ NLWDSHUROHK[\


[

[





[ 

 

















D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

7DEHOVHWHODKGLOHQJNDSLDGDODK

'DULWDEHOGLDWDVGLSHUROHKSDVDQJDQEHUXUXWDQ        GDQ  



y
6HWLDSSDVDQJDQEHUXUXWDQ


WHUVHEXWDGDODKSHQ\HOHVDLDQ

SHUVDPDDQ[\ 
0HQHQWXNDQWLWLNWLWLNNRRUGLQDW
GDULSHQ\HOHVDLDQ

(2, 3)

(  , 0)

 

(, 1)



(, 5)

://
tp
ht

(, 9)

*DPEDU7LWLNWLWLNVHOHVDLDQSHUVDPDDQ[\ 

0$7(0$7,.$

Ajak siswa untuk mengamati alternatif


penyelesaian Contoh 4.1
118

Buku Guru Kelas VIII SMP/MTs

Semester 1



7LWLNWLWLN\DQJWHUVHEXWPHODOXLVXDWXJDULVOXUXV.LWDJDPEDUJDULV\DQJPHODOXLWLWLNWLWLNXQWXN
PHPEXDWJUDN
y


(2, 3)
(  , 0)


 

(, 1)



(, 5)



*DPEDU*DULVOXUXVGDULSHUVDPDDQ[\ 

$\R.LWD
0HQDODU

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

*DULVOXUXVPHQXQMXNNDQVHPXDSHQ\HOHVDLDQSHUVDPDDQ[\ 6HWLDSWLWLNSDGDJDULVPHUXSDNDQ
SHQ\HOHVDLDQSHUVDPDDQ8QWXNPHPEXDWJUDNSHUVDPDDQJDULVOXUXVNLWDFXNXSPHPEXWXKNDQ
GXDWLWLNVDMD

.id

(, 9)

6HWHODK NDOLDQ PHQJDPDWL WLWLNWLWLN VHOHVDLDQ GDQ *DPEDU  DSDNDK GLSHUOXNDQ WLWLNWLWLN
VHEDQ\DNLWXXQWXNPHQHQWXNDQJUDNSHUVDPDDQJDULVOXUXV"$GDNDKFDUD\DQJOHELKPXGDKXQWXN
PHQJJDPEDUJUDNSHUVDPDDQJDULVOXUXV"

&RQWRK 

tp

.HODV9,,,60307V

ht



://


*DPEDU\  [GHQJDQPHQHQWXNDQWLWLNSRWRQJVXPEXGDQWLWLNODLQQ\D


6HPHVWHU

Ayo Kita
Menalar
Dari hasil mengamati
contoh 4.1, mintalah
siswa bernalar tentangcara
menggambar grafik
persamaan garis lurus
yang lebih mudah. Minta
beberapa siswa untuk
MATEMATIKA

119

$OWHUQDWLI
3HQ\HOHVDLDQ
.LWDDNDQPHPXODLQ\DGHQJDQPHQHQWXNDQWLWLNSRWRQJVXPEX
7LWLNSRWRQJVXPEX[EHUDUWL\ 

\  [ 

WXOLVSHUVDPDDQ

 


[


VXEVWLWXVL\ 

 


[


WDPEDKNDQNHGXDUXDVROHK

 [ 

NDOLNDQNHGXDUXDVROHK

-DGL7LWLNSRWRQJVXPEX[DGDODK 

\ 


  


VXEVWLWXVL[ 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

\  


VHGHUKDQDNDQ
7LWLNSRWRQJVXPEX\DGDODK  

.id

7LWLNSRWRQJVXPEX\EHUDUWL[ 

\  [ 

WXOLVSHUVDPDDQ


.LWD KDUXV PHQHQWXNDQ WLWLN ODLQ 3HUKDWLNDQ SHUVDPDDQ \  



[   .RHVLHQ [ DGDODK 



0LVDOQ\DNLWDSLOLKQLODL[DGDODKNHOLSDWDQ

0LVDO[ 
\  [ 
WXOLVSHUVDPDDQ



\  

7LWLNNHWLJDDGDODK 

://

Untuk membantu
siswa dalam bernalar,
ajak siswa untuk
mengamati Contoh 4.2.
Setelah siswa mengamati
contoh, minta siswa
untuk kembali mengecek
jawaban.


\    



VXEVWLWXVL[ 

VHGHUKDQDNDQ

7LWLNSRWRQJ
VXPEX[



7LWLNSRWRQJ
VXPEX\

[



\  [


*DPEDU*UDNSHUVDPDDQ

JDULVOXUXV\  [

0$7(0$7,.$

ht

tp

Berikan kesempatan
kepada siswa untuk
mengamati dan
memahami beberapa
contoh cara yang
lebih mudah untuk
menggambar grafik
persamaan garis lurus
melalui titik potong
sumbu.

120

Buku Guru Kelas VIII SMP/MTs

Semester 1



&RQWRK 
0HQHQWXNDQWLWLNSRWRQJJDULVGHQJDQVXPEX[GDQVXPEX\
7HQWXNDQWLWLNSRWRQJJDULV \


[ SDGDVXPEX[GDQVXPEX\*DPEDUJUDNJDULVWHUVHEXW


$OWHUQDWLI
3HQ\HOHVDLDQ

Berikan kesempatan
kepada siswa untuk
mengamati dan memahami
beberapa contoh cara
yang lebih mudah untuk
menggambar grafik
persamaan garis lurus
melalui titik potong
sumbu.

8QWXNPHQHQWXNDQWLWLNSRWRQJVXPEX[VXEVWLWXVL\ 


[



[

 [

\


7LWLNSRWRQJJDULVGHQJDQVXPEX[DGDODK 
8QWXNPHQHQWXNDQWLWLNSRWRQJVXPEX\VXEVWLWXVL[ 

.id


[





\ 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Ayo
Kita Amati

7LWLNSRWRQJJDULVGHQJDQVXPEX\DGDODK  
3HUKDWLNDQEDKZDWLWLNSRWRQJJDULVGHQJDQVXPEX[GDQVXPEX\VDPDVDPDEHUDGDGL  +DO
LQL WLGDN PHPSHUROHK GXD WLWLN \DQJ EHUEHGD VHEDJDL V\DUDW WHUEHQWXNQ\D JDULV 6HKLQJJD SHUOX
GLWHQWXNDQ WLWLN ODLQ XQWXN PHPEXDW JDULV .DOLDQ GDSDW PHPLOLK VHEDUDQJ QLODL [ DWDX \ 'HQJDQ
GHPLNLDQXQWXNSHUVDPDDQ \
[ 



[


\


 


6XEVWLWXVL[ 


[ SLOLKQLODL[\DQJNHOLSDWDQNDUHQDDNDQOHELKPXGDKVHSHUWL










6HKLQJJD WLWLN    DGDODK VDODK VDWX VHOHVDLDQ GDUL
SHUVDPDDQ
*UDN\DQJWHUEHQWXNWDPSDNSDGDJDPEDUGLVDPSLQJ

tp


[


 [

    

6HPHVWHU

://

.HODV9,,,60307V

ht



    






Bimbing siswa untuk


dapat menyimpulkan
bahwa cara menggambar
grafik persamaan garis
lurus dapat dilakukan
dengan menentukan dua
titik yang dilaluinya, yaitu
dengan mensubtitusikan
jika x = 0 dan y = 0 pada
persamaan garis lurus
sehingga diperoleh dua
koordinat titik yang
dilalui oleh garis tersebut.

MATEMATIKA

121

0DVDODK 
3HQHUDSDQWLWLNSRWRQJJDULVGHQJDQVXPEX[GDQVXPEX\

Ayo
Kita Amati

3HUXVDKDDQ GLL]LQNDQ XQWXN PHQXUXQNDQ KDUJD DVHW \DQJ GLPLOLNL 3UDNWLN DNXQWDQVL LQL GLVHEXW
GHSUHVLDVLJDULVOXUXV'DODPSURVHGXULQLUHQWDQJXPXUPDQIDDWDVHWGLWHQWXNDQGDQNHPXGLDQDVHW
WHUVHEXWPHQ\XVXWGHQJDQMXPODK\DQJVDPDVHWLDSWDKXQVDPSDLKDUJDNHQDSDMDNGDULDVHWWHUVHEXW
VDPDGHQJDQQRO
&9 7RULN 0HJD -D\D PHPEHOL VHEXDK WUXN EDUX VHKDUJD 5S +DUJD WUXN DNDQ
PHQJDODPL SHQ\XVXWDQ 5S SHU WDKXQ 3HUVDPDDQ \DQJ PHQ\DWDNDQ SHQ\XVXWDQ
VHEDJDLEHULNXW

\PHQ\DWDNDQKDUJDWUXNGDQ[DGDODKXVLDWUXNGDODPWDKXQ
D 7HQWXNDQ WLWLN SRWRQJ JDULV GHQJDQ VXPEX[ GDQ VXPEX\ *DPEDU JUDN SHUVDPDDQ SDGD
ELGDQJNRRUGLQDW\DQJPHQXQMXNNDQSHQ\XVXWDQKDUJDWUXN
E 0HQXQMXNNDQDSDNDKWLWLNSRWRQJJDULVGHQJDQVXPEX[GDODPPDVDODKLQL"
F 0HQXQMXNNDQDSDNDKWLWLNSRWRQJJDULVGHQJDQVXPEX\GDODPPDVDODKLQL"
$OWHUQDWLI3HPHFDKDQ0DVDODK
8QWXNPHQHQWXNDQWLWLNSRWRQJJDULVGHQJDQVXPEX[VXEVWLWXVL\ 
 [
[ 
[ 
7LWLNSRWRQJJDULVGHQJDQVXPEX[DGDODK 





8QWXNPHQHQWXNDQWLWLNSRWRQJJDULVGHQJDQVXPEX\VXEVWLWXVL[ 
\  
\ 

.id

D





D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Cara menggambar grafik


persamaan garis lurus
dapat dilakukan dengan
menentukan dua titik
yang dilaluinya, yaitu
dengan mensubtitusikan
jika x = 0 dan y = 0
pada persamaan garis
lurus sehingga diperoleh
dua koordinat titik
yang dilalui oleh garis
tersebut.

%HVDU3DMDNWHUKDGDS8VLD7UXN

%HVDU3DMDNWHUKDGDS8VLD7UXN

 \








          

8VLD WDKXQ

E 7LWLNSRWRQJJDULVGHQJDQVXPEX[DGDODK  PHQXQMXNNDQEDKZDNHWLNDWUXNEHUXVLD


WDKXQEHVDUSDMDNWUXNDGDODK5S
F 7LWLNSRWRQJJDULVGHQJDQVXPEX\DGDODK  PHQXQMXNNDQEDKZDNHWLNDEDUX 
WDKXQ EHVDUSDMDNWUXNDGDODK5S

0$7(0$7,.$

ht

tp

://

Minta siswa untuk


memperhatikan Masalah
4.1 tentang penerapan
titik potong garis dengan
sumbu koordinat.
Dalam masalah,
terdapat persamaan
yang menyatakan
hubungan penyusutan
harga dengan usia truk,
yaitu y = 360.000.000
12.000.000x

122

Buku Guru Kelas VIII SMP/MTs

Semester 1



3HUVDPDDQ[ FGDSDWMXJDGLWXOLVGDODPEHQWXN[\ F-XJDVDPDXQWXN\ GGDSDWGLWXOLV


GDODPEHQWXN[\ G%DJDLPDQDNDKNLWDPHQJJDPEDUJUDNQ\D"$PDWLODKFRQWRKEHULNXW
&RQWRK 
%XDWODKJUDNSHUVDPDDQ[ 
$OWHUQDWLI
3HQ\HOHVDLDQ

[ 

.LWDELVDPHPEXDWWDEHOQLODLXQWXNSHUVDPDDQ[ 





D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

*DPEDU*UDNSHUVDPDDQ[ 

.id



6HWHODKPHQHQWXNDQWLWLNWLWLNNRRUGLQDWNLWDPHPEXDWJDULVOXUXV\DQJPHODOXLNHWLJDWLWLNNRRUGLQDW
&RQWRK 

%XDWODKJUDNSHUVDPDDQ\ 
$OWHUQDWLI
3HQ\HOHVDLDQ

.LWDELVDPHPEXDWWDEHOQLODLXQWXNSHUVDPDDQ\ VHSHUWLEHULNXW







[

\ 



://



*DPEDU*UDNSHUVDPDDQ\ 

ht

tp

6HWHODKPHQHQWXNDQWLWLNWLWLNNRRUGLQDWNLWDPHPEXDWJDULVOXUXV\DQJPHODOXLNHWLJDWLWLNNRRUGLQDW



.HODV9,,,60307V

6HPHVWHU

Minta siswa untuk memahami Contoh 4.4 dan


4.5 tentang garis yang sejajar sumbu koordinat.

MATEMATIKA

123

"

$\R.LWD
0HQDQ\D

'DULNHHPSDWFRQWRK\DQJGLEHULNDQDSDNDKSHUWDQ\DDQEHULNXWPXQFXOGLEHQDNNDOLDQ"
 $SDV\DUDWVXDWXSHUVDPDDQVXSD\DJUDN\DQJGLVDMLNDQEHUXSDJDULVOXUXV"
 $SDNDKDGDSHUVDPDDQ\DQJPHPRWRQJVXPEX[GDQVXPEX\WHSDWGLVDWXWLWLN"

0HQJJDOL
,QIRUPDVL

8QWXNPHQJHWDKXLMDZDEDQGDULSHUWDQ\DDQQRGLDWDVSHUKDWLNDQ&RQWRKEHULNXW
&RQWRK 
D %XDWODKJUDNSHUVDPDDQ\ [
 %XDWWDEHOXQWXNPHQHQWXNDQWLWLNWLWLNNRRUGLQDWSHUVDPDDQ
\
[\





















D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Ayo Kita
Menanya

Berikan kesempatan
siswa untuk memikirkan
kemungkinan pertanyaan
yang muncul dari hasil
pengamatan sebelumnya.















6DOLQGDQKXEXQJNDQ
WLWLNWLWLN\DQJNDOLDQEXDW
$SDNDKJUDN\DQJNDOLDQ
EXDWPHPEHQWXNVXDWXJDULV
OXUXV"%HUDSDNDKWLWLN\DQJ
PHPRWRQJVXPEX["




*DPEDU7LWLNWLWLNNRRUGLQDWSHUVDPDDQ\ [

://

0$7(0$7,.$

ht

tp

AyoMenggali
Informasi

Mintalah siswa untuk


menggali informasi
tentang syarat suatu
persamaan yang
menghasilkan grafik
garis lurus dan tepat di
satu titik, yaitu titik (0,0),
melalui beberapa contoh
yang disajikan.
124

Buku Guru Kelas VIII SMP/MTs

[


Semester 1



E *UDNSHUVDPDDQ[\ 


 %XDWWDEHOXQWXNPHQHQWXNDQWLWLNWLWLNNRRUGLQDWSHUVDPDDQNHPXGLDQJDPEDUWLWLNWLWLN
SDGDELGDQJNRRUGLQDWVHSHUWL*DPEDU
[
\
[\


WLGDN
DGD
KDVLO


WLGDN
DGD
KDVLO











GDQ




 














WLGDN
DGD
KDVLO


D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o



.id

[






*DPEDU7LWLNWLWLNNRRUGLQDWSHUVDPDDQ[\ 

'DULWDEHOGDSDWNLWDOLKDWEDKZDXQWXNQLODL[!GDQ[WLGDNDGDQLODL\\DQJPHPHQXKL
SHUVDPDDQ6HKLQJJDWLGDNPHPLOLNLNRRUGLQDW
8QWXNPHQMDZDESHUWDQ\DDQQRSHUKDWLNDQ&RQWRKEHULNXW

&RQWRK 

*DPEDU JUDN SHUVDPDDQ \  [ \  [ GDQ \ 


 [ GDODP VDWX ELGDQJ NRRUGLQDW$GDNDK


NHVDPDDQNHWLJDJUDN\DQJWHUEHQWXN"-HODVNDQ

3HQ\HOHVDLDQ

.HODV9,,,60307V

6HPHVWHU

ht



tp

://

8QWXNPHOLKDWNHWLJDJUDNWHUVHEXWWHQWXNDQWLWLNWLWLNNRRUGLQDWNHPXGLDQJDPEDUJUDNQ\D

Ajak siswa untuk memperhatikan dan


memahami Contoh 4.6 dan 4.7 tentang syarat
persamaan yang dapat membentuk garis lurus.
Diskusikan dengan siswa syarat-syarat persamaan
garis lurus.

MATEMATIKA

125

Ayo Kita
Menalar

$\R.LWD
0HQDODU


[


.id

*DPEDU*UDNSHUVDPDDQ\ [\ [GDQ\ 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

1. Minta siswa untuk


mendiskusikan dengan
teman sebangku tentang
perbedaan persamaan
garis lurus dan bukan,
banyak titik koordinat
paling sedikit untuk
menggambar grafik
persamaan garis lurus,
dan persamaan garis
lurus yang memotong
sumbu-x dan sumbu-y
di satu titik.
2. Arahkan siswa untuk
memikirkan pertanyaan
tersebut dari hasil
mengamati dan
menggali informasi
sebelumnya.
3. Mintalah siswa
menuliskan hasil
diskusinya untuk
mengomunikasikan
kepada temannya yang
lain.

'LVNXVLNDQGHQJDQWHPDQVHEDQJNX6HWHODKNDOLDQPHQJDPDWLPHQDQ\DGDQPHQJJDOLLQIRUPDVL
GDSDWNDK NDOLDQ PHPEHGDNDQ SHUVDPDDQ JDULV OXUXV GDQ \DQJ EXNDQ" 6HEXWNDQ DSD \DQJ NDOLDQ
NHWDKXLWHQWDQJ3HUVDPDDQ*DULV/XUXV"
%HUDSDNDKEDQ\DNWLWLNNRRUGLQDWSDOLQJVHGLNLW\DQJGLWHQWXNDQXQWXNPHPEXDWJUDNSHUVDPDDQ
JDULVOXUXV"
%LVDNDKNDOLDQPHQMHODVNDQSHUVDPDDQJDULVOXUXV\DQJEDJDLPDQD\DQJPHPRWRQJVXPEX[GDQ
VXPEX\GLVDWXWLWLN"

$\R.LWD
%HUEDJL

7XOLVNDQKDVLOGLVNXVLGLEXNXWXOLVNDOLDQNHPXGLDQWXNDUNDQGHQJDQWHPDQNDOLDQ\DQJODLQ
3DSDUNDQKDVLOGLVNXVLNDOLDQGLGHSDQNHODVGDQEHULNRPHQWDUVHFDUDVDQWXQ

Ayo Kita
Berbagi

0$7(0$7,.$



ht

tp

://

1. Mintalah siswa
menukarkan hasil
diskusi dengan teman
lainnya untuk diberikan
komentar.
2. Bahas secara klasikal
hasil jawaban siswa
untuk mengarahkan pada
kesimpulan yang benar.

Kegiatan
1. Periksalah apakah semua siswa sudah melaksanakan tugas-tugasnya dengan baik.
2. Berikan penilaian terhadap proses dan hasil karya siswa dengan menggunakan
pedoman penilaian
3. Berikan tugas kepada siswa untuk mengerjakan latihan secara mandiri dan
mengumpulkannya kepada guru.
126

Buku Guru Kelas VIII SMP/MTs

Semester 1

"

/DWLKDQ 

 *DPEDUODKJUDNSHUVDPDDQJDULVEHULNXWSDGDELGDQJNRRUGLQDW
D \ [
E \ [
F [ \
G \ [
H [\ 
 6HRUDQJ0DQDMHU3HPDVDUDQPHPSHUROHKJDMLVHEHVDU5SSHUWDKXQGLWDPEDK
NRPLVLGDULWRWDOSHQMXDODQVHODPDVHWDKXQ*DMLWDKXQDQ\DQJGLDSHUROHKGLQ\DWDNDQ
GDODPSHUVDPDDQEHULNXW
\PHQ\DWDNDQJDMLWDKXQDQQ\DGDQ[PHQ\DWDNDQWRWDOSHQMXDODQWLDSWDKXQ













D %HUDSDNDK JDML PDQDMHU WHUVHEXW VHODPD VHWDKXQ MLND WRWDO SHQMXDODQ VHEHVDU
5S"
E %HUDSDNDK JDML PDQDMHU WHUVHEXW VHODPD VHWDKXQ MLND WRWDO SHQMXDODQ VHEHVDU
5S"
F $SDNDKPDNVXGGDULNRRUGLQDWWLWLNSRWRQJJDULVGHQJDQVXPEX\GDODPPDVDODKLQL"

 *DPEDUODKJUDNSHUVDPDDQ\ [\ [GDQ\ [SDGDELGDQJNRRUGLQDW\DQJ


VDPD$SDGDPSDNSHUXEDKDQJUDNGDUL[PHQMDGL[GDQPHQMDGL["-HODVNDQ

 *DPEDUODKJUDNSHUVDPDDQ\ [\ [GDQ\ [SDGDELGDQJNRRUGLQDW\DQJ


VDPD$SDGDPSDNSHUXEDKDQJUDNGDULGDQ"-HODVNDQ

 *DPEDUODKJUDNSHUVDPDDQ\ [\ [\ GDQ\ SDGDELGDQJNRRUGLQDW


\DQJ VDPD %HUEHQWXN DSDNDK SHUSRWRQJDQ NHHPSDW JUDN SHUVDPDDQ WHUVHEXW" 7HQWXNDQ
OXDVEDQJXQ\DQJWHEHQWXNGDULWLWLNSRWRQJDQNHHPSDWJUDNSHUVDPDDQWHUVHEXW
 *DPEDUODKJUDN[\ [\ [\ GDQ[\ 


$SDNDKEHQWXNEDQJXQGDULSHUSRWRQJDQNHHPSDWJDULVWHUVHEXW"

.HODV9,,,60307V

Sebagai tambahan,
minta siswa untuk
menentukan kapan garis
dari persamaan tersebut
memotong sumbu-y.

6HPHVWHU

ht

tp

://



Soal nomor 2 pada


latihan ini merupakan
aplikasi dari persamaan
garis lurus. Sebelum
menyelesaikan masalah,
minta siswa untuk
membuat persamaannya.
Persamaan gaji tahunan
diperoleh adalah y =
100.000.000 + 0.05x

.id



D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

7RWDO*DML6HWLDS7DKXQ



Minta siswa untuk


menyelesaikan soal
latihan dan dibahas di
kelas dengan menunjuk
salah satu siswa, sedang
siswa yang lain diminta
menanggapi dengan
santun. Begitu seterusnya
untuk nomor soal
lainnya.

1. Periksalah apakah semua siswa sudah mampu memahami perbedaan persamaan


garis lurus dan bukan persamaan garis lurus, mampu membuat garis persamaan
garis lurus, dan memahami himpunan selesaian dari persamaan garis.
2. Berikan penilaian terhadap proses dan hasil karya siswa dengan menggunakan
pedoman penilaian
3. Berikan tugas kepada siswa untuk mengerjakan latihan secara mandiri dan
mengumpulkannya kepada guru.

MATEMATIKA

127

Membelajarkan 4.2

MenentukanKemiringan
Persamaan Garis Lurus

Apersepsi

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

1. Amati dan kenali terlebih beberapa materi prasyarat atau pendukung yang telah
dipelajari oleh siswa sebagai bahan apersepsi sebelum mempelajari materi
Persamaan Garis Lurus, yaitu Fungsi dan Sistem Koordinat.
2. Bentuk siswa menjadi kelompok-kelompok kecil (2-3 orang) yang memungkinkan
siswa belajar lebih efektif.
3. Identifikasi siswa yang biasanya kesulitan membuat pertanyaan.

0HQHQWXNDQ.HPLULQJDQ
3HUVDPDDQ*DULV/XUXV

.HJLDWDQ 

ht

tp

://

1. Arahkan siswa untuk


mengenal tentang
kemiringan yang tampak
dalam kehidupan seharihari.
2. Siswa diberikan
informasi bahwa
kemiringan sama dengan
perbandingan antara
perubahan panjang sisi
tegak dan perubahan
panjang sisi mendatar.
3. Bimbinglah siswa
untuk mengenal
masalah yang berkaitan
dengan kemiringan
dan memperhatikan
alternatif
pemecahannya.
4. Bimbinglah siswa untuk
mengenal masalah
dyang berkaitan
dengan kemiringan
dan memperhatikan
alternatif
pemecahannya.


+DWL+DWLODK0HODQJNDK

'DODP PHUDQFDQJ WDQJJD GDQ MDODQ WLWLDQ KDUXVODK


PHPSHUKDWLNDQ NHPLULQJDQ XQWXN NHDPDQDQ GDQ
NHQ\DPDQDQSHQJJXQD

+$7,+$7,
7$1**$

-DODQ \DQJ PHQDQMDN MXJD PHPLOLNL NHPLULQJDQ -LND


WHUODOX FXUDP NHQGDUDDQ DNDQ PHQJDODPL NHVXOLWDQ XQWXN
PHOLQWDVLQ\D7HPSDWSDUNLUSXQGHPLNLDQMLNDWHPSDWSDUNLU
WHUODOXPLULQJWLGDNDPDQEDJLSHQJHQGDUDPDXSXQPRELO
3HUVDPDDQEHULNXWPHQ\DWDNDQSHQJHUWLDQNHPLULQJDQ

*DPEDU7DQGDSHULQJDWDQ

.HPLULQJDQ  

SHUXEDKDQ SDQMDQJ VLVL WHJDN YHUWLNDO


SHUXEDKDQ SDQMDQJ VLVL PHQGDWDU KRUL]RQWDO

7DKXNDKNDPXQHJHULNDQJJXUX$XVWUDOLDPHPLOLNLSHUDWXUDQSHUXQGDQJXQGDQJDQXQWXNNHPLULQJDQ
VXDWXMDODQDWDXOLQWDVDQ


.HPLULQJDQMDODQXQWXNSHQJJXQDNXUVLURGDWLGDNEROHKOHELKGDUL



.HPLULQJDQWHPSDWSDUNLU\DQJDPDQWLGDNEROHKOHELKGDUL



.HPLULQJDQWDQJJDVXDWXEDQJXQDQWLGDNEROHKOHELKGDUL



.HPLULQJDQWURWRDUEDJLSHMDODQNDNLWLGDNEROHKOHELKGDUL

0DVDODK 
6HNDUDQJSHUKDWLNDQPDVDODKEHULNXW*DPEDUGLEDZDKLQLPHQXQMXNNDQVHUDPELEHODNDQJVHNRODK
6HEXDK MDODQ NKXVXV EDJL SHQJJXQD NXUVL URGD DNDQ GLEDQJXQ XQWXN PHPXGDKNDQ PHUHND -LND
SDQMDQJMDODQ\DQJDNDQGLEDQJXQPHWHUPXODLELELUEHUDQGDDSDNDKPHPHQXKLV\DUDWNHDPDQDQ
XQWXNSHQJJXQDNXUVLURGD"%HUDSDNDKSDQMDQJMDODQWHUSHQGHN\DQJGDSDWGLEDQJXQVXSD\DDPDQ
EDJLSHQJJXQDNXUVLURGD"
%HUDSDNDK SDQMDQJ MDODQ WHUSHQGHN
\DQJ GDSDW GLEDQJXQ VXSD\D DPDQ EDJL
SHQJJXQDNXUVLURGD"

EHUDQGD
FP
ODQWDLGDVDU

0$7(0$7,.$

128

Buku Guru Kelas VIII SMP/MTs

Semester 1



Ayo
Kita Amati

3HQ\HOHVDLDQ






|


D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

3HUKDWLNDQJDPEDUGLDWDVWLQJJLEHUDQGDGDULODQWDLGDVDUDGDODKFPGDQSDQMDQJMDODQGDULELELU
EHUDQGDDGDODKPDWDXFP6HKLQJJDNHPLULQJDQMDODQ\DQJDNDQGLEDQJXQGDSDWGLWHQWXNDQ
VHEDJDLEHULNXW
SHUXEDKDQSDQMDQJVLVLWHJDN WLQJJLEHUDQGD
.HPLULQJDQ



SHUXEDKDQSDQMDQJVLVLPHQGDWD U SDQMDQJMDODQGDULELELUEHUDQGD

1. Ajak siswa untuk


mengamati contoh
masalah dan
penyelesaiannya
menggunakan konsep
kemiringan
2. Berikan beberapa
pertanyaan untuk
memastikan bahwa
siswa memahami
cara penyelesaiannya
dengan benar

-DGLMDODQ\DQJGLEDQJXQPHPHQXKLV\DUDWNHDPDQDQXQWXNSHQJJXQDNXUVLURGDNDUHQDNHPLULQ
JDQMDODQ\DQJDNDQGLEDQJXQNXUDQJGDUL

8QWXNPHQHQWXNDQSDQMDQJMDODQWHUSHQGHN\DQJGDSDWGLEDQJXQVXSD\DDPDQEDJLSHQJJXQDNXUVL
URGDPDNDNHPLULQJDQMDODQ\DQJGLDQMXUNDQDGDODK
0LVDONDQSDQMDQJMDODQWHUSHQGHN\DQJGLPLQWDDGDODK[VHKLQJJDGLODNXNDQSHQJKLWXQJDQVHEDJDL
EHULNXW
.HPLULQJDQ



SHUXEDKDQSDQMDQJVLVLWHJDN WLQJJLEHUDQGD

SHUXEDKDQSDQMDQJVLVLPHQGDWD U SDQMDQJMDODQWHUSHQGHN





[

[



NDOLNDQNHGDUXDVROHK[

[



EDJLNHGXDUXDVROHK

VXEVWLWXVLNDQXNXUDQ\DQJGLNHWDKXL

-DGLSDQMDQJMDODQWHUSHQGHNGDULELELUWDQJJDDGDODKFPDWDXP

$\R
.LWD$PDWL

ht

tp

://

5DPEXSDGD*DPEDUPHQDQGDNDQMDODQGLGHSDQPHP
SXQ\DL NHPLULQJDQ  +DO LQL EHUDUWL XQWXN VHWLDS SHUX
EDKDQ PHQGDWDU VHMDXK  P WHUGDSDW SHUXEDKDQ VHFDUD
YHUWLNDOP
'DULJDPEDUGLDWDVNLWDGDSDWPHQ\DWDNDQSHUJHUDNDQNHQG
DUDDQ0LVDONDQNHPLULQJDQMDODQGDULWLWLN$NHWLWLN%7LWLN
$GDQ%EHUNRRUGLQDW  GDQ  



.HODV9,,,60307V

*DPEDU5DPEXMDODQ

6HPHVWHU

MATEMATIKA

129

Minta siswa untuk


mengajukan pertanyaan
dengan kata kunci
kemiringan dan garis.

SHUXEDKDQ
% VLVLWHJDN
  P
[
$ 
SHUXEDKDQVLVLPHQGDWDU P

.HPLULQJDQJDULV$%



SHUXEDKDQ SDQMDQJ VLVL WHJDN YHUWLNDO


SHUXEDKDQ SDQMDQJ VLVL PHQGDWDU KRUL]RQWDO




 

.DOLDQDNDQPHQHPXNDQUXPXVXQWXNPHQHQWXNDQNHPLULQJDQJDULVOXUXVMLNDGXDWLWLNSDGDJDULV
GLNHWDKXLVHWHODKPHODNXNDQNHJLDWDQEHULNXW

$\R.LWD
0HQDQ\D

.id

"

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.HPLULQJDQ GLVLPERONDQ P GDQ NDOLDQ DNDQ PHQHPXNDQ UXPXV NHPLULQJDQ JDULV VHWHODK NDOLDQ
PHQMDZDESHUWDQ\DDQEHULNXW
D  -HODVNDQEDJDLPDQDNDOLDQPHQHQWXNDQNHPLULQJDQJDULVOXUXV\DQJPHODOXLGXDWLWLN3GDQ4

E  'DSDWNDK NDOLDQ PHQGXJD UXPXV PHQHQWXNDQ NHPLULQJDQ JDULV OXUXV \DQJ VXGDK GLNHWDKXL
NRRUGLQDWGXDWLWLN\DQJGLNHWDKXL"
\

4 [\

SHUXEDKDQQLODL\
\\

3 [\

Ayo Kita
Menanya

SHUXEDKDQQLODL[
 [[

*DPEDU

0$7(0$7,.$

tp

://

1. Arahkan siswa untuk


memahami pertanyaan
yang tersaji agar siswa
terfokus pada tujuan
pembelajaran yang akan
dicapai saat ini.

ht

2. Mintalah siswa
memperhatikan cara
menentukan rumus
kemiringan persamaan
garis lurus yang
melalui dua titik
dengan seksama, yaitu
kemiringan (m) sama
dengan

130

Buku Guru Kelas VIII SMP/MTs

Semester 1



$\R
.LWD$PDWL
.DOLDQWHODKPHPSHODMDULEDJDLPDQDPHQHQWXNDQNHPLULQJDQJDULV\DQJPHODOXLGXDWLWLN'HQJDQ
PHQJHWDKXLQLODLNHPLULQJDQNLWDGDSDWPHQHQWXNDQGXDEXDKJDULVDSDNDKVHMDMDUDWDXWHJDNOXUXV
8QWXNLWXSHUKDWLNDQDPDW*DPEDU
3HUKDWLNDQEDKZD$%&'DGDODKSHUVHJLGHQJDQ$  %  &  GDQ'  
0DVLKLQJDWNDKNDOLDQVLIDWVLIDWSHUVHJL"

 6LVLVLVL \DQJ EHUKDGDSDQ VHMDMDU \DNQL $% GDQ


'&VHUWD$'GDQ%&

D(7, 10)
A(1, 8)

6HNDUDQJNLWDDNDQPHQHQWXNDQNHPLULQJDQJDULV
\DQJPHODOXLWLWLN$GDQ%VHUWDNHPLULQJDQJDULV
\DQJPHODOXLWLWLN'GDQ&
.HPLULQJDQJDULV\DQJPHODOXL$  GDQ%  
GDSDWGLWHQWXNDQVHEDJDLEHULNXW

0LVDONDQNHPLULQJDQJDULV\DQJPHODOXL$ [\ 
GDQ% [\ DGDODKP6HKLQJJDNHPLULQJDQJDULV
\DQJPHODOXLWLWLN$GDQ%DGDODK
P

\   \

[  [

NHPLULQJDQ JDULV \DQJ


PHODOXLGXDWLWLN

P



 

VXEVWLWXVLNDQQLODL[GDQ\

C(9, 4)
B(3, 2)
0

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

*DPEDU

.id

P     VHGHUKDQDNDQ




.HPLULQJDQJDULV\DQJPHODOXL'  GDQ&  GLWHQWXNDQVHEDJDLEHULNXW

0LVDONDQNHPLULQJDQJDULV\DQJPHODOXL' [\ GDQ& [\ DGDODKP6HKLQJJDNHPLULQJDQ


JDULV\DQJPHODOXLWLWLN$GDQ%DGDODK


P

    


P

NHPLULQJDQJDULV\DQJPHODOXLGXDWLWLN

VXEVWLWXVLNDQQLODL[GDQ\


  VHGHUKDQDNDQ


.HPLULQJDQNHGXDJDULV$%GDQ'&DGDODKVDPD'HQJDQFDUD\DQJVDPDNHPLULQJDQJDULV$'
GDQ%&MXJDVDPD

6HPHVWHU

://

.HODV9,,,60307V

tp



ht

\   \

[  [

P

Ayo
Kita Amati

1. Arahkan siswa
mengamati contoh
masalah terkait
kemiringan garis pada
grafik yang berbentuk
persegi, yaitu ada garis
yang saling sejajar
dan garis yang saling
berpotongan tegak lurus.
2. Lakukan tanya jawab
untuk memastikan bahwa
siswa telah memahami
dengan benar.
MATEMATIKA

131

 6LVLVLVL\DQJEHUGHNDWDQEHUSRWRQJDQWHJDNOXUXVGLVLPERONDQA\DNQLVLVL$%A%&$%A$'
$'A'&GDQ%&A'&


6HNDUDQJNLWDDNDQPHQHQWXNDQNHPLULQJDQJDULV\DQJPHODOXLWLWLN$GDQ%VHUWDNHPLULQJDQ
JDULV\DQJPHODOXLWLWLN%GDQ&

.HPLULQJDQJDULV\DQJPHODOXL$  GDQ%  GDSDWGLWHQWXNDQVHEDJDLEHULNXW

0LVDONDQNHPLULQJDQJDULV\DQJPHODOXL$ [\ GDQ% [\ DGDODKP6HKLQJJDNHPLULQJDQ


JDULV\DQJPHODOXLWLWLN$GDQ%DGDODK

P

P

 

\  \

[  [

P  



 

NHPLULQJDQJDULV\DQJPHODOXLGXDWLWLN

   


VXEVWLWXVLNDQQLODL[GDQ\

VHGHUKDQDNDQ

.HPLULQJDQJDULV\DQJPHODOXL%  GDQ&  GLWHQWXNDQVHEDJDLEHULNXW

0LVDONDQNHPLULQJDQJDULV\DQJPHODOXL% [\ GDQ& [\ DGDODKP6HKLQJJDNHPLULQJDQ


JDULV\DQJPHODOXLWLWLN$GDQ%DGDODK

P

\  \

[  [

NHPLULQJDQJDULV\DQJPHODOXLGXDWLWLN

P

  


VXEVWLWXVLNDQQLODL[GDQ\

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

P



  



VHGHUKDQDNDQ

'HQJDQFDUD\DQJVDPDNDOLDQELVDPHQHQWXNDQNHPLULQJDQJDULV\DQJODLQ

"

$\R.LWD
0HQDQ\D

6HWHODK NDOLDQ PHQJDPDWL *DPEDU  GDQ PHQHQWXNDQ NHPLULQJDQ JDULV \DQJ PHODOXL NHHPSDW
JDULVSHUVHJLNDOLDQPXQJNLQEHUWDQ\DVHSHUWLSHUWDQ\DDQEHULNXW
 %DJDLPDQDNDKNHPLULQJDQGXDJDULV\DQJVHMDMDU"

 %DJDLPDQDNDKNHPLULQJDQGXDJDULV\DQJVDOLQJWHJDNOXUXV"

 'DSDWNDKNHPLULQJDQGXDJDULV\DQJWHJDNOXUXVNHGXDQ\DEHUQLODLSRVLWLI"
 'DSDWNDKNHPLULQJDQGXDJDULV\DQJVHMDMDUNHGXDQ\DEHUQLODLSRVLWLI"

Ayo Kita
Menanya

ht

tp

://

0$7(0$7,.$

Arahkan siswa untuk


memahami pertanyaan
yang tersaji sehingga siswa
memahami masalah yang
diamati sebelumnya dan
termotivasi untuk menggali
informasi lebih jauh.
132

Buku Guru Kelas VIII SMP/MTs

Semester 1



0HQJJDOL
,QIRUPDVL

8QWXNPHQMDZDESHUWDQ\DDQGLDWDVSHUKDWLNDQQLODLNHGXDNHPLULQJDQJDULV

=+

0LVDONDQNHPLULQJDQJDULV\DQJPHODOXLWLWLN$GDQ%DGDODKPNHPLULQJDQJDULV\DQJPHODOXL
WLWLN'GDQ&DGDODKPGDQP GDQP 

Menggali
Informasi

.LWDWDKXEDKZDJDULV$%GDQ'&DGDODKVHMDMDUGDQP P


3HUKDWLNDQKDVLONDOLNHGXDNHPLULQJDQPP     

-DGLGXDJDULVGLNDWDNDQVDOLQJWHJDNOXUXVDSDELODPP 

$\R.LWD
0HQDODU

$\R.LWD
%HUEDJL

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

6HWHODKNDOLDQPHQJDPDWLPHQDQ\DGDQPHQJJDOLLQIRUPDVLGDSDWNDKNDOLDQPHQHQWXNDQKXEXQJDQ
GXDSHUVDPDDQJDULVDSDNDKVHMDMDU"DWDXWHJDNOXUXV"-HODVNDQMDZDEDQPX

7XOLVNDQ KDVLO GLVNXVL GL EXNX WXOLV NDOLDQ NHPXGLDQ WXNDUNDQ GHQJDQ WHPDQ NDOLDQ \DQJ ODLQ
6LODNDQPHPEHULNRPHQWDUGDQPHPEHULNRPHQWDUVHFDUDVDQWXQ
&RQWRK 

 GDQ 


[\ GDQ [\
\  \
    
 
[  [
  




6HPHVWHU

://

.HODV9,,,60307V




tp



ht

P

Ayo Kita
Menalar

1. Arahkan siswa
berdiskusi berpikir
tentang hubungan dua
persamaan garis, yaitu
garis yang saling sejajar
dan garis yang saling
berpotongan.

7HQWXNDQNHPLULQJDQJDULV\DQJPHODOXLWLWLN  GDQ  


$OWHUQDWLI
3HQ\HOHVDLDQ

Bimbinglah siswa untuk


menggali informasi dari
pertanyaan yang tersaji
sebelumnya, sehingga siswa
memahami bahwa :
- kemiringan garis yang
saling sejajar adalah
sama
- kemiringan garis yang
saling berpotongan
adalah -1

.id

0LVDONDQNHPLULQJDQJDULV\DQJPHODOXLWLWLN$GDQ%DGDODKPNHPLULQJDQJDULV\DQJPHODOXL

WLWLN%GDQ&DGDODKPGDQP GDQP  


2. Berikan kesempatan
kepada siswa untuk
bersiskusi dan
memahami contoh
beserta penyelsaiannya
yang tersaji.

Ayo Kita
Berbagi
Mintalah siswa untuk memajang lembar
hasil kerjanya di papan pajangan kelas
secara terpisah antara kelompok satu
dengan kelompok yang lain dan saling
mengunjungi hasil karya kelompok
lain, beri komentar, kritik, saran yang
perlu.
MATEMATIKA

133

&RQWRK 
*DULVOPHODOXLWLWLN  GDQ  GDQJDULVOPHODOXLWLWLN  GDQ  7DQSDPHQJJDPEDU
JUDNWHQWXNDQDSDNDKJDULVOGDQOVHMDMDUWHJDNOXUXVDWDXWLGDNNHGXDQ\D
$OWHUQDWLI
3HQ\HOHVDLDQ
3HUWDPDWDPDPHQHQWXNDQNHPLULQJDQPDVLQJPDVLQJJDULV.HPXGLDQPHPEDQGLQJNDQNHPLULQJDQ
XQWXNPHQHQWXNDQMLNDNHGXDJDULVVHMDMDUDWDXWHJDNOXUXV
8QWXNJDULVO 
 GDQ  
[\ GDQ [\ 

   









8QWXNJDULVO
 GDQ 
[\ GDQ [\

    








.HPLULQJDQJDULVODGDODKGDQNHPLULQJDQJDULVODGDODK


+DVLONDOLNHPLULQJDQNHGXDJDULV


.id

DGDODK-DGLJDULVOGDQJDULVOVDOLQJWHJDNOXUXV

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

&RQWRK 

*DPEDUODKJUDILNSHUVDPDDQJDULVOXUXV\DQJPHODOXL3  GDQWHJDNOXUXV -. GHQJDQ


-  GDQ.  
$OWHUQDWLI
3HQ\HOHVDLDQ

 \

3HUWDPDWHQWXNDQNHPLULQJDQ -. 
\  \

 WXOLVUXPXVNHPLULQJDQ
P
[  [


    
 VXEVWLWXVLNDQQLODL[GDQ\
   


 


3 


VDWXDQ
NHEDZDK


. 

4 
- 

VDWXDQ
NHNDQDQ
+DVLONDOLNHPLULQJDQGXDJDULV\DQJVDOLQJWHJDNOXUXVDGDODK


VHGHUKDQDNDQ

 
2OHKNDUHQD   VHKLQJJDNHPLULQJDQJDULV\DQJWHJDNOXUXV -. GDQPHODOXLWLWLN3 
 

://

 DGDODK 





ht

tp

*DPEDUJUDNGHQJDQFDUDPXODLGDULWLWLN3  WXUXQNHEDZDKVDWXDQNHPXGLDQNHNDQDQ


VDWXDQ%HULQDPDWLWLN4*DPEDUJDULV34

0$7(0$7,.$

Ajak siswa untuk mengamati dan memahami


Contoh 4.9 dan 4.10 tentang menentukan dua garis
apakah sejajar atau tegak lurus.

134

Buku Guru Kelas VIII SMP/MTs

Semester 1



0DVDODK 
.HPLULQJDQVXDWXJDULVGDSDWGLJXQDNDQXQWXNPHQJLGHQWLNDVLNRRUGLQDWVHEDUDQJWLWLNSDGDJDULV
.HPLULQJDQLQLMXJDGLJXQDNDQXQWXNPHQ\DWDNDQODMXSHUXEDKDQ/DMXSHUXEDKDQPHQ\DWDNDQVXDWX
NXDQWLWDVEHUXEDKGDULZDNWXNHZDNWX












          

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

7DKXQ
*DPEDU*UDN3HQMXDODQ$ODW2ODKUDJD

.id

7RWDO3HQMXDODQ MXWD



3HUXVDKDDQ DODW RODKUDJD PHODSRUNDQ EDKZD SHQMXDODQ SHUDODWDQ RODKUDJD DQWDUD WDKXQ  GDQ
PHQLQJNDWGHQJDQUDWDUDWD5SMXWDSHUWDKXQ3DGDWDKXQWRWDOSHQMXDODQVHEHVDU
5SMXWD-LNDSHQMXDODQPHQLQJNDWGHQJDQUDWDUDWD\DQJVDPDEHUDSDNDKWRWDOSHQMXDODQ
\DQJGLSHUROHKSHUXVDKDDQWHUVHEXWSDGDWDKXQ"
$OWHUQDWLI3HPHFDKDQ0DVDODK

0LVDONDQ [\    GDQP 


P

\  \

[  [

















UXPXVNHPLULQJDQ

\  

  

VXEVWLWXVLP \ [ GDQ[ 

\   



VHGHUKDQDNDQ

\

NHGXDUXDVNDOLNDQ

\

NHGXDUXDVWDPEDKNDQ

://

.RRUGLQDWWLWLNPHQ\DWDNDQSHQMXDODQGLWDKXQDGDODK  



ht

tp

-DGLWRWDOSHQMXDODQGLWDKXQDGDODK5SMXWD

.HODV9,,,60307V

6HPHVWHU

Ajak siswa untuk memahami penerapan kemiringan pada


masalah penjualan. Minta siswa untuk mengamati representasi
kemiringan dalam masalah.

MATEMATIKA

135

"

Latihan

/DWLKDQ 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

?!

.id

1. Periksalah apakah semua siswa sudah melaksanakan tugas-tugasnya dengan baik.


2. Berikan penilaian terhadap proses dan hasil karya siswa dengan menggunakan
pedoman penilaian.
3. Berikan tugas kepada siswa untuk mengerjakan latihan secara mandiri dan
mengumpulkannya kepada guru.

 7HQWXNDQNHPLULQJDQWDQJJDUDQMDQJGLEDZDKLQL

 0DVLQJPDVLQJGLDJUDPEHULNXW3GDQ4PHXSDNDQGXDWLWLNSDGDJDULV




://

Mintalah siswa untuk


mengerjakan tugas
Latihan secara mandiri.
Bahas dengan siswa di
kelas dengan menunjuk
salah satu siswa, sedang
siswa yang lain diminta
menanggapi dengan
santun. Begitu seterusnya
untuk nomor soal
lainnya. Lakukan diskusi
baik secara klasikal
maupun kelompok untuk
mengetahui berbagai cara
yang digunakan siswa.
Perhatikan siswa yang
masih menggunakan
penalaran intuitifnya,
namun jangan pernah
menyalahkannya.

tp

ht













x




L 

LL

D  7HQWXNDQNHPLULQJDQVHWLDSJDULV
E  3LOLKODKGXDWLWLNODLQGDQKLWXQJODKNHPLULQJDQQ\D$SDNDKNHPLULQJDQQ\DMXJD
EHUXEDK"0HQJDSD"

0$7(0$7,.$

136

Buku Guru Kelas VIII SMP/MTs

Semester 1



 -HODVNDQEDJDLPDQDNDOLDQPHQHQWXNDQNHPLULQJDQJDULVOXUXV\DQJPHODOXLGXDWLWLNEHULNXW
E   GDQ  

.id

D   GDQ  

1. Periksalah apakah
semua siswa sudah
melaksanakan tugastugasnya dengan
baik.
2. Berikan tugas
kepada siswa untuk
mengerjakan latihan
secara mandiri dan
mengumpulkannya
kepada guru.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 *DPEDUNDQJUDNGHQJDQGLNHWDKXLVHEDJDLEHULNXW
D   GHQJDQNHPLULQJDQ  

E   GHQJDQNHPLULQJDQ
F   GHQJDQNHPLULQJDQ


 *DULV\DQJPHODOXLWLWLN$  GDQ% S PHPLOLNLNHPLULQJDQ 7HQWXNDQQLODLS


 .HPLULQJDQJDULV\DQJPHODOXLWLWLN K GDQ K NHPLULQJDQ 7HQWXNDQQLODLK


8QWXNVRDOQRPRUGLNHWDKXLGXDWLWLNSDGDJDULVOGDQJDULVO7DQSDPHQJJDPEDUJUDN
WHQWXNDQDSDNDKNHGXDJDULVWHJDNOXUXVVHMDMDUDWDXWLGDNNHGXDQ\D


O  GDQ 


O  GDQ 



 O  GDQ 


O  GDQ 

O  GDQ 


O  GDQ 

 O  GDQ 


O  GDQ 



O  GDQ 


O  GDQ 

 O  GDQ 


O  GDQ 

 *DULV\DQJPHODOXLWLWLN S GDQ S PHPLOLNLNHPLULQJDQ\DQJVDPDGHQJDQJDULV


\DQJPHODOXLWLWLN  GDQ  7HQWXNDQQLODLS
 *DPEDUODKJUDN\DQJPHODOXLWLWLN:  GDQWHJDNOXUXV '( GHQJDQ'  GDQ(  
3HQHUDSDQNHPLULQJDQVXDWXJDULV

%DQ\DNQ\DODNLODNLEHUXVLDOHELKGDULWDKXQ\DQJEHNHUMDGLVXDWXSURYLQVLVHFDUDOLQHDU
PXODLGDULVDPSDLGLWXQMXNNDQROHKJDPEDUGLEDZDK3DGDWDKXQVHNLWDU
ODNLODNLEHUXVLDGLDWDVWDKXQ\DQJEHNHUMD3DGDWDKXQMXPODKLQLPHQLQJNDW
PHQMDGL




D 7HQWXNDQNHPLULQJDQJDULVJXQDNDQWLWLN  GDQWLWLN 


E $SDPDNVXGGDULNHPLULQJDQSDGDVRDODGDODPNRQWHNVPDVDODKLQL"



ht

%DQ\DN/DNLODNL ULEXDQ

tp

://














        

.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

137

Membelajarkan 4.3

Menentukan
Persamaan Garis Lurus

.id

1. Amati dan kenali terlebih beberapa materi prasyarat atau pendukung yang telah
dipelajari oleh siswa sebagai bahan apersepsi sebelum mempelajari materi
Persamaan Garis Lurus, yaitu Fungsi dan Sistem Koordinat.
2. Bentuk siswa menjadi kelompok-kelompok kecil (2-3 orang) yang
memungkinkan siswa belajar lebih efektif.
3. Identifikasi siswa yang biasanya kesulitan membuat pertanyaan.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

0HQHQWXNDQ
3HUVDPDDQ*DULV/XUXV

.HJLDWDQ 

D .HPLULQJDQJDULV\DQJPHODOXLGXDWLWLN

$\R
.LWD$PDWL

B(4, 5)

&RQWRK 

A(2, 1)

7HQWXNDQNHPLULQJDQJDULV\DQJPHODOXLWLWLN$  
GDQ% 

$OWHUQDWLI
3HQ\HOHVDLDQ

0LVDO  DGDODK [\ GDQ  DGDODK [\ 

Ayo
Kita Amati

ht

tp

://

Bimbinglah siswa untuk


mengamati contoh
dan penyelesaiannya
tentang kemiringan
persamaan garis yang
melalui dua titik melalui
konsep yang telah
dipelajari pada kegiatan
sebelumnya, sehingga
siswa dapat mengetahui
nilai positif atau negatif
dari kemiringan suatu
persamaan garis lurus.
138

.HPLULQJDQJDULV$%

\  \
[  [

 
 


*DPEDU*DULV\DQJNHPLULQJDQQ\D
EHUQLODLSRVLWLI

3HUKDWLNDQ EDKZD NHPLULQJDQ JDULV \DQJ EHUQLODL SRVLWLI EHQWXN JDULVQ\D QDLN VHODOX PLULQJ NH
NDQDQ 

&RQWRK 

7HQWXNDQ NHPLULQJDQ JDULV \DQJ PHODOXL WLWLN   


GDQ 

(-2 , 5)
(1 , 2)

$OWHUQDWLI
3HQ\HOHVDLDQ

0LVDO  DGDODK [\ GDQ  DGDODK [\ 


.HPLULQJDQJDULV$%







\   \
[  [



   



 

*DPEDU*DULV\DQJNHPLULQJDQQ\D
EHUQLODLQHJDWLI

3HUKDWLNDQEDKZDNHPLULQJDQJDULV\DQJEHUQLODLQHJDWLIEHQWXNJDULVQ\DWXUXQ VHODOXPLULQJNHNLUL 

Buku Guru Kelas VIII SMP/MTs

0$7(0$7,.$

Semester 1



Ayo Kita
Menanya

Mintalah siswa untuk


menuliskan pertanyaan lain
tentang perbedaan nilai
kemiringan dan grafik
dari keempat contoh yang
diamati sebelumnya.

.id

Selain pertanyaan yang


sudah ada di buku
siswa, giring siswa
untuk mempertanyakan
bagaimanakah kemiringan
suatu garis yang sejajar
dengan sumbu koordinat?

&RQWRK 

$OWHUQDWLI
3HQ\HOHVDLDQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

7HQWXNDQ NHPLULQJDQ JDULV \DQJ VHMDMDU


VXPEX[GDQPHODOXLWLWLN  

*UDN PHQXQMXNNDQ JDULV KRUL]RQWDO PHODOXL WLWLN


   DGDODKWLWLN\DQJMXJDPHODOXL*DULV
\  \
.HPLULQJDQ
 
[  [



 



 


&RQWRK 

\  \
[  [



 


ht


WLGDNWHUGHQLVL

"

(2, 4)

(2, 1)

tp



://

*UDN PHQXQMXNNDQ JDULV KRUL]RQWDO PHODOXL


WLWLN    DGDODKWLWLN\DQJMXJDPHODOXL
JDULV
.HPLULQJDQ

(1, 3)

(0, 3)

*DPEDU*UDN\DQJVHMDMDUVXPEX[

7HQWXNDQ NHPLULQJDQ JDULV \DQJ VHMDMDU


VXPEX\GDQPHODOXLWLWLN  
$OWHUQDWLI
3HQ\HOHVDLDQ




*DPEDU*UDN\DQJVHMDMDUVXPEX\

$\R.LWD
0HQDQ\D

3HUKDWLNDQNHHPSDWFRQWRKGDQSHQ\HOHVDLDQQ\D\DQJWHODKNDOLDQDPDWL0XQJNLQNDOLDQEHUWDQ\D
&RQWRKPLVDOQ\D$SDNDKMLND  DGDODK [\ GDQ  DGDODK [\ QLODLNHPLULQJDQ
JDULVDNDQEHUXEDKMXJD"0HQJDSD"
6HNDUDQJEXDWODKSHUWDQ\DDQWHQWDQJSHUEHGDDQQLODLNHPLULQJDQGDQJUDNGDULNHHPSDWFRQWRK



.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

139

0HQJJDOL
,QIRUPDVL

'DUL SHUWDQ\DDQSHUWDQ\DDQ \DQJ WHODK NDOLDQ EXDW PXQJNLQ SHUWDQ\DDQSHUWDQ\DDQ EHULNXW


WHUPDVXNGLGDODPGDIWDUSHUWDQ\DDQNDOLDQ
*UDN\DQJEDJDLPDQDNDK\DQJPHPLOLNLNHPLULQJDQSRVLWLI"
*UDN\DQJEDJDLPDQDNDK\DQJPHPLOLNLNHPLULQJDQQHJDWLI"
$SDNDKVHEXDKJDULVPHPLOLNLOHELKGDULVDWXNHPLULQJDQ"
$SDNDKDGDVLIDWNHPLULQJDQODLQVHODLQNHHPSDWVLIDWVHSHUWL\DQJGLFRQWRKNDQ"
8QWXN PHQMDZDE SHUWDQ\DDQSHUWDQ\DDQ GL DWDV SHUKDWLNDQ NHPEDOL FRQWRK \DQJ GLEHULNDQ
%XDWODKGXJDDQWHQWDQJVLIDWVLIDWNHPLULQJDQGDQEHQWXNJUDNSHUVDPDDQJDULV\DQJGLEHQWXN
6HODQMXWQ\D FRED NDOLDQ GLVNXVLNDQ GHQJDQ WHPDQ VHEDQJNX NDOLDQ &RQWRK  GDQ
SHQ\HOHVDLDQQ\DGLEDZDKLQL

&RQWRK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

.HPLULQJDQJDULV\DQJPHODOXLWLWLN S GDQ  DGDODK   7HQWXNDQQLODLS



$OWHUQDWLI
3HQ\HOHVDLDQ
0LVDONDQ S DGDODK [\ GDQ  DGDODK [\ 

.HPLULQJDQJDULV 

\   \

   GLNHWDKXL
[  [


GHQJDQPHQVXEVWLWXVLQLODLNHUXPXVGLDWDVGLSHUROHK
.HPLULQJDQJDULV 

\   \

[  [





 S

   

VXEVWLWXVLQLODL[GDQ\





 S



VHGHUKDQDNDQ

 

 S 

NDOLNDQVLODQJ



S

VHGHUKDQDNDQ



S

NXUDQJNDQNHGXDUXDVROHK



S

VHGHUKDQDNDQ





S

EDJLNHGXDUXDVROHK







Menggali
Informasi

ht

=+

tp

://

0$7(0$7,.$

Bimbinglah siswa
untuk berdiskusi untuk
menggali informasi dari
pertanyaan yang tersaji
sebelumnya dengan
memperhatikan contoh
yang disajikan.
140

Buku Guru Kelas VIII SMP/MTs

Semester 1



E.HPLULQJDQJDULV\ P[F











$\R
.LWD$PDWL

3HUVDPDDQ \  [   DGDODK FRQWRK


SHUVDPDDQJDULVOXUXV*UDNSHUVDPDDQ
JDULV OXUXV WHUVHEXW GLWXQMXNNDQ JDPEDU
EHULNXW
'DULJUDN
.HPLULQJDQ 
EHUSRWRQJDQGHQJDQVXPEX\GL\ 

$\R.LWD
0HQDQ\D

\ [

SHUXEDKDQYHUWLNDO 

SHUXEDKDQKRUL]RQWDO 

         

*DPEDU*UDNJDULVSHUVDPDDQ\ [

.id

"

    






3HUKDWLNDQEDKZDNHPLULQJDQJDULVVDPDGHQJDQNRHVLHQ[GLSHUVDPDDQ\ [%HJLWXMXJD
WLWLNSRWRQJVXPEX\\DQJVDPDGHQJDQVXNXNRQVWDQ

0DVDODK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

%DJDLPDQDGHQJDQSHUVDPDDQ\ [EHUDSDNDKNHPLULQJDQSHUVDPDDQWHUVHEXW"%HUDSDNDK
SHUSRWRQJDQVXPEX\Q\D"&REDJDPEDUJUDNQ\DXQWXNPHQGXNXQJMDZDEDQPX

3HUVDPDDQJDULVO[\ 7HQWXNDQ
D NHPLULQJDQJDULVO

E .RRUGLQDWWLWLNSRWRQJJDULVOGHQJDQVXPEX\

F .RRUGLQDWWLWLNSRWRQJJDULVOGHQJDQVXPEX[GDQJDPEDUJUDNQ\D

$OWHUQDWLI3HPHFDKDQ0DVDODK
[\



GDSDWGLQ\DWDNDQGDODPEHQWXNXPXP

[\



WXOLVSHUVDPDDQ\DQJGLNHWDKXL

[

\

WDPEDKNHGXDUXDVROHK\


 [


\

EDJLNHGXDUXDVROHK

6HPHVWHU

tp

://

.HODV9,,,60307V

ht



Ayo Kita
Menanya

Bimbinglah siswa untuk


mengamati contoh dan
penyelesaiannya tentang
kemiringan pada persamaan
garis y= mx + c
MATEMATIKA

141

'HQJDQGHPLNLDQP 


GDQF 



D .HPLULQJDQJDULVODGDODK 

E *DULVOPHPRWRQJVXPEX\GL  
F *DULVODNDQPHPRWRQJVXPEX[XQWXN\ 


[


\

WXOLVSHUVDPDDQJDULV


[




VXEVWLWXVL\ 


[




NXUDQJLNHGXDUXDVROHK

[



NDOLNDQNHGXDUXDVROHK





D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

-DGLJDULVOPHODOXLWLWLN  GDQ




.id





&HNNHPLULQJDQ

.HPLULQJDQJDULVO\DQJPHODOXL  GDQ


P 

\   \
 
[  [









 


  






[


*DPEDU*UDNJDULVO[\

F0HQHQWXNDQSHUVDPDDQJDULVOXUXV


\ P[F

NHPLULQJDQ SHUSRWRQJDQVXPEX\

ht

tp

://

3HUKDWLNDQSHUVDPDDQJDULVOXUXV\ P[FNLWDGDSDWGHQJDQPXGDKPHQHQWXNDQSHUVDPDDQJDULV
OXUXVMLNDNLWDPHQJHWDKXLQLODLPGDQF

0$7(0$7,.$

Ajak siswa untuk mengamati dan memahami


Masalah 4.5 dan penyelesaiannya. Ajak siswa untuk
memahami bagaimana menentukan kemiringan
garis dengan membentuk persamaan yang diketahui
menjadi bentuk umum y = mx + c.

142

Buku Guru Kelas VIII SMP/MTs

Semester 1



7LJDNDVXVEHULNXWPHQXQMXNNDQEDJDLPDQDNLWDPHQHQWXNDQSHUVDPDDQJDULVOXUXVMLNDVDODKVDWX
XQVXUEHULNXWGLNHWDKXL
D .HPLULQJDQGDQQLODLF .DVXV,
E .HPLULQJDQGDQVHEXDKWLWLNSDGDJDULV .DVXV,,
F 'XDWLWLNSDGDJDULV .DVXV,,,

\
P

[\

[\

.DVXV,
'LNHWDKXLNHPLULQJDQPGDQ
QLODLF

.DVXV,,
'LNHWDKXLNHPLULQJDQP
GDQVDODKVDWXWLWLN [\

.DVXV,,,
'LNHWDKXLGXDWLWLN
[\ GDQ [\

.id

[\

*DPEDU%HEHUDSDNDVXVSHUVDPDDQJDULVOXUXV

&RQWRK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

6HNDUDQJSHUKDWLNDQFRQWRKEHULNXWXQWXNVHWLDSNDVXV

0HQHQWXNDQSHUVDPDDQJDULVOXUXV\DQJGLNHWDKXLNHPLULQJDQGDQWLWLNSRWRQJVXPEX\

7HQWXNDQSHUVDPDDQJDULVOXUXV\DQJPHPLOLNLNHPLULQJDQGDQPHPRWRQJVXPEX\GL  
$OWHUQDWLI
3HQ\HOHVDLDQ

'LNHWDKXLNHPLULQJDQP GDQJDULVPHPRWRQJVXPEX\GL  EHUDUWLF 


'HQJDQGHPLNLDQ
\

P[F

WXOLVSHUVDPDDQXPXP


\
[
-DGLSHUVDPDDQJDULVOXUXV\DQJGLPDNVXGDGDODK\ [

&RQWRK 

.HODV9,,,60307V

ht



tp

://

0HQHQWXNDQSHUVDPDDQJDULVOXUXV\DQJGLNHWDKXLNHPLULQJDQGDQNRRUGLQDWWLWLN\DQJPHODOXLJDULV

7HQWXNDQSHUVDPDDQJDULVOXUXV\DQJPHPLOLNLNHPLULQJDQ GDQPHODOXLWLWLN  


6HPHVWHU

1. Mintalah siswa untuk mengamati kasus


masalah dan alternatif penyelesaiannya yang
tersaji dengan seksama.
2. Lakukan tanya jawab untuk memastikan
bahwa siswa telah memahami cara
menentukan persamaan garis lurus dengan
benar.

MATEMATIKA

143

$OWHUQDWLI
3HQ\HOHVDLDQ

2OHKNDUHQDSHUVDPDDQJDULVEHUEHQWXN\ P[F
\

P[F

GDQWLWLN  GLODOXLJDULVPDND

WXOLVSHUVDPDDQXPXP


  F 


VXEVWLWXVLQLODL[GDQQLODL\





F

VHGHUKDQDNDQ



F

NXUDQJNDQNHGXDUXDVROHK

-DGLSHUVDPDDQJDULV\DQJGLPDNVXGDGDODK
\


[





[

NDOLNDQNHGXDUXDVROHK



[\

NXUDQJNDQNHGXDUXDVROHK\

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

$OWHUQDWLI
3HQ\HOHVDLDQ

.id

\

$OWHUQDWLISHQ\HOHVDLDQLQLPHQJJXQDNDQNHPLULQJDQGXDEXDKWLWLN\DQJPHODOXLJDULV

0LVDO3 [\ DGDODKVHEDUDQJWLWLNSDGDJDULV2OHKNDUHQDNHPLULQJDQJDULV\DQJPHODOXLWLWLN


 GDQ3 [\ DGDODK  VHKLQJJD


P 
\   \
\


WXOLVUXPXVNHPLULQJDQ

P 
[  [



   \ 
[


VXEVWLWXVLQLODLP[GDQ\

 \ 

 [

NDOLNDQVLODQJ

\ 

 [

VHGHUKDQDNDQ

\  [

\

  [


MXPODKNDQNHGXDUXDVROHK

EDJLNDQNHGXDUXDVROHK

-DGLSHUVDPDDQJDULV\DQJGLPDNVXGDGDODK \

3 [\

*DPEDU*UDNSHUVDPDDQ
\   [


[   


\\ P [[

ht

tp

://

'DUL &RQWRK  NLWD WDKX EDKZD SHUVDPDDQ JDULV OXUXV \DQJ PHODOXL WLWLN [ \  GDQ PHPLOLNL
NHPLULQJDQPDGDODK

0$7(0$7,.$

1. Mintalah siswa untuk mengamati alternatif penyelesaian Contoh 4.17.


2. Lakukan tanya jawab untuk memastikan bahwa siswa telah memahami cara
menentukan persamaan garis lurus dengan benar.

144

Buku Guru Kelas VIII SMP/MTs

Semester 1



&RQWRK 
0HQHQWXNDQSHUVDPDDQJDULVOXUXV\DQJGLNHWDKXLNRRUGLQDWGXDWLWLN\DQJPHODOXLJDULV
7HQWXNDQSHUVDPDDQJDULV\DQJPHODOXLWLWLN  GDQ  
$OWHUQDWLI
3HQ\HOHVDLDQ

.HPLULQJDQJDULV\DQJPHODOXLWLWLN  GDQ  DGDODK


\  \
P  
[  [

   

  

.id



2OHKNDUHQDSHUVDPDDQJDULVEHUEHQWXN\ P[FGDQWLWLN  GLODOXLJDULVPDND
\ P[F
   F
F 
-DGLSHUVDPDDQJDULV\DQJPHODXLWLWLN  GDQ  DGDODK\ [

$OWHUQDWLI
3HQ\HOHVDLDQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

&DWDWDQ+DVLO\DQJVDPDMLND  GLJXQDNDQXQWXNPHQHQWXNDQQLODLF

$OWHUQDWLISHQ\HOHVDLDQLQLPHQJJXQDNDQNHVDPDDQGXDEHQWXNDOMDEDUXQWXNNHPLULQJDQJDULV\DQJ
GLPDNVXG

0LVDO3 [\ VHEDUDQJWLWLNSDGDJDULV2OHKNDUHQDNHPLULQJDQJDULV\DQJPHODOXL  GDQ


3 [\ DGDODK
\
\
 
P

[
[   
\
.HPLULQJDQJDULV\DQJPHODOXL  GDQ  DGDODK
P

   
 
  

2OHKNDUHQDNHGXDNHPLULQJDQGLDWDVDGDODKVDPDPDND
\
 
[

3 [\



*DPEDU*UDNSHUVDPDDQ
\ [



ht

tp

://

\  [
\ [
\
[
-DGLSHUVDPDDQJDULV\DQJGLPDNVXGDGDODK\ [



.HODV9,,,60307V

6HPHVWHU

1. Mintalah siswa untuk mengamati alternatif penyelesaian Contoh 4.18.


2. Lakukan tanya jawab untuk memastikan bahwa siswa telah memahami cara
menentukan persamaan garis lurus dengan benar.

MATEMATIKA

145

$\R.LWD
0HQDODU

0DVDODK 
.DOLDQWHODKPHQJHWDKXLFDUDPHQHQWXNDQSHUVDPDDQJDULV\DQJPHPLOLNLNHPLULQJDQGDQPHODOXL
WLWLN WHUWHQWX %DJDLPDQD FDUD NDOLDQ PHQHQWXNDQ SHUVDPDDQ JDULV \DQJ VHMDMDU DWDX WHJDN OXUXV
GHQJDQJDULVODLQ"
3HUKDWLNDQFRQWRKEHULNXWXQWXNPHPEDQWXNDOLDQPHQMDZDEPDVDODKGLDWDV
&RQWRK 

Ayo Kita
Menalar

7HQWXNDQSHUVDPDDQJDULV\DQJPHODOXLWLWLN  GDQVHMDMDUJDULV[\ 



$OWHUQDWLI
3HQ\HOHVDLDQ

Ayo Kita
Berbagi

.id

8QWXNPHQHQWXNDQSHUVDPDDQJDULVNDOLDQKDUXVPHQJHWDKXLWLWLNSDGDJDULVGDQNHPLULQJDQJDULV
7LWLN\DQJGLNHWDKXLDGDODK  .DUHQDJDULV\DQJGLPDNVXGVHMDMDU[\ NHGXDJDULVSDVWL
PHPLOLNLGXDNHPLULQJDQ\DQJVDPD3HUKDWLNDQEDKZDSHUVDPDDQ[\ PHPLOLNLEHQWXN\DQJ
VDPDGHQJDQ\ \VHKLQJJDNHPLULQJDQNHGXDJDULVDGDODK
6HNDUDQJWHQWXNDQSHUVDPDDQJDULV\DQJPHODOXLWLWLN  GDQPHPLOLNLNHPLULQJDQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Ajak siswa bernalar


bagaimana menentukan
persamaan garis lurus
jika diketahui titik
dan garis lain yang
sejajar atau tegak lurus.
Minta siswa untuk
memperhatikan
Masalah 4.6.

P [[ 

\    >[  @

VXEVWLWXVLP GDQ  XQWXN [\

\

  [ 

VHGHUKDQDNDQ

\

 [

VHGHUKDQDNDQGHQJDQGLVWULEXVLSHUNDOLDQ

\
 [
NXUDQJNDQNHGXDUXDVROHK
-DGLSHUVDPDDQ\DQJGLPLQWDDGDODK\ [

'LVNXVLNDQGHQJDQWHPDQNDOLDQEDJDLPDQDNDOLDQPHQHQWXNDQSHUVDPDDQJDULV\DQJWHJDNOXUXV
GHQJDQJDULVODLQ"-HODVNDQSURVHGXU\DQJNDOLDQJXQDNDQXQWXNPHQHQWXNDQSHUVDPDDQJDULV\DQJ
WHJDNOXUXVGHQJDQJDULVODLQ
'HQJDQFDUD\DQJVDPDVHSHUWL&RQWRKNDOLDQELVDPHQHQWXNDQSHUVDPDDQ\DQJGLPDNVXG
1DPXQ\DQJKDUXVGLLQJDWEDKZDKDVLONDOLNHPLULQJDQGXDJDULV\DQJVDOLQJWHJDNOXUXVDGDODK

$\R.LWD
%HUEDJL

7XOLVNDQKDVLOGLVNXVLGLEXNXWXOLVNDOLDQNHPXGLDQWXNDUNDQGHQJDQWHPDQNDOLDQ\DQJODLQ6LODNDQ
PHPEHULNRPHQWDUGDQPHPEHULNRPHQWDUVHFDUDVDQWXQ

0$7(0$7,.$

ht

tp

://

1. Tugaskan kepada
siswa untuk
diskusi tentang
cara menentukan
persamaan garis
yang saling tegak
lurus berdasarkan
pengamatan
sebelumnya.
2. Mintalah siswa untuk
menulis hasil diskusi
pada lembar jawaban.
3. Kemudian
menukarkan lembar
jawaban tersebut
dengan kelompok
lain. Saling diskusi
lembar jawaban
kelompok lain serta
memberikan kritik,
saran, dan komentar
yang perlu.

\\

146

Buku Guru Kelas VIII SMP/MTs

Semester 1



"

/DWLKDQ 

 7XOLVODKSHUVDPDDQJDULV\DQJGLWXQMXNNDQPDVLQJPDVLQJJDPEDUEHULNXW
\
E
D
\


.HPLULQJDQ 

.HPLULQJDQ




.id

 7XOLVODKSHUVDPDDQJDULV\DQJGLWXQMXNNDQPDVLQJPDVLQJJDPEDUEHULNXW
E
D \
\


.HPLULQJDQ 

.HPLULQJDQ 


D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o



 7XOLVODKSHUVDPDDQJDULV\DQJGLWXQMXNNDQPDVLQJPDVLQJJDPEDUEHULNXW
\
E
D
\






tp

.HODV9,,,60307V

ht



://



6HPHVWHU

?!

Latihan

Mintalah siswa
untuk mengerjakan
tugas latihan secara
mandiri dari 3 kasus
yang disajikan.
Hasil peojek ditulis
dengan rapi dan
dipajang pada papan
pajangan kelas untuk
dikomentari teman
lainnya.
MATEMATIKA

147

 7HQWXNDQSHUVDPDDQJDULVOXUXVMLNDGLNHWDKXLLQIRUPDVLEHULNXWLQL


D 0HPLOLNLNHPLULQJDQ GDQPHODOXLSHUSRWRQJDQVXPEX\GLWLWLN  

E 0HPLOLNLNHPLULQJDQGDQPHODOXL  
F 0HODOXLWLWLN  GDQ  
G 0HODOXL  GDQVHMDMDUGHQJDQJDULV\ [
H 6HMDMDUVXPEX[GDQPHODOXL  
I 6HMDMDUVXPEX\GDQPHODOXL  
J 0HODOXL  GDQWHJDNOXUXVGHQJDQJDULV\DQJPHODOXLWLWLN  GDQ  
 7HQWXNDQSHUVDPDDQJDULV\DQJPHODOXL  GDQVHMDMDUGHQJDQJDULV[\ 

E O

F P

G Q

H WHJDNOXUXVJDULVOGDQPHODOXL

 

I

VHMDMDUJDULVNGDQPHODOXL 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id


 7HQWXNDQSHUVDPDDQJDULV\DQJWHJDNOXUXV\  [ GDQPHODOXLWLWLN  

 7HQWXNDQSHUVDPDDQJDULVOXUXVXQWXNPDVLQJPDVLQJJDULVEHULNXW
\
P
N
O
 D N

J VHMDMDUJDULVQGDQPHODOXL 




K WHJDNOXUXVJDULVPGDQPHODOXL



 3EHUNRRUGLQDWGL  4EHUNRRUGLQDWGL  GDQ2DGDODKWLWLNDVDO

D 7HQWXNDQSHUVDPDDQJDULV\DQJPHODOXL3GDQPHPLOLNLNHPLULQJDQVDPDGHQJDQJDULV24

E 'LNHWDKXLEDKZDJDULVGLVRDODPHODOXL N WHQWXNDQQLODLN

 3HUVDPDDQJDULVODGDODK\[ 7HQWXNDQ

D 7LWLNNRRUGLQDWJDULVO\DQJPHPRWRQJVXPEX[
E 7LWLNNRRUGLQDWJDULVO\DQJPHPRWRQJVXPEX\
F .HPLULQJDQJDULVO
G *DPEDUNDQJDULVO

 *DULVNPHODOXLWLWLN$  GDQ%  *DULVOPHODOXLWLWLN&  ' G 7 W 
*DULVNWHJDNOXUXVJDULVO7HQWXNDQQLODLGGDQW

ht

tp

://

0$7(0$7,.$

1. Periksalah apakah semua siswa sudah


mampu memahami dan menentukan
persamaan garis lurus, menentukan
persamaan garis yang sejajar atau tegak
lurus dengan garis lain yang diketahui,
2. Berikan tugas kepada siswa untuk
mengerjakan latihan secara mandiri dan
mengumpulkannya kepada guru.
148

Buku Guru Kelas VIII SMP/MTs

Semester 1



7XJDV
3URMHN

 7HPXNDQ FDUD PHQJJDPEDU JUDN SHUVDPDDQ JDULV OXUXV GHQJDQ ODQJNDKODQJNDK VHSHUWL
SDGDNHJLDWDQ%XDWODKODSRUDQ GLNHWLNGHQJDQNRPSXWHU NHPXGLDQSDMDQJNDQODSRUDQ
NDOLDQSDGDSDSDQSDMDQJDQ

8QWXN PHQJJDPEDU JUDN SHUVDPDDQ JDULV OXUXV LQL VHEHQDUQ\D GDSDW PHQJJXQDNDQ
VRIWZDUH NRPSXWHU )[ 'UDZ 0DSOH 0LFURVRIW ([FHO 0DWKHPDWLFD *HR*HEUD 0DWODE
DWDX 4W2NWDYH  GDQ LWX VDQJDW PXGDK 0HQXUXW NDOLDQ PDVLK SHUOXNDK NDOLDQ PHPLOLNL
NHPDPSXDQPHQJJDPEDUJUDNSHUVDPDDQJDULVOXUXVVHFDUDPDQXDO"0HQJDSD"
&RQWRKJUDNSHUVDPDDQJDULVOXUXV
\


\ [






\ 





















1. Siapkan perangkat
computer, printer
beserta salah satu
software menggambar
grafik persamaan garis
lurus. Misal, Fx Draw,
Mapple, Mathematica,
GeoGebra, Matlab.



D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o



Tugas
Projek



.id















[ \



\ [



*DPEDU&RQWRKJUDNSHUVDPDDQJDULVOXUXV

&RQWRKEXNDQJUDNSHUVDPDDQJDULVOXUXV
\












\ [

\ ORJ[







[









*DPEDU&RQWRKJUDNEXNDQSHUVDPDDQJDULVOXUXV

6HPHVWHU

tp

://

.HODV9,,,60307V

ht















2. Minta siswa untuk


mencetak hasil gambar
grafik dan memberikan
komentar.
3. Jika ada siswa yang
lebih cepat mahir dalam
menggunakan salah
satu software tersebut,
berikan motivasi agar
dia mau membantu
teman lainnya dalam
menggunakan sofware
dengan senang hati.
4. Untuk sekolah yang
belum tersedia
laboratorium computer
di sekolah, cobalah
gambar grafik
persamaan garis lurus
yang tersedia di kertas
milimeter blok.
MATEMATIKA

149

%XDWODK EHUPDFDPPDFDP JUDN IXQJVL GHQJDQ PHQJJXQDNDQ VRIWZDUH \DQJ DGD


.HORPSRNNDQJUDNJUDNWHUVHEXWVHVXDLGHQJDQNDWHJRUL\DQJNDOLDQLQJLQNDQ0LVDOQ\D
PHPLOLNLNHPLULQJDQ\DQJVDPDGXDJDULV\DQJVHMDMDUGXDJDULV\DQJVDOLQJWHJDNOXUXVGDQ
ODLQQ\D%HULODKNRPHQWDUXQWXNPDVLQJPDVLQJNHORPSRN-HODVNDQEDJDLPDQDFDUDNDOLDQ
PHQJHORPSRNNDQQ\D

 8QWXNNDOLDQ\DQJWLGDNPHQJJXQDNDQNRPSXWHUDWDXEHOXPWHUVHGLDODERUDWRULXPNRPSXWHU
GLVHNRODKFREDODKJDPEDUJUDNSHUVDPDDQJDULVOXUXVEHULNXWGLNHUWDVEHUSHWDN\DQJNDOLDQ
PLOLNLDWDX\DQJNDOLDQEXDW

1. Gradien (kemiringan)
garis

3. Garis p tegak lurus


garis q jika dan hanya
jika mp mq = - 1
4. Persamaan garis jika
diketahui gradien &
satu titik adalah y y1
= m(x x1)
5. Persamaan garis
jika diketahui
dua titik adalah

E [  \
D E

-HODVNDQSURVHGXUSDOLQJVHGHUKDQDXQWXNPHPEXDWJUDNWHUVHEXW

&DWDWDQ6LODNDQJDQWLQLODLDGDQEVHPDXNDOLDQ

6DMLNDQJUDN\DQJNDOLDQEXDWGHQJDQWDPSLODQ\DQJEDLNDJDUWHPDQNDOLDQWHUWDULNGDQPXGDK
PHPEDFDQ\D3DMDQJJUDNGDQPLQWDODKNRPHQWDUGDULWHPDQNDOLDQ-LNDDGDWHPDQ\DQJWHUWDULN
SDGD NDU\D NDOLDQ WHQWDQJ VDODK VDWX SURJUDP NRPSXWHU WHUVHEXW PDND VHEDLNQ\D NDOLDQ PDX
PHQJDMDULGHQJDQVHQDQJKDWL

0HUDQJNXP

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

2. Garis p dan q sejajar


jika dan hanya jika mp
= mq

D D[E\F 

.id

Merangkum

.DOLDQWHODKPHPSHODMDULWHQWDQJEHQWXNSHUVDPDDQJDULVOXUXVGDQFDUDPHQJJDPEDUJUDNQ\D
-DZDEODKEHEHUDSDSHUWDQ\DDQEHULNXWXQWXNPHPDQWDSNDQKDOSHQWLQJ\DQJSHUOXGLSHUKDWLNDQ
SDGDPDWHULSHUVDPDDQJDULVOXUXV
 %DJDLPDQDODQJNDKODQJNDKPHQJJDPEDUJUDNSHUVDPDDQJDULVOXUXV"
 %DJDLPDQDPHQHQWXNDQNHPLULQJDQJDULV\DQJPHODOXLGXDEXDWWLWLN"

 %DJDLPDQDPHQHQWXNDQNHPLULQJDQJDULVMLNDGLNHWDKXLSHUVDPDDQQ\D"

 %DJDLPDQD FDUD PHQHQWXNDQ SHUVDPDDQ JDULV OXUXV \DQJ PHODOXL NHPLULQJDQ P  GDQ WLWLN
$ [\ "

 %DJDLPDQDFDUDPHQHQWXNDQSHUVDPDDQJDULVOXUXV\DQJPHODOXLGXDWLWLN$ [\  GDQ


% [ \ "
 $SD\DQJGDSDWNDOLDQNHWDKXLWHQWDQJNHPLULQJDQ
D 'XDJDULV\DQJVDOLQJVHMDMDU"

E 'XDJDULV\DQJEHUSRWRQJDQVDOLQJWHJDNOXUXV"

 3HUVDPDDQVXDWXJDULVGHQJDQNHPLULQJDQPGDQPHODOXLWLWLN [\ GDSDWGLQ\DWDNDQROHK


\\ P [[ DWDX\ P [[ \-HODVNDQEDJDLPDQDKXEXQJDQJUDN
\ P [[ \GDQJUDN\ P[

://

0$7(0$7,.$

tp

6. Kedudukan dua garis


lurus

ht

a. Sejajar , jika m1
= m2

b. Berhimpit, jika m1
= m2 dan c1 = c2
c. Berpotongan, jika
d. Tegak lurus, jika
m1 m2 = -1
150

Buku Guru Kelas VIII SMP/MTs

Semester 1



"

8ML
.RPSHWHQVL

 *DPEDUODKJUDNSHUVDPDDQJDULVOXUXVEHULNXW
D \ [

E \[ 

 .HWXWGDQ.DGHNPHQJKLWXQJNHPLULQJDQJDULV\DQJPHODOXLWLWLN$  GDQ%  

.HWXW

Kadek

P = 

 

m =  





=

.id

= 

 7HQWXNDQNHPLULQJDQPDVLQJPDVLQJJDULVEHULNXW
\

E

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

D









 7HQWXNDQSHUVDPDDQJDULVOXUXVMLNDGLNHWDKXLLQIRUPDVLEHULNXW
D 0HPLOLNLNHPLULQJDQGDQPHODOXLWLWLN  

E 0HPLOLNLNHPLULQJDQ  GDQPHODOXLWLWLN 



F 0HPLOLNLNHPLULQJDQGDQPHODOXLWLWLN 
G 0HODOXL  GDQ  

tp

.HODV9,,,60307V

6HPHVWHU

ht



://

H 0HODOXL  GDQ 

Minta siswa untuk menyelesaikan soal kompetensi dan diskusikan soal yang banyak
siswa mengalami kesulitan. Lakukan diskusi baik secara klasikal maupun kelompok
untuk mengetahui masalah yang ditemui siswa. Perhatikan siswa yang masih kesulitan
dalam menyelesaikan uji kompetensi 4 ini.

MATEMATIKA

151

 7LWLN34GDQ5EHUWXUXWWXUXWEHUNRRUGLQDWGL
   GDQ  

\
5 

D *DULVOPHPLOLNLNHPLULQJDQ\DQJVDPD
GHQJDQJDULV34GDQPHODOXLWLWLN5
7HQWXNDQSHUVDPDDQJDULVO

3 

E *DULVOEHUNHPLULQJDQPHODOXLWLWLN5GDQ
PHPRWRQJVXPEX\GL6
L 

7HQWXNDQSHUVDPDDQJDULVO

4 

LL  7HQWXNDQNRRUGLQDWWLWLN6

E L 

.HPLULQJDQ 

F L  

LL  \ [

LL 

.HPLULQJDQ  


LL  

LLL \[ 

LLL  .HPLULQJDQ 

LLL  

LY [\ 

LY  .HPLULQJDQ 

LY  

L  \ [

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

 &RFRNNDQVHWLDSSHUVDPDDQJDULVOXUXVGLDGHQJDQNHPLULQJDQGLEWLWLNSRWRQJVXPEX\GLF
GDQJDPEDUJUDNGLG

G L







ht

tp

 LLL





  




LL







   [

://

    




  




LY

   [

\




     [

  





     [

0$7(0$7,.$

152

Buku Guru Kelas VIII SMP/MTs

Semester 1



SoalPengayaan

=+

1. Tentukan titik potong pada sumbu x dan sumbu y dari persamaan garis
2. Tentukan persamaan garis lurus yang melalui pangkal koordinat dan mempunyai besar
kemiringan berikut.
a. 3

c.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3. Tentukan persamaan garis lurus dengan ketentuan sebagai berikut.

.id

b. - 5

a. kemiringan 4 dan melalui titik (0,7)


b. kemiringan

dan melalui titik (0,5)

c. kemiringan 2 dan melalui titik (2,1)

4. Tentukan persamaan garis lurus yang melalui dua titik berikut.

a. K(4, 6) dan L(1, 3)


b. M(1,0) dan N(3,8)
c. O(4,7) dan P(3,1)
5. Hitunglah kemiringan garis yang menghubungkan setiap pasangan titik berikut.
a. Q(3,6) dan R(1, 10)

ht

tp

://

b. S(4, 1) dan T(6, 7)


c. U(5,7) dan V(8,2)
6. Tentukan persamaan garis yang melalui titik P(3, 5) dan memiliki kemiringan 2.
7. Garis k melalui titik A(2,3) dan B(3, 1).
Garis l melalui titik C(6, 5), D(2,d), T(t ,5)
Garis k tegak lurus garis l. Tentukan d dan t.
8. Tentukan persamaan garis yang sejajar dengan garis y = 2x + 1 dan melalui titik
(4,3).
9. Gambarlah sebuah bidang koordinat.
Kemudian tentukan gambar grafik persamaan garis lurus berikut.
a.
b.
c.

MATEMATIKA

153

d.
e.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

10. Gambarlah garis dengan persamaan


. Jika titik R(a, 5) terletak pada garis
tersebut, tentukan nilai a.
11. Tentukan kemiringan dan persamaan garis dari grafik yang tersaji berikut.

12. Persamaan garis lurus yang melalui titik (2, 5) dan tegak lurus garis
adalah
13. a. Hitunglah

bila A(3, 0) dan B(0, 2)

b. Jika garis h sejajar dengan AB, tentukan kemiringan garis h.


c. Jika garis k tegak lurus dengan AB, tentukan kemiringan garis k.
14. Garis dengan persamaan = 5x 1 melalui titik A(2, a) dan B(3, b)

://

a. Tentukan nilai a dan b


b. Berapakah kemiringan garis tersebut?

ht

tp

15. a. Tentukan persamaan garis yang melalui titik (0, 7) dan memiliki kemiringan
3
sebesar
4
b. Tentukan persamaan garis yang melalui titik (7, 6) dan memiliki
kemiringan sebesar 3
15. Tentukanlah kemiringan dari persamaan garis berikut.

a.

d.

b.

e.

c.
154

Buku Guru Kelas VIII SMP/MTs

Semester 1

16. Persamaan garis melalui titik (2, 5) dan sejajar garis

adalah .

a.
b.
c.
d.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

17. Tentukan persamaan garis h yang melalui titik K(2,4) dan sejajar garis g dengan
.
persamaan
18. Empat puluh buah buku akan terjual jika harganya (dalam ribuan) Rp120,00 dan lima
puluh buku akan terjual jika harganya Rp 80,00. Tentukan:
a. Fungsi permintaannya dan grafiknya.
b. Banyak barang yang diminta jika harga per unit Rp 20,00
19. Sepeda merek Kuat bila dijual seharga (dalam ribuan) Rp 300, perunit akan
laku sebanyak 1.000 unit, dan pada setiap kenaikan harga sebesar Rp 100, jumlah
penjualannya bertambah sebanyak 400 unit. Tentukan
a. fungsi penawarannya,
b. banyak sepeda yang dirawarkan jika harga per unit Rp 250,00.

ht

tp

://

20. Perusahaan taxi di Jakarta memasang tarif Rp10.000,00 untuk kilometer


pertama dan Rp2.000,00 per kilometer berikutnya. Tarif yang dikenakan
disajikan oleh grafik di bawah ini.

a. Jelaskan mengapa bagian pertama dalam grafik dinyatakan dalam garis


horizontal.
b. Apa maksud dari titik potong garis dengan sumbu-y dalam konteks masalah
ini?
c. Jelaskan mengapa garis yang menyatakan tarif taxi lebih dari 1 km tidak
horizontal?
d. Tentukan persamaan tarif taxi.
e. Berapakah ongkos yang harus dibayar jika penumpang menempuh 6 km?

MATEMATIKA

155

Pedoman
Penilaian
No
1

Capaian
B

Keterangan
Bila Buku Siswa terselesaikan dengan baik

<B

Bila ada bagian dari Buku Siswa yang tidak


terselesaikan

Portofolio:
a) Uji Kompetensi
b) Soal dari tempat
lain

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan mampu menyelesaikannya dengan
baik

.id

Aspek Penilaian
Keterselesaian Buku
Siswa

Bila memilih soal dari Uji Kompetensi dengan


kategori Sedang dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Mudah dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan kurang mampu
menyelesaikannya dengan baik

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o
B+

B , B
B+, B,
B

Bila memilih soal dari Uji Kompetensi


A, B+ , dengan kategori Mudah dan kurang mampu
B, B menyelesaikannya dengan baik
Bila Proyek terselesaikan dan manpu
A
mempresentasikan dengan Baik
A, B+, Bila ada bagian dari Proyek yang tidak terselesaikan
atau kurang mampu mempresentasikan
B

://

ht

tp

Tugas Projek

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan kurang mampu menyelesaikannya
dengan baik
Bila memilih soal dari Uji Kompetensi
dengan kategori Sedang dan kurang mampu
menyelesaikannya dengan baik

Bila Proyek tidak terselesaikan samasekali

Keterangan: - Nilai KKM = B




156

- Aspek penilaian Nomor 1 adalah syarat nilai yang


harus terpenuhi, sedangkan Aspek penilaian Nomor 2
adalah penambahan nilai.

Buku Guru Kelas VIII SMP/MTs

Semester 1

Teorema
Pythagoras

Bab 5

Rumus Pythagoras

Tripel Pythagoras

Segitiga siku-siku khusus

.id

Kata Kunci

1.

2.

3.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

K ompetensi
D asar

Memahami Teorema
Pythagoras melalui
alat peraga dan
penyelidikan pola
bilangan.
MenggunakanTeorema
Pythagoras untuk
menyelesaikan
berbagai masalah.
Menggunakan pola
dan generalisasi untuk
menyelesaikan masalah
nyata.

Sumber:www.andy.web/id

Seorang pekerja bangunan sedang memeriksa kesikuan,


sebelum membuat desain pondasi suatu bangunan. Dalam
memeriksa kesikuan ini mereka menggunakan Tripel
Pythagoras 6, 8, 10, meski secara ilmiah Pak Tukang tidak
mengerti alasan mengapa menggunakan itu. Ini adalah salah
satu penerapan Teorema Pythagoras dalam kehidupan seharihari.

ht

tp

://

Pengalaman
Belajar

1. Menggunakan alat peraga dan pola bilangan untuk menemukan Teorema Pythagoras .
2. Menemukan hubungan antar sisi pada segitiga siku-siku khusus.
3. Menyelesaikan permasalahan nyata denganTeorema Pythagoras.

MATEMATIKA
MATEMATIKA

137

157

Peta
Konsep

Segitiga Siku-siku
Khusus

Penerapan

ht

tp

://

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Pengertian

.id

Teorema
Pythagoras

158

138

Kelas VIII SMP/MTs

Buku Guru Kelas VIII SMP/MTs

Semester 1

Semester 1

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Pythagoras (582 SM 496 SM)


lahir di pulau Samos, di daerah Ionia,
Yunani Selatan. Salah satu peninggalan
Phytagoras yang paling terkenal hingga
saat ini adalah teorema Pythagoras, yang
menyatakan bahwa kuadrat sisi miring
suatu segitiga siku- siku sama dengan
jumlah kuadrat dari sisi-sisinya. Yang
unik, ternyata rumus ini 1.000 tahun
sebelum masa Phytagoras, orang-orang
Yunani sudah mengenal penghitungan
ajaib ini. Walaupun fakta di dalam
teorema ini telah banyak diketahui
sebelum lahirnya Pythagoras, namun
teorema ini dianggap sebagai temuan
Pythagoras, karena ia yang pertama
membuktikan pengamatan ini secara
matematis. Pythagoras menggunakan
metode aljabar untuk menyatakan
teorema ini.

Pythagoras
(582 SM 496 SM)

Temuan lain yang ditemukan oleh


Phytagoras adalah rasio/perbandingan
emas (golden ratio). Pada masa lalu,
matematika memang tidak hanya berkaitan dengan bilangan. Matematika digunakan
untuk menjabarkan lsafat dan memahami keindahan. Termasuk golden ratio ini.
Berdasarkan penemuan Phytagoras, ternyata banyak hal di alam semesta ini mengarah
pada golden ratio. Cangkang siput, galur-galur pada nanas, dan ukuran tubuh bagian atas
manusia dibandingkan bagian bawahnya hampir pasti mendekati golden ratio 1 : 1,618.
Phytagoras juga membuktikan, semua benda yang memenuhi golden ratio senantiasa
memiliki tingkat estetika yang sangat tinggi. Kalau alam semesta berlimpahan dengan
benda-benda dengan ukuran golden ratio, maka manusia mesti membuat yang serupa
demi menjaga keindahan tersebut. Bahkan, Phytagoras berprinsip bahwa Segala
sesuatu adalah angka; dan perbandingan emas adalah raja semua angka.

2.

3.

Matematika adalah ilmu yang menarik untuk kita pelajari, bukan ilmu yang
menyeramkan seperti dikatakan sebagian orang. Karena telah banyak sejarah yang
menceritakan tentang peran matematika dalam memajukan peradaban manusia,
salah satunya adalah teorema Pythagoras yang menjadi spelopor perkembangan
ilmu geometri dan arsitektur.

tp

://

Pythagoras adalah orang yang mempunyai rasa ingin tahu yang sangat tinggi.
Sekalipun teorema tentang segitiga siku-siku sudah dikenal masyarakat sebelumnya,
tapi dia terus menggalinya sehingga dapat membuktikan kebenaran teorema
tersebut secara matematis.

ht

Berdasarkan uraian di atas dapat kita ambil beberapa kesimpulan, antara lain:
1.

Tanpa kita sadari ternyata bumi yang indah beserta kehidupan yang ada di dalamnya
ini tidak lepas dari perhitungan matematika. Oleh karena itu kita perlu belajar
matematika dengan lebih mendalam sehingga bisa menguak rahasia alam sekaligus
membuktikan ke-Mahabesaran ciptaan Tuhan YME.

MATEMATIKA

159
139

159

Membelajarkan 5.1

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

1. Sampaikan tujuan pembelajaran pada siswa

.id

Memahami Teorema Pythagoras

2. Mintalah siswa membaca sebentar tentang sedikit cerita tentang


Pythagoras.

3. Persilahkan siswa untuk mengemukakakan beberapa pertanyaan untuk


memancing rasa ingin tahu siswa.
4. Berikan kesempatan pada siswa untuk sedikit berdiskusi tentang cerita
Pythagoras yang baru dibaca
5. Sampaikan pada siswa tentang pentingnya belajar tentang materi ini
untuk memotivasi siswa.
6. Mintalah siswa membaca dan memahami masalah 6.1

7. Bagilah kelas menjadi kelompok yang terdiri 4 -5 orang

ht

tp

://

8. Siapkan alat peraga berupa model persegi dengan ukuran:3 3, 4


4, 5 5, 6 6, 7 7, 8 8, 9 9, 10 10, 12 12, 13 13, 15
15 ,16 16, 17 17, 20 20, 24 24 dan 25 25 (bisa dibuat
dari karton yang ditempel kertas yang memiliki grid atau gunakan
millimeter blok) untuk setiap kelompok.

160

Buku Guru Kelas VIII SMP/MTs

Semester 1

.HJLDWDQ 

0HPDKDPL7HRUHPD3\WKDJRUDV

0DVDODK 
7HRUHPD 3\WKDJRUDV EDQ\DN GLPDQIDDWNDQ
GDODP NHKLGXSDQ VHKDULKDUL6DODK VDWX
GLDQWDUDQ\DGDODPELGDQJSHUWXNDQJDQ6HRUDQJ
WXNDQJ \DQJ DNDQ PHPEDQJXQ VXDWX UXPDK
ELDVDQ\DPHQJXNXUODKDQ\DQJDNDQGLEDQJXQ
7XNDQJWHUVHEXWPHPDVWLNDQEDKZDVXGXWVXGXW
SRQGDVL EDQJXQDQ \DQJ DNDQ GLEDQJXQ EHQDU
EHQDU VLNXVLNX GHQJDQ FDUD PHQJJXQDNDQ
VHJLWLJD GHQJDQ NRPELQDVL XNXUDQ VLVL  FP
FPGDQFP
%DUDQJNDOL3DN7XNDQJVHQGLULWLGDNPHQ\DGDUL
PHQJDSD ELODQJDQ LWX \DQJ WHSDW XQWXN
PHPEHQWXNVXGXWVLNXVLNX8QWXNPHQJHWDKXL
NHEHQDUDQFDUD\DQJGLJXQDNDQROHKSDNWXNDQJ
WHUVHEXWDNDQNLWDSHODMDULSDGDEDELQL

8NXUDQXNXUDQ \DQJ GLJXQDNDQ ROHK 3DN WXNDQJ WHUVHEXW DNDQ NLWD EXNWLNDQ PHPHQXKL WHRUHPD
3\WKDJRUDV

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

'DODP NHJLDWDQ  DNDQ NLWD SHODMDUL OHELK EDQ\DN WHQWDQJ DSD LWX WHRUHPD 3\WKDJRUDV 7HRUHPD
3\WKDJRUDVHUDWNDLWDQQ\DGHQJDQVHJLWLJDVLNXVLNX7HRUHPDELVDGLPDQIDDWNDQXQWXNPHQ\HOHVDLNDQ
PDVDODKGLVHNLWDU

.id

*DPEDU6HRUDQJ7XNDQJVHGDQJPHQJXNXU
NHVLNXDQODKDQ

$OWHUQDWLI3HPHFDKDQ0DVDODK
$\R
.LWD$PDWL

3HUKDWLNDQ*DPEDUEHULNXW
$

'

+
)

&

'

+
+

)
)

( (

* *

&

*DPEDU

6HPHVWHU

tp

://

.HODV9,,,60307V

ht



Ayo
Kita Amati

Ajak siswa mengamati


Gambar 5.1 untuk
membuat ilustrasi dalam
pembuktian teorema
pythagoras. Jelaskan
bahwa segitiga EAF,
FBG, GCH, dan HDE
adalah segitiga siku-siku
dengan ukuran yang
sama (kongruen).
MATEMATIKA

161

%DQJXQJGDWDU$%&'DGDODKEDQJXQSHUVHJLGHQJDQSDQMDQJVLVLVDWXDQSDQMDQJ3HUVHJL$%&'
WHUVXVXQGDULVHJLWLJDVLNXVLNXGHQJDQXNXUDQVDPD ($))%**&+GDQ+'( GDQSHUVHJL
()*+ 
8QWXNPHQXQMXNNDQEDKZD()*+DGDODKSHUVHJLSHUKDWLNDQSHQMHODVDQEHULNXW
3HUKDWLNDQVHJLWLJD)%*
6HJLWLJD)%*DGDODKVHJLWLJDVLNXVLNXGHQJDQVXGXWVLNXVLNXGL%2OHKNDUHQDLWXP%*)
P*)% 
3HUKDWLNDQVHJLWLJD*&+
6HJLWLJD*&+DGDODKVHJLWLJDVLNXVLNXGHQJDQXNXUDQ\DQJVDPDGHQJDQVHJLWLJD)%*
)% *&
%* &+
*) +*
2OHKNDUHQDVHJLWLJD)%*GDQ*&+DGDODKGXDVHJLWLJD\DQJXNXUDQQ\DVDPDPDNDVHWLDSVXGXW
VXGXW\DQJEHUVHVXDLDQEHVDUQ\DMXJDVDPD

.id

P*)% P+*&
P)%* P*&+

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

P%*) P&+*

'DUL GDQ GLGDSDWNDQEDKZD


P%*)P+*& 

3HUKDWLNDQ%*)+*&GDQ)*+

.HWLJDVXGXWWHUVHEXWVDOLQJEHUSHOXUXVVHKLQJJD
P%*)P+*&P)*+ 
.DUHQDP%*)P+*& 

$NLEDWQ\DP)*+ 'HQJDQNDWDODLQ)*+DGDODKVXGXWVLNXVLNX

'HQJDQFDUD\DQJVDPDNLWDELVDPHPEXNWLNDQEDKZDNHHPSDWVXGXWSDGDVHJLHPSDW()*+DGDODK
VLNXVLNX

://

'LVNXVLNDQ
%XNWLNDQEDKZDNHWLJDVXGXW\DQJODLQSDGDVHJLHPSDW()*+DGDODKVLNXVLNX

ht

tp

6HODQMXWQ\DNLWDDNDQPHQFDULWDKXEHUDSDNDKOXDVSHUVHJL()*+

0$7(0$7,.$



Sebelum membuktikan teorema Pythagoras, ajak siswa untuk memahami pembuktian bahwa segiempat EFGH adalah suatu persegi. Pada pembuktian yang disajikan di
buku siswa halaman 141 hanya satu sudut saja. Minta siswa untuk membuktikan ketiga
sudut yang lain adalah siku-siku juga.

162

Buku Guru Kelas VIII SMP/MTs

Semester 1

/)%*/()*+ 

'

$NLEDWQ\D
/$%&'




  /()*+

/()*+ 


/()*+



/()*+



.DUHQD/$() /)%* /*&+ /+'(







&



.DUHQD OXDV SHUVHJL ()*+  


VDWXDQ OXDV DNLEDWQ\D SDQMDQJ VLVL
()  *+  +(  ()   VDWXDQ
SDQMDQJ

3HUKDWLNDQJDPEDUEHULNXW
F

E
D

F
D
E

/XDVVHJLWLJDVLNXVLNX/XDVSHUVHJLNHFLO /XDVSHUVHJLEHVDU


 DE F


DEF

F

 DE 

DDEE 

NHGXDUXDVGLNXUDQJLDE

DE

'DUL DQDOLVLVGL DWDV Q\DWDNDQKXEXQJDQ SDQMDQJVLVLVLVL VHJLWLJDVLNXVLNX\DQJSDQMDQJVLVLQ\D


D E GDQ F GHQJDQ NDOLPDW NDOLDQ VHQGLUL +XEXQJDQ SDQMDQJ VLVLVLVL VHJLWLJD VLNXVLNX WHUVHEXW
GLQDPDNDQ7HRUHPD3\WKDJRUDV

"

$\R.LWD
0HQDQ\D

6HWHODK PHQJHWDKXL KXEXQJDQ VLVLVLVL VHJLWLJD VLNX EXDWODK SHUWDQ\DDQ \DQJ EHUNDLWDQ GHQJDQ
VHJLWLJDVLNXVLNX
0LVDO

$GDNDKVHJLWLJDVLNXVLNX\DQJNHWLJDSDQMDQJVLVLQ\DDGDODKELODQJDQEXODW VHODLQSDQMDQJVLVL
GDQ "

tp

://

.HODV9,,,60307V

ht



Ayo Kita
Menanya

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

'HQJDQ FDUD \DQJ VDPD GHQJDQ NHJLDWDQ GL DWDV NLWD GDSDW PHQHQWXNDQ KXEXQJDQ GDUL VLVLVLVL
VHJLWLJDVLNXVLNX\DQJSDQMDQJVLVLQ\DDEGDQF

Ajak siswa untuk


memahami pembuktian
teorema pythagoras.
Minta siswa untuk membuat pernyataan tentang
teorema pythagoras.
Pernyataan yang diharapkan muncul:
Pada segitiga siku-siku,
jumlah kuadrat sisi sikusikunya sama dengan
kuadrat sisi miring
(apotema).

.id

/$()/)%*/*&+/+'(/()*+ /$%&'

6HPHVWHU

1. Minta siswa untuk


mengajukan
pertanyaan seputar
kegiatan yang
sudah dilakukan.
Sedikitnya
pertanyaan tersebut
terkait dengan
segitiiga atau sisi
segitiga.
2. Jika tidak ada siswa
yang mau bertanya,
berikan pertanyaan
pancingan pada
siswa misalnya,
segitiga apakah yang
terbentuk?mengapa
kalian yakin bahwa
segitiga yang
terbentuk adalah
siku-siku?
3. Tunjuk satu atau
dua kelompok
untuk menjawab
dan memberikan
jawaban.
4. Tunjuk kelompok
lain untuk
memberikan
komentar.

MATEMATIKA

163

$\R.LWD
0HQJJDOL,QIRUPDVL

6HJLWLJD VLNXVLNX \DQJ NHWLJD VLVLQ\D DGDODK ELODQJDQ EXODW GLVHEXW 7ULSOH 3\WKDJRUDV 8QWXN
PHQJHQDOOHELKMDXKWHQWDQJ7ULSOH3\WKDJRUDVPDULPHODNXNDQNHJLDWDQEHULNXW
/DQJNDKODQJNDK.HJLDWDQ
 $PELOODK  HQDP EHODV PRGHO SHUVHJL GHQJDQ EHUEDJDL
XNXUDQQQGLDQWDUDQ\D

GDQ\DQJGLVHGLDNDQROHKJXUX
 'DULHQDPEHODVPRGHOSHUVHJLWHUVHEXWSLOLKWLJDSHUVHJL
NHPXGLDQVXVXQVHKLQJJDWHUEHQWXNVXDWXVHJLWLJDVHSHUWL
JDPEDU
 8NXUODKEHVDUVXGXWWHUEHVDUSDGDVHJLWLJD\DQJWHUEHQWXN
GHQJDQPHQJJXQDNDQEXVXUGHUDMDW
 7HQWXNDQ VHJLWLJD DSD \DQJ WHUEHQWXN GDQ FDWDWODK
SDQMDQJVLVLVHJLWLJDVHJLWLJDWHUVHEXW
*DPEDU6HJLWLJDVLNXVLNX
GHQJDQSDQMDQJVLVLVDWXDQ

.id

 /DNXNDQ ODQJNDK QRPRU  GDQ  VHFDUD EHUXODQJ


VHKLQJJD NDOLDQ GDSDW PHQHPXNDQ GHODSDQ VHJLWLJD
GHQJDQEHUEDJDLXNXUDQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

'DUL NHHQDP VHJLWLJD \DQJ GLKDVLONDQ SDGD NHJLDWDQ PHQJDPDWL PXQJNLQ EHEHUDSD GL DQWDUDQ\D
DGDODK VHJLWLJD VLNXVLNX 8QWXN VHODQMXWQ\D NLWD DNDQ PHPEDKDV VHJLWLJDVHJLWLJD \DQJ VLNX
VLNX VHEDJDL V\DUDW EHUODNXQ\D WHRUHPD 3\WKDJRUDV &DWDWODK EHUDSD VDMD VLVLVLVL VHJLWLJD \DQJ
PHQJKDVLONDQVHJLWLJDVLNXVLNX-LNDNDOLDQPDVLKEHOXPPHQHPXNDQSDVDQJDQVLVLVHJLWLJD\DQJ
PHQJKDVLONDQVHJLWLJDVLNXVLNXVLONDQNDOLDQFREDNHPEDOLXQWXNPHQHPXNDQSDVDQJDQWHUVHEXW
$\R.LWD
%HUQDODU

%HULNXWGLEHULNDQSDQMDQJVLVLVLVLVHJLWLJDVLNXVLNX
/HQJNDSLWDEHOEHULNXW

7DEHO+XEXQJDQVLVLVLVLVHJLWLJDVLNXVLNX

1R

D



























 
   






E

F

DE DF EF











DE F

DF E

EF D

<D
7LGDN

7LGDN
<D

7LGDN
7LGDN

Menggali
Informasi

tp

=+

://

0$7(0$7,.$

ht

1. Minta siswa untuk mengamati dan mengidentifikasi 16 persegi, berdasarkan


ukuran dan luasnya.
2. Minta siswa untuk mengamati contoh pada Gambar 5.2 (luas persegi yang
membentuk segitiga siku-siku).
3. Siswa menyusun persegi-persegi tersebut menjadi bentuk segitiga siku-siku
(pastikan ada 8 segitiga yang ditemukan).
4. Pantau kinerja setiap kelompok. Jika terdapat kelompok yang menemukan
segitiga yang bukan siku-siku, guru meminta mereka mengecek ulang ukuran
sudut pada segitiga tersebut.Sehingga pada akhirnya setiap kelompok bisa
menemukan 8 segitiga siku-siku.
5. Minta siswa untuk mengidentifikasi panjang sisi segitiga siku-siku yang mereka
temukan dan luas setiap persegi yang membentuk segitiga tersebut.
164

Buku Guru Kelas VIII SMP/MTs

Semester 1



Ayo Kita
Menalar
1. Minta siswa untuk mengisi Tabel 5.1 sesuai dengan contoh yang sudah diberikan
2. Minta siswa berdiskusi dengan anggota kelompoknya untuk memastikan jawaban
mereka benar.
3. Minta siswa untuk menjawab pertanyaan pada kegitan bernalar
4. Beri kesempatan pada siswa untuk mendiskusikan jawaban mereka dengan anggota
kelompoknya
Berikut alternatif penyelesaiain Ayo Kita Bernalar pada buku siswa halalam 143
No.

a2

b2

c2

a2+b2

a2+c2

1.

16

25

25

34

41

Ya

Tidak

2.

12 13

144 169 25

313

169

194

Tidak

Ya

3.

25 24

625 576

49

1201

674

625

Tidak

Tidak

Ya

4.

10

36

64

100

100

136

164

Ya

Tidak

Tidak

5.

17 8 15 289

64

225

353

514

289

Tidak

Tidak

Ya

6.

9 12 15

81 144 225

225

306

369

Ya

Tidak

Tidak

7.

12 16 20 144 256 400

400

544

656

Ya

Tidak

Tidak

8.

15 20 25 225 400 625

625

850

1025

Ya

Tidak

Tidak

.id

Tidak

Tidak

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

b2+c2 a2+b2=c2 a2+c2=b2 b2+c2=a2

1. Nomor 1, 4, 6, 7 dan 8 bersesuaian dengan gambar A

Nomor 2 bersesuaian dengan gambar B

Nomor 3 dan 5 bersesuaian dengan gambar C


atau

://

2.

ht

tp

3. Kelipatan suatu Tripel Pythagoras adalah Tripel Pythagoras juga. Artinya jika
suatu Tripel Pythagoras, maka
untuk suatu
bilangan asli,
adalah Tripel Pythagoras juga.
4. Jika dan adalah panjang sisi suatu segitiga, dan adalah sisi terpanjang maka:
a. Hubungan yang terjadi pada segitiga tumpul adalah
b. Hubungan yang terjadi pada segitiga lancip adalah

karena
karena

MATEMATIKA

165

6HWHODKPHOHQJNDSLWDEHOMDZDESHUWDQ\DDQEHULNXW
 %HULNXWDGDWLJDJDPEDUVHJLWLJDVLNXVLNX

D
$

F
%

3DVDQJNDQVHWLDSQRPRUSDGDWDEHOGHQJDQVDWXJDPEDUVHJLWLJDVLNXVLNX\DQJEHUVHVXDLDQ

&

 -LNDGLNHWDKXLVXDWXVHJLWLJDVLNXVLNXGHQJDQVLVLPLULQJ KLSRWHQXVD FGDQVLVLODLQQ\DDGDQ


E7HQWXNDQKXEXQJDQNHWLJDVLVLWHUVHEXW
 7LJD ELODQJDQ DVOL \DQJ PHPHQXKL WHRUHPD 3\WKDJRUDV GLVHEXW 7ULSHO 3\WKDJRUDV 7ULSHO
3\WKDJRUDVELDVDQ\DGLWXOLVNDQGDODPEHQWXNDEF6HEDJDLFRQWRKDGDODKWULSHO
3\WKDJRUDVNDUHQD 3HUKDWLNDQQRPRUGDQSDGDWDEHO

$SDNDKKXEXQJDQDQWDUELODQJDQELODQJDQSDGDQRPRUWHUVHEXW" SHUKDWLNDQSHUEDQGLQJDQQ\D

DEF
DEF
DEF
DE!F

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

D
E
F
G

.id

 0LVDO F DGDODK VLVL WHUSDQMDQJ SDGD VHJLWLJD EXNDQ VLNXVLNX VHJLWLJD WXPSXO DWDX VHJLWLJD
ODQFLS VHGDQJNDQVLVL\DQJODLQDGDODK DGDQ E'LDQWDUDNHHPSDWSLOLKDQEHULNXW0DQDNDK
\DQJPHQXQMXNNDQKXEXQJDQVHJLWLJDWXPSXOGDQPDQD\DQJVHJLWLJDODQFLS"-HODVNDQ

$\R.LWD
%HUEDJL

'XGXNODK VHFDUD EHUNHORPSRN NHPXGLDQ GLVNXVLNDQ KDVLO \DQJ NDOLDQ GDSDWNDQ SDGD NHJLDWDQ
EHUQDODU
6HGLNLW
,QIRUPDVL

%HQWXN$NDU

-LNDNDOLDQPHQJJXQDNDQWHRUHPD3\WKDJRUDVXQWXNPHQFDULSDQMDQJGLDJRQDOSHUVHJLSDGDNHUWDV
EHUJULG VHSHUWL GL EDZDK LQL NDOLDQ DNDQ PHQGDSDWNDQ EHQWXN  6HFDUD JHRPHWULNLWD GDSDW
PHQXQMXNNDQ EHQWXN DNDU VHEDJDL SDQMDQJ VLVL PLULQJ VHJLWLJD VLNXVLNX \DQJ SDQMDQJ NHGXD VLVL
VLNXVLNXQ\DDGDODK

.HODV9,,,60307V

6HPHVWHU

://



ht

tp

Ayo Kita
Berbagi

1. Minta perwakilan
setiap kelompok untuk
mempresentasikan
hasil diskusinya dalam
menjawab pertanyaan
pada kegiatan bernalar
2. Minta kelompok lain
untuk memberikan
tanggapan.
166

Buku Guru Kelas VIII SMP/MTs

Semester 1

[    




[

0DULNLWDOLKDWNDVXV\DQJODLQ'HQJDQPHQJJXQDNDQWHRUHPD3\WKDJRUDVSDGDJDPEDUGLEDZDK
NDOLDQDNDQPHQHPXNDQEDKZDSDQMDQJVLVLPLULQJVHJLWLJDVLNXVLNXGLEDZDKLQLDGDODK

[ 
[ 
[  

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3HUKDWLNDQEDKZDDGDODKSDQMDQJVLVLPLULQJVHJLWLJDVLNXVLNX\DQJSDQMDQJNHGXDVLVLVLNX
VLNXQ\DDGDODK

.id

.DOLDQ GDSDW PHQJJXQDNDQ LGH WHQWDQJ DNDU VHEDJDL SDQMDQJ VLVL VHJLWLJD VLNXVLNX LQL XQWXN
PHQ\HGHUKDQDNDQ VXDWX EHQWXN DNDU 3HUKDWLNDQ GXD NDVXV GL DWDV %DJDLPDQDNDK MLND NLWD
EDQGLQJNDQSDQMDQJUXDVJDULVGHQJDQ"3HUKDWLNDQEDKZDUXDVJDULV\DQJSDQMDQJQ\D
GDSDWGLEDQJXQROHKOLPDUXDVJDULV\DQJSDQMDQJQ\D6HKLQJJDNLWDELVDPHQXOLVNDQ 
%HQWXNDGDODKEHQWXNDNDU\DQJOHELKVHGHUKDQDNDUHQDPHQJJXQDNDQUHSUHVHQWDVLJHRPHWUL
\DQJOHELKVHGHUKDQD\DLWX\DQJPHUXSDNDQSDQMDQJGLDJRQDOSHUVHJLVDWXVDWXDQ
.DOLDQMXJDELVDPHQ\HGHUKDQDNDQEHQWXNDNDUVHFDUDDOMDEDUGHQJDQPHQHQWXNDQDNDUGDULIDNWRU
\DQJPHUXSDNDQNXDGUDWVHPSXUQDSDGDVXDWXEHQWXNDNDU

&RQWRK 
6HGHUKDQDNDQ

&DUD\DQJELVDGLJXQDNDQXQWXNPHQ\HGHUKDQDNDQDGDODKPHQFDULDNDUIDNWRU\DQJEHUXSDELODQJDQ
NXDGUDWVHPSXUQD
     

Sedikit
Informasi

ht

tp

://

0$7(0$7,.$



1. Minta siswa membaca


sedikit informasi
2. Minta siswa
mengajukan
pertanyaan jika ada hal
yang tidak dimengerti
terkait informasi yang
diberikan
3. Bantu siswa untuk
memahami informasi
dengan menjawab
pertanyaan yang
diajukan siswa serta
berilah keterangan
tambahan.

MATEMATIKA

167

"

/DWLKDQ 

 7HQWXNDQQLODLDEGDQFSDGDJDPEDUGLEDZDK




 7HQWXNDQSDQMDQJNHWLJDVLVLVHJLWLJDVLNXVLNX\DQJEHUXSDELODQJDQEXODWEHUXUXWDQ
 $SDNDK VXDWX VHJLWLJD \DQJ SDQMDQJ NHWLJD VLVLQ\D EHUWXUXWWXUXW  FP  FP GDQ  FP
DGDODKVHJLWLJDVLNXVLNX"-HODVNDQ
 7HQWXNDQSDQMDQJNHWLJDVLVLVHJLWLJDVLNXVLNX\DQJEHUXSDELODQJDQJHQDSEHUXUXWDQ
 7HQWXNDQMDUDNGXDJDULVVHMDMDUSDGDEDQJXQVHJLGHODSDQEHUDWXUDQ

.id

 'LNHWDKXL OXDV VXDWX VHJLWLJD VLNXVLNX DGDODK  FP 7HQWXNDQ SDQMDQJ VLVLVLVL VHJLWLJD
WHUVHEXW
 -LNDSDQMDQJVLVLVLVLVXDWXVHJLWLJDVLNXVLNXEHUWXUXWWXUXWDGDODK[GDQ[7HQWXNDQQLODL[
'LNHWDKXL VXDWX WUDSHVLXP VDPD NDNL $%&' $% VHMDMDU '& %&  $' $%  D &'  F
GDQ()DGDODKJDULVVLPHWUL\DQJWHJDNOXUXV$%GDQ&'-LNDSDQMDQJJDULV()DGDODKK
WHQWXNDQNDQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o



D /HWDNVXDWXWLWLN;\DQJEHUDGDSDGDJDULVVLPHWULWHUVHEXWVHGHPLNLDQVHKLQJJD%;& 
$;' 
E -DUDNVHWLDSWLWLN;GDUL$%GDQGDUL&'

 6HRUDQJPDWHPDWLNDZDQ+LQGX\DQJEHUQDPD%KDVNDUDPHQ\XVXQVHEXDKSHUVHJLGDQHPSDW
EXDK VHJLWLJD VLNXVLNX \DQJ PHPLOLNL SDQMDQJ VLVL \DQJ VDPD \DLWX D E GDQ F  NHGDODP
VHEXDKSHUVHJL\DQJPHPSXQ\DLSDQMDQJVLVLF
F
E

?!

D
D
D

D 7XQMXNNDQEDJDLPDQDNHOLPDSRWRQJEDQJXQGDWDU\DQJGLVXVXQWHUVHEXWGDSDWGLVXVXQXQWXN
PHQJLVLGXDSHUVHJL\DQJEHUDGDGLVHEHODKNDQDQ
E -HODVNDQEDJDLPDQDWHRUHPD3\WKDJRUDVWHUPXDWGDODPSHUWDQ\DDQD

Latihan



.HODV9,,,60307V

6HPHVWHU

ht

tp

://

1. Jika Kegiatan 5.1


sudah dibelajarkan,
maka satu cara
untuk mengetahui
pemahaman siswa
adalah dengan
meminta siswa
mengerjakan
Latihan 5.1
2. Lakukan pembahasan
pada beberapa soal
sedangkan untuk soal
yang lain bisa bisa
digunakan sebagai
pekerjaan rumah.
168

Buku Guru Kelas VIII SMP/MTs

Semester 1

 7DEHO EHULNXW PHQXQMXNNDQ SDQMDQJ VLVLVLVL EHEHUDSD VHJLWLJD VLNXVLNX-LND GLNHWDKXL
SDQMDQJGXDGDULWLJDVLVLVHJLWLJDVLNXVLNXNDOLDQGDSDWVHFDUDODQJVXQJPHQFDULSDQMDQJVLVL
\DQJ NHWLJD GHQJDQ PHQJJXQDNDQ WHRUHPD 3\WKDJRUDV6HNDUDQJKDQ\D GLEHULNDQ SDQMDQJ
VLVLWHUSHQGHN7HQWXNDQSDQMDQJGXDVLVL\DQJODLQEHUGDVDUNDQFRQWRK\DQJGLVHGLDNDQ











3DQMDQJVLVLVLNXVLNX
WHUSHQGHN

3DQMDQJVLVLVLNXVLNX



3DQMDQJVLVLPLULQJ















"

"

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

D 7HQWXNDQQLODL\DQJEHOXPGLNHWDKXLSDGD7DEHOWHUVHEXWGDQEXNWLNDQEDKZDWHRUHPD
S\WKDJRUDVGLSHQXKL

.id

E /DQMXWNDQWDEHOWHUVHEXWXQWXNGXDEDULVODJLGDQEXNWLNDQEDKZDWHRUHPDS\WKDJRUDV
GLSHQXKL
 7HQWXNDQSDQMDQJVLVLPLULQJVHJLWLJDVLNXVLNX\DQJNH




FP

3HUKDWLNDQJDPEDUGXDSHUVHJLEHULNXW

3DQMDQJ VLVL SHUVHJL EHVDU DGDODK  FP /XDV


SHUVHJLNHFLODGDODKFP7HQWXNDQQLODL[

FP

ht

tp

://

0$7(0$7,.$



1. Ajak siswa untuk


melakukan refleksi
terhadap kegiatan
pembelajaran yang sudah
dilalui.
2. Periksalah apakah
semua kelompok sudah
mencatat hal-hal yang
penting pada kegiatan
kali ini.
3. Jika dipandang perlu,
minta siswa mengerjakan
soal latihan di rumah
MATEMATIKA

169

Membelajarkan 5.2
Menemukan Hubungan
Antar Panjang Sisi pada Segitiga Khusus

1.Ajak siswa untuk mengingat kembali persamaan pada rumus Pythagoras

a 2 + b2 =
c2

'XD6HJLWLJD.KXVXV

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Ayo
Kita Amati

.id

2.Rencanakan pembentukan kelompok yang terdiri dari 4 siswa untuk berdiskusi


secara efektif

0HQHPXNDQ+XEXQJDQ$QWDU
3DQMDQJ6LVL3DGD6HJLWLJD.KXVXV

.HJLDWDQ 

0DVDODK 

'LNHWDKXLVXDWXVHJLWLJDGHQJDQEHVDUGXDVXGXWQ\DDGDODKGDQ-LNDVDODKVDWXVLVLSHQJDSLW
VXGXWVLNXVLNXQ\DDGDODKFP7HQWXNDQSDQMDQJNHGXDVLVL\DQJODLQ
$OWHUQDWLI3HPHFDKDQ0DVDODK

8QWXNPHQ\HOHVDLDNDQSHUPDVDODKDQLQLNDOLDQVHEDLNQ\DPHPDKDPLWHUOHELKGDKXOXVHJLWLJDDSDNDK
\DQJWHUEHQWXNWHUVHEXW
$\R
.LWD$PDWL

/DQJNDKODQJNDK
 %XDWODKVHJLWLJDVLNXVLNXVDPDNDNL\DQJSDQMDQJVLVLVLNXVLNXQ\DEHUWXUXWWXUXWFP
FPFPFP

ht

tp

://

1. Bagi siswa menjadi


beberapa kelompok
yang terdiri dari
2 siswa setiap
kelompok.
2. Minta siswa
berdiskusi untuk
mengerjakan
langkah-langkah
pada kegiatan Ayo
Kita Amati
3. Bantu siswa jika
mengalami kesulitan
dalam mengerjakan
langkah-langkah
kegiatan.
4. Minta beberapa
siswa untuk
mempresentasikan
hasil kegiatan
mengamati sekaligus
beberapa siswa
yang lain untuk
memberikan
komentar
5. Pastikan seluruh
siswa dapat
melakukan langkahlangkah kegiatan
dengan benar.

7HRUHPD3\WKDJRUDVGDSDWGLJXQDNDQXQWXNPHODNXNDQSHQ\HOLGLNDQWHUKDGDSVLIDWPHQDULN
GDULVHJLWLJDVLNXVLNXVDPDNDNLGDQVHJLWLJDVLNXVLNX\DQJEHVDUVXGXWQ\D
'DODPNHJLDWDQLQLNLWDDNDQPHQHPXNDQKXEXQJDQDQWDUSDQMDQJVLVLSDGDVHJLWLJDVLNX
VLNXVDPDNDNLGDQVHJLWLJDVLNXVLNX

170






 %HUDSDNDKXNXUDQVXGXWSDGDPDVLQJPDVLQJVHJLWLJDWHUVHEXW"
 'HQJDQPHQJJXQDNDQWHRUHPD3\WKDJRUDV\DQJWHODKNDOLDQGDSDWNDQSDGDNHJLDWDQWHQWXNDQ
SDQMDQJVLVLPLULQJVHPXDVHJLWLJDVLNXVLNXWHUVHEXW6HGHUKDQDNDQVHWLDSEHQWXNDNDUNXDGUDW
Q\D
 6DOLQNHPXGLDQOHQJNDSLWDEHOEHULNXW



.HODV9,,,60307V

Buku Guru Kelas VIII SMP/MTs

6HPHVWHU

Semester 1

Tabel kegiatan Ayo Kita Amati


Panjang sisi sikusiku
Panjang sisi
miring

10

Ayo Kita
Menalar



.id

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3DQMDQJVLVL
VLNXVLNX
3DQMDQJVLVL
PLULQJ

1. Minta siswa berdiskusi


dengan kelompoknya
untuk menjawab
pertanyaan atau
masalah pada kegiatan
Ayo kita Bernalar.
2. Pantau kegiatan diskusi
siswa
3. Tunjuk beberapa
kelompok untuk
mempresentasikan hasil
diskusinya
4. Tunjuk beberapa siswa
utnuk memberikan
komentar.
5. Beri komentar pada
jawaban siswa di akhir
kegiatan bernalar untuk
memperbaiki jawaban
siswa yang kurang
tepat.

$\R.LWD
%HUQDODU

 $SDNDK NDOLDQ PHOLKDW SROD GLDQWDUD SDQMDQJ VLVL VLNXVLNX GDQ SDQMDQJ VLVL PLULQJ" -LND \D
EDJDLPDQDNDKSRODQ\D"
 $SDNDKSRODWHUVHEXWMXJDWHUMDGLSDGDVHPEDUDQJVHJLWLJDVDPDNDNL"
 'LNHWDKXLKLSRWHQXVDVHJLWLJDVLNXVLNXVDPDNDNLDGDODKFP7HQWXNDQSDQMDQJVLVL\DQJODLQ
 7HQWXNDQSHQ\HOHVDLDQGDUL0DVDODK
$\R.LWD
%HUEDJL

6DMLNDQVROXVLGDULSHUPDVDODKDQWHUVHEXWVHPHQDULNPXQJNLQ
6DPSDLNDQGLGHSDQNHODV%DQGLQJNDQGHQJDQMDZDEDQWHPDQNDOLDQ\DQJODLQ
0DVDODK 

://

'LNHWDKXLVXDWXVHJLWLJDPHPLOLNLSDQMDQJKLSRWHQXVDQ\DDGDODKFP-LNDGXDVXGXWQ\DEHUWXUXW
WXUXWDGDODKGDQWHQWXNDQSDQMDQJNHGXDVLVL\DQJODLQ

$OWHUQDWLI3HPHFDKDQ0DVDODK

ht

tp

-XPODKVHPXDVXGXWSDGDVHJLWLJDDGDODK-LNDGXDVXGXWGLNHWDKXLDGDODKGDQPDND
VXGXW \DQJ NHWLJD SDVWL  3DGD VHJLWLJD LQL PHPLOLNL KXEXQJDQ NKXVXV DQWDU VLVLQ\D 'HQJDQ
PHQJHWDKXLVDWXVLVLVDMDNLWDELVDPHQHQWXNDQNHGXDVLVL\DQJODLQ0DULPHQFDULKXEXQJDQDQWDU
VLVLVLVLVHJLWLJDWHUVHEXW
$\R.LWD
0HQJJDOL,QIRUPDVL

&
6HJLWLJDVLNXVLNX
6HJLWLJD$%&DGDODKVHJLWLJDVDPDVLVL*DULV&'DGDODKJDULV
VLPHWULVHJLWLJD$%&

'

0$7(0$7,.$



MATEMATIKA

171

Alternatif Penyelesaian Ayo Kita Bernalar


1. Ya ada pola. Jika panjang kedua sisinya satuan, maka panjang sisi miringnya adalah
satuan.
2. Tidak,tapi pola ini hanya terjadi pada segitiga siku-aiku yang sama kaki. Karena pada
segitiga sama kaki yang tidak siku-siku tidak berlaku teorema Pythagoras.
3. Diketahui : Segitiga siku-siku sama kaki
Panjang sisi miringnya 20 cm
Ditanyakan: Panjang sisi siku-siku?



D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3DQMDQJVLVL
VLNXVLNX
3DQMDQJVLVL
PLULQJ

.id

Jawab:
Misal panjang sisi siku-sikunya cm, maka berdasarkan pola yang berlaku
cm.
pada segitiga siku-siku samakaki panjang sisi miringnya adalah

$\R.LWD
%HUQDODU

4.

 $SDNDK NDOLDQ PHOLKDW SROD GLDQWDUD SDQMDQJ VLVL VLNXVLNX GDQ SDQMDQJ VLVL PLULQJ" -LND \D
EDJDLPDQDNDKSRODQ\D"
 $SDNDKSRODWHUVHEXWMXJDWHUMDGLSDGDVHPEDUDQJVHJLWLJDVDPDNDNL"
 'LNHWDKXLKLSRWHQXVDVHJLWLJDVLNXVLNXVDPDNDNLDGDODKFP7HQWXNDQSDQMDQJVLVL\DQJODLQ
 7HQWXNDQSHQ\HOHVDLDQGDUL0DVDODK
$\R.LWD
%HUEDJL

6DMLNDQVROXVLGDULSHUPDVDODKDQWHUVHEXWVHPHQDULNPXQJNLQ
6DPSDLNDQGLGHSDQNHODV%DQGLQJNDQGHQJDQMDZDEDQWHPDQNDOLDQ\DQJODLQ
0DVDODK 

Menggali
Informasi

://

tp

ht

172

$OWHUQDWLI3HPHFDKDQ0DVDODK

-XPODKVHPXDVXGXWSDGDVHJLWLJDDGDODK-LNDGXDVXGXWGLNHWDKXLDGDODKGDQPDND
VXGXW \DQJ NHWLJD SDVWL  3DGD VHJLWLJD LQL PHPLOLNL KXEXQJDQ NKXVXV DQWDU VLVLQ\D 'HQJDQ
PHQJHWDKXLVDWXVLVLVDMDNLWDELVDPHQHQWXNDQNHGXDVLVL\DQJODLQ0DULPHQFDULKXEXQJDQDQWDU
VLVLVLVLVHJLWLJDWHUVHEXW

1. Mintalah siswa
membaca dan
memahami Masalah 6.4
2. Mintalah siswa
mengamati gambar
kemudian menjawab
pertanyaan pada
kegiatan menggali
informasi secara
individu.
3. Tunjuk beberapa siswa
untuk mempresentasikan
jawabannya dan benahi
jika ada jawaban yang
kurang tepat

'LNHWDKXLVXDWXVHJLWLJDPHPLOLNLSDQMDQJKLSRWHQXVDQ\DDGDODKFP-LNDGXDVXGXWQ\DEHUWXUXW
WXUXWDGDODKGDQWHQWXNDQSDQMDQJNHGXDVLVL\DQJODLQ

$\R.LWD
0HQJJDOL,QIRUPDVL
&

6HJLWLJDVLNXVLNX
6HJLWLJD$%&DGDODKVHJLWLJDVDPDVLVL*DULV&'DGDODKJDULV
VLPHWULVHJLWLJD$%&

Buku Guru Kelas VIII SMP/MTs

=+

'

0$7(0$7,.$

Semester 1



Alternatif Penyelesaian Menggali Informasi

.id

1.
2. Panjang ruas garis AD dan BD sama
3. Segitiga CAD dan CBD kongruen (panjang sisi dan besar sudut yang
seletak sma)
4. Diketahui : Segitiga CBD panjang BC= 20 cm
Ditanyakan : a) panjang BD dan
b) panjang CD
Jawab:
Perhatikan segitiga CBD
Karena panjang BC=AB dan
panjang BD=1/2 panjang AB , maka panjang BD=10 cm.
Dengan menggunakan teorema Pythagoras dapat ditentukan panjang CD, yaitu:

6HJLWLJD$%&DGDODKVHJLWLJDVDPDVLVL*DULV&'DGDODKJDULVVLPHWULVHJLWLJD$%&

D $&'

E $'&

F %&'

G %'&

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 %HUDSDNDKEHVDUVXGXWGLEDZDKLQL"-HODVNDQ

cm

 $SD\DQJGDSDWNDPXNHWDKXLWHQWDQJUXDVJDULV$'GDQ%'"

 $SD\DQJGDSDWNDPXNHWDKXLWHQWDQJVHJLWLJD&$'GDQ&%'"

 3HUKDWLNDQVHJLWLJD&%'-LNDGLNHWDKXLSDQMDQJBC = 20 cmWHQWXNDQ


D 3DQMDQJ%'
E 3DQMDQJ&'
$\R.LWD
0HQDODU

%HULNXW DGDODK WDEHO \DQJ EHULVL WHQWDQJ SDQMDQJ VLVLVLVL SDGD VHJLWLJD VLNXVLNX     
*XQDNDQWHRUHPD3\WKDJRUDVXQWXNPHOHQJNDSLWDEHOEHULNXW

3DQMDQJVLVL
VLNXVLNXWHUSHQGHN

3DQMDQJVLVLPLULQJ

://

3DQMDQJVLVL
VLNXVLNX\DQJODLQ



ht

tp

6HWHODKPHOHQJNDSLWDEHOGLDWDVMDZDESHUWDQ\DDQEHULNXW
 $SDNDKNDOLDQPHOLKDWSRODSDGDSDQMDQJVLVLVLVLVHJLWLJDVLNXVLNX"-LND\D
EDJDLPDQDNDKSRODQ\D"
 -LNDSDQMDQJVLVLWHUSHQGHNVHJLWLJDVLNXVLNXDGDODKDVDWXDQEHUDSDNDKSDQMDQJ
VLVLPLULQJGDQVLVLVLNXVLNX\DQJODLQ"
 $SDNDKSRODWHUVHEXWMXJDELVDEHUODNXXQWXNVHJLWLJDVLNXVLNX\DQJODLQ"-HODVNDQ
$\R.LWD
%HUEDJL
6DMLNDQVROXVLGDULSHUPDVDODKDQWHUVHEXWVHPHQDULNPXQJNLQ
6DPSDLNDQGLGHSDQNHODV%DQGLQJNDQGHQJDQMDZDEDQWHPDQNDOLDQ\DQJODLQ



.HODV9,,,60307V

6HPHVWHU

Ayo Kita
Menalar

1. Mintalah siswa
mengamati kembali
gambar pada kegiatan
menggali informasi
Masalah 5.3
2. Mintalah siswa mengisi
tabel kemudian
menjawab pertanyaan
secara berkelompok
3. Tunjuk beberapa
kelompok untuk
mempresentasikan hasil
diskusinya
4. Tunjuk beberapa
kelompok untuk
menanggapi
5. Beriakan penjelasan
jika ada jawaban yang
kurang tepat
MATEMATIKA

173

Tabel kegiatan Ayo Kita Menalar


Panjang sisi siku-siku terpendek
Panjang sisi miring
Panjang sisi siku-siku yang lain

1
2

2
4

3
6

4
8

5
10

6
12

7
14

8
16

9
18

10
20

Alternatif Penyelesaian Ayo Kita Menalar

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

1. Ya. Polanya adalah panjang sisi miring atau sisi terpanjang adalah dua kali
panjang sisi terpendek dan jika panjang sisi siku-siku terpendek adalah satuan
maka panjang sisi siku-siku yang lain adalah adalah satuan.
2. Jika panjang sisi siku-siku terpendek adalah satuan maka panjang sisi miringnya
adalah satuan dan panjang sisi siku-siku yang lain adalah adalah satuan
3. Tidak.Karena pada segitiga siku-siku yang lain panjang sisi miringnya bukan dua
kali panjang sisi siku-siku terpendeknya.

"

/DWLKDQ 

 7HQWXNDQQLODLDGDQESDGDJDPEDUGLEDZDK

?!



 7HQWXNDQOXDVVHJLWLJDEHULNXW

Latihan



 $SD\DQJVDODKGHQJDQJDPEDUGLEDZDKLQL"-HODVNDQ

://

1. Jika Kegiatan 5.2


sudah dibelajarkan,
maka satu cara
untuk mengetahui
pemahaman siswa
adalah dengan
meminta siswa
mengerjakan
Latihan 5.2

FP

tp

ht

FP


FP

 7HQWXNDQOXDVSHUVHJLSDQMDQJ./01EHULNXW

2. Lakukan pembahasan
pada beberapa soal
sedangkan untuk
soal yang lain bisa
digunakan sebagai
pekerjaan rumah
174

FP

FP

Buku Guru Kelas VIII SMP/MTs

0
F


.

0$7(0$7,.$

Semester 1



Membelajarkan 5.3
Menyelesaikan Permasalahan Nyata
dengan Teorema Pythagoras

.id

Ajak siswa untuk mengingat kembali persamaan pada rumus Pythagoras a 2 + b 2 =


c2
Rencanakan pembentukan kelompok yang terdiri dari 4 siswa untuk berdiskusi secara
efektif

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3HQHUDSDQ
7HRUHPD3\WKDJRUDV

0HQ\HOHVDLNDQ3HUPDVDODKDQ1\DWD
GHQJDQ7HRUHPD3\WKDJRUDV

.HJLDWDQ 

%HULNXWDGDODKFRQWRKPDVDODKQ\DWD\DQJELVDGLVHOHVDLNDQGHQJDQ7HRUHPD3\WKDJRUDV
0DVDODK 

3DN0LFKDHOPHQMXDOVHELGDQJWDQDKVHKDUJD5S7DQDKWHUVHEXWEHUEHQWXNWUDSHVLXP
VHSHUWLJDPEDUGLEDZDK
P

P

P

://

%HUDSDKDUJDWDQDKWHUVHEXWVHWLDSPHWHUSHUVHJLQ\D"

tp

$OWHUQDWLI3HPHFDKDQ0DVDODK
'LNHWDKXL

/XDVWDQDK

ht

+DUJDWDQDK5S

P

P



.HODV9,,,60307V

Ajak siswa untuk


memahami Masalah 5.4
serta alternatif pemecahannya.

P

6HPHVWHU

MATEMATIKA

175

*XQDNDQWHRUHPD3\WKDJRUDVXQWXNPHQGDSDWNDQW
W 
W 
W 
W    
-DGLWLQJJLWUDSHVLXPPHWHU
  
 P
/XDVELGDQJWDQDKDGDODK

.DUHQDLWXKDUJDWDQDKSHUPHWHUSHUVHJL





-DGLKDUJDWDQDKSHUPHWHUSHUVHJLDGDODK5S

.id

0DVDODK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

6HEXDKNDSDOQHOD\DQEHUWRODNGDULSHODEXKDQXQWXNPHQDQJNDSJHURPERODQLNDQWXQD\DQJELDVDQ\D
EHUNXPSXO GL VXDWX WLWLN GLOHSDV SDQWDL$JDU GDSDW PHQDQJNDS LNDQ OHELK EDQ\DN NDSDO QHOD\DQ
WLGDNODQJVXQJPHQXMXWHPSDWWHUVHEXWPHODLQNDQEHUOD\DUPHOHZDWLMDOXUEDUX\DNQLNPNHEDUDW
NHPXGLDQNPNHVHODWDQ%HUSDVHOLVLKMDUDN\DQJGLWHPSXKNDSDOGHQJDQPHQJJXQDNDQMDOXUEDUX
GHQJDQMDUDN\DQJGLWHPSXKMLNDPHOHZDWLMDOXUOXUXV"
$OWHUQDWLI3HPHFDKDQ0DVDODK

,OXVWUDVL*DPEDU

3HODEXKDQ

NP

%HUGDVDUNDQ LOXVWUDVL JDPEDU GDSDW GLSHUROHK


MDUDN \DQJ KDUXV GLWHPSXK NDSDO GHQJDQ
PHQJJXQDNDQMDOXUEDUXPHQXMXNHUXPXQDQLNDQ
\DLWX NP
'HQJDQPHQJJXQDNDQWHRUHPD3\WKDJRUDVGDSDW
GLNHWDKXLSDQMDQJMDOXUOXUXV\DQJELVDGLWHPSXK
XQWXNPHQXMXNHUXPXQDQLNDQ\DNQL

   

NP

  

  NP

ht

tp

://

-DGLVHOLVLKMDUDN\DQJGLWHPSXKNDSDOGHQJDQ
PHQJJXQDNDQMDOXUEDUXGHQJDQMDUDN\DQJ
GLWHPSXKMLNDPHOHZDWLMDOXUVHEHQDUQ\DDGDODK
 NP

NXPSXODQ
LNDQ

0$7(0$7,.$

Ajak siswa untuk memahami Masalah 5.5


serta alternatif pemecahannya.

176

Buku Guru Kelas VIII SMP/MTs

Semester 1



0DVDODK 
6XDWXKDUL:DFKLGGDQ'DQLPHUHQFDQDNDQDNDQSHUJLEHUOLEXUNHSDQWDL:DFKLGPHQMHPSXW'DQL
XQWXNEHUDQJNDWEHUVDPDVDPDNHSDQWDL5XPDK:DFKLGEHUDGDGLVHEHODKEDUDWUXPDK'DQLGDQ
SDQWDL\DQJDNDQPHUHNDNXQMXQJLWHUOHWDNWHSDWGLVHEHODKXWDUDUXPDK'DQL-DUDNUXPDK:DFKLG
GDQ'DQLDGDODKNPVHGDQJNDQMDUDNUXPDK'DQLNHSDQWDLDGDODKNP-LNDNHFHSDWDQUDWDUDWD
EHUVHSHGDPRWRU:DFKLGDGDODKNPMDPWHQWXNDQVHOLVLKZDNWX\DQJGLWHPSXK:DFKLGDQWDUD
PHQMHPSXW'DQLGHQJDQODQJVXQJEHUDQJNDWVHQGLULNHSDQWDL"

$OWHUQDWLI3HPHFDKDQ0DVDODK

.id

,OXVWUDVLJDPEDU

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3DQWDL

NP

5XPDK
:DFKLG

5XPDK
'DQL

NP

%HUGDVDUNDQJDPEDUGDSDWGLNHWDKXLWRWDOMDUDN\DQJGLWHPSXK:DFKLGPHQXMXNHSDQWDLDGDODK
 NP6HKLQJJDGHQJDQNHFHSDWDQUDWDUDWDNPMDPZDNWX\DQJGLEXWXKNDQXQWXN
VDPSDLNHSDQWDLDGDODKNPNPMDP MDPDWDXVHWDUDGHQJDQPHQLW

  



tp

  

://

1DPXQMLND:DFKLGWLGDNSHUOXPHQMHPSXW'DQLPDNDGHQJDQPHQJJXQDNDQWHRUHPD3\WKDJRUDV
GDSDWGLFDULMDUDNWHUSHQGHNGDULUXPDK:DFKLGNHSDQWDL\DLWX

NP

ht

'HQJDQNHFHSDWDQNPMDP:DFKLGKDQ\DPHPHUOXNDQZDNWX DWDXVHWDUDGHQJDQ
PHQLW
-DGL VHOLVLK ZDNWX DQWDUD:DFKLG PHQMHPSXW GHQJDQ WLGDN PHQMHPSXW 'DQL DGDODK     
PHQLW



.HODV9,,,60307V

6HPHVWHU

Ajak siswa untuk memahami Masalah 5.6 serta


alternatif pemecahannya.
MATEMATIKA

177

?!

"

Latihan

/DWLKDQ 

 7LQJJLVHEXDKMHQGHODODQWDLSDGDVHEXDKJHGXQJNLUDNLUD
PHWHU'LGHSDQJHGXQJWHUVHEXWDGDVHEXDKWDPDQGHQJDQOHEDU
 PHWHU %HUDSD SDQMDQJ WDQJJD PLQLPXP \DQJ GLEXWXKNDQ
DJDUNDNLNDNLWDQJJDWLGDNPHUXVDNWDPDQWHUVHEXW"

Soal latihan 5.3 bisa


digunakan sebagai
tugas individu dan
dibahas secara
klasikal

 6XDWX NHWLND WHUMDGL JHPSD EXPL \DQJ PHQJDNLEDWNDQ WLDQJ


OLVWULNSDWDK-LNDWLDQJWHUVHEXWSDWDKSDGDNHWLQJJLDQPHWHU
GDULWDQDKGDQEDJLDQWLDQJ\DQJSDWDKPHPEHQWXNVXGXW
GHQJDQSHUPXNDDQWDQDK%HUDSDWLQJJLPHQDUDVHEHQDUQ\D

7XJDV
3URMHN

Tugas
Projek

.id

'HQJDQPHPDQIDDWNDQSHPDKDPDQNDOLDQWHQWDQJWHRUHPD3\WKDJRUDVODNXNDQSHUKLWXQJDQ
WLQJJLVXDWXSRKRQJHGXQJDWDXVXDWX\DQJWLQJJLODLQQ\D

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

6DMLNDQSHQJXNXUDQGDQSHUKLWXQJDQVHPHQDULNPXQJNLQ2EMHNEROHKOHELKGDUL6HUWDNDQ
IRWRREMHNGDQNHJLDWDQNDOLDQGDODPPHODNXNDQSHQJDPDWDQ

Tugas ini bisa dikerjakan


secara berkelompok
maupun individu. Alat
yang bisa digunakan
untuk membantu siswa
melaksanakan tugas ini
adalah klinometer.

0HUDQJNXP

3HUWDQ\DDQEHULNXWDNDQPHPEDQWXNDPXXQWXNPHUDQJNXPDSD\DQJWHODKNDPXSHODMDUL
 1\DWDNDQWHRUHPD3\WKDJRUDV

 -LND GLNHWDKXL SDQMDQJ GXD VLVL VXWX VHJLWLJD VLNXVLNX EDJDLPDQD FDUD NDOLDQ PHQHQWXNDQ
SDQMDQJVLVL\DQJNHWLJD
 %DJDLPDQDNDKFDUDNDOLDQPHQHQWXNDQVXDWXVHJLWLJDDGDODKVHJLWLJDVLNXVLNXMLNDKDQ\D
GLNHWDKXLSDQMDQJNHWLJDVLVLQ\D"
 $SDNDKNHOLSDWDQVXDWXWULSHO3\WKDJRUDVDGDODK7ULSHO3\WKDJRUDVMXJD"

 %DJDLPDQDNDKKXEXQJDQSDGDVLVLVLVLVHJLWLJDVLNXVLNX\DQJVDODKVDWXVXGXWQ\D"
 %DJDLPDQDNDKKXEXQJDQSDGDVLVLVLVLVHJLWLJDVLNXVLNXVDPDNDNL"

 &DULODKSHUPDVDODKDQQ\DWD\DQJGDSDWGLVHOHVDLNDQGHQJDQWHRUHPD3\WKDJRUDVVHNDOLJXV
WHQWXNDQVHOHVDLDQQ\D

Merangkum

0$7(0$7,.$



ht

tp

://

1. Pada segitiga siku-siku yang panjang sisi-sisinya berturut-turut a,b dan c dengan c
adalah sisi miring,maka berlaku:
2. Jika sisi yang ketiga adalah sisi miring,maka panjang sisi miring tersebut adalah
akar dari jumlah kuadrat panjang kedua sisi segitiga siku-siku tersebut.Tapi jika sisi
yang ketiga adalah sisi siku-siku,maka panjang sisi yang ketiga adalah akar dari
selisih kuadrat kedua sisi yang diketahui.
3. Suatu Tripel yang merupakan kelipatan Tripel Pythagoras adalah Tripel Pythagoras
juga.
4. Jika panjang sisi miring suatu segitiga siku-siku yang salah satu sudutnya adalah
satuan,maka panjang sisi yang lain berturut-turut

dan

5. Jika panjang sisi siku-siku suatu segitiga sama kaki adalah


sisi miringnya adalah

178

satuan.
satuan,maka panjang

satuan.

Buku Guru Kelas VIII SMP/MTs

Semester 1

"

8ML
.RPSHWHQVL

 7HQWXNDQQLODLDSDGDJDPEDUEHULNXW
D

D
D

1LNRODV

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

-RGL

.id

 6XDWXNHWLND-RGLGDQ1LNRODVGLPLQWDPHQHQWXNDQDSDNDKDGDODKVXDWX7ULSHO
3\WKDJRUDV.HPXGLDQPHUHNDPHQMDZDE

 



 
 



 z 









 
 
 
 

%XNDQ7ULSHO3\WKDJRUDV

7ULSHO3\WKDJRUDV

0DQDNDK\DQJEHQDU"MHODVNDQ

 7HQWXNDQQLODL[






://






tp

 7HQWXNDQ DSDNDK $%& GHQJDQ NRRUGLQDW $    %    GDQ &    DGDODK VXDWX
VHJLWLJDVLNXVLNX"-HODVNDQ

ht

 8NXUDQ OD\DU PRQLWRU NRPSXWHU ELDVDQ\D GLXNXU


EHUGDVDUNDQ SDQMDQJ GLDJRQDOQ\D 6HEXDK PRQLWRU
 LQFK EHUDUWL PHPSXQ\DL SDQMDQJ GLDJRQDO 
LQFK-LNDWLQJJLOD\DUPRQLWRULQFKEHUDSDNDK
OHEDUQ\D"



.HODV9,,,60307V



LQ

FK

6HPHVWHU

MATEMATIKA

179

 'LNHWDKXLVHEXDK%DORN$%&'()*+GHQJDQSDQMDQJ$% FP%& FPGDQ%) 


FP7LWLN0DGDODKWLWLNSRWRQJDQWDUDGLDJRQDO$&GDQ%'-HODVNDQDSDNDKKXEXQJDQ
DQWDUDSDQMDQJ+0)0*0GDQ(0

'
&

%DJDLPDQDKXEXQJDQDQWDUVHJLWLJD$%&GDQVHJLWLJD$&'"
7HQWXNDQEHVDUVXGXWVXGXWSDGDVDODKVDWXVHJLWLJDGLDWDV
%HUDSDNDKSDQMDQJGLDJRQDO$&"-HODVNDQ
0LVDONDQSDQMDQJVLVLSHUVHJL$%&'VDWXDQ$SDNDK\DQJEHUXEDKGDULMDZDEDQPX
SDGDVRDOE GDQF "-HODVNDQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

D 
E 
F 
G 

.id

3HUKDWLNDQJDPEDUGLDWDV3HUVHJL$%&'PHPSXQ\DLSDQMDQJVLVLVDWXDQGDQJDULV$&
DGDODKGLDJRQDO

 7HQWXNDQNHOLOLQJVHJLWLJD$%&





F

ht

tp

://



'

&

6HEXDK DLU PDQFXU WHUOHWDN GL WHQJDK SHUHPSDWDQ MDODQ GL


SXVDWNRWD0RELOPHUDKGDQPRELOKLMDXVDPDVDPDPHODMX
PHQLQJJDONDQ DLU PDQFXU WHUVHEXW 0RELO PHUDK PHODMX
GHQJDQNHFHSDWDQNPMDPVHGDQJNDQPRELOKLMDXNP
MDP
D %XDWODKWDEHO\DQJPHQXQMXNNDQMDUDN\DQJGLWHPSXK
NHGXDPRELOGDQMDUDNNHGXDPRELOWHUVHEXWVHWHODK
MDPMDPGDQMDP*DPEDUNDQSHUXEDKDQMDUDN
WHUVHEXW
E 0LVDONDQPRELOPHUDKPHODMXGHQJDQNHFHSDWDQ
NPMDPVHWHODKMDPMDUDNDQWDUDNHGXDPRELO
NP%HUDSDNDKNHFHSDWDQPRELOKLMDXSDGDVDDWLWX"
.HWHUDQJDQ -DUDN NHGXD PRELO \DQJ GLPDNVXG DGDODK
SDQMDQJ UXDV JDULV \DQJ PHQJKXEXQJNDQ NHGXGXNDQ GXD
PRELOWHUVHEXW

0$7(0$7,.$

180

Buku Guru Kelas VIII SMP/MTs



Semester 1






&

D 7HQWXNDQNHOLOLQJVHJLWLJD$&'
E $SDNDKKXEXQJDQDQWDUDNHOLOLQJVHJLWLJD
 $&'GDQ$%&"
F $SDNDK KXEXQJDQ DQWDUD OXDV VHJLWLJD
$&'

GDQ$%&"



$ FP '

 7HQWXNDQSDQMDQJ$)&(GDQ&'SDGDJDPEDUEHULNXW




.id



D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

'

FP



,,

,,,

F

 3DGDNHWLJDVLVLVHEXDKVHJLWLJDVLNXVLNXGLEXDW
VHWHQJDKOLQJNDUDQ

D 7HQWXNDQOXDVVHWLDSVHWHQJDKOLQJNDUDQ
E %DJDLPDQDNDK KXEXQJDQ NHWLJD OXDV
VHWHQJDKOLQJNDUDQWHUVHEXW"

&

FP

FP

 3DGDVHEXDKVHJLWLJDVHJLWLJDVLNXVLNXGLEXDWVHJLWLJDVDPDVLVL

,,,

ht

tp

FP

P
F

://

,,

FP

,





D 7HQWXNDQOXDVVHWLDSVHJLWLJDVDPDNDNL
E %DJDLPDQDNDKKXEXQJDQNHWLJDOXDVVHJLWLJDVDPDVLVLWHUVHEXW"

.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

181

=+

SoalPengayaan

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

1. Sebuah galah sepanjang 7 m disandarkan


pada tembok sehingga membentuk sudut 45o.
Berapakah tinggi BC?

2. Sebuah atap dirancang sesuai dengan gambar berikut.

Berapakah panjang AD dan DC?

ht

tp

://

3. Keliling
pada gambar di Samping adalah 60 cm.
dan
sama dan sebangun (mirip).
Jika panjang AC =26cm, maka panjang BE adalah...

4. Gunakan gambar berikut untuk pertanyaan a c. Jelaskan jawaban kalian.


a. Tentukan keliling segitiga ABC
b. Tentukan luas segitiga ABC
c. Tentukan luas segitiga ACD dan segitiga BCD

182

Buku Guru Kelas VIII SMP/MTs

Semester 1

5. Tentukan jarak kedua titik yang ditunjukkan oleh gambar berikut.

A B C D E F 30

Kota A terletak 50 km di sebelah utara kota B, dan kota C


terletak 120 km di sebelah timur kota B, dan kota D terletak di tengah antara kota A
dan C. Jarak kota D dari kota A adalah .

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

6.

7. Perhatikan gambar di samping ini. Jika CE =


C
EB, AD = DB, besar ABC = 30, dan panjang
AC = 4 cm, maka panjang CF adalah .......

://

8. Perhatikan gambar di samping. Diketahui


panjang AB = 2 cm, CD=4 cm. AB//EF//DC,
dan AB tegak lurus BC. Berapakah panjang
EF?

30 0

ht

tp

9. Tentukan panjang d untuk setiap gambar


di bawah ini.

MATEMATIKA

183

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

11. Tiga segienam beraturan digambar sehingga


sisi-sisinya membentuk segitiga siku-siku.

.id

10. Markus, seorang mahasiswa, harus berjalan dari


asramanya di Wisma Nusantara menuju Gedung
Bhayangkara untuk mengikuti kelas matematika.
Biasanya, dia berjalan 500 meter ke timur dan
600 meter ke utara. Namun hari ini dia terlambat
bangun. Dia memutuskan untuk mengambil jalan
pintas melalui padang rumput.
Berapakah panjang jalan pintas yang dia tempuh?

a. Tentukan luas setiap segienam

b. Tentukan luas bangun datar yang terbentuk

12. Gambar berikut menunjukkan Tangram Cina

://

a. Berapakah luas bangun E?

tp

b. Berapakah panjang sisi bangun E?

ht

c. Berapakah panjang sisi-sisi segitiga A?

184

Buku Guru Kelas VIII SMP/MTs

Semester 1

13. Gambar sebelah kanan adalah jaring-jaring piramida segitiga samasisi.


a. Berapakah panjang sisi b?
b. Berapakah luas bangun di samping? (luas bangun
di samping adalah luas permukaan piramida)

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

14. Sebuah pohon di depan rumah miring dan hampir roboh tertiup angin kencang.
Supaya tidak jatuh, ayah menyangga pohon dengan galah sepanjang 250 cm dan
tampak seperti gambar di bawah ini. Pohon disangga 155 cm dari puncak pohon.

Berapakah tinggi pohon

ht

tp

://

15. Gambar di bawah menunjukkan kereta gantung di taman nasional dengan kereta yang
meluncur sepanjang kabel. Berapakah panjang kabel kereta gantung yang dimaksud?

MATEMATIKA

185

Pedoman
Penilaian

Portofolio:
a) Uji Kompetensi
b) Soal dari tempat
lain

Capaian
B

Keterangan
Bila Buku Siswa terselesaikan dengan baik

<B

Bila ada bagian dari Buku Siswa yang tidak


terselesaikan

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan mampu menyelesaikannya dengan
baik

B+

Bila memilih soal dari Uji Kompetensi dengan


kategori Sedang dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Mudah dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan kurang mampu
menyelesaikannya dengan baik

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Aspek Penilaian
Keterselesaian Buku
Siswa

.id

No
1

B , B

://

B+, B,
B

ht

tp

Tugas Projek

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan kurang mampu menyelesaikannya
dengan baik
Bila memilih soal dari Uji Kompetensi
dengan kategori Sedang dan kurang mampu
menyelesaikannya dengan baik

Bila memilih soal dari Uji Kompetensi


A, B+ , dengan kategori Mudah dan kurang mampu
B, B menyelesaikannya dengan baik
Bila Proyek terselesaikan dan manpu
A
mempresentasikan dengan Baik
A, B+, Bila ada bagian dari Proyek yang tidak terselesaikan
atau kurang mampu mempresentasikan
B
B

Bila Proyek tidak terselesaikan samasekali

Keterangan: - Nilai KKM = B




186

- Aspek penilaian Nomor 1 adalah syarat nilai yang


harus terpenuhi, sedangkan Aspek penilaian Nomor 2
adalah penambahan nilai.

Buku Guru Kelas VIII SMP/MTs

Semester 1

Bab 6

Statistika
Kata Kunci
data
tabel
grak
diagram
komputer

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

K ompetensi
D asar

.id

ht

tp

://

1. Memahami teknik
penyajian data dua
variabel menggunakan
tabel, grak batang,
diagram lingkaran,
dan grak garis
dengan komputer serta
menganalisis hubungan
antara variabel.
2. Mengumpulkan,
mengolah,
menginterpretasi,
dan menyajikan data
hasil pengamatan
dalam bentuk tabel,
diagram, dan grak
dari dua variabel
serta mengidentikasi
hubungan antar variabel.

Pengalaman
Belajar
1.
2.
3.
4.

Dalam kehidupan sehari-hari sering dijumpai penyajian


data dalam bentuk tabel, diagram, dan grak. Salah satunya
dalam bidang ekonomi dan perbankan yang sering dijumpai
adalah uktuatif nilai tukar Rupiah terhadap Dolar AS yang
sering disebut dengan kurs mata uang.
Setiap hari selalu ada perubahan kurs mata uang yang
ditampilkan dalam bentuk diagram untuk mempermudah
dalam mengamati peningkatan maupun penurunan kurs mata
uang yang terjadi.

Menyajikan data dalam diagram batang dengan menggunakan komputer.


Menyajikan data dalam diagram garis dengan menggunakan komputer.
Menyajikan data dalam diagram lingkaran dengan menggunakan komputer.
Mengumpulkan, mengolah, menginterpretasi dan menyajikan data hasil pengamatan dalam
bentuk tabel, diagram, dan grak.

MATEMATIKA

159

MATEMATIKA

187

Peta
Konsep

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Pengumpulan
Data

.id

Statistika

Pengolahan Data

ht

tp

://

Penyajian
Data

188

KelasKelas
VIII SMP/MTs
160 Guru
Buku
VIII SMP/MTs

Semester
1 1
Semester

Karl Pearson

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Karl Pearson (1857 1936) adalah


contributor
utama
perkembangan
awal statistika hingga sebagai disiplin
ilmu
tersendiri.
Ia
mendirikan
jurusan
Statistika
Terapan
di
University College London pada
tahun 1911, yang merupakan jurusan
statistika pertama kali untuk tingkat
universitas di dunia. Semenjak kecil,
ayahnya mempengaruhinya supaya
ia menyelesaikan pendidikan
di
bidang undang-undang, yang akhir
mendorongnya untuk menekuni bidang
undang-undang di University College
School, London.

Setelah
menamatkan
pendidikan
bidang undang-undang ini, barulah
Pearson belajar displin matematika
di Kings College, Cambridge.
Ketekunannya dalam mempelajari
matematika, dibuktikan dengan banyak sekali karangan buku-buku statistika yang
memberikan kontribusi sangat besar terhadap perkembangan matematika khususnya
statistika. Karl Pearson mungkin bukanlah ilmuan yang paling pintar pada zamannya,
mungkin bukan juga ilmuan yang paling popular, tapi yang nyata sekali, beliau sudah
berhasil menjadikan matematika dan statistik menjadi ilmu yang sangat menarik. Cara
beliau memecahkan masalah, hati-hati dalam menjelaskan, dan karya bukunya telah
merangsang inspirasi kepada ilmuwan setelahnya.

Karl Pearson
(1857 1936)

://

Hikmah yang dapat diambil:

tp

1. Kerja keras dan ketekunan merupakan kunci sukses dalam memacahkan masalah
dalam kehidupan sehari-hari.

ht

2. Belajar bidang apapun jika dilakukan dengan motivasi yang kuat dari dalam diri
sendiri akan memberikan kontribusi yang besar terhadap keberhasilan.
3. Orang yang baik adalah orang yang bermanfaat dan memberikan kontribusi positif
dalam bentuk apapun kepada orang lain.

161
MATEMATIKA
189

189

Membelajarkan 6.1
Menyajikan Data
Dalam Bentuk Diagram Batang

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

1. Siapkan laboratorium komputer untuk praktik menyajikan data dalam bentuk


diagram batang dengan menggunakan komputer,jika tidak tersedia laboratorium
komputer cukup dengan demontrasi dengan menggunakan LCD
2. Lengkapi pula dengan layar LCD untuk menampilkan penyajian data dengan
komputer

3HQ\DMLDQ'DWD
0HQJJXQDNDQ.RPSXWHU

Pengantar

3HQ\DMLDQ GDWD GHQJDQ PHQJJXQDNDQ NRPSXWHU MDXK OHELK PXGDK OHELK SUDNWLV GDQ OHELK DNXUDW
GLEDQGLQJNDQGHQJDQSHQ\DMLDQGDWDGHQJDQPDQXDO2OHKNDUHQDLWXNDOLDQKDUXVPDPSXPHQ\DMLNDQ
GDWD GDODP EHQWXN GLDJUDP EDWDQJ GLDJUDP JDULV GDQ GLDJUDP OLQJNDUDQ GHQJDQ PHQJJXQDNDQ
NRPSXWHU 6DODK VDWX PDQIDDW SHQ\DMLDQ GDWD GDODP GLDJUDP EDWDQJ DGDODK PHPXGDKNDQ NDOLDQ
GDODPPHPEDFDGDQPHQHQWXNDQIUHNXHQVLGDULVXDWXGDWDGHQJDQFHSDWGDQDNXUDW0LVDOQ\DDGD
GDWD WHQWDQJ QLODL UDWDUDWD WHV 8ODQJDQ$NKLU 6HPHVWHU SHODMDUDQ 0DWHPDWLND NHODV 9,,, GL 603
&DNUDZDOD\DQJGLVDMLNDQGDODPWDEHOVHEDJDLEHULNXW
7DEHO1LODL8$6SHODMDUDQ0DWHPDWLND

















































































8QWXN PHQJHWDKXL EHUDSD EDQ\DN VLVZD \DQJ PHPSHUROHK QLODL       GDQ 
WHQWXNLWDDNDQPHQJDODPLNHVXOLWDQ&DUDPXGDKXQWXNPHQJHWDKXLEDQ\DNVLVZDXQWXNVHWLDSQLODL
DGDODKPHQ\DMLNDQGDWDWHUVHEXWGDODPEHQWXNGLDJUDPEDWDQJVHSHUWLJDPEDUGLEDZDKLQL

1LODL8$60DWHPDWLND6LVZD.HODV9,,,'

ht

%DQ\DN6LVZD

tp

://

1. Sampaikan kepada
siswa bahwa salah satu
manfaat penyajian data
dalam bentuk diagram
batang adalah untuk
mengetahui frekuensi
siswa yang memperoleh
nilai tertentu pada
setiap ujian karena
sajikan data dalam
bentuk diagram batang
memudahkan kita untuk
diketahui frekuensi
siswa yang memperoleh
nilai tertentu.

2. Minta siswa untuk


menyebutkan manfaat
dari diagram dalam
permasalahan kehidupan
sehari-hari.
190

1LOD
*DPEDU'LDJUDPEDWDQJ1LODL8$6SHODMDUDQ0DWHPDWLND

'DUL GLDJUDP WHUVHEXW NLWD GHQJDQ PXGDK PHQJHWDKXL EDQ\DN VLVZD XQWXN VHWLDS QLODL PLVDOQ\D
EDQ\DNVLVZD\DQJPHQGDSDWQLODLDGDVLVZDEDQ\DNVLVZD\DQJPHQGDSDWQLODLDGDVLVZD
GDQVHWHUXVQ\D



Buku Guru Kelas VIII SMP/MTs

.HODV9,,,60307V

6HPHVWHU

Semester 1

Ayo
Kita Amati

$\R
.LWD$PDWL

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

0HQ\DMLNDQ'DWD
'DODP%HQWXN'LDJUDP%DWDQJ

.HJLDWDQ 

'DODPNHKLGXSDQVHKDULKDULNDOLDQVHULQJPHQHPXNDQGLDJUDPEDWDQJNDUHQDGLDJUDPLQLSDOLQJ
VHGHUKDQD GDQ XPXP 3HQ\DMLDQ GDWD GDODP EHQWXN GLDJUDP EDWDQJ PHPXGDKNDQ NDOLDQ GDODP
PHPEDFDGDWDGDQVHULQJGLJXQDNDQ'LDJUDPEDWDQJELDVDQ\DGLJXQDNDQXQWXNPHQ\DMLNDQGDWD
WHQWDQJSHUNHPEDQJDQQLODLVXDWXRE\HNGDODPNXUXQZDNWXWHUWHQWX&REDSHUKDWLNDQVDMLDQGDWD
GDODPEHQWXNGLDJUDPEDWDQJGLEDZDKLQL\DQJPHQXQMXNNDQKXEXQJDQDQWDUDEDQ\DNRUDQJGDQ
MHQLVSHNHUMDDQGLVXDWXZLOD\DK
1R

-HQLV3HNHUMDDQ

 3HJDZDL1HJHUL6LSLO




 71,32/5,

 %801

 3HWDQL



 1HOD\DQ

 3HGDJDQJ

 /DLQODLQ

WW dE/ hDE W E W >

E ^ WK>Z/
^

://



tp

*DPEDU6DMLDQGDWDGDODPWDEHOGDQ'LDJUDPEDWDQJ

ht

 &REDDPDWLVDMLDQGDWDGDODPEHQWXNWDEHOWHQWDQJMHQLVSHNHUMDDQGDQEDQ\DNQ\DRUDQJ
 &REDDPDWLVDMLDQGDWDGDODPEHQWXNGLDJUDPEDWDQJWHQWDQJMHQLVSHNHUMDDQ

"

$\R.LWD
0HQDQ\D

6HWHODKNDOLDQPHQJDPDWLVDMLDQGDWDGDODPGLDJUDPEDWDQJGHQJDQPHQJJXQDNDQPLFURVRIWRIFH
H[FHO GDQ MLND NDOLDQ EHOXP ELVD PHQJJXQDNDQ PLFURVRIW RIFH H[FHO $SD NDOLDQ SHUWDQ\DNDQ"
7XOLVODKSHUWDQ\DDQNDOLDQGLEXNX

0$7(0$7,.$

Ayo Kita
Menanya

Minta siswa mengungkap


kan pertanyaan yang
terkait dengan penyajian
data dalam bentuk diagram
batang. Pertanyaan yang
diharapakan:

:E/^W<Z:E

%DQ\DN

 3HJDZDL6ZDVWD

-80/$+

.id

1. Minta siswa untuk


mengamati tabel dan
penyajian data dalam
diagram batang
2. Fokuskan pengamatan
siswa pada kesesuaian
antara data dengan
digram batang yang
terbentuk dari tabel.



1.Bagaimana cara
membuat diagram batang
dengan menggunakan
komputer ?
2.Mengapa dalam diagram
batang tidak ada data
jumlah seluruhnya
seperti di tabel?
3.Bagaimana cara
membuat diagram batang
yang berwarna dan
menarik?
MATEMATIKA

191

6HGLNLW
,QIRUPDVL
&DUDPHPEXDWGLDJUDPEDWDQJGHQJDQPHQJJXQDNDQPLFURVRIWRIFHH[FHOVHEDJDLEHULNXW
 %XNDODKSURJUDPPLFURVRIWRIFHH[FHOVHSHUWLGLEDZDKLQL

.id



D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

*DPEDU6DMLDQSURJUDPPLFURVRIWRIFHH[FHO

 0DVXNNDQGDWDGDODPPLFURVRIWRIFHH[FHOVHSHUWLGLEDZDKLQL

Sedikit
Informasi

*DPEDU'DWDGDODPWDEHOSDGDSURJUDPPLFURVRIWRIFHH[FHO



.HODV9,,,60307V

6HPHVWHU

ht

tp

://

1. Ajak siswa mencoba


secara langsung
untuk membuat
diagram batang
dengan komputer dan
mendemontrasikannya
kepada siswa yang lain.
2. Berikan informasi lain
cara membuat diagram
batang yang bervariasi
dan berbagai jenis
sehingga lebih menarik
3. Minta siswa untuk
membuat grafik dengan
menggunakan program
komputer seperti pada
buku siswa. Sehingga
siswa dapat memperoleh
informasi yang lengkap
bagaimana membuat
diagram batang dengan
menggunakan program
komputer.
192

Buku Guru Kelas VIII SMP/MTs

Semester 1

 %HULODKEORNSDGDGDWDSDGDWDEHOVHSHUWLGLEDZDKLQL

.id

*DPEDU'DWDGDODPWDEHO\DQJVXGDKGLEORN



D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 .OLNPHQX,QVHUWDNDQPXQFXOEHUEDJDLMHQLVGLDJUDPEDWDQJ
PHQX
PHQXSLOLKDQ
,QVHUW
'LDJUDP%DWDQJ

*DPEDU3LOLKDQGLDJUDPEDWDQJGDODPPLFURVRIWRIFHH[FHO

ht

tp

://

 3LOLKODKGLDJUDPEDWDQJ\DQJVHVXDLDNDQPXQFXOGLDJUDPEDWDQJ0XGDKNDQ
 .DOLDQ ELVD PHPEXDW YDULDVL ZDUQD MHQLV GLDJUDP EDWDQJ GDQ VHEDJDLQ\D GHQJDQ PHPLOLK
PHQX\DQJWHUVHGLD

0$7(0$7,.$



Ayo Kita
Menalar

1. Minta siswa untuk


mencari diagram
batang yang sesuai
dengan tabel dan
temukan mengapa
dua giagram yang
lain tidak sesuai
2. Mintalah siswa untuk
membuat diagram
batang dari data yang
dibuat sendiri.
MATEMATIKA

193

$\R.LWD
0HQDODU
7DEHO)UHNXHQVLWLQJJLEDGDQVLVZD

'LNHWDKXL DGD GDWD WHQWDQJ IUHNXHQVL  WLQJJL


VLVZDNHODVVHSHUWLSDGD7DEHO

7LQJJLEDGDQVLVZD
FP
FP
FP
FP
FP
FP
FP
FP
FP
FP

'DUL 7DEHO  GL VDPSLQJ GDSDW GLSHUROHK


LQIRUPDVL EDKZD IUHNXHQVL \DQJ SDOLQJ WLQJJL
DGDODK VLVZD GHQJDQ WLQJJL EDGDQ  FP
VHGDQJNDQ IUHNXHQVL \DQJ SDOLQJ UHQGDK
DGDODK VLVZD GHQJDQ WLQJJL EDGDQ  FP
6LVZD GHQJDQ WLQJJL EDGDQ  FP PHPLOLNL
IUHNXHQVL VDPD GHQJDQ VLVZD GHQJDQ WLQJJL
EDGDQFP
-LNDGDWDWHUVHEXWGLPDVXNNDQGDODPPLFURVRIW
RIFH H[FHO GDQ GLEXDW GLDJUDP EDWDQJ
PDQD GLDQWDUD GLDJUDP EDWDQJ EHULNXW  \DQJ
PHQJJDPEDUNDQGDWD\DQJDGDGLWDEHO"&RED
MHODVNDQMDZDEDQPX"

)UHNXHQVL











/^

.id



















d

^/









D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

*DPEDU'LDJUDPEDWDQJ











d



.HODV9,,,60307V

6HPHVWHU

^/

*DPEDU'LDJUDPEDWDQJ



















d

*DPEDU'LDJUDPEDWDQJ

$\R.LWD
%HUEDJL

-LNDNDOLDQVXGDKGDSDWPHQHQWXNDQGLDJUDPEDWDQJ\DQJVHVXDLGHQJDQWDEHOIUHNXHQVLWLQJJLEDGDQ
VLVZDFREDFRFRNNDQGDQEDQGLQJNDQKDVLOSLOLKDQNDOLDQGHQJDQKDVLOSLOLKDQWHPDQNDOLDQGDQ
GLVNXVLNDQPHQJDSDNDOLDQPHPLOLKGLDJUDPWHUVHEXW

tp

://

Ayo Kita
Berbagi

ht

Setelah siswa ber


hasil menemukan
diagram batang yang
sesuai dengan tabel,
tunjukkan lagi tabel
dengan diagram
batang yang berbeda
dan suruh siswa
untuk mendiskusikan
diagram batang yang
sesuai dengan tabel.
194

Buku Guru Kelas VIII SMP/MTs

0DVDODK 

'LNHWDKXLGDWDXNXUDQVHSDWXVLVZDNHODV9,,,VDODKVDWX6031HJHULGL0DODQJDGDODKVHEDJDL
EHULNXW
$UPDQ



'RGL



$UPDQ



$QWRQ



5RODQGR



'HZR



$\X



+DUWRQR



1LNR



$KPDG



6LQDJD



5HQGL



%XUKDQ



0R]HV



)DWLPDK



'LRQ



3XWX



6XZDUQR



<D\XN



<RVHS



%LQWDQJ



&LFD



%XUMX



<DQWL



0DULD



1\RPDQ



$VHS



VXJHQJ



)HOLN



5LULQ



&REDEXDWODKGLDJUDPEDWDQJGDULGDWDWHUVHEXWWHQWXNDQQRPRUVHSDWX\DQJSDOLQJEDQ\DNGLSDNDL
VLVZD

0$7(0$7,.$

Semester 1



$OWHUQDWLI3HPHFDKDQ0DVDODK

Ayo
Kita Amati

$\R
.LWD$PDWL
'DULKDVLOSHQJDPDWDQWDEHOWHUVHEXWWHUQ\DWDMXPODKVLVZDDGDRUDQJ1RPRUVHSDWXSDOLQJEHVDU
DGDODKGDQQRPRUVHSDWXSDOLQJNHFLODGDODK

"

$\R.LWD
0HQDQ\D

&REDVXVXQODKSHUWDQ\DDQ\DQJWHUNDLWGHQJDQ0DVDODK%HEHUDSDFRQWRKSHUWDQ\DDQDGDODK
 %DJDLPDQDFDUDPHPEXDWGLDJUDPEDWDQJMLNDGDWDVHSHUWLSDGDWDEHOWHUVHEXW
 'DODPPHPEXDWGLDJUDPEDWDQJDSDNDKQDPDVHPXDVLVZDKDUXVGLWXOLV"

Minta siswa untuk


mengamati tabel pada
Masalah 6.1 tentang
data ukuran sepatu dan
siswa yang memakainya.

 %DJDLPDQDFDUDQ\DDJDUWDEHOQ\DOHELKVHGHUKDQD"

7DEHO8NXUDQ6HSDWX
GDQEDQ\DNVLVZD6LVZD
8NXUDQ
%DQ\DN
6HSDWX
VLVZD




















D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

6HEHOXPPHPEXDWGLDJUDPEDWDQJPDNDGLKLWXQJGXOXEHUDSDEDQ\DNVLVZDSDGDPDVLQJPDVLQJ
XNXUDQVHSDWXVHKLQJJDGLSHUROHKWDEHOVHEDJDLEHULNXW

.id

$\R.LWD
0HQDODU

'HQJDQPHQJJXQDNDQPLFURVRIWRIFHH[FHOPDNDWDEHOWHUVHEXWGDSDWGLEXDWGLDJUDPEDWDQJ

6HPHVWHU

tp

://

.HODV9,,,60307V

ht



MATEMATIKA

195

$\R.LWD
%HUEDJL
'LDJUDPEDWDQJ\DQJVXGDKNDOLDQEXDWFREDEDQGLQJNDQGHQJDQGLDJUDPEDWDQJ\DQJVXGDK
GLEXDWWHPDQPX-LNDDGDSHUEHGDDQFREDGLVNXVLNDQGHQJDQWHPDQPX
&RQWRK 
7DEHOEHULNXWPHQXQMXNNDQGDWDWHQWDQJKDVLOSDQHQSDGLGLNRWDVXNDEXPL

3DGLGDODPWRQ

















D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

7DKXQ

.id

7DEHO+DVLOSDQHQSDGL













 %XDWODKGLDJUDPEDWDQJGDULGDWDWHUVHEXW
 3DGDWDKXQEHUDSDNHQDLNDQSDQHQSDOLQJWLQJJLGDQEHUDSDSHUVHQWDVHNHQDLNDQGDULWDKXQ
VHEHOXPQ\D"
$OWHUQDWLI
3HQ\HOHVDLDQ

ht

tp

://

 'DWDSDGD7DEHOMLNDGLEXDWGLDJUDPEDWDQJDGDODKVHEDJDLEHULNXW

 .HQDLNDQSDQHQSDOLQJWLQJJLSDGDWDKXQ\DLWXVHEHVDUWRQGHQJDQSHUVHQWDVH

0$7(0$7,.$



Ajak siswa untuk mengamati dan memahami Contoh 6.1 serta alternatif
penyelesaiannya mengenai diagram batang.

196

Buku Guru Kelas VIII SMP/MTs

Semester 1

"

/DWLKDQ 

 +DVLO3(0,/8.$'$SDGDVXDWX.DEXSDWHQGLWXQMXNNDQVHSHUWLSDGDWDEHOEHULNXW
3DVDQJDQFDORQEXSDWL
3HUVHQWDVHSHUROHKDQVXDUD


&

'













&REDVDMLNDQGDWDWHUVHEXWGDODPGLDJUDPEDWDQJ

 %XDWODKGLDJUDPEDWDQJGDULWDEHOEHULNXW

/DNLODNL

3HUHPSXDQ





D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

9,,,$

%DQ\DNVLVZD

.id

.HODV

9,,,%





9,,,&





9,,,'





9,,,(





9,,,)





 1LODL UDWDUDWD 8MLDQ 1DVLRQDO GDUL 603 7XQDV %DQJVD WDKXQ SHODMDUDQ    
GLWXQMXNNDQGDODPWDEHOEHULNXW&REDEXDWODKGLDJUDPEDWDQJGDULGDWDWHUVHEXW
0DWDSHODMDUDQ







%DKDVD,QGRQHVLD







0DWHPDWLND



















://

,3$



ht

tp

%DKDVD,QJJULV

.HODV9,,,60307V

6HPHVWHU

Minta siswa untuk menyelesaikan Latihan 6.1 mengenai penyajian data


menggunakan komputer

MATEMATIKA

197

Membelajarkan 6.2

Menyajikan Data
dengan Diagram Garis

Ayo
Kita Amati

0HQ\DMLNDQ'DWD
'DODP%HQWXN'LDJUDP*DULV

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.HJLDWDQ 

.id

1. Siapkan laboratorium komputer untuk praktik menyajikan data dalam bentuk


diagram garis dengan menggunakan komputer, jika tidak tersedia laboratorium
komputer cukup dengan demontrasi dengan menggunakan LCD
2. Lengkapi pula dengan layar LCD untuk menampilkan penyajian data dengan
komputer

Ajak siswa untuk


mengamati diagram
garis. fokuskan pada
perbedaan dan kesamaan
dengan diagram batang.

Ayo Kita
Menanya

=+

ht

tp

://

Minta siswa untuk


menulis pertanyaan
tentang hal yang belum
dipahami.
Contoh pertanyaan :
Bagaimana cara
membuat diagram garis
dengan menggunakan
komputer?

Menggali
Informasi

'LDJUDPJDULVELDVDQ\DGLJXQDNDQXQWXNPHQ\DMLNDQGDWDGDODPZDNWXEHUNDODDWDXEHUNHVLQDPEXQJDQ
&RED DPDWL SHQ\DMLDQ GDWD GLDJUDP JDULV GHQJDQ PLFURVRIW RIFH H[FHO WHQWDQJ QLODL WXNDU UXSLDK
WHUKDGDSGRODU$6SDGDWDKXQSDGD*DPEDU
%XODQ
-DQXDUL
)HEUXDUL
0DUHW
$SULO
0HL
-XQL
-XOL
$JXVWXV
6HSWHPEHU
2NWREHU
1RYHPEHU
'HVHPEHU

.XUV5XSLDK
5S
5S
5S
5S
5S
5S
5S
5S
5S
5S
5S
5S

*DPEDU6DMLDQGDWDGDODPEHQWXNWDEHOGDQ'LDJUDP*DULV

"

$\R.LWD
0HQDQ\D

6HWHODKNDOLDQPHQJDPDWLVDMLDQGDWDGDODPEHQWXNGLDJUDPJDULVGDQMLNDNDOLDQPDVLKEHOXPELVD
PHPEXDW GLDJUDP JDULV NLUDNLUD DSD \DQJ DNDQ NDOLDQ WDQ\DNDQ7XOLVODK SHUWDQ\DDQ WHUVHEXW GL
EXNXWXOLVNDOLDQ

Minta siswa mencari


informasi dan mencoba
dengan program
komputer untuk
membuat diagram garis.

$\R
.LWD$PDWL

0HQJJDOL
,QIRUPDVL

.DOLDQVXGDKELVDPHPEXDWGLDJUDPEDWDQJGHQJDQPLFURVRIWRIFHH[FHOGLNRPSXWHUVHNDUDQJ
FREDFDULODKLQIRUPDVLEDJDLPDQDFDUDPHPEXDWGLDJUDPJDULVGHQJDQPHQJJXQDNDQPLFURVRIW
RIFHH[FHO

0$7(0$7,.$

198

Buku Guru Kelas VIII SMP/MTs

Semester 1



Ayo Kita
Menalar

$\R.LWD
0HQDODU
 .DOLDQVXGDKELVDPHPEXDWGLDJUDPEDWDQJGDQVXGDKPHQGDSDWNDQLQIRUPDVLFDUDPHPEXDW
GLDJUDPJDULVGHQJDQPLFURVRIWRIFHH[FHO&REDVHNDUDQJVDMLNDQGDWDGDODPGLDJUDPEDWDQJ
GDQ GLDJUDP JDULV GHQJDQ PHQJJXQDNDQ NRPSXWHU WHQWDQJ EDQ\DN VLVZD 603 GDODP NXUXQ

.id

ZDNWXWDKXQWHUDNKLUSDGD7DEHO
7DEHO%DQ\DNVLVZD603GDODPWDKXQ

/DNLODNL
3HUHPSXDQ
-XPODK

7DKXQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

-HQLV.HODPLQ

































 &REDEDQGLQJNDQVDMLDQGDWDGDODPGLDJUDPEDWDQJGDQGLDJUDPJDULV\DQJVXGDKNDOLDQEXDW"
$SDNHVDPDDQGDQSHUEHGDDQQ\D"
 &REDVDMLNDQGLDJUDPEDWDQJGDQGLDJUDPJDULVGHQJDQEHUEDJDLMHQLV\DQJEHUYDULDVL
$\R.LWD
%HUEDJL

 -LNDVXGDKVHOHVDLPHPEXDWGLDJUDPEDWDQJGDQGLDJUDPJDULVFREDKDVLONHUMDNDOLDQGLVDOLQ
GDQGLWHPSHONDQGLSDSDQSHPDMDQJDQGHQJDQWHPSDW\DQJEHUEHGDEHGD

 6HWLDSNHORPSRNPHQJXQMXQJLGLDJUDPEDWDQJGDQGLDJUDPJDULVGDQEHULODKNRPHQWDUGHQJDQ
PHPEHULNDQFDWDWDQSDGDWHPSDW\DQJWHODKGLVHGLDNDQ

"

/DWLKDQ 

1. Minta siswa untuk


membuat diagram garis
dengan data tersebut
dan membandingkan
dengan diagram batang,
berikutnya siswa
diminta mencoba
membuat diagram garis
agar terlihat bagus dan
menarik.
2. Tuntun siswa untuk
memperoleh jawaban
Persamaan diagram
batang dan garis
adalah sama-sama
menggunakan garis
vertikal dan garis
horizontal.
3. Perbedaannya adalah
diagram batang
menggunakan batang
untuk menggambarkan
banyaknya data
sedangkan diagram
garis hanya
menggunakan titik dan
titik satu dengan lainnya
dihubungkan dengan
garis.

://

 1LODLWXNDU5XSLDKWHUKDGDSGRODU$6GDODPVHPLQJJXGLWXQMXNNDQGDODPWDEHOEHULNXW
6HODVD

5DEX

.DPLV

-XPDW

VDEWX

0LQJJX













tp

6HQLQ


ht

%XDWODKGLDJUDPJDULVGDULGDWDWHUVHEXW



.HODV9,,,60307V

Ayo Kita
Berbagi
6HPHVWHU

Suruh siswa untuk


menempelkan hasil
bernalaranya di mading kelas
dan minta siswa kelompok
yang lain untuk melihat dan
menanggapi hasil bernalar
siswa dari kelompok lain.
MATEMATIKA

199

 %XDWODKVDMLDQGLDJUDPJDULVGDULGDWDEHUDWEDGDQVHRUDQJED\LGDODPZDNWXEXODQSDGD
WDEHOEHULNXW
%XODQ



%HUDW NJ





















 3HUKDWLNDQGLDJUDPJDULVEHULNXW

>
<

.id

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

W

W

D %XDWODKWDEHOGDULJUDNGLDJUDPJDULVWHUVHEXW
E 3DGDEXODQDSDSHQMXDODQODSWRSGDQNRPSXWHUSDOLQJWLQJJL
F 3DGDEXODQDSDSHQMXDODQODSWRSGDQNRPSXWHUSDOLQJWLQJJLPHQJDODPLNHQDLNDQSDOLQJ
WLQJJL
 'DWDMXPODKSHQGXGXNXVLDWDKXQGLVXDWXGDHUDKVHODPDWDKXQWHUDNKLUGLVDMLNDQ
GDODPEHQWXNWDEHOEHULNXW











/DNLODNL











3HUHPSXDQ











%XDWODKGLDJUDPEDWDQJGDULGDWDGLDWDV

0$7(0$7,.$

ht

tp

://

-HQLV.HODPLQ

1. Hasil karya siswa dicetak dan ditempel di papan pemajangan di dalam kelas, dan
dinilai sebagai nilai keterampilan
2. Mintalah setiap siswa untuk menilai hasil karya temannya dengan katagori baik
sekali, baik, cukup dan kurang.
3. Nilai dari siswa sebagai bahan acuan untuk penilaian guru.
200

Buku Guru Kelas VIII SMP/MTs

Semester 1



Membelajarkan 6.3

Menyajikan Data
Dalam Bentuk Diagram Lingkaran

1. Siapkan laboratorium komputer untuk praktik menyajikan data dalam bentuk


diagram lingkaran dengan menggunakan komputer,jika tidak tersedia laboratorium
komputer cukup dengan demontrasi dengan menggunakan LCD.

Ayo
Kita Amati

0HQ\DMLNDQ'DWD
'DODP%HQWXN'LDJUDP/LQJNDUDQ

.HJLDWDQ 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Ajak siswa untuk


mengamati diagram
lingkaran.

.id

2. Lengkapi pula dengan layar LCD untuk menampilkan penyajian data dengan
komputer.

Ayo Kita
Menanya

tp

://

Minta siswa menuliskan


pertanyaan tentang hal
yang diamati.
Contoh pertanyaan:
Bagaimana cara
menetukan persentase
pada diagram lingkaran.

ht

Sedikit
Informasi

Minta siswa untuk


mencari informasi
langsung di komputer
atau dengan demontrasi
penyajian data dalam
bentuk diagram
lingkaran dengan
berbagai variasi
tampilan dan warna
yang menarik.

$\R
.LWD$PDWL

'LDJUDPOLQJNDUDQELDVDQ\DGLJXQDNDQXQWXNPHQ\DMLNDQGDWDGDODPEHQWXNSHUVHQWDVH0HQ\DMLNDQ
GDWDGDODPEHQWXNGLDJUDPOLQJNDUDQKDPSLUVDPDGHQJDQPHQ\DMLNDQGDWDGDODPEHQWXNGLDJUDP
EDWDQJGDQGLDJUDPJDULV
1R

-HQLV3HNHUMDDQ

%DQ\DN

3HJDZDL1HJHUL6LSLO



3HJDZDL6ZDVWD

71,32/5,

%801

3HWDQL



1HOD\DQ

3HGDJDQJ

/DLQODLQ

-80/$+

3HGDJDQJ


1HOD\DQ


-HQLV3HNHUMDDQ
/DLQODLQ


3HWDQL


%801


316


3HJDZDL
6ZDVWD
71,32/
5, 




*DPEDU6DMLDQGDWDGDODPEHQWXNWDEHOGDQ'LDJUDP/LQJNDUDQ

&REDFHUPDWLGLDJUDPOLQJNDUDQGLDWDVDSDVDMDSHUEHGDDQGDQNHVDPDDQGHQJDQGLDJUDPEDWDQJ
GDQGLDJUDPJDULV\DQJVXGDKNDOLDQEXDWVHEHOXPQ\D"

"

$\R.LWD
0HQDQ\D

6HWHODK NDOLDQ PHQJDPDWL GLDJUDP OLQJNDUDQ WHUVHEXW NLUDNLUD DSD SHUWDQ\DDQ \DQJ DNDQ NDOLDQ
NHPXNDNDQDJDUGDSDWPHQ\DMLNDQGDWDGDODPGLDJUDPOLQJNDUDQ
6HGLNLW
,QIRUPDVL
7HQWXNDOLDQPDVLKLQJDWEDJDLPDQDFDUDQ\DPHPEXDWGLDJUDPEDWDQJGDQGLDJUDPJDULVGHQJDQ
PHQJJXQDNDQ NRPSXWHU &DUD PHPEXDW GLDJUDP OLQJNDUDQ KDPSLU VDPD GHQJDQ PHPEXDW
GLDJUDPEDWDQJGDQGLDJUDPJDULVWLQJJDOPHPLOLKGLDJUDPOLQJNDUDQSDGDWRPEROLQVHUWVHSHUWL
GLEDZDKLQL



.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

201

.id

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

*DPEDU&DUDPHPEXDWGLDJUDP/LQJNDUDQ

$\R.LWD
0HQDODU

 .DOLDQVXGDKPHQJHWDKXLFDUDPHQ\DMLNDQGDWDGDODPEHQWXNGLDJUDPEDWDQJGLDJUDPJDULV
GDQGLDJUDPOLQJNDUDQ6HNDUDQJSHUKDWLNDQEHUEDJDLMHQLVGDWD\DQJGLVDMLNDQGDODP7DEHO
0DQDNDKGLDQWDUDMHQLVGDWDWHUVHEXW\DQJOHELKWHSDWGLVDMLNDQGDODPEHQWXNGLDJUDPEDWDQJ
GLDJUDPJDULVDWDXGLDJUDPOLQJNDUDQ EHULWDQGD 
7DEHO-HQLVMHQLVGDWD

1R

-HQLVGDWD

%DQ\DNQ\DVLVZDODNLODNLGDQSHUHPSXDQ
GDODPVDWXVHNRODK



+DUJD%%0SDGDWDKXQ



%DQ\DNQ\DVLVZD\DQJPHQJLNXWLEHUEDJDL
NHJLDWDQHNVWUDNXULNXOHU



+DVLOSHPLOXNDGDGLVXDWXGDHUDKWHUWHQWX



%DQ\DNPRELO\DQJWHUMXDOGLVXDWXNRWD
GDODPZDNWXWDKXQWHUDNKLU



-HQLVSHNHUMDDQRUDQJWXDVLVZDNHODV



7LQJJLEDGDQVLVZDGDODPVDWXNHODV



1LODLXODQJDQ+DULDQVLVZDGDODPVDWXNHODV

'LDJUDP
*DULV

'LDJUDP
/LQJNDUDQ

0$7(0$7,.$

ht

tp

://



'LDJUDP
%DWDQJ

Ayo Kita
Menalar
Minta siswa untuk
menjawab pertanyaan
dengan berdiskusi
kelompok.
202

Buku Guru Kelas VIII SMP/MTs

Semester 1



 &REDWHPXNDQDSDSHUVDPDDQGDQSHUEHGDDQGDULNHWLJDGLDJUDPWHUVHEXW
 &REDSLNLUNDQEDJDLPDQDNDKPHPEXDWGLDJUDPOLQJNDUDQGDULGDWDGLEDZDKLQL$GDEHUDSD
EDQ\DNGLDJUDPOLQJNDUDQ\DQJPXQJNLQELVDGLEXDWGDQMHODVNDQDODVDQQ\D
%DQ\DNVLVZD

-HQLV.HODPLQ

6'

603

60$

60.

/DNLODNL









3HUHPSXDQ









-XPODK









&RQWRK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

6HNDUDQJNDOLDQVXGDKELVDPHPEXDWSHQ\DMLDQGDWDGHQJDQPHQJJXQDNDQGLDJUDPEDWDQJGLDJUDP
JDULVGDQGLDJUDPOLQJNDUDQ
 -HODVNDQNHSDGDWHPDQPXDODVDQPHQJDSDGDWDSDGD7DEHOGLVDMLNDQGHQJDQGLDJUDPEDWDQJ
GLDJUDPJDULVDWDXGLDJUDPOLQJNDUDQ
 &RED VHNDUDQJ MHODVNDQ NHSDGD WHPDQPX EDJDLPDQD FDUD NDOLDQ  PHPEDFD NHWLJD GLDJUDP
WHUVHEXWGHQJDQEHQDU

.id

$\R.LWD
%HUEDJL

'DODPVXDWXSROLQWHUKDGDSSHPLUVDWHQWDQJDFDUD\DQJSDOLQJGLVXNDLSDGDVDODKVDWXVWDVLXQ
7HOLYLVLGLGDSDWNDQGDWD\DQJGLVDMLNDQGDODPEHQWXNGLDJUDPOLQJNDUDQVHEDJLEHULNXW
%HUGDVDUNDQGLDJUDPOLQJNDUDQWHUVHEXW
 $FDUDDSDNDK\DQJSDOLQJEDQ\DNGLPLQDWLSHPLUVD"'DQEHUDSDEDQ\DNSHPLUVD\DQJ
PHPLQDWLQ\D"
 $FDUDDSDNDK\DQJSDOLQJVHGLNLWGLPLQDWLSHPLUVD"'DQEHUDSDEDQ\DNSHPLUVD\DQJ
PHPLQDWLQ\D"
 %HUDSDSHUVHQSHPLUVD\DQJPHPLQDWLDFDUD
$FDUD79\DQJ3DOLQJ'LVXNDL
2ODK5DJD"'DQ%HUDSDEDQ\DNSHPLUVD\DQJ
PHPLQDWLQ\D"
2ODK5DJD

$OWHUQDWLI
3HQ\HOHVDLDQ

.XLV


 $FDUD\DQJSDOLQJEDQ\DNGLPLQDWLSHPLUVD
DGDODKDFDUDVLQHWURQ\DLWXVHEDQ\DN%DQ\DN
SHPLUVD\DQJPHPLQDWLQ\DDGDODK

ht

tp

.HODV9,,,60307V

://


 SHPLUVD




0XVLN


,QIRWDQPHQW


%HULWD


6LQHWURQ


6HPHVWHU

Ayo Kita
Berbagi
Informasikan kepada siswa
untuk mendiskusikan dalam
kelompoknya mengenai
penyajian data dengan
mengunakan diagram
batang dan setelah itu
menjelaskan pada teman
sekelasnya

MATEMATIKA

203

 $FDUD\DQJSDOLQJVHGLNLWGLPLQDWLSHPLUVDDGDODKDFDUDPXVLN\DLWXVHEDQ\DN
%DQ\DNSHPLUVD\DQJPHPLQDWLQ\DDGDODK


 SHPLUVD

 3HPLUVD\DQJPHPLQDWLDFDUD2ODK5DJDDGDODK
    
-DGLSHUVHQWDVHSHPLUVDDFDUD2ODK5DJDDGDODKGDQEDQ\DNSHPLUVDQ\DDGDODK


 SHPLUVD


"

/DWLKDQ 

 %XDWODKGLDJUDPOLQJNDUDQGDULGDWDEDQ\DNVLVZDNHODV9,,,EHULNXWLQL
%DQ\DNVLVZD
.HODV
9,,,$

.HODV
9,,,%

.HODV
9,,,&

.HODV
9,,,'









.HODV
9,,,)





D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

/DNLODNL

.HODV
9,,,(

.id

-HQLV
.HODPLQ

3HUHPSXDQ













 /DSRUDQSHQMXDODQGHOHUVHSHGDPRWRUVHODPDOLPDWDKXQGLVDMLNDQGDODPWDEHOVHEDJDLEHULNXW
7DKXQ











%DQ\DNVHSHGDPRWRUWHUMXDO











%XDWODKGLDJUDPOLQJNDUDQGDULGDWDWHUVHEXW

 'DWDMHQLVSHNHUMDDQVLVZDNHODV9,,,GLVDMLNDQGDODPWDEHOVHEDJDLEHULNXW
-HQLV3HNHUMDDQ

3HJDZDL1HJHUL

%DQ\DNRUDQJWXD


3HJDZDL%801



71,32/5,



3HJDZDLVZDVWD



3HGDJDQJ



3HWDQL



/DLQODLQ



0$7(0$7,.$

ht

tp

://

1R

1. Setiap kelompok secara bergantian menjelaskan persamaan dan perbedaan


diagram batang, diagram garis, dan diagram lingkaran
2. Berilah penilaian yang meliputi penjelasan kelompok, keaktifan kelompok,
kebenaran materi, cara menjelaskan dan sebagainya
3. Bila ada siswa yang belum tuntas dapat diberikan pembelajaran remidi.
204

Buku Guru Kelas VIII SMP/MTs

Semester 1



7XJDV
3URMHN

.DOLDQ VXGDK ELVD  PHPEXDW GLDJUDP EDWDQJ GLDJUDP JDULV GDQ GLDJUDP OLQJNDUDQ GHQJDQ
PHQJJXQDNDQNRPSXWHU1DFKVHNDUDQJFREDNDOLDQEHNHUMDVHFDUDNHORPSRN\DQJWHUGLULGDUL
RUDQJXQWXNPHQJXPSXONDQGDWDPHQJRODKGDWDGDQPHQ\DMLNDQGDWDGDODPEHQWXNGLDJUDP
EDWDQJGLDJUDPJDULVGDQGLDJUDPOLQJNDUDQ
$\RODNXNDQNHJLDWDQEHULNXW
 .DOLDQEHQWXNNHORPSRN\DQJWHUGLULGDULRUDQJ
 6HWLDS VLVZD PHQJXPSXONDQ GDWD WHQWDQJ  MHQLV PDNDQDQ GDQ  MHQLV PLQXPDQ \DQJ
SDOLQJGLVXNDLDQJJRWDNHOXDUJD D\DKLEXDGLNNDNDNGDQVD\DVHQGLUL GLUXPDKPX
 .XPSXONDQGDWDGDULPDVLQJPDVLQJVLVZDGDODPVDWXNHORPSRN
 %XDWODKWDEHOWHQWDQJPDNDQDQGDQPLQXPDQ\DQJSDOLQJGLVXNDL
 6DMLNDQ GDWD SDGD WDEHO GDODP EHQWXN GLDJUDP EDWDQJ GLDJUDP JDULV GDQ GLDJUDP
OLQJNDUDQ

1. Pembelajaran proyek
memerlukan waktu
dua minggu untuk
menyelesaikannya
2. Siapkan koran
diperpustakaan yang
dapat membantu
siswa
3. Buatlah alur kerja
yang sistematis,
sehingga siswa
bekerja sesuai dengan
alur yang sudah
ditentukan, namun
tetap memperhatikan
kreatifitas siswa
4. Berilah bantuan
bagi siswa yang
mengalami kesulitan,
misalnya dalam
satu kelompok tidak
ada yang memiliki
komputer, tidak ada
yang memiliki printer
dan lain-lain
5. Identifikasi kembali
siswa-siswa yang
masih belum
mencapai ketuntasan
dalam belajar,
untuk dilakukan
pembelajaran remidi
dan pengayaan

0HUDQJNXP 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

 %XDWODKNHVLPSXODQWHUKDGDSKDVLOSHQ\DMLDQGDWDGDODPEHQWXNGLDJUDPEDWDQJGLDJUDP
JDULVGDQGLDJUDPOLQJNDUDQ

Tugas
Projek

.DOLDQWHODKPHPSHODMDULWHQWDQJFDUDPHQ\DMLNDQGDWDGDODPEHQWXNGLDJUDPEDWDQJGLDJUDP
JDULVGDQGLDJUDPOLQJNDUDQGHQJDQPLFURVRIWRIFHH[FHO-DZDEODKEHEHUDSDSHUWDQ\DDQEHULNXW

 7XOLVODKODQJNDKODQJNDKPHQ\DMLNDQGDWDGDODPEHQWXNGLDJUDPEDWDQJGDQGLDJUDPJDULV
GHQJDQPLFURVRIWRIFHH[FHO

 7XOLVODKODQJNDKODQJNDKPHQ\DMLNDQGDWDGDODPEHQWXNGLDJUDPOLQJNDUDQGHQJDQPLFURVRIW
RIFHH[FHO
 6HEXWNDQGDWDGDWD\DQJFRFRNGLVDMLNDQGDODPEHQWXNGLDJUDPEDWDQJGLDJUDPJDULVGDQ
GLDJUDPOLQJNDUDQ
 $SDSHUEHGDDQGDQSHUVDPDDQDQWDUDGLDJUDPEDWDQJGLDJUDPJDULVGDQGLDJUDPOLQJNDUDQ

.HODV9,,,60307V

6HPHVWHU

ht

tp

://



1. Bentuk kelompok yang heterogen dari sisi kemampuan.


2. Berikan siswa petunjuk yang jelas dan sistematis bagaimana siswa bekerja dan
menyelesaikan proyeknya.
3. Cek hasil kerja siswa agar dapat terkontrol setiap waktu, sehingga pada saat
dikumpulkan mereka selesai tepat waktu.

MATEMATIKA

205

"

8ML
.RPSHWHQVL

6HOHVDLNDQVRDOEHULNXWGHQJDQFHUPDW
 %DQ\DNQ\DSHQGXGXNGDULVDWXNHFDPDWDQVHSHUWLGLWXQMXNNDQGDODPWDEHOGLEDZDKLQL

3HUHPSXDQ





.HGXQJMDMDQJ





6XPEHUUHMR





$UMRSXUR





6LGRPDNPXU





D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

/DNLODNL

6LGRPXO\R

.id

%DQ\DNSHQGXGXN

1DPDGHVD

0HUMRVDUL





D %XDWODKGLDJUDPEDWDQJGDQGLDJUDPJDULVGDULGDWDWHUVHEXW"
E $SDNHVLPSXODQWHQWDQJEDQ\DNQ\DSHQGXGXNODNLODNLGDQSHUHPSXDQGDULVHWLDSGHVD"
 'DODP VDWX PLQJJX EDQ\DNQ\D NHQGDUDDQ \DQJ PHOLQWDV GL MDODQ WRO WHUFDWDW GDODP WDEHO
EHULNXW
%DQ\DNQ\DNHQGDUDDQ

6HQLQ



6HODVD



5DEX



.DPLV



-XPDW



6DEWX



0LQJJX



ht

tp

://

+DUL

D %XDWODKGLDJUDPOLQJNDUDQGDULGDWDWHUVHEXW
E 7HQWXNDQSHUVHQWDVHEDQ\DNNHQGDUDDQVHWLDSKDULGDODPVHSHNDQ
F $SD NHVLPSXODQ NDOLDQ WHQWDQJ EDQ\DNQ\D NHQGDUDDQ \DQJ PHOLQWDV GDODP VHSHNDQ GL
MDODQWRO"

0$7(0$7,.$

206

Buku Guru Kelas VIII SMP/MTs

Semester 1



3HQMXDODQ0RELO

 'LDJUDPOLQJNDUDQGLEDZDKLQLPHQXQMXNNDQSHQMXDODQ
PRELOGLEHEHUDSDNRWDEHVDU
D -LND VHPXD PRELO \DQJ WHUMXDO VHEDQ\DN 
WHQWXNDQ EHUDSD EDQ\DN PRELO \DQJ WHUMXDO WLDSWLDS
NRWD"
E $SDNHVLPSXODQNDOLDQWHQWDQJEDQ\DNQ\DPRELO\DQJ
WHUMXDOGDULNRWDEHVDUWHUVHEXW"

3DOX



'HQSDVDU



-DNDUWD



0HGDQ



 'LNHWDKXLGLDJUDPEDWDQJWHQWDQJWLQJJLEDGDQVHSHUWLGL
EDZDKLQL

6XUDED\D


%DQGXQJ



6HPDUDQJ



.id

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

         

'LNHWDKXLMXPODKVLVZDDGDODKDQDN
D 7HQWXNDQEHUDSDEDQ\DNVLVZDPDVLQJPDVLQJ
E 3DGDWLQJJLEDGDQEHUDSDMXPODKVLVZD\DQJSDOLQJEDQ\DNGDQSDOLQJVHGLNLW"
F 7HQWXNDQXNXUDQWLQJJLEDGDQ\DQJEDQ\DNVLVZDQ\DVDPD"

 %DQ\DNVLVZDODNLODNLGDQSHUHPSXDQGL6'60360$GDQ60.GLWXQMXNNDQGDODPWDEHO
GLEDZDKLQL
6HNRODK

/DNLODNL

3HUHPSXDQ

6'





603





60$





60.





://
tp
ht

%DQ\DNVLVZD

D %XDWODKGLDJUDPEDWDQJGDQGLDJUDPJDULVGDULGDWDWHUVHEXW
E %XDWODKGLDJUDPOLQJNDUDQGDULGDWDWHUVHEXW
F $SD\DQJGDSDWNDOLDQVLPSXONDQGDULNHWLJDGLDJUDPWHUVHEXW



.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

207

Tugas
Projek
Jenis data
Banyaknya siswa laki-laki dan perempuan dalam
satu sekolah

Diagram

Diagram

Diagram

batang

garis

Lingkaran

Harga BBM pada tahun 2000 2013

Banyaknya siswa yang mengikuti berbagai


kegiatan ekstrakurikuler

Banyak mobil yang terjual di suatu kota dalam


waktu 5 tahun terakhir

.id

Hasil pemilukada di suatu daerah tertentu

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Jenis pekerjaan orang tua siswa kelas 8


Tinggi badan siswa dalam satu kelas

Nilai ulangan Harian siswa dalam satu kelas

Garis
Tampilan
Diagram
Hubungan
data satu
dengan
lainnya

208

Diagram batang

ht

Aspek

tp

://

1. Langkah-langkah dalam menyajikan data dalam diagram batang dan diagram garis
adalah sebagai berikut
a. Buatlah tabel dalam microsoft office excel
b. Bloklah data yang akan dibuat diagram batang dan diagram garis
c. Klik insert dan pilihlah gambar diagram batang atau diagram garis
d. Terbentuklah diagram batang atau diagram garis
e. Veriasi warna dan lainnya dapat klik di desain
2. Langkah-langkah dalam menyajikan data dalam diagram lingkaran adalah sebagai
berikut
f. Buatlah tabel dalam microsoft office excel
g. Bloklah data yang akan dibuat diagram lingkaran
h. Klik insert dan pilihlah gambar diagram lingkaran
i. Terbentuklah diagram lingkaran
j. Veriasi warna dan lainnya dapat klik di desain
3. Perbedaan diagram batang, diagram garis, dan diagram lingkaran adalah sebagai
berikut
Ada dua garis, yaitu
garis vertikal dan
garis horizontal
Banyak data
ditunjukkan dengan
batang
Tidak ada hubungan
antara data satu
dengan lainnya

Diagram garis
Ada dua garis, yaitu
garis vertikal dan garis
horizontal
Banyak data ditunjukkan
dengan titik

Diagram Lingkaran
Tidak memiliki garis
vertikal dan horizontal

Banyak data ditunjukkan


dengan luas juring
lingkaran
Titik satu dengan lainnya Semua data membentuk
dihubungkan dengan
satu lingkaran
garis

Buku Guru Kelas VIII SMP/MTs

Semester 1

=+

SoalPengayaan

Data dalam tabel berikut ini menggambarkan laporan penjualan PT Makmur tahun
2009 2013. Coba sajikan data tersebut dengan diagram yang sesui dengan data
dalam tabel. Jelaskan alasan kalian mengapa memilih penyajian data dengan diagram
tersebut

2.

Data di samping menggambarkan banyak mahasiswa baru tahun 2011-2013 dari


beberapa Fakultas. Coba sajikan data tersebut dalam diagram garis dan diagram
lingkaran

://
tp

ht

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

1.

MATEMATIKA

209

Pedoman
Penilaian
No
1

Capaian
B

Keterangan
Bila Buku Siswa terselesaikan dengan baik

<B

Bila ada bagian dari Buku Siswa yang tidak


terselesaikan

Portofolio:
a) Uji Kompetensi
b) Soal dari tempat
lain

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan mampu menyelesaikannya dengan
baik

.id

Aspek Penilaian
Keterselesaian Buku
Siswa

Bila memilih soal dari Uji Kompetensi dengan


kategori Sedang dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Mudah dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan kurang mampu
menyelesaikannya dengan baik

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o
B+

B , B
B+, B,
B

Bila memilih soal dari Uji Kompetensi


A, B+ , dengan kategori Mudah dan kurang mampu
B, B menyelesaikannya dengan baik
Bila Proyek terselesaikan dan manpu
A
mempresentasikan dengan Baik
A, B+, Bila ada bagian dari Proyek yang tidak terselesaikan
atau kurang mampu mempresentasikan
B

://

ht

tp

Tugas Projek

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan kurang mampu menyelesaikannya
dengan baik
Bila memilih soal dari Uji Kompetensi
dengan kategori Sedang dan kurang mampu
menyelesaikannya dengan baik

Bila Proyek tidak terselesaikan samasekali

Keterangan: - Nilai KKM = B




210

- Aspek penilaian Nomor 1 adalah syarat nilai yang


harus terpenuhi, sedangkan Aspek penilaian Nomor 2
adalah penambahan nilai.

Buku Guru Kelas VIII SMP/MTs

Semester 1

Persamaan Linear
Dua Variabel

Bab 1

Kata Kunci

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Persamaan Linear Dua


Variabel.
Model Matematika
Selesaian.
Sistem Persamaan
Linear Dua Variabel.

.id

K ompetensi
D asar

Sumber: Kemdikbud

1. Menentukan nilai
variabel persamaan
linear dua variabel
dalam konteks nyata.
2. Membuat dan
menyelesaikan model
matematika dari
masalah nyata yang
berkaitan dengan
persamaan linear dua
variabel.

Setiap hari rambut kita terus bertambah panjang. Rambut


kita akan memanjang 0,3 milimeter tiap hari. Misalkan panjang
rambut seorang gadis yang berumur 18 tahun pada gambar
di atas awalnya adalah 250 mm. Kita bisa memperkirakan
panjang rambutnya y milimeter setelah x hari dengan
persamaan linear

y = 0,3x + 250

Bagaimana dengan panjang rambut kalian? Dapatkah kalian


menentukan persamaan linear panjang rambut kalian sendiri?

tp

://

Pengalaman
Belajar

ht

Berdasarkan Kompetensi Dasar di atas, pengalaman belajar yang akan kita lalui antara lain.
1. Membuat dan mendenisikan bentuk persamaan linear dua variabel.
2. Menentukan selesaian persamaan persamaan linear dua variabel.
3. Membuat model matematika dari masalah sehari-hari yang berkaitan dengan persamaan
linear dua variabel.
4. Menyelesaikan masalah yang berkaitan dengan peramaan linear dua variabel.

1
MATEMATIKA
MATEMATIKA

211

Peta
Konsep
Persamaan Linear Dua
Variabel (PLDV)

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

mempelajari

Himpunan
Selesaian
PLDV

Denisi PLDV

ht

tp

://

diselesaikan dengan

212

Buku
Guru
Kelas VIII SMP/MTs
Kelas VIII SMP/MTs
2

Semester
2
Semester 2

Diophantus Dan Persamaan Linear


Dua Variabel

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Persamaan linear dua variabel


berkaitan erat dengan persamaan
diophantine. Persamaan ini pertama
kali dipelajari oleh seseorang
yang bernama Diophantus yang
menghabiskan hidupnya di Alexandria.
Diophantus juga dikenal dengan
julukan bapak dari aljabar. Namun
julukan itu kemudian disandang
oleh Al-Khawarizmi tentunya. Dia
merupakan seorang matematikawan
Yunani yang bermukim di Iskandaria,
pada waktu itu Alexandria adalah pusat
pembelajaran Matematika.
Semasa hidup Diophantus terkenal
karena karyanya yang berjudul
Arithmetica. Arithmetica adalah suatu
Diophantus
pembahasan analitis teori bilangan
yang berisi tentang pengembangan
( 250 SM - 200 SM)
aljabar yang dilakukan dengan
membuat persamaan. Persamaanpersamaan tersebut dikenal sebagai Diophantine Equation (Persamaan Diophantine).

Persamaan deophantine merupakan suatu persamaan yang mempunyai solusi yang


diharapkan berupa bilangan bulat. Persamaan Diophantine tidak harus berbentuk
persamaan linier, bisa saja kuadrat, kubik, atau lainnya selama mempunyai solusi
bilangan bulat.
Bentuk paling sederhananya diberikan oleh

ax + by = c

://

a, b koesien dan c konstanta bulat yang diberikan. Penyelesaian persamaan


Diophantine adalah semua pasangan bilangan bulat (x, y) yang memenuhi persamaan

ht

tp

ini. Jika d adalah FPB dari a dan b, maka agar persamaan di atas mempunyai solusi
maka d harus dapat membagi c. Terkadang dalam menentukan pasangan bilangan bulat
yang memenuhi persamaan, kita harus mencoba-coba dan pandai menentukan pola dari
selesaiannya.
Hikmah apa yang dapat kalian ambil dari biogra Diophantus ini?
1.

Menyelesaikan masalah tidaklah semudah menyelesaikan perkalian dengan


mencongak. Kita harus menentukan strategi yang tepat untuk menyelesaikannya.

2.

Terkadang kita dihadapkan dengan masalah yang selesaiannya tidak tunggal. Oleh
karena itu jangan pernah menyerah untuk menggali informasi lebih dalam sehingga
mendapatkan selesaian lainnya.

3
MATEMATIKA
213

213

Membelajarkan 1.1

3HUVDPDDQ/LQHDU
'XD9DULDEHO

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

1. Kenali terlebih dahulu


konsep penggantian
(substitusi). Konteks yang
diberikan dalam buku
siswa adalah timbangan
tuah dan penghilang
dahaga (mengisi air
dalam botol). Konteks
ini mengenalkan
siswa terutama untuk
konsep penggantian
(substitusi) yang nantinya
digunakan mereka dalam
menyelesaikan Sistem
Persamaan Linear Dua
Variabel (SPLDP).
2. Amati dan kenali terlebih
dahulu beberapa contoh
konsep persamaan linear
dua variabel dalam
kehidupan nyata, seperti:
persamaan yang terbentuk
dari hubungan waktu
(hari) dan panjang rambut,
hubungan antara banyak
siswa dengan harga sewa
bus, konversi suhu, dan
lainnya.
3. Buat siswa menjadi
kelompok-kelompok
kecil (2 4 orang) yang
memungkinkan belajar
lebih efektif.

.id

Membuat Persamaan Linear Dua Variabel

'L .HODV 9,, NDOLDQ WHODK PHPSHODMDUL PDWHUL WHQWDQJ SHUVDPDDQ OLQHDU VDWX YDULDEHO 0DVLK
LQJDWNDKNDPXDSD\DQJGLPDNVXGGHQJDQSHUVDPDDQOLQHDUVDWXYDULDEHO"6HODLQSHUVDPDDQOLQHDU
GXDYDULDEHONDOLDQWHQWXQ\DPDVLKLQJDWSHUVDPDDQJDULVOXUXVSDGD%DEGL6HPHVWHU3HUVDPDDQ
JDULV OXUXV PDVLK HUDW NDLWDQQ\D GHQJDQ SHUVDPDDQ OLQHDU GXD YDULDEHO 2OHK NDUHQD LWX XQWXN
PHPDKDPLSHQJHUWLDQGDQNRQVHSGDVDU3/'9SHODMDULPDVDODKEHULNXWGDQVHOHVDLNDQODK
3DVDU%XDK

 %HUDSD EDQ\DN SLVDQJ \DQJ GLEXWXKNDQ XQWXN PHQ\HLPEDQJNDQ WLPEDQJDQ NHWLJD" -HODVNDQ
DODVDQPX

ht

tp

://

SLVDQJ
QDQDV QDQDV
SLVDQJ
DSHO
DSHO
 %HUDSDEDQ\DNZRUWHO\DQJNDPXEXWXKNDQXQWXNPHQ\HLPEDQJNDQWLPEDQJDQNHWLJD"-HODVNDQ
DODVDQPX

214

ZRUWHO


MDJXQJ MDJXQJ
SDSULND

SDSULND

SDSULND

3HQJKLODQJ'DKDJD
 %HUDSDEDQ\DNJHODVDLU\DQJGDSDW

NDPXWXDQJNDQNHGDODPERWROEHVDU"

-HODVNDQDODVDQPX

Buku Guru Kelas VIII SMP/MTs

.HODV9,,,60307V

6HPHVWHU

Semester 2

Apersepsi
0HPEXDW3HUVDPDDQ/LQHDU
'XD9DULDEHO

.HJLDWDQ 
0DVDODK 
$JHQ%XV\DQJPDQD\D"

$JHQ%XV

 

*DODNVL

0HOD\DQL6WXGL:LVDWD
VL
*DODN

$$J6HQ%$XV

$1*.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3HUMDODQDQ0XODL

.id

6HNHORPSRN VLVZD 603 6XNDPDMX PHUHQFDQDNDQ VWXGL ZLVDWD 3HUZDNLODQ NHORPSRN PHUHND
PHQJDPDWLEURVXUVSHVLDO\DQJGLWDZDUNDQROHKGXDDJHQEXV.HGXDEURVXUWHUVHEXWWDPSDNVHSHUWL
GLEDZDKLQL

%LD\D3HPHVDQDQ+$1<$

5S

3HUVLVZDKDQ\D

5S

DQ
UMDODQ

3H

D
:LVDW
6WXG$L1*.$6$

Q
S+DUL
HVDQD
DW6HWLD
D3HP
%HUDQJN  
!%LD\ DWDX






VZD

O
VL
S
X
3XN
2 5
SHU
3520 !5S
3(.$1

*DPEDU%URVXUSHQDZDUDQVSHVLDODJHQEXV$QJNDVDGDQ*DODNVL

0HQXUXWPX DJHQ EXV PDQDNDK \DQJ DNDQ NDPX SLOLK" -HODVNDQ DODVDQPX PHQJDSD DJHQ EXV LWX
NDPXSLOLK
$\RFHNMDZDEDQPXGHQJDQPHOHQJNDSLWDEHOGLEDZDKLQL

7DEHO3HUEDQGLQJDQKDUJDVHZDDJHQEXV$QJNDVDGDQ*DODNVL







$JHQ%XV$QJNDVD

$JHQ%XV*DODNVL

://

%DQ\DN6LVZD

Sebelum memulai
pembelajaran, ingatkan
kembali materi persamaan
linear satu variabel yang
sudah dipelajari siswa
di kelas VII. Setelah
itu, sampaikan tujuan
pembelajaran untuk
pembelajaran Kegiatan 1.1.
Berikan penjelasan terkait
dengan contoh masalah
PLDV, yakni pemilihan
agen bus.ajak siswa untuk
menyelesaikan masalah di
permulaan bab ini.
Pertanyaan pada apersepsi
ini, adalah pertanyaan
yang membuat siswa
memiliki jawaban yang
berbeda. Namun, setelah
selesai melengkapi tabel
yang disediakan, siswa
akan membandingkan dan
mengetahui masalah apa
yang dihadapi. Dengan
melakukan apersepsi ini,
siswa akan mengenal
manfaat mempelajari PLDV

ht

tp



6HNDUDQJJXQDNDQ7DEHOGLDWDVXQWXNPHQHUDQJNDQDJHQEXVPDQDNDK\DQJWDZDUDQQ\DOHELK
EDLNNHPXGLDQEDQGLQJNDQGHQJDQMDZDEDQPXSDGDSHUWDQ\DDQGLDWDV

0$7(0$7,.$

MATEMATIKA

215

 'DSDWNDKNDOLDQPHQHQWXNDQSHUVDPDDQEHVDUELD\D\DQJGLNHOXDUNDQXQWXNPHQ\HZDEXVWDQSD
KDUXVUHSRWPHPEXDWWDEHO"
 %DJDLPDQDFDUDPHPEXDWPRGHOPDWHPDWLNDQ\D"'DQEDJDLPDQDMXJDFDUDPHQ\HOHVDLNDQQ\D"

Ayo
Kita Amati

$OWHUQDWLI3HPHFDKDQ0DVDODK

Minta siswa untuk


menjawab pertanyaanpertanyaan yang
berkaitan dengan
Gambar 4.1 Bonus
penawaran agen bus.
Bimbing siswa
dengan memberikan
pertanyaan pertanyaan
pancingan. Misalnya:
Apa yang kalian
ketahui tentang
Rp4.000.000,00 dan
Rp2.000.000,00
dari kedua brosur?,
Apakah uang sewa
masih tetap dikanakan
jika banyak siswa yang
mengikuti studi wisata
berbeda-beda?

$\R
.LWD$PDWL
3HUKDWLNDQGHQJDQVHNVDPDSDGDPDVDODKSHPLOLKDQDJHQEXV
 8UDLNDQ GHQJDQ NDWDNDWD EDJDLPDQD PHQHQWXNDQ ELD\D VHZD EXV GL$JHQ %XV$QJNDVD MLND
VLVZD\DQJPHQJLNXWLVWXGLZLVDWDEDQ\DNQ\DVHPEDUDQJ


%LD\DQ\DVDPDGHQJDQGLWDPEDK

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

 *XQDNDQYDULDEHOGDQELODQJDQXQWXNPHQXOLVNDQVHEXDKSHUVDPDDQ\DQJPHQMHODVNDQELD\D
SHQJJXQDDQ %XV$QJNDVD GHQJDQ EDQ\DN VLVZD VHEDUDQJ 0LVDO K PHQXQMXNNDQ ELD\D \DQJ
GLNHOXDUNDQGDQVPHQXQMXNNDQEDQ\DNVLVZD

K 
 *XQDNDQFDUD\DQJVDPD\DQJNDPXODNXNDQSDGDSHUWDQ\DDQGDQXQWXNPHQXOLVNDQVHEXDK
SHUVDPDDQ\DQJPHQMHODVNDQELD\DSHQJJXQDDQ%XV*DODNVLGHQJDQEDQ\DNVLVZDVHPEDUDQJ
0LVDOKPHQXQMXNNDQELD\D\DQJGLNHOXDUNDQGDQVPHQXQMXNNDQEDQ\DNVLVZD

K 

3HUVDPDDQ\DQJWHODKNDOLDQEXDWSDGDSHUWDQ\DDQQRPRUGDQDGDODKEHQWXNSHUVDPDDQOLQHDU
GXDYDULDEHO

"

Ayo Kita
Menanya

$\R.LWD
0HQJJDOL,QIRUPDVL

6HEHOXPNDOLDQPHQJJDOLLQIRUPDVLVHEDLNQ\DNDOLDQSHUKDWLNDQXUDLDQEHULNXW
&RQWRKEHQWXNSHUVDPDDQOLQHDUGXDYDULDEHO
D \ [
E DE 
F PQ 

.HODV9,,,60307V

6HPHVWHU

216

=+

ht

tp

://

Minta siswa untuk


menanyakan dan
menulis hal yang ingin
mereka ketahui dari
mengamati dan sedikit
informasi. Diskusikan
pertanyaan yang telah
diajukan siswa. Pilih
pertanyaan yang sesuai
dengan masalah.
Seandainya tidak ada
siswa yang mengajukan
pertanyaan, berikan
pertanyakan tentang
hubungan persaman
linear yang telah dibuat
dengan persamaan garis
lurus.

$\R.LWD
0HQDQ\D

7HUNDLWGHQJDQIRNXVSHQJDPDWDQGLDWDVFREDEXDWODKSHUWDQ\DDQ\DQJPHPXDWNDWDNDWDEHULNXW
%LD\DSHPHVDQDQ5SGDQ%LD\DSHPHVDQDQ5S
8DQJVHZDGDQEDQ\DNVLVZD\DQJPHQJLNXWLVWXGLZLVDWDEHUEHGDEHGD
3HUVDPDDQOLQHDUGDQVHOHVDLDQEXNDQVHOHVDLDQ
7XOLVODKSHUWDQ\DDQNDOLDQGLEXNXWXOLV

6HWHODKPHPSHODMDUL%DELQLNDOLDQDNDQPDPSXPHPEXDWPRGHOGDQPHQ\HOHVDLNDQPDVDODK
\DQJEHUNDLWDQGHQJDQSHUVDPDDQOLQHDUGXDYDULDEHO

Menggali
Informasi

Minta siswa untuk mencari 10 persamaan linear dua


variabel dengan cara mengunjungi perpustakaan, mencari
buku matematika, bertanya kepada guru matematika,
fisika, ekonomi atau mencari di internet.
Alternatif:
Untuk mengantisipasi siswa tidak dalam pengawasan
ketika menyelesaikan bagian ini, buatlah kartu yang berisi
persamaan linear dua variabel dan yang bukan persamaan
linear dua variabel.

Buku Guru Kelas VIII SMP/MTs

Semester 2

9DULDEHOSDGDSHUVDPDDQ\ [DGDODK[GDQ\VHGDQJNDQYDULDEHOSDGDSHUVDPDDQDE 


DGDODKDGDQE$GDSXQYDULDEHOSDGDSHUVDPDDQPQ DGDODKPGDQQ3HUKDWLNDQEDKZD
SDGDVHWLDSFRQWRKSHUVDPDDQGLDWDVEDQ\DNQ\DYDULDEHODGDGXDGDQPDVLQJPDVLQJEHUSDQJNDW
VDWX

Ayo Kita
Menalar

3HUVDPDDQOLQHDUGXDYDULDEHOGDSDWGLQ\DWDNDQGDODPEHQWXN
D[E\ FGHQJDQDEF5DEGDQ[\VXDWXYDULDEHO
&DULODKVHGLNLWQ\DFRQWRK\DQJWHUPDVXNSHUVDPDDQOLQHDUGXDYDULDEHOGDQ\DQJEXNDQ
WHUPDVXNSHUVDPDDQOLQHDUGXDYDULDEHOGDULEXNXPDWHPDWLNDEXNXSHODMDUDQODLQQ\DDWDX
LQWHUQHW
$\R.LWD
0HQDODU
%HUGDVDUNDQ LQIRUPDVL \DQJ NDOLDQ GDSDWNDQ FRED SHUKDWLNDQ WDEHO  EHULNXW GDQ MDZDEODK
SHUWDQ\DDQSHUWDQ\DDQQ\D
7DEHO%HQWXN8PXP3HUVDPDDQ/LQHDU'XD9DULDEHO
3HUVDPDDQ/LQHDU'XD9DULDEHO

D[E\ FD E F 

[\ 

K V


[


DVEK FD E F 


D[E\ FD   E F 


  V  W

D  E



S T



[\ 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

%HQWXN8PXP

.id

1RPRU

DVEW FD E F 






Setelah siswa
membedakan persamaan
yang merupakan
persamaan linear dua
variabel dan yang
bukan, ajak siswa untuk
menemukan bentuk
umum persamaan
linear dua variabel
dengan meminta siswa
mengamati tabel. Berikan
pertanyaan-pertanyaan
yang memancing
penalaran siswa.
Misalnya: Bilangan
apakah koefisien dan
konstanta yang terdapat
dalam persamaan?
Setelah siswa
menemukan bentuk
umum dari persamaan
linear dua variabel,
dengan berpasangan,
minta siswa
untuk menjelaskan
(membagikan)
pengetahuannya di depan
kelas.

DPEQ FD E F 

DS  ET F D


E



F





D[E\ FD E F 


D[E\ FD E F 

ht

tp

://

0$7(0$7,.$

Tanyakan kepada siswa yang lain untuk kemungkinan penjelasan yang berbeda.
Setelah semua mencapai kesepakatan, beri penguatan tentang bentuk umum
persamaan linear dua variabel.

a, b, dan c adalah bilangan real
a, b keduanya tidak sama dengan nol
Ingatkan bahwa PLDV adalah persamaan yang pangkat variabelnya adalah satu, dan
setiap suku hanya dibolehkan satu variabel saja.

MATEMATIKA

217

?!

Latihan

$\R.LWD
%HUEDJL
6DMLNDQ KDVLO SHQDODUDQ NDOLDQ GL GHSDQ NHODV 3HULNVD GDQ VHFDUD VDQWXQ VLODNDQ VDOLQJ PHPEHUL
NRPHQWDUGDQPHQDQJJDSLNRPHQWDUWHPDQPX

"

/DWLKDQ 

 /LPDVLVZD6036XNDPDMXWHODKPHQDEXQJXQWXNPHQJLNXWLVWXGLZLVDWD0HUHND
PHQ\DMLNDQGDWDXQWXNPHQXQMXNNDQWDEXQJDQPDVLQJPDVLQJVHEDJDLEHULNXW

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Minta salah satu siswa


untuk menyajikan hasil penalarannya di depan kelas.
Tunjuk siswa lain untuk
menanggapi dan minta
untuk menanggapi sajian
temannya tersebut secara
santun. Diskusikan hasil
penalaran apabila tidak
sesuai dengan alternatif
jawaban yang diharapkan.

3HUKDWLNDQQLODLQLODLDEGDQF$GDNDKV\DUDWV\DUDWVXDWXSHUVDPDDQGLNDWDNDQSHUVDPDDQOLQHDU
GXDYDULDEHO".DODXDGDDSDVDMDV\DUDWV\DUDWQ\D"%DJDLPDQDELODVDODKVDWXGDULQLODLYDULDEHO[
DWDX\VDPDGHQJDQQRO"/DOXEDJDLPDQDMLNDQLODLDGDQENHGXDQ\DVDPDGHQJDQQRO"$SDNDK
PHPEHQWXNVXDWXSHUVDPDDQOLQHDUGXDYDULDEHO"%XDWODKVLPSXODQGDQEHULNDQDODVDPX

.id

Ayo Kita
Berbagi

Sebagai tugas tambahan


yang wajib dikerjakan
siswa, soal Latihan ini
bisa dijadikan pekerjaan
rumah atau sebagai tugas
akhir pekan.

0DQDNDKGLDQWDUDNHOLPDGDWDGLDWDV\DQJGDSDWPHQ\DWDNDQSHUVDPDDQOLQHDUGXDYDUL
DEHO"-HODVNDQ

.HODV9,,,60307V

6HPHVWHU

ht

tp

://

Latihan ini terdapat


masalah-masalah yang
menggunakan pola.

218

Buku Guru Kelas VIII SMP/MTs

Semester 2

 3HUKDWLNDQSHQ\HGHUKDQDDQEHQWXNDOMDEDU\DQJGLODNXNDQ=DLQXOEHULNXW

6HWHODKLWX=DLQXOPHQJDWDNDQEDKZD

DEHONDUHQDELVDGLVHGHUKDQDNDQPHQMDGL[\ 
0HQXUXWNDOLDQDSDNDKSHUQ\DWDDQ=DLQXOEHQDU"

[  \
[ \

 PHUXSDNDQSHUVDPDDQOLQHDUGXDYDUL

 %HQWXNXPXPSHUVDPDDQOLQHDUGXDYDULDEHODGDODKD[E\ F-LNDGLNHWDKXLSHUVDPDDQ


\ [EHUDSDNDKQLODLDEGDQF"-LNDGLNHWDKXLSHUVDPDDQ\ [EHUDSDNDKQLODLDE
GDQF"%DJDLPDQDNDKJUDN\DQJWHUEHQWXNGDULNHGXDSHUVDPDDQWHUVHEXW"

 

%DQJXQ

%DQJXQ

D6DOLQGDQOHQJNDSLWDEHOVDPSDLEDQJXQNHOLPD
E7XOLVNDQSHUVDPDDQXQWXNPHQHQWXNDQNHOLOLQJWLDSWLDSEDQJXQ
%DQ\DNVHJLOLPD










0$7(0$7,.$

tp

://



.HOLOLQJ

ht




%DQJXQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 3HUKDWLNDQNHWLJDEDQJXQ\DQJWHUEHQWXNGDULVHJLOLPDEHUWXUDQEHULNXW


.id

1. Periksalah apakah semua siswa sudah


mampu membedakan persamaan linear
dua variabel dan bukan persamaan
linear dua variabel, serta membuat
persamaan linear.
2. Mintalah siswa untuk melakukan
refleksi dan menuliskan hal penting dari
apa yang telah dipelajarinya.
MATEMATIKA

219

Alternatif
Jawaban
Alternatif pertama jawaban Latihan 1.1 soal No. 2
Pernyataan Zainul yang mengatakan bahwa

merupakan PLDV

adalah tidak benar. Menurut saya,

bukan merupakan PLDV,

meskipun persamaan tersebut bisa disederhanakan menjadi


dikarenakan bahwa

. Hal ini

sendiri tidak memiliki syarat dan ciri-ciri yang dimiliki

.id

PLDV. Pangkat variabel x dan y tidak sama dengan satu.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Alternatif kedua jawaban Latihan 1.1 soal No. 2


Pernyataan Zainul yang mengatakan bahwa

merupakan PLDV

adalah tidak benar. Menurut saya,

bukan merupakan PLDV,

meskipun persamaan tersebut bisa disederhanakan menjadi


jika persamaan mula-mula menjadi

. Perhatikan bahwa

salah satu selesaiannya adalah

Namun, syarat yang diberikan adalah

. Padahal, selesaiannya bisa jadi bilangan

bukan PLDV.

real dan sama. Jadi,

Alternatif ketiga jawaban Latihan 1.1 soal No. 2

merupakan PLDV

tp

://

Pernyataan Zainul yang mengatakan bahwa


adalah tidak benar. Menurut saya,

bukan merupakan PLDV,

ht

meskipun persamaan tersebut bisa disederhanakan menjadi


kedua ruas dengan menjadi

. Jika saya mengalikan


Dari persamaan
Sehingga, persamaan

220

, memiliki pangkat terbesar 2 untuk tiap variabel.


bukan PLDV.

Buku Guru Kelas VIII SMP/MTs

Semester 2

Membelajarkan 1.2
Menentukan Selesaian Persamaan Linear Dua Variabel

.id

Sediakan lembar kertas HVS untuk hasil kerja siswa. Minta mereka duduk dalam
kelompok kecil, 2 atau 3 orang. Ajak siswa mengingat kembali bagaimana membuat
persamaan linear dua variabel.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

6HOHVDLDQ3HUVDPDDQ
/LQHDU'XD9DULDEHO

.HJLDWDQ

0HQHQWXNDQ6HOHVDLDQ
3HUVDPDDQ/LQHDU'XD9DULDEHO

0DVDODK 
.RSHUDVL6HNRODK

Apersepsi

%X 5HWQR EHUWDQJJXQJ MDZDE DWDV NRSHUDVL


VHNRODK.RSHUDVLVHNRODKGLEXNDVHWLDSKDULGDQ
PHQMXDOVHJDODNHEXWXKDQVLVZD1DPXQNDUHQD
PHQJDMDU%X5HWQRWLGDNVHWLDSZDNWXPHQMDJD
NRSHUDVL VHNRODK 2OHK NDUHQD LWX %X 5HWQR
PHPEHUODNXNDQ6LVWHP.HMXMXUDQVHWLDSVLVZD
\DQJLQJLQPHPEHOLSHQVLOGDQSHQJKDSXV
6LVZDKDQ\DWLQJJDOPHOHWDNNDQXDQJQ\DNHGDODP
NRWDN NHMXMXUDQ \DQJ GLVHGLDNDQ 'L NRSHUDVL
VHNRODK KDUJD VHWLDS SHQVLO DGDODK 5S
GDQKDUJDVHWLDSSHQJKDSXV5S

*DPEDU.RSHUDVLVHNRODK

://

6XDWXKDUL%X5HWQRPHQGDSDWNDQ5SGDODPNRWDNNHMXMXUDQ%HOLDXPHUDVDNHELQJXQJDQ
NHWLNDPHQHQWXNDQKDUJDSHQVLOGDQSHQJKDSXV\DQJWHUMXDO6XSD\DOHELKPXGDK%X5HWQRPHPEXDW
GXDGDIWDUKDUJDVDWXXQWXNKDUJDSHQVLOGDQVDWXODJLXQWXNKDUJDSHQJKDSXV

%DQ\DN
3HQVLO


tp

7DEHO'DIWDUKDUJDSHQVLOGDQSHQJKDSXV

5S

%DQ\DN
3HQJKDSXV


5S

5S



ht

+DUJD

+DUJD
5S

5S

5S

5S

5S

5S

5S

5S

5S

5S

5S

5S

5S

.HODV9,,,60307V

Sebelum memulai
pembelajaran, ingatkan
siswa tentang fungsi dan
nilai fungsi, persamaan
garis lurus, dan definisi
persamaan linear dua
variabel. Ajak siswa untuk
membaca dan mencoba
menyelesaikan
Masalah 1.2 dan Minta
siswa membandingkan
jawaban temannya yang
berbeda-beda.

6HPHVWHU

MATEMATIKA

221

%X 5HWQR PHQJLUD EDKZD EDUDQJ \DQJ WHUMXDO DGDODK  SHQVLO GDQ  SHQJKDSXV $SDNDK DGD
NHPXQJNLQDQODLQQ\D"
'LKDUL\DQJODLQWHUGDSDW5SGDODPNRWDNNHMXMXUDQ%X5HWQRWLGDNGDSDWPHQHQWXNDQDSD
VDMD\DQJWHUMXDO%LVDNDKNDOLDQPHPEDQWX%X5HWQR"
1DKEDQ\DNSHQVLOGDQSHQJKDSXV\DQJNDOLDQWHQWXNDQPHUXSDNDQVHOHVDLDQSHUVDPDDQOLQHDUGXD
YDULDEHOMLNDPHQJKDVLONDQMXPODK\DQJVDPDGHQJDQMXPODKXDQJ\DQJDGDGDODPNRWDN
$OWHUQDWLI3HPHFDKDQ0DVDODK

Ayo
Kita Amati

0DVDODK\DQJGLKDGDSL%X5HWQRELVDGHQJDQPXGDKNLWDVHOHVDLNDQMLNDNLWDPHQJJDQWLQLODLEDQ\DN
SHQVLOGDQSHQJKDSXVNHSHUVDPDDQ\DQJNDOLDQEXDW
$\R
.LWD$PDWL
&REDSHUKDWLNDQEHQWXNSHUVDPDDQOLQHDUGXDYDULDEHOGDULPDVDODK.RSHUDVL6HNRODK\DQJGLKDGDSL
%X5HWQREHVHUWDVHOHVDLDQGDQEXNDQVHOHVDLDQQ\DSDGD7DEHOEHULNXW
7DEHO6HOHVDLDQGDQ%XNDQ6HOHVDLDQDWDV0DVDODK%X5HWQR
3HUVDPDDQ


VHEDE
    


VHEDE
     


VHEDE
    

Ayo Kita
Menanya

$\R.LWD
0HQDQ\D

%X5HWQRPDVLKEHOXPSXDVGHQJDQWDEHOKDUJD\DQJ
GLEXDWQ\D%X5HWQRPHQFREDEHUSLNLUEDJDLPDQD
FDUDQ\DXQWXNPHQGDSDWNDQVHPXDKDUJDSHUSDGXDQGDUL
SHQVLOGDQSHQJKDSXVGDODPVDWXGLDJUDP

0XQFXOLGH%X5HWQRXQWXNPHPEXDWGLDJUDPSHUSDGXDQ
KDUJD.DOLDQDPDWLEDJLDQGDULGLDJUDP\DQJGLEXDWROHK
%X5HWQRGLEDZDKLQL
'DULGLDJUDP\DQJGLEXDW%X5HWQR\DQJWHODKNDOLDQ
DPDWLFREDWXOLVNDQSHUWDQ\DDQ\DQJLQJLQNDOLDQNHWDKXL
MDZDEDQQ\D7XOLVSHUWDQ\DDQSDGDEXNXFDWDWDQNDOLDQ

'LDJUDP3HUSDGXDQ

















%DQ\DN3HQVLO

0$7(0$7,.$

://

Minta siswa untuk


memperhatikan
diagram perpaduan
untuk menyelesaikan
Masalah 1.2.
Minta siswa
untuk menuliskan
pertanyaan sebayakbanyaknya.

"

%DQ\DN3HQJKDSXV

&RQWRK%XNDQVHOHVDLDQ


VHEDE
     

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

SK 
SDGDODKEDQ\DNSHQVLOGDQ
KDGDODKEDQ\DNSHQJKDSXV
3HUVDPDDQGLDWDVPHPLOLNL
VHOHVDLDQ SK

&RQWRK6HOHVDLDQ

.id

Ajak siswa untuk


mengamati Tabel 1.4
yang berisi persamaan,
selesaian, dan bukan
selesaian.

ht

tp

Tunjuk 2-3 orang


siswa untuk
menyampaikan contoh
pertanyaan. Kemudian
saring pertanyaan
yang relevan dan
minta siswa lain untuk
mencoba menjawab.
Beri penguatan dan
ajak siswa untuk
melanjutkan kegiatan.
222

Buku Guru Kelas VIII SMP/MTs

Semester 2



$\R.LWD
0HQJJDOL,QIRUPDVL

6HEHOXPNDOLDQPHQJJDOLLQIRUPDVLVHEDLNQ\DSHUKDWLNDQFRQWRKVRDOEHULNXW
&RQWRK 
7HQWXNDQVHOHVDLDQGDUL[\ 
3HQ\HOHVDLDQ
[\ DGDODKSHUVDPDDQOLQHDUGHQJDQGXDYDULDEHO
 GDSDWMXJDGLVHEXWGHQJDQSHUVDPDDQJDULVOXUXV
 MDGLVHPXDWLWLNNRRUGLQDW\DQJEHUDGDSDGDJDULVWHUVHEXWPHUXSDNDQSHQ\HOHVDLDQQ\D
 0LVDO[ GDQ\  

.id

 0LVDO[ GDQ\  

&RQWRK 

3HQ\HOHVDLDQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

7HQWXNDQVHOHVDLDQGDUL[\ 

8QWXNPHQFDULQLODL[GDQ\\DQJPHPHQXKLSHUVDPDDQ[\ GDSDWGLWXOLVGDODPEHQWXN
WDEHOVHSHUWLEHULNXW
[





[\



















-DGLKLPSXQDQVHOHVDLDQSHUVDPDDQ[\ DGDODK^          `

.HODV9,,,60307V

6HPHVWHU

=+

tp

://

ht



Menggali
Informasi

Ajak siswa memperhatikan


contoh bagaimana
menentukan selesaian
suatu persamaan linear
variabel. Ajak siswa
untuk mengamati
kembali Masalah 1.2
dan menentukan harga
penjualan. Minta siswa
untuk menyelesaikan tugas
yang diminta.
MATEMATIKA

223

Ayo Kita
Menalar

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Kesimpulan ini digunakan


siswa sebagai bekal untuk
menyelesaikan sistem
persamaan linear dua
variabel.

.id

-LNDNDOLDQPHPSHUOXDVGLDJUDPVHSHUWLGLEDZDKLQLNDOLDQGDSDWPHQXQMXNNDQSHUSDGXDQKDUJD
SHQVLOGDQSHQJKDSXVOHELKEDQ\DNODJL


%DQ\DNQ\D3HQJKDSXV

Minta siswa untuk


menjawab pertanyaanpertanyaan yang diberikan.
Bimbing siswa untuk
menyimpulkan bahwa jika
banyak pensil sama dengan
banyak penghapus yang
terjual, maka berlaku juga
kelipatannya.






 











%DQ\DNQ\D3HQVLO

*DPEDU'LDJUDPSHUSDGXDQKDUJDSHQJKDSXVGDQSHQVLO

D 6DOLQGDQOHQJNDSLSHUVHJLEHUZDUQDSXWLKVHVXDLKDUJDGDULSHUSDGXDQSHQVLOGDQSHQJKDSXV
E /LQJNDULKDUJDWLJDSHQVLOGDQGXDSHQJKDSXV
$\R.LWD
0HQDODU

Ayo Kita
Berbagi

$\R.LWD
%HUEDJL

6DMLNDQ KDVLO SHQDODUDQ NDOLDQ GL GHSDQ NHODV 3HULNVD GDQ VHFDUD VDQWXQ VLODNDQ VDOLQJ PHPEHUL
NRPHQWDUGDQPHQDQJJDSLNRPHQWDUWHPDQPXGDQPHQ\HSDNDWLNDOLPDWNDOLPDW\DQJSDOLQJWHSDW

ht

tp

://

Setelah menyelesaikan
Ayo Kita Menalar, minta
siswa berdiskusi dengan
menyampaikan hasil
penalarannya di depan
kelas. Minta tiga atau empat
kelompok menuliskan hasil
diskusinya. Hasil tulisan
mereka dibandingkan dan
didiskusikan. Dengan
menuliskan di papan
tulis, akan terlihat adakah
perbedaan dan persamaan
pemikiran siswa.

 'DUL SHQJDODPDQ NDOLDQ PHQJJDOL LQIRUPDVL KDOKDO DSD VDMD \DQJ SHUOX GLSHUKDWLNDQ GDODP
PHQHQWXNDQVHOHVDLDQGDULVXDWXSHUVDPDDQOLQHDUGXDYDULDEHO"
 %HUDSDNDKEDQ\DNSHQVLOGDQSHQJKDSXVMLNDXDQJ\DQJGLSHUROHK5S"$GDNDKVHOHVDLDQ
ODLQ"
 %HUDSDNDK EDQ\DN SHQVLO GDQ SHQJKDSXV MLND XDQJ \DQJ GLSHUROHK 5S" $GDNDK
VHOHVDLDQODLQ"
 $SD\DQJGDSDWNDOLDQVLPSXONDQGDULSHUWDQ\DDQ GDQ "

224

Buku Guru Kelas VIII SMP/MTs

0$7(0$7,.$

Semester 2



"

/DWLKDQ 

 $PDWL NHPEDOL PDVDODK %X 5HWQR -LND GDODP NRWDN NHMXMXUDQ WHUGDSDW XDQJ 5S
EHUDSDEDQ\DNSHQVLOGDQSHQJKDSXV\DQJWHUMXDO"-HODVNDQEDJDLPDQDNDOLDQPHQHQWXNDQQ\D
 3HUKDWLNDQGLDORJEHULNXW


=DLQXO

6HKDUXVQ\DSHUVDPDDQ  [   \  WLGDNPHPLOLNLVHOHVDLDQ

(ULN

/KR[\ SXQ\DVHOHVDLDQPLVDOQ\D  

D 0HQJDSD=DLQXOPHQJDWDNDQLWXVHGDQJNDQ(ULNPHQJDWDNDQKDO\DQJODLQ"

E 1DKXQWXNVHPHVWD\DQJEDJDLPDQDNDKSHUQ\DWDDQ=DLQXOEHQDU"

 $SDNDK  [   \  PHPSXQ\DLVHOHVDLDQSDGDKLPSXQDQELODQJDQDVOL"6HEXWNDQDSDVDMD


VHOHVDLDQQ\D
 $SDNDK  [   \

 PHPSXQ\DLVHOHVDLDQSDGDKLPSXQDQELODQJDQDVOL"-HODVNDQ

 3HUKDWLNDQNHPEDOLEURVXUSHQDZDUDQGXDDJHQEXV3DGDGLDJUDPGLEDZDKLQLJXQDNDQZDUQD
\DQJEHUEHGDXQWXNPHOXNLVJUDNELD\D\DQJGLNHOXDUNDQGDQVLVZD*XQDNDQ
VDWXZDUQDXQWXNPHQXQMXNNDQ$JHQ%XV$QJNDVDGDQZDUQDODLQXQWXN$JHQ%XV*DODNVL


Sebagai tugas tambahan


yang wajib dikerjakan
siswa, soal Latihan 1.2 ini
bisa dijadikan pekerjaan
rumah atau sebagai tugas
akhir pekan.











D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

%LD\D GDODPSXOXKDQULEX



Latihan

.id

?!

Latihan 1.2 soal No. 5,


masih berkaitan dengan
masalah yang dialami
siswa untuk memilih
agen bus. Sehingga ada
keterkaitan antar topik
dalam materi ini.

       


%DQ\DNQ\D6LVZD

D 'DULJUDN\DQJWHODKNDPXEXDWNDSDQNDKNHGXDDJHQEXVPHPLOLNLELD\D\DQJVDPD"
E %HUDSDNDK EDWDV EDQ\DN VLVZD \DQJ PHQJLNXWL VWXGL ZLVDWD VXSD\D SHQDZDUDQ DJHQ EXV
$QJNDVDOHELKEDLN"-HODVNDQEDJDLPDQDNDPXPHQHQWXNDQQ\D
F %HUDSDNDK EDWDV EDQ\DN VLVZD \DQJ PHQJLNXWL VWXGL ZLVDWD VXSD\D SHQDZDUDQ DJHQ EXV
*DODNVLOHELKEDLN"-HODVNDQEDJDLPDQDNDPXPHQHQWXNDQQ\D

.HODV9,,,60307V

6HPHVWHU

ht

tp

://



1. Periksalah apakah semua siswa


sudah mampu menentukan selesaian
persamaan linear dua variabel.
2. Mintalah siswa untuk melakukan
refleksi dan menuliskan hal penting dari
apa yang telah dipelajarinya.
MATEMATIKA

225

Membelajarkan 1.3
Membuat Model Masalah dari
Sistem Persamaan Linear Dua Variabel

.id

Sediakan lembar kertas HVS untuk hasil kerja siswa.Minta mereka duduk dalam
kelompok kecil, 2 atau 3 orang. Ingatkan siswa bagaimana menentukan dan membuat
persamaan.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

6LVWHP3HUVDPDDQ
/LQHDU'XD9DULDEHO

0HPEXDW0RGHO0DVDODKGDUL
6LVWHP3HUVDPDDQ/LQHDU'XD9DULDEHO

.HJLDWDQ 

0DVDODK 

3HUKDWLNDQPDVDODKEHULNXWLQL1DZDGDQ5LQDPHPEHOLDODWWXOLVXQWXNPHUHNDVHQGLULGDQWHPDQ
WHPDQQ\D 0HUHND PHPEHOL GL WRNR \DQJ VDPD GDQ PHPEHOL EDUDQJ GHQJDQ PHUHN \DQJ VDPD
0DVDODKQ\DPHUHNDOXSDPHPLQWDVWUXNSHPEHOLDQ
$ODW7XOLV

Apersepsi

.HWHUDQJDQ

5S



ht

tp

://

Sebelum memulai
pembelajaran, ajak siswa
untuk membaca dan
mencoba menyelesaikan
Masalah 1.3 yang dialami
Nawa dan Rina.Tunjuk
beberapa siswa untuk
menduga jawaban dari
Masalah 1.3. Minta siswa
mencocokkan jawaban
yang mereka duga dengan
alternatif pemecahan
masalah yang diberikan.

5S

226

5LQDPHQJHOXDUNDQ
5SXQWXN
PHPEHOLHPSDWSDSDQ
SHQMHSLWGDQGHODSDQSHQVLO

1DZDPHQJHOXDUNDQ
5SXQWXN
PHPEHOLWLJDSDSDQ
SHQMHSLWGDQVHSXOXKSHQVLO

*XQDNDQJDPEDUJDPEDUGLDWDVXQWXNPHQMDZDEPDVDODKEHULNXW
 7DQSDPHQJHWDKXLKDUJDVHEXDKSDSDQSHQMHSLWDWDXSHQVLOGDSDWNDKNDOLDQPHQHQWXNDQEDUDQJ
PDQD\DQJOHELKPDKDO"-HODVNDQ
 %HUDSDKDUJDVHEXDKSHQVLO"-HODVNDQ

$OWHUQDWLI3HPHFDKDQ0DVDODK
8QWXN PHQ\HOHVDLNDQ PDVDODK WHUVHEXW 1DZD GDQ 5LQD PHPEXDW SHUVDPDDQ PDVLQJPDVLQJ
SHPEHOLDQPHUHND3HUVDPDDQ\DQJGLEXDW1DZDDGDODKMS GDQSHUVDPDDQ\DQJGLEXDW
5LQDDGDODKMS 
+XUXIMPHQXQMXNNDQKDUJDSDSDQSHQMHSLWGDQSPHQXQMXNNDQKDUJDSHQVLO

Buku Guru Kelas VIII SMP/MTs

0$7(0$7,.$

Semester 2



Minta siswa untuk melengkapi tabel yang disajikan


yang berkaitan dengan Masalah 1.3. Minta siswa untuk
menjawab pertanyaan dan minta mereka untuk membuat
kesimpulan.

$\R
.LWD$PDWL
8QWXN PHPEDQWX PHUHND OHQJNDSL WDEHO EHULNXW XQWXN WLDSWLDS SHUVDPDDQ VXSD\D OHELK PXGDK
PHQHQWXNDQKDUJDSDSDQGDQSHQVLO\DQJPHUHNDEHOL
S





















"

MS 

$\R.LWD
0HQDQ\D

7HUNDLWGHQJDQIRNXVSHQJDPDWDQGLDWDVFREDEXDWODKSHUWDQ\DDQ\DQJPHPXDWNDWDNDWDEHULNXW
SDSDQSHQMHSLWSHQVLOGDQKDUJDPDVLQJPDVLQJ
FDUDVLVWHPSHUVDPDDQOLQHDUGXDYDUHDEHO
7XOLVODKEHEHUDSDSHUWDQ\DDQSDGDEXNXWXOLVNDOLDQ

$\R.LWD
0HQJJDOL,QIRUPDVL

Arahkan dan beri


pancingan, Berapakah
banyaknya selesaian
yang sama berdasarkan
dua persamaan yang
dibuat Rina dan Nawa?,
Apakah mungkin jika
nilai j dan p berbeda?
Kesimpulan yang
diharapkan adalah,
memang benar bahwa
hanya satu selesaian
yang sama dari dua
persamaan. Jadi,
sistem persamaan
linear dua variabel
adalah suatu cara untuk
menyelesaikan dua buah
persamaan dua variabel
sedemikian sehingga
memiliki satu selesaian.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

MS 
M

=+

6HEHOXPNDOLDQPHQJJDOLLQIRUPDVLVHEDLNQ\DNDOLDQSHUKDWLNDQXUDLDQEHULNXW
&RQWRK 

://

7HQWXNDQVHOHVDLDQGDUL[\ GDQ[\ 


3HQ\HOHVDLDQ

tp

[\ GDQ[\ DGDODKVLVWHPSHUVDPDDQOLQHDUGXDYDULDEHO

ht

 -LND SHQJJDQWLSHQJDQWL GDUL NHGXD YDULDEHO GDSDW GLQ\DWDNDQ EHQDU PDND GDSDW GLNDWDNDQ
SHQ\HOHVDLDQGDULVLVWHPSHUVDPDDQWHUVHEXW
 9DULDEHOGDULPDVLQJPDVLQJSHUVDPDDQKDUXVVHMHQLV
 0LVDO[ GDQ\ 
[\
  



 [\
  
 
 %HQDU 




 6DODK

-DGLNDUHQDVDODKVDWXSHUVDPDDQPHQMDGLNDOLPDW\DQJVDODK0DND[ GDQ\ EXNDQ


SHQ\HOHVDLDQGDULVLVWHPSHUVDPDDQ[\ GDQ[\ 



.HODV9,,,60307V

Ayo Kita
Menanya

.id

Ayo
Kita Amati

6HPHVWHU

Ayo Kita
Menggali Informasi

Ajak siswa untuk


menentukan x3 + y3 dari
kegiatan sebelumnya
dengan menggantikan
nilai x dan y. Ajak siswa
untuk menggali informasi
tentang menentukan
selesaian dari dua
persamaan linear. Minta
siswa untuk menentukan
selesaian lain yang
mungkin supaya kedua
persamaan tersebut
menjadi benar saat
diganti nilai x dan nilai y.
MATEMATIKA

227

 0LVDO[ GDQ\ 


[\
[\
   
  




 %HQDU 





 %HQDU

-DGL NDUHQD NHGXD SHUVDPDDQ PHQMDGL NDOLPDW \DQJ EHQDU 0DND [   GDQ \   DGDODK
SHQ\HOHVDLDQGDULVLVWHPSHUVDPDDQ[\ GDQ[\ 
&DUDGLDWDVDGDODKVDODKVDWXFDUDXQWXNPHQHQWXNDQVHOHVDLDQGDULVLVWHPSHUVDPDDQOLQHDUGXD
YDULDEHO \DLWX  GHQJDQ PHQVXEVWLWXVLNDQ QLODL [ GDQ \ VHEDUDQJ SDGD GXD SHUVDPDDQ WHUVHEXW
6HKLQJJD DSDELOD NHGXD SHUVDPDDQ WHUVHEXW PHQMDGL NDOLPDW \DQJ EHQDU PDND QLODL [ GDQ \
DGDODKSHQ\HOHVDLDQGDULVLVWHPSHUVDPDDQOLQHDUWHUVHEXW&DUDVHSHUWLLQLPDVLKNXUDQJHIHNWLI
NDUHQDPDVLKEXWXKZDNWXXQWXNPHQHPXNDQQLODL[GDQ\\DQJPHUXSDNDQVHOHVDLDQ
6HNDUDQJFREDWHPXNDQFDUDODLQSDGDEXNXWHUWHQWXGLLQWHUQHWDWDXLQIRUPDVLODLQQ\D7HQWDQJ
FDUDPHQ\HOHVDLNDQ6LVWHP3HUVDPDDQ/LQHDU'XD9DULDEHO
$\R.LWD
0HQDODU

.id

%HUGDVDUNDQLQIRUPDVL\DQJNDOLDQGDSDWNDQPDNDWHUDSNDQODKSDGDVRDOEHULNXWLQL
  7HQWXNDQV\DUDWVHEXDKVLVWHPSHUVDPDDQOLQHDUGXDYDULDEHOPHPLOLNLVHOHVDLDQ
  7HQWXNDQSHQ\HOHVDLDQVLVWHPSHUVDPDDQGDUL [ \ GDQ[ \  
  *XQDNDQJDPEDUGLEDZDKLQLXQWXNPHQMDZDEPDVDODK

Ayo Kita
Menalar

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

D 7DQSDPHQJHWDKXLKDUJDVHEXDKNDFDPDWDDWDXFHODQDGDSDWNDKNDOLDQPHQHQWXNDQEDUDQJ
PDQD\DQJOHELKPDKDO"-HODVNDQ
E %HUDSDEDQ\DNFHODQD\DQJGDSDWGLEHOLMLNDNDOLDQPHPSXQ\DLXDQJ5S"
F %HUDSDKDUJDVHEXDKNDFDPDWD"-HODVNDQDODVDQPX

Minta siswa untuk menalar dengan menyelesaikan


masalah yang diberikan.

*DPEDU3HUEDQGLQJDQKDUJDGXDSDNHWNDFDPDWDGDQFHODQD

6WUDWHJLDSD\DQJNDOLDQJXQDNDQXQWXNPHQ\HOHVDLNDQNHWLJDPDVDODKGLDWDV"%HUDSDSHUVDPDDQ
\DQJWHUEHQWXNGDULGXDJDPEDUGLDWDV"

Ayo Kita
Berbagi

6DMLNDQ KDVLO SHQDODUDQ NDOLDQ GL GHSDQ NHODV 3HULNVD GDQ VHFDUD VDQWXQ VLODNDQ VDOLQJ PHPEHUL
NRPHQWDUGDQPHQDQJJDSLNRPHQWDUWHPDQPX

0$7(0$7,.$

ht

tp

://

Setelah menyelesaikan
kegiatan bernalar, minta
siswa berdiskusi dengan
menyampaikan hasil
penalarannya di depan
kelas. Instruksikan tiga
atau empat kelompok
menuliskan hasil
diskusinya. Hasil tulisan
mereka dibandingkan
dan didiskusikan.
Dengan menuliskan di
papan tulis, akan terlihat
adakah perbedaan dan
persamaan pemikiran
siswa.

$\R.LWD
%HUEDJL

228

Buku Guru Kelas VIII SMP/MTs

Semester 2



0DVDODK 
-LND GLNHWDKXL VLVWHP SHUVDPDDQ  [  \   GDQ [  \  
%DJDLDPDQDFDUDPHQHQWXNDQQLODL[\"-HODVNDQ
$OWHUQDWLI3HPHFDKDQ0DVDODK
8QWXNPHQ\HOHVDLDNDQSHUPDVDODKDQLQLNDOLDQVHEDLNQ\DPHPDKDPLWHUOHELKGDKXOXSHUPDVDODKDQ
\DQJVHGHUKDQDEHULNXWLQL
$\R
.LWD$PDWL
 'LNHWDKXLVLVWHPSHUVDPDDQ[\ GDQ[\ 7HQWXNDQQLODL[\

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

3HQ\HOHVDLDQ
8QWXNPHQ\HOHVDLNDQSHUVDPDDQWHUVHEXWLNXWLODKODQJNDKODQJNDKSHQ\HOHVDLDQEHULNXW
/DQJNDK,WXOLVODKSHUVDPDDQWHUVHEXWPHQMDGLSHUVDPDDQ  GDQ 
/DQJNDK,,MXPODKNDQNHGXDSHUVDPDDQWHUVHEXWGDQVHGHUKDQDNDQPLVDONDQSHUVHPDDQEDUX
WHUVHEXWDGDODKSHUVDPDDQ 
/DQJNDK,,,NXUDQJNDQNHGXDSHUVDPDDQWHUVHEXWGDQVHGHUKDQDNDQPLVDONDQSHUVHPDDQEDUX
WHUVHEXWDGDODKSHUVDPDDQ 
/DQJNDK,9GDULSHUVDPDDQ  GDQ  MXPODKNDQDWDXNXUDQJNDQVHKLQJJDGLNHWDKXLQLODL[GDQ
QLODL\Q\D
/DQJNDK9VHODQMXWQ\DQLODL[GDQ\VXEVLWXVLNDQNHEHQWXN[\
 'LNHWDKXLVLVWHPSHUVDPDDQ[\ GDQ[\ 
3HQ\HOHVDLDQ
/DNXNDQODQJNDKODQJNDKSHQ\HOHVDLDQVHSHUWLQRPRU

 'LNHWDKXLVLVWHPSHUVDPDDQ[\ GDQ[\ 

3HQ\HOHVDLDQ
/DNXNDQODQJNDKODQJNDKSHQ\HOHVDLDQVHSHUWLQRPRU
7XOLVODKSHQ\HOHVDLDQVRDOQRPRUGDQSDGDEXNXWXOLVOHPEDUNHUMDNDOLDQ

"

$\R.LWD
0HQDQ\D

7HUNDLWGHQJDQIRNXVSHQJDPDWDQGLDWDVFREDEXDWODKSHUWDQ\DDQ\DQJPHPXDWNDWDNDWDEHULNXW
 NRHYLVLHQ[GDQ\GLUXDVNLULGDQNRQVWDQWDGLUXDVNDQDQ
 FDUDGDQSHQ\HOHVDLDQ
7XOLVODKEHEHUDSDSHUWDQ\DDQSDGDEXNXWXOLVOHPEDUNHUMDNDOLDQ

Ajak siswa untuk mengamati penyelesaian masalah


dengan mengikuti langkah-langkah yang
diberikan.

6HPHVWHU

tp

://

.HODV9,,,60307V

ht



Ayo
Kita Amati

Ayo Kita
Menanya

Minta siswa untuk menanyakan dan menulis hal


yang ingin mereka ketahui dari mengamati dan
sedikit informasi. Diskusikan pertanyaan yang
telah diajukan siswa. Pilih
pertanyaan yang sesuai
dengan masalah.
MATEMATIKA

229

$\R.LWD
0HQJJDOL,QIRUPDVL

&REDNDOLDQJXQDNDQFDUDODLQXQWXNPHQHQWXNDQQLODL[\\DQJWHUGDSDWSDGDNHJLDWDQD\R
NLWDDPDWL
$JDU NDOLDQ PHQMDGL OHELK \DNLQ EDJDLPDQD FDUD PHQ\HOHVDLNDQ SDGD PDVDODK  FREDODK
PHPEXDWSHQ\HOHVDLDQVHEDJDLEHULNXWGDQOHQJNDSLODK
'LNHWDKXL
/DQJNDK,7XOLVODKSHUVDPDDQWHUVHEXWPHQMDGLSHUVDPDDQ  GDQ 
[\    

[\   
/DQJNDK,,-XPODKNDQNHGXDSHUVDPDDQWHUVHEXWGDQVHGHUKDQDNDQPLVDONDQSHUVHPDDQEDUX
WHUVHEXWDGDODKSHUVDPDDQ 
[\ 

[\ 
 DWDX    
/DQJNDK,,,.XUDQJNDQNHGXDSHUVDPDDQWHUVHEXWGDQVHGHUKDQDNDQPLVDONDQSHUVHPDDQEDUX
WHUVHEXWDGDODKSHUVDPDDQ 
[\ 
[\ 
 DWDX    

.id

Ayo Kita
Menggali Informasi

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

=+

Ajak siswa untuk menggali informasi dan memahami langkah-langkah


yang ditunjukkan di buku
siswa tentang bagaimana
menentukan x3 + y3 dari
kegiatan Ayo Kita Amati
sebelumnya.

/DQJNDK,9'DULSHUVDPDDQ  GDQ  MXPODKNDQDWDXNXUDQJNDQVHKLQJJDGLNHWDKXLQLODL[


GDQQLODL\Q\D
'DULSHUVDPDDQ  GDQ  GLGDSDW
 
 
 
DWDX[ 
VHKLQJJD\ 
/DQJNDK9 6HODQMXWQ\DQLODL[GDQ\VXEVLWXVLNDQNHEHQWXN[\
-DGL[\    

$\R.LWD
%HUEDJL

7XOLVNDQKDVLOGLVNXVLGLEXNXWXOLVNDOLDQNHPXGLDQWXNDUNDQGHQJDQWHPDQNDOLDQ\DQJODLQ
3DSDUNDQGLGHSDQNHODVGDQVLODNDQPHPEHULNRPHQWDUVHFDUDVDQWXQ

Ayo Kita
Berbagi

0$7(0$7,.$

ht

tp

://

Setelah menyelesaikan
kegiatan bernalar, minta
siswa berdiskusi dengan
menyampaikan hasil penalarannya di depan kelas.
instruksikan tiga atau empat kelompok menuliskan
hasil diskusinya. Hasil tulisan mereka dibandingkan
dan didiskusikan. Dengan
menuliskan di papan
tulis, akan terlihat adakah
perbedaan dan persamaan
pemikiran siswa.
230

Buku Guru Kelas VIII SMP/MTs

Semester 2



"

/DWLKDQ 

 6HWHODKSHUZDNLODQNHORPSRNPHQHQWXNDQDJHQEXVXQWXNPHQ\HZDEXVVHNDUDQJPHUHND
PHQLPEDQJ SDNHW KDUJD XQWXN ELD\D SHQJLQDSDQ GDQ WLNHW PDVXN PXVHXP .HGXD SDNHW
GLWXQMXNNDQVHSHUWLGLEDZDKLQL

0LVDONDQWHUGDSDWSHQDZDUDQVWXGLZLVDWDGDULDJHQZLVDWDODLQQ\D\DQJPHQDZDUNDQSDNHW
XQWXNELD\DKRWHOGDQWHPSDWZLVDWD



$NRPRGDVL
!3HQJLQDSDQPDODP
!7LNHW2EMHN:LVDWD

N
ITNN
2H4E14#0)
2'

<

!3HQJLQDSDQPDODP
!7LNHW2EMHN:LVDWD

2
2'41JFNTNNN
4#0)

 /LPDVDPSDQEHVDUGDQGXDVDPSDQNHFLOGDSDWPHQJDQJNXWRUDQJ

'XDVDPSDQEHVDUGDQVHEXDKVDPSDQNHFLOGDSDWPHQJDQJNXWRUDQJ
D 7XOLVODK GXD SHUVDPDDQ \DQJ PHQ\DWDNDQ LQIRUPDVL GL DWDV *XQDNDQ KXUXI E GDQ N
XQWXNYDULDEHO
 E 0HQXQMXNNDQDSDKXUXIEGDQNSDGDSHUVDPDDQ\DQJNDPXWXOLV"

 'DODPSHUVDPDDQSHUVDPDDQEHULNXWELODQJDQGDQGDSDWPHQ\DWDNDQSDQMDQJEHUDW
KDUJDDWDXDSDSXQ\DQJNDOLDQLQJLQNDQ

OP 

OP 

7XOLVODKVHEXDKFHULWD\DQJVHVXDLGHQJDQSHUVDPDDQGLDWDV
 6HEXDK SHUVHJL SDQMDQJ PHPLOLNL SDQMDQJ  FP OHELK GDUL  NDOL OHEDUQ\D -LND NHOLOLQJ
SHUVHJLSDQMDQJFPPDNDKLWXQJODKSDQMDQJGDQOHEDUSHUVHJLSDQMDQJWHUVHEXW

 -LNDGLNHWDKXLVLVWHPSHUVDPDDQOLQHDUGXDYDULDEHO[\ GDQ


[\ %DJDLDPDQDFDUDPHQHQWXNDQQLODL[\"-HODVNDQ

6HPHVWHU

Latihan

Sebagai tugas tambahan


yang wajib dikerjakan
siswa, soal Latihan 1.3
ini bisa dijadikan
pekerjaan rumah atau
sebagai tugas akhir
pekan. Soal latihan
ini berkaitan dengan
masalah yang dialami
siswa untuk memilih
agen bus. Sehingga ada
keterkaitan antar topik
dalam materi ini.

tp

://

.HODV9,,,60307V

ht



?!

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

D 7XOLV VHEXDK SHUVDPDDQ XQWXN 3DNHW ; GHQJDQ K PHQ\DWDNDQ ELD\D DNRPRGDVL KRWHO
VHWLDSPDODPGDQWPHQ\DWDNDQELD\DWLNHWPDVXNREMHNZLVDWD
E 7XOLV VHEXDK SHUVDPDDQ XQWXN 3DNHW < GHQJDQ K PHQ\DWDNDQ ELD\D DNRPRGDVL KRWHO
VHWLDSPDODPGDQWPHQ\DWDNDQELD\DWLNHWPDVXNREMHNZLVDWD

.id

3$.(7 $NRPRGDVL

1. Periksalah apakah semua siswa sudah


mampu membuat model matematika
terkait dengan persamaan linear
dua variabel serta menentukan
selesaiannya.
2. Mintalah siswa untuk melakukan
refleksi dan menuliskan hal penting
dari apa yang telah dipelajarinya.
MATEMATIKA

231

Membelajarkan 1.4

Menyelesaikan Masalah
yang berkaitan dengan
Sistem Persamaan linear Dua Variabel

Apersepsi

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Sebelum memulai pembelajaran, sampaikan bahwa persamaan linear dua variabel


sering dijumpai dalam masalah-masalah sehari-hari dan berkaitan erat dengan materi
perlajaran lain. Tanyakan kepada siswa, masalah apa saja yang terkait dengan PLDV
Ingatkan kembali bahwa persamaan linear dua variabel memiliki selesaian berupa
pasangan berurutan. Selain itu, ingatkan siswa dalam mensubstitusikan nilai variabel
pada persamaan.
3HQHUDSDQ
6LVWHP3HUVDPDDQ/LQHDU
'XD9DULDEHO

Ayo
Kita Amati

.HJLDWDQ

0DVDODK 

3DQMDQJ5DPEXW

6HNDUDQJSDQMDQJUDPEXW$\XQ\DQJEHUXPXUWDKXQDGDODK
PLOLPHWHU PP 'LDLQJLQPHQGXJDSDQMDQJUDPEXWQ\D
VDWXEXODQ.HPXGLDQGLDWDKXEDKZDUDPEXWDNDQEHUWDPEDK
SDQMDQJ  PP WLDS KDUL $GLNQ\D 1DGLD PHQ\DUDQNDQ
XQWXN PHPEXDW WDEHO XQWXN PHQJHWDKXL SDQMDQJ UDPEXWQ\D
VHWLDS  KDUL 1DPXQ $\XQ PHQJDWDNDQ EDKZD DGD VXDWX
SHUVDPDDQ\DQJPXGDKXQWXNPHQJHWDKXLSDQMDQJUDPEXWQ\D
VHWHODKVHNLDQKDUL
%HULNXWLQLKDOKDO\DQJGLODNXNDQ$\XQ
 0HPEXDWPRGHOSHUVDPDDQ
 0HQ\HOHVDLNDQPRGHOSHUVDPDDQ
 0HQDIVLUNDQKDVLOVHOHVDLDQ
 0HPHULNVDNHWHSDWDQVHOHVDLDQ

tp

://

Instruksikan siswa
untuk memperhatikan
masalah dan bagaimana
menyelesaikan masalah
Panjang Rambut.
Sampaikan bagaimana
membuat model
suatu masalah dan
menyelesaikannya.
minta siswa untuk
memperhatikan
masalah dan bagaimana
menyelesaikan
Masalah 1.5.
Sampaikan bagaimana
menyelesaikan masalah
PLDV
1. Membuat model.
2. Menyelesaiakan
model.
3. Menafsirkan
selesaian.
4. Memeriksa
ketepatan.

6XPEHU.HPGLNEXG

*DPEDU*DGLVEHUDPEXWSDQMDQJ

$OWHUQDWLI3HPHFDKDQ0DVDODK

ht

232

0HQ\HOHVDLNDQ0DVDODK
\DQJ%HUNDLWDQGHQJDQ
6LVWHP3HUVDPDDQ/LQHDU'XD9DULDEHO

$\R
.LWD$PDWL

%HULNXW\DQJGLODNXNDQ$\XQXQWXNPHPEXDWPRGHOSHUVDPDDQPHQJHQDLSDQMDQJUDPEXWQ\D
 0HPEXDWPRGHOSHUVDPDDQ
 3DQMDQJUDPEXWVD\DDGDODKGLNDOLNDQVHNLDQKDULGLWDPEDKGHQJDQSDQMDQJUDPEXWVD\D
VHNDUDQJ
 $\XQPHQXOLVVXDWXSHUVDPDDQ


Buku Guru Kelas VIII SMP/MTs



SDQMDQJUDPEXW MXPODKKDUL

0$7(0$7,.$

Semester 2



Ayo Kita
Menanya

 0HQ\HOHVDLNDQPRGHOSHUVDPDDQ
0DULD PHQ\HGHUKDQDNDQ SHUVDPDDQ \DQJ GLEXDW $\XQ GHQJDQ PHQJJXQDNDQ KXUXI VHEDJDL
YDULDEHO'LDPHQJJXQDNDQSVHEDJDLSHQJJDQWLSDQMDQJUDPEXWGDQKVHEDJDLSHQJJDQWLMXPODK
KDUL



.HWLND NDPX PHQJDOLNDQ VXDWX ELODQJDQ GHQJDQ YDULDEHO NDPX GDSDW PHQJKLODQJNDQ WDQGD
SHUNDOLDQ6HKLQJJDNDPXELVDPHULQJNDVSHUVDPDDQPHQMDGL



D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

S K

S K

 0HQDIVLUNDQKDVLOVHOHVDLDQ


6HNDUDQJ GHQJDQ SHUVDPDDQ \DQJ GLWXOLV PHUHND ELVD GHQJDQ PHXGDK PHQDIVLUNDQ SDQMDQJ
UDPEXW$\XQVDDWEXODQ0HUHNDPHODNXNDQSHQJKLWXQJDQEHULNXWLQL



.DUHQD\DQJGLXNXUDGDODKUDPEXW$\XQVHODPDEXODQ\DNQLKDULEHUDUWLK 6HKLQJJD



S   



S 



S 

-DGLSDQMDQJUDPEXW$\XQVHWHODKKDULDGDODKPP

.id

Minta siswa untuk


menjawab pertanyaan yang
diberikan. Bimbing siswa
untuk membedakan masalah
panjang rambut dan masalah
Nawa dan Rina.

S K

 0HPHULNVDNHWHSDWDQVHOHVDLDQ

8QWXN PHPHULNVD NHWHSDWDQ SHQDIVLUDQ PHUHND 0DULD PHQJHFHNQ\D GHQJDQ FDUD VHEDJDL
EHULNXW
$SDNDK EHQDU NDODX SDQMDQJ UDPEXW $\XQ  PP ZDNWX \DQJ GLEXWXKNDQ XQWXN
PHPDQMDQJNDQQ\DKDUL"
0DULDPHPLVDONDQS GDQPHQVXEVWLWXVLNDQQ\DNHGDODPSHUVDPDDQ


 K



 K

 K

 K

://




"

ht

tp

7HUQ\DWDEHQDUEDKZDODPD\DQJGLEXWXKNDQ$\XQXQWXNPHPDQMDQJNDQUDPEXWQ\DKLQJJD
PPDGDODKKDUL

$\R.LWD
0HQDQ\D

&REDEDQWX$\XQGDQ0DULDXQWXNPHQDNVLUODPD\DQJGLEXWXKNDQ$\XQPHPDQMDQJNDQUDPEXWQ\D
VDPSDLPP
0DVDODK3DQMDQJ5DPEXWVHSHUWLGLDWDVOHELKPXGDKGLVHOHVDLNDQGDULSDGDPDVDODK\DQJGLVHOHVDLNDQ
1DZDGDQ5LQDGL.HJLDWDQ$SDSHUEHGDDQPDVDODK3DQMDQJ5DPEXWGDQPDVDODK1DZDGDQ5LQD
\DQJWLGDNPHPLOLNLVWUXNEHODQMD"0DQDNDK\DQJOHELKHIHNWLIPHQJJXQDNDQGLDJUDPSHUSDGXDQ
GDQWDEHOKDUJD"
7XOLVODKSHUWDQ\DDQODLQ\DQJLQJLQNDOLDQNHWDKXLMDZDEDQQ\DSDGDEXNXWXOLVOHPEDUNHUMD



.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

233

$\R.LWD
0HQJJDOL,QIRUPDVL

'DODP 0DVDODK  NDOLDQ PHQGDSDWNDQ SHQJDODPDQ GDODP PHQXOLV SHUVDPDDQ OLQHDU GHQJDQ
GXD YDULDEHO XQWXN PHQJHNVSUHVLNDQ EHUEDJDL NRQGLVL PDVDODK GDQ PHQ\HOHVDLNDQ PDVDODK
GHQJDQ PHQHQWXNDQ QLODL VDODK VDWX YDULDEHO VDMD 7HUNDGDQJ WHUGDSDW PDVDODK PHOLEDWNDQ GXD
PRGHOSHUVDPDDQOLQHDU\DQJKDUXVGLVHOHVDLNDQVHFDUDEHUVDPDVDPD7XJDVNDOLDQDGDODKXQWXN
PHQHPXNDQVDWXSDVDQJDQ [\ GDULQLODLQLODL\DQJPHPHQXKLNHGXDSHUVDPDDQOLQHDU

D 3HQ\HOHVDLDQ VLVWHP SHUVDPDDQ OLQHDU GXD YDULDEHO GHQJDQ


PHQJJXQDNDQJUDNGDQVXEVWLWXVL
'DODP NHJLDWDQ LQL NDOLDQ DNDQ PHQJHPEDQJNDQ NHPDPSXDQ GDODP PHQXOLV PHQDIVLUNDQ GDQ
PHPHFDKNDQVLVWHPSHUVDPDDQOLQHDU
$GD EHEHUDSD PHWRGH \DQJ EHUEHGD XQWXN PHQ\HOHVDLNDQ VLVWHP SHUVDPDDQ OLQHDU GXD YDULDEHO
.HWLNDNDOLDQPHQ\HOHVDLNDQPDVDODKLQLNDOLDQDNDQPHQJJDOLLQIRUPDVLWHQWDQJMDZDEDQSHUWDQ\DDQ
EHULNXW
%DJDLPDQDJUDNGDQVXEVWLWXVLDOMDEDUGLJXQDNDQXQWXNPHPHFDKNDQVLVWHPSHUVDPDDQOLQHDUGXD
YDULDEHO"
8QWXNPHQMDZDESHUWDQ\DDQWHUVHEXWSHUKDWLNDQ&RQWRKEHULNXW

.id

6HWHODK NDOLDQ PHODNXNDQ NDJLDWDQ PHQJDPDWL GDQ PHPEXDW SHUWDQ\DDQ FRED SHUKDWLNDQ FRQWRK
VRDOEHULNXW

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

&RQWRK 

.HOLOLQJVHEXDKNHEXQ\DQJEHUEHQWXNSHUVHJLSDQMDQJDGDODKP6HOLVLKSDQMDQJGDQOHEDUNHEXQ
DGDODKP7HQWXNDQSDQMDQJGDQOHEDUNHEXQ"

=+

Menggali
Informasi

0DVDODK GDUL VLWXDVL &RQWRK  GDSDW GLVHOHVDLNDQ GHQJDQ PHPEXDW PRGHO SHUVDPDDQ GDQ
PHQ\HOHVDLNDQQ\D
0LVDONDQSDQMDQJSHUVHJLSDQMDQJ [GDQOHEDUQ\D \PDNDNDOLPDWPDWDNDWLNDQ\DDGDODK
.HOLOLQJNHEXQ\DQJEHUEHQWXNSHUVHJLSDQMDQJDGDODKPGDSDWGLEHQWXNSHUVDPDDQ


[\ 

6HOLVLKSDQMDQJGDQOHEDUNHEXQDGDODKPGDSDWGLEHQWXNSHUVDPDDQ


[\ 

'DODP %DE  VHPHVWHU  NDOLDQ WHODK PHPSHODMDUL EDKZD SHUVDPDDQ GDODP EHQWXN D[  E\  F
GLVHEXWSHUVDPDDQOLQHDUNDUHQDJUDNVHOHVDLDQPHUHNDDGDODKEHUXSDJDULVOXUXV*DPEDUGLEDZDK
PHQXQMXNNDQJUDNVHOHVDLDQXQWXNSHUVDPDDQ[\ GDQ[\ 
6HOHVDLDQGDULSHUVDPDDQ[\ 

0$7(0$7,.$

ht

tp

://

Ajak siswa untuk


memperhatikan cara lain
dalam menyelesaikan dua
persamaan linear yang
memiliki sebuah selesaian
yang memenuhi kedua
persamaan. Bimbing siswa
dalam menyelesaikan sistem
persamaan. Sampaikan
dua metode dalam
menyelesaikan sistem
persamaan, yakni substitusi
dan eliminasi. Ingatkan
terlebih dahulu tentang
grafik persamaan linear
di semester 1. Sampaikan
juga bahwa penyelesaian
sistem persamaan linear
dua variabel dapat
direpresentasikan dengan
titik potong dua garis yang
dibentuk.

$OWHUQDWLI
3HQ\HOHVDLDQ

234

Buku Guru Kelas VIII SMP/MTs

Semester 2























6HOHVDLDQGDULSHUVDPDDQ[\ 
[

















'DULNHGXDWDEHOVHOHVDLDQWHUGDSDWVHEXDKSDVDQJDQWHUXUXW [\ \DQJPHPHQXKLNHGXDSHUVDPDDQ


\DNQL  
\

.id



D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o





[\ 



[\ 













*DPEDU*UDNVHOHVDLDQ[\ GDQ[\ 

ht

tp

://

7LWLNSHUSRWRQJDQNHGXDJDULVPHUXSDNDQVHOHVDLDQGDULNHGXDSHUVDPDDQ\DNQL  
7HUGDSDWEDQ\DNNDVXV\DQJPXGDKXQWXNPHPHFDKNDQVLVWHPSHUVDPDDQOLQHDUGXDYDULDEHOWDQSD
NHVXOLWDQXQWXNPHQJKDVLONDQJUDNGDQPHPSHUNLUDNDQQLODLQLODL[GDQ\\DQJGLEXWXKNDQ6DODK
VDWXVWUDWHJLODLQDGDODKPHWRGHVXEVWLWXVL\DNQLPHQJJDEXQJNDQGXDSHUVDPDDQGXDYDULDEHONH
GDODPSHUVDPDDQWXQJJDOGHQJDQKDQ\DVDWXYDULDEHOGHQJDQPHQJJDQWLGDULVDWXSHUVDPDDQNH\DQJ
ODLQ



.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

235

/DQJNDK

0HQXOLVNDQPRGHONHGXDSHUVDPDDQ[\ GDQ[\ 

/DQJNDK

3HUVDPDDQ[\ GDSDWGLWXOLV[ \

/DQJNDK

6XEVLWXVLNDQSHUVDPDDQ[ \NHSHUVDPDDQ[\ 







 \ \
\\
\
\
\

/DQJNDK





0HQJJDQWLQLODL\\DNQL\ NHSHUVDPDDQ[ \


[ 
[ 













-DGLSDQMDQJNHEXQ\DQJGLPDNVXGDGDODKPGDQOHEDUQ\DP

E 3HQ\HOHVDLDQ VLVWHP SHUVDPDDQ OLQHDU GXD YDULDEHO GHQJDQ


PHQJJXQDNDQHOLPLQDVL

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

6WUDWHJL JUDN GDQ VXEVWLWXVL XQWXN SHQ\HOHVDLDQ VLVWHP SHUVDPDDQ OLQHDU GXD YDULDEHO PXGDK
GLJXQDNDQGDODPEHEHUDSDVLWXDVLQDPXQWLGDNSDGDVLWXDVLODLQQ\D0HWRGHJUDNPHPEXWXKNDQ
JDPEDUGDQSHQHQWXDQWLWLN\DQJFHUPDWGDQPXQJNLQPHPEHULNDQSHUNLUDDQKDQ\DVROXVL0HWRGH
VXEVWLWXVLSDOLQJPXGDKXQWXNPHPHFDKNDQVDWXYDULDEHO.HWLNDNDOLDQPHQ\HOHVDLNDQPDVDODKLQL
NDOLDQDNDQPHQJJDOLLQIRUPDVLWHQWDQJMDZDEDQSHUWDQ\DDQEHULNXW
%DJDLPDQDSHQJKDSXVDQYDULDEHOGLJXQDNDQXQWXNPHPHFDKNDQVLVWHPSHUVDPDDQOLQHDU"

3HUKDWLNDQ&RQWRKXQWXNPHQJHWDKXLSHQJJXQDDQPHWRGHHOLPLQDVLGDODPPHQHQWXNDQVHOHVDLDQ
VLVWHPSHUVDPDDQOLQHDUGXDYDULDEHO
&RQWRK 

+DUJDEXNXGDQSHQJJDULVDGDODK5S-LND0DKHUPHPEHOLEXNXGDQSHQJJDULV
PDNDLDKDUXVPHPED\DU5S%HUDSDNDKKDUJD\DQJKDUXVGLED\DUROHK6XFLMLNDLDPHPEHOL
EXNXGDQSHQJJDULV\DQJVDPD"
3HQ\HOHVDLDQ

0LVDONDQ[DGDODKKDUJDEXNXGDQ\DGDODKKDUJDSHQJJDULV
/DQJNDK

0HPEXDWVLVWHPSHUVDPDDQQ\D

+DUJDEXNXGDQSHQJJDULVDGDODK5SSHUVDPDDQQ\D[\ 

+DUJDEXNXGDQSHQJJDULVDGDODK5SSHUVDPDDQQ\D[\ 

/DQJNDK

0HQJHOLPLQDVLPHQJKLODQJNDQYDULDEHO\PDNDNRHVLHQYDULDEHO\KDUXVVDPD

__



[\

[\ 

__



[\





[







[ 

ht

tp

://

[\ 



0$7(0$7,.$

Ajak siswa untuk memahami Contoh 1.5 serta alternatif penyelesaiannya


dalam menentukan selesaian sistem persamaan liniear duavariable dengan
metode eliminasi.
236

Buku Guru Kelas VIII SMP/MTs

Semester 2



/DQJNDK

0HQJJDQWLNDQQLODL[NHVDODKVDWXSHUVDPDDQ

[\

  \



\



\



\



\



\



/DQJNDK



0HQJHFHNQLODL[GDQ\GDODPNHGXDSHUVDPDDQ
    

    







+DUJD%XNXDGDODK5SGDQKDUJDSHQJJDULVDGDODK5S

.id

.DUHQD6XFLLQJLQPHPEHOL%XNXGDQSHQJJDULVPDND

&RQWRK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

[\
   




-DGLXDQJ\DQJKDUXVGLED\DUROHK6XFLDGDODK5S

7RKLU PHPSXQ\DL XDQJ 5S 6HMXPODK XDQJ LWX DNDQ GLKDELVNDQ XQWXN PHPEHOL  EXDK
SHUDODWDQVHNRODK,DPHPEHOLEHEHUDSDEXNXGHQJDQKDUJD5SSHUEXNXGDQLDMXJDPHPEHOL
EHEHUDSDSHQVLOGHQJDQKDUJD5SSHUSHQVLO%HUDSDEDQ\DNSHQVLO\DQJGLEHOL7RKLU"
$OWHUQDWLI
3HQ\HOHVDLDQ

0LVDONDQEDQ\DNEXNXDGDODKEGDQEDQ\DNSHQVLODGDODKS ESDGDODKELODQJDQDVOL 
0DNDSHUVDPDDQPDWHPDWLNDGDULVRDOWHUVHEXWDGDODK
ES 

'LVHGHUKDQDNDQPHQMDGLEN GLPDQDES 

S 
S 
 S 


://

ES 
ES B
E 
E 
VHKLQJJDES 









ht

tp

-DGLEDQ\DNSHQVLO\DQJGLEHOL7RKLUDGDODK

.HODV9,,,60307V

6HPHVWHU

Ajak siswa untuk memahami Contoh 1.6 serta alternatif penyelesaiannya


dalam menentukan selesaian sistem persamaan liniear duavariable dengan
metode eliminasi.
MATEMATIKA

237

&RQWRK 
3HUKDWLNDQ*DPEDUEHULNXWLQL

C
D

%DQJXQ$%&'()*DGDODKPHQXQMXNNDQNHDGDDQVHEXDKNDPDU.HDGDDQ\DQJVHEHQDUQ\D$' 
'($% PHWHUGDQ() PHWHUVHUWDOXDVNDPDUP-LNDVHEXDKSHQ\HNDWGLEXDWGDUL

.id

(VDPSDL&\DQJPHPEDJLOXDVNDPDUPHQMDGLGXDEDJLDQ\DQJVDPDOXDVPDNDMDUDNGDUL&NH*
DGDODK

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

$OWHUQDWLI
3HQ\HOHVDLDQ

28 m

C
H

18 m

/XDVNDPDUVHOXUXKQ\D P
.DUHQDOXDVQ\DPHPEDJLGXDPDNDOXDV$%&(' PGDQOXDV&()* P
3HUKDWLNDQNHPEDOLLOXVWUDVLJDPEDUGLDWDV


$' '( +%(+ )*

$% '+  '((+

$% $'(+

$'(+  

ht

tp

://

/XDVNDPDUVHOXUXKQ\D OXDV$%+'/XDV()*+
 
 $%$'())*
 
 $')*
 
 $'(+


0$7(0$7,.$

Ajak siswa untuk memahami Contoh 1.7 serta alternatif penyelesaiannya


dalam menentukan selesaian sistem persamaan liniear duavariable dengan
metode eliminasi.
238

Buku Guru Kelas VIII SMP/MTs

Semester 2



Ayo Kita
Menalar

$'(+ 

$'(+ _ $'(+ 

$'(+ 
$'(+
_
 


 
 

 


 
 

 


 
 

'HQJDQGHPLNLDQ3HUKDWLNDQWUDSHVLXP()*&

/XDVWUDSHVLXP()*&





&*() )*


 &*() ()


 &* 



D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

/XDVWUDSHVLXP()*&

$'(+ 
 

$' 

$'
 (+ 

Bimbing siswa untuk


menyimpulkan bahwa
strategi yang diakukan Lisa
adalah apa yang dikatakan
eliminasi.



 &* 
 

&*
 
&*

-DGLMDUDNGDUL&NH*DGDODKP
$\R.LWD
0HQDODU

.id

'DULSHUVDPDDQ  GDQ  GLSHUROHK

Minta siswa untuk


menjelaskan strategi
yang digunakan Lisa.
Bimbing siswa dengan
beberapa pertanyaan
pancingan. Bagaimana
Lisa mendapatkan sebuah
lilin panjang dan sebuah
lilin pendeh seharga
Rp8.100? Mengapa
Lisa mendapatkan tiga
lilin panjang dan tiga lilin
pendek?

1DKVHNDUDQJSHUKDWLNDQVWUDWHJL\DQJGLJXQDNDQ/LVDXQWXNPHQHQWXNDQKDUJDPDVLQJPDVLQJ
OLOLQ
5S



/LVD



5S



5S



5S



5S



5S



://

5S

tp

*DPEDU 3HQDODUDQ/LVDXQWXN0HQ\HOHVDLNDQ
0DVDODK3HPEHOLDQ/LOLQ

ht

-HODVNDQVWUDWHJL\DQJGLJXQDNDQ/LVDXQWXNPHQHQWXNDQKDUJDVHEXDKOLOLQNXQLQJGDQVHEXDKOLOLQSXWLK
$\R.LWD
%HUEDJL

6DMLNDQ KDVLO SHQDODUDQ NDOLDQ GL GHSDQ NHODV 3HULNVD GDQ VHFDUD VDQWXQ VLODNDQ VDOLQJ PHPEHUL
NRPHQWDUGDQPHQDQJJDSLNRPHQWDUWHPDQPX



.HODV9,,,60307V

6HPHVWHU

Ayo Kita
Berbagi

Setelah menyelesaikan
kegiatan bernalar, minta
siswa berdiskusi dengan
menyampaikan hasil
penalarannya di depan kelas.
instruksikan tiga atau empat
kelompok menuliskan hasil
diskusinya. Hasil tulisan
mereka dibandingkan dan
didiskusikan. Dengan
menuliskan di papan
tulis, akan terlihat adakah
perbedaan dan persamaan
pemikiran siswa.
MATEMATIKA

239

"

Latihan

 $QGUHPHPED\DU5SXQWXNWLJDLNDWEXQJDVHGDSPDODPGDQHPSDWLNDWEXQJD
DVWHU6HGDQJNDQ5LPDPHPED\DU5SXQWXNGXDLNDWEXQJDVHGDSPDODPGDQOLPD
LNDWEXQJDDVWHUGLWRNREXQJD\DQJVDPDGHQJDQ$QGUH
D 7XOLVSHUVDPDDQ\DQJPHQ\DWDNDQLQIRUPDVLGLDWDV
E 7XOLVVHEXDKSHUVDPDDQ\DQJPHQXQMXNNDQKDUJDVHLNDWEXQJDVHGDSPDODPGDQHQDP
LNDWEXQJDDVWHU
F 7HPXNDQKDUJDVHLNDWEXQJDVHGDSPDODPGDQVHLNDWEXQJDDVWHU
 7LJD7VKLUWGDQHPSDWWRSLGLMXDOVHKDUJD5S'XD7VKLUWGDQOLPDWRSLGLMXDO
5S%HUDSDNDKKDUJDVHWLDS7VKLUW"%HUDSDNDKKDUJDVHWLDSWRSL"

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Sebagai tugas tambahan


yang wajib dikerjakan siswa,
soal Latihan 1.4 ini bisa
dijadikan pekerjaan rumah
atau sebagai tugas akhir
pekan. Soal Latihan 1.4 ini
berkaitan dengan masalah
yang dialami siswa untuk
memilih agen bus. Sehingga
ada keterkaitan antar topik
dalam materi ini.

/DWLKDQ 

.id

?!

 0DUOLQDPHPEHOLGXDJHODVVXVXGDQGXDGRQDWGHQJDQWRWDOKDUJD5S6HGDQJNDQ
=HQLPHPEHOLHPSDWJHODVVXVXGDQWLJDGRQDWGHQJDQWRWDOKDUJD5S7HQWXNDQ
KDUJDVHJHODVVXVX
 6XDWX\D\DVDQPHQ\XPEDQJNDQEXNXNHVHNRODK%DQ\DNEXNX\DQJGLWHULPDXQWXN
VHWLDSVHNRODKWLGDNVDPD6HOLVLKEXNX\DQJGLWHULPDVHNRODK$GDQ%DGDODK6HOLVLK
EXNX\DQJGLWHULPDVHNRODK%GDQ&DGDODK6HOLVLKEXNX\DQJGLWHULPDVHNRODK&GDQ
' DGDODK  6HNRODK$ PHQHULPD EXNX SDOLQJ VHGLNLW GLEDQGLQJNDQ GHQJDQ \DQJ GLWHULPD
VHNRODKODLQ-LNDVHNRODK'PHQHULPDEXNXNDOLOHELKEDQ\DNGDULSDGDEXNX\DQJGLWHULPD
VHNRODK$WHQWXNDQEDQ\DNEXNX\DQJGLWHULPDPDVLQJPDVLQJVHNRODK

tp

://

0$7(0$7,.$

ht

1. Periksalah apakah semua


siswa sudah mampu
mengidentifikasi dan
menyelesaikan masalah sistem
persamaan linear dua variabel
dengan berbagai metode.
2. Mintalah siswa untuk
melakukan refleksi dan
menuliskan hal penting dari
apa yang telah dipelajarinya.
240

Buku Guru Kelas VIII SMP/MTs

Semester 2



7XJDV
3URMHN

Tugas
Projek

0HODNXNDQ3HUFREDDQ$LU\DQJWHUEXDQJVLDVLD
'L EHUEDJDL VLWXDVL SROD GDQ
SHUVDPDDQ PHQMDGL WHUOLKDW NHWLND
GDWDWHODKGLNXPSXONDQGLRODKGDQ
GLVDMLNDQ .DOLDQ DNDQ PHODNXNDQ
SHUFREDDQ VHFDUD EHUNHORPSRN
6HWLDSNHORPSRNWHUGLULDWDVRUDQJ

%HUDSDEDQ\DN$LU
\DQJWHUEXDQJ

"

.id

'DODP SHUFREDDQ LQL NDOLDQ DNDQ


PHQ\LPXODVLNDQ VHEXDK NUDQ \DQJ
ERFRU GDQ PHQJXPSXONDQ GDWD
YROXPH DLU \DQJ WHUEXDQJ VHWLDS 
GHWLN .DOLDQ DNDQ PHQJJXQDNDQ
GDWD WHUVHEXW XQWXN PHPSUHGLNVL
VHEHUDSDEDQ\DNDLU\DQJWHUEXDQJNHWLNDNUDQPHQJDODPLNHERFRUDQVHODPDVDWXEXODQ%DFDODK
SHWXQMXNVHFDUDVHNVDPDVHEHOXPPHPXODLSHUFREDDQ6DMLNDQKDVLOWHPXDQPXGLNHODV

EXDKJHODVSODVWLN
*HODVXNXU EHUEHQWXNVLOLQGHU
$LU


-DPWDQJDQDWDXVWRSZDWFK
3DNX

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

$ODWGDQ%DKDQ






*HODV8NXU

3DNX

6WRSZDWFK

6HPHVWHU

tp

://

.HODV9,,,60307V

*HODV3ODVWLN

Minta siswa mengumpulkan


tugas Projek ini dalam
bentuk artikel, baik berupa
paper atau makalah yang
bisa disajikan di majalah
sekolah atau mading
sekolah.

ht



Minta siswa mengerjakan


Tugas Projek 1 yang
dikumpulkan satu
minggu setelah semua
kegiatan pembelajaran
materi persamaan linear
dua variabel ini selesai.
Kelompokkan siswa menjadi
beberapa kelompok yang
setiap kelompok terdiri atas
4 orang.
Tanyakan kepada siswa
apakah alat dan bahan yang
diminta dalam Projek ini
susah didapat. Pinjamkan
gelas ukur (gelas beker)
dari sekolah untuk siswa
yang tidak memiliki gelas
ukur (kalau ada, gelas untuk
mengukur bahan makanan)
di rumah.

MATEMATIKA

241

3HWXQMXN
%DJLWXJDVXQWXNWLDSWLDSDQJJRWDNHORPSRNPX
 %XDWODKWDEHOXQWXNPHQFDWDWZDNWXGDQMXPODKDLU\DQJWHUEXDQJ,VLODKNRORPZDNWXGDUL
GHWLNVDPSDLGHWLNGHQJDQLQWHUYDOGHWLN PDNVXGQ\DGDQVHWHUXVQ\D 
:DNWX GHWLN























-XPODK
$LU\DQJ
WHUEXDQJ PO

.id

*XQDNDQSDNXXQWXNPHOXEDQJLEDJLDQGDVDUJHODVSODVWLN7XWXSLOXEDQJGHQJDQMDULPX
,VLODKJHODVSODVWLNGHQJDQDLU
6LDSNDQJHODVXNXUGDQOHWDNNDQGLEDZDKJHODVSODVWLN\DQJNDOLDQSHJDQJ
6HWHODKVLDSXQWXNPXODLPHQJXNXUZDNWXOHSDVNDQMDULNDOLDQGDULOXEDQJJHODVSODVWLNVHKLQJJD
DLUPHQHWHVNHGDODPJHODVXNXU VLPXODVLNUDQERFRU 
 &DWDWMXPODKDLUGDODPJHODVXNXUVHWLDSGHWLNVHODPDVDWXPHQLW

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o






*XQDNDQSHUFREDDQLQLXQWXNPHQXOLVVHEXDKSRVWHUPHQFREDPH\DNLQNDQRUDQJXQWXNPHQJKHPDW
DLU
3RVWHU\DQJNDOLDQEXDWKDUXVPHQFDNXSLQIRUPDVLEHULNXW
 *UDNGDWD\DQJNDOLDQFDWDW


3HUVDPDDQ/LQHDU\DQJWHEHQWXNEHVHUWDSHQMHODVDQYDULDEHO\DQJNDOLDQPDNVXG
'DWD\DQJPHQXQMXNNDQSUHGLNVLNDOLDQXQWXN

-XPODKDLU\DQJWHUEXDQJVLDVLDVHODPDGHWLNPHQLWPHQLWGDQPHQLWVHDQGDLQ\DDLU
NUDQ\DQJERFRUPHPLOLNLODMX\DQJVDPDVHSHUWLJHODVSODVWLNNDOLDQ

-HODVNDQEDJDLPDQDNDOLDQPHPEXDWSUHGLNVL$SDNDKNDOLDQPHQJJXQDNDQWDEHOJUDNDWDX
PHWRGHODLQ"

3HQMHODVDQWHQWDQJEHUDSDEDQ\DNDLU\DQJWHUEXDQJVLDVLDGDODPVDWXEXODQMLNDNUDQDLU\DQJ
ERFRUPHPLOLNLODMXVHSHUWLOXEDQJJHODVSODVWLN-HODVNDQEDJDLPDQDNDOLDQPHPEXDWSUHGLNVL

%LD\D DLU \DQJ WHUEXDQJ VLDVLD GDODP VDWX EXODQ XQWXN PHQ\HOHVDLNDQ LQL NDOLDQ KDUXV
PHQJHWDKXL EHUDSD ELD\D DLU GL GDHUDK NDOLDQ PDVLQJPDVLQJ .HPXGLDQ JXQDNDQ LQIRUPDVL
WHUVHEXWXQWXNPHQJKLWXQJELD\DDLU\DQJWHUEXDQJVLDVLD 

ht

tp

://

0$7(0$7,.$

242

Buku Guru Kelas VIII SMP/MTs



Semester 2

0HUDQJNXP

.DOLDQ WHODK PHPSHODMDUL FLULFLUL SHUVDPDDQ OLQHDU GXD YDULDEHO PHQHQWXNDQ QLODL YDULDEHO
PHQHQWXNDQSDVDQJDQ EHUXUXWVHEDJDL VHOHVDLDQGDUL SHUVDPDDQOLQHDU GXDYDULDEHOGDQVLVWHP
SHUVDPDDQOLQHDUGXDYDULDEHOVHUWDPHPEXDWPRGHOGDQPHQ\HOHVDLNDQPDVDODK\DQJEHUNDLWDQ
GHQJDQSHUVDPDDQOLQHDUGXDYDULDEHO3HUWDQ\DDQEHULNXWDNDQPHPEDQWXNDOLDQXQWXNPHUDQJNXP
DSD\DQJWHODKNDOLDQSHODMDUL

.id

6HPHVWHU

tp

://

.HODV9,,,60307V

Minta siswa untuk


menjawab pertanyaan di
kegiatan Merangkum 1.
Minta siswa menulis
jawaban di buku catatan
mereka atau buku siswa
yang mereka miliki.
Beri kebebasan kepada
siswa untuk menuliskan
hal penting lain selama
kegiatan. Jawab pertanyaanpertanyaan siswa yang
mungkin relevan dengan
kegiatan merangkum.

ht



Merangkum

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 $SD\DQJNDPXNHWDKXLWHQWDQJSHUVDPDDQOLQHDUGXDYDULDEHO"
 3URVHGXUDSDVDMD\DQJNDOLDQODNXNDQNHWLNDPHPEXDWSHUVDPDDQOLQHDUGXDYDULDEHO"
 $SD \DQJ NDOLDQ EXWXKNDQ NHWLND PHPEXDW WDEHO XQWXN PHQHQWXNDQ VHOHVDLDQ SHUVDPDDQ
OLQHDUGXDYDULDEHO"
 %DJDLPDQD GLDJUDP SHUSDGXDQ KDUJD PHPEDQWX NDOLDQ XQWXN PHQHQWXNDQ VHOHVDLDQ
SHUVDPDDQOLQHDUGXDYDULDEHO"
 %DJDLPDQDJUDNGDSDWPHPEDQWXNDOLDQXQWXNPHQHQWXNDQVHOHVDLDQSHUVDPDDQOLQHDUGXD
YDULDEHO"
 $SD\DQJNDPXNHWDKXLWHQWDQJVLVWHPSHUVDPDDQOLQHDUGXDYDULDEHO"
 3URVHGXUDSDVDMD\DQJNDOLDQODNXNDQNHWLNDPHQ\HOHVDLNDQVLVWHPSHUVDPDDQOLQHDUGXD
YDULDEHO"
 'DODPKDODSDNDKVLVWHPSHUVDPDDQOLQHDUGXDYDULDEHOEHUPDQIDDW"
 7RSLN DWDX PDWHUL DSD VDMD \DQJ EHUNDLWDQ HUDW GHQJDQ PDWHUL 3HUVDPDDQ /LQHDU 'XD
9DULDEHO"

MATEMATIKA

243

"

8ML
.RPSHWHQVL

 6HOHVDLNDQVRDOEHULNXWGHQJDQEHQDU
 7HQWXNDQSHUVDPDDQVHWLDSJUDNEHULNXW
 D 



E



[




 



[


F



 






[




 



-HQGHOD

FP

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id


 $QGLGDQ'LDQVHGDQJPHQDWDXODQJUXDQJ26,60HUHNDLQJLQPHOHWDNNDQOHPDULGLVHSDQMDQJ
VDODKVDWXGLQGLQJUXDQJDQ0HUHNDPXODLPHQJXNXUUXDQJGDQPHQJJDPEDUEDJDQ
FP

3LQWX

$QGLGDQ'LDQPHQJHFHNOHPDUL\DQJDGDGLWRNROHPDULWHUGLULGXDXNXUDQ\DQJEHUEHGD
\DLWXFPGDQFP
D 7HQWXNDQSHUVDPDDQOLQHDUGXDYDULDEHO\DQJWHUEHQWXN
E %HUDSD EDQ\DN OHPDUL \DQJ DNDQ GLSHVDQ$QGL GDQ 'LDQ VXSD\D WHSDW GLWHPSDWNDQ GL
VHSDQMDQJGLQGLQJ\DQJEHUXNXUDQFP"&REDODKWHPXNDQOHELKGDULVDWXNHPXQJNLQDQ
MDZDEDQ


 /HQJNDSLSDVDQJDQWHUXUXWXQWXNWLDSWLDSSHUVDPDDQ
D \

 [    

E \


F  [   \      


G  [   \

=+

 [   

 


0$7(0$7,.$

ht

tp

://

Uji
Kompetensi

Gunakan Uji Kompetensi 1


untuk menilai kemampuan
siswa pada pembelajaran
sebelumnya.Suruh siswa
untuk melihat kembali
pelajaran sebelumnya.
244

Buku Guru Kelas VIII SMP/MTs

Semester 2



       
/DPD0HQDEXQJ %XODQ









       
/DPD0HQDEXQJ %XODQ









.id

G7DNVDWXSXQ\DQJEHQDU

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

-XPODK7DEXQJDQ 5S

F

-XPODK7DEXQJDQ 5S









       
/DPD0HQDEXQJ %XODQ

 .HODV 9,,, $ PHQJXPSXONDQ XDQJ


DPDOXQWXNPHPEDQWXNRUEDQEHQFDQD
DODP0HUHNDPHQJJXQDNDQXDQJDPDO
XQWXN PHPEHOL SHUOHQJNDSDQ VHNRODK
EDJL DQDNDQDN \DQJ PHQMDGL NRUEDQ
EHQFDQD$OEHUWXVPHQJJXQDNDQJUDN
XQWXN PHQJHWDKXL MXPODK XDQJ DPDO
WLDSDNKLUSHNDQ
  

/DSRUDQ.HXDQJDQ.HODV9,,,$





-XPODK$PDO 5S

-XPODK7DEXQJDQ 5S

 3LOLKDQ*DQGD
 0XKDOLPDNDQSHUJLNH0DNDVVDUWDKXQGHSDQXQWXNPHQJLNXWLSDZDLGUXPEDQGVHNRODKQ\D
'LD EHUHQFDQD PHQ\LVLKNDQ 5S GDUL XDQJ EXODQDQQ\D SDGD VHWLDS DNKLU EXODQ
XQWXNSHUMDODQDQQDQ\D3LOLKODKJUDN\DQJPHQXQMXNNDQEDJDLPDQDWDEXQJDQ0XKDOLPDNDQ
WHUEHQWXNVHODPDVHODQJZDNWXWHUWHQWX
E
D









tp

.HODV9,,,60307V

ht



://





 

   
0LQJJXNH



 

6HPHVWHU

=+

Uji
Kompetensi

Uji Kompetensi 1 soal No. 8 merupakan soal yang


berhubungan dengan pola yang telah di pelajari
siswa di kelas VII maupun yang akan dipelajari
siswa di kelas IX. Selain itu, ajak siswa untuk
berpikir sebagaimana seorang perancang jembatan
memilih model yang lebih baik.
MATEMATIKA

245

D ,QIRUPDVLDSD\DQJGLWXQMXNNDQROHKJUDNWHQWDQJODSRUDQNHXDQJDQGLNHODV9,,,$"
E %XDWWDEHOGDWDXQWXNPLQJJXSHUWDPD-HODVNDQPHQJDSDWDEHOPHQXQMXNNDQKXEXQJDQ
\DQJOLQHDU
F 7XOLVNDQ VXDWX SHUVDPDDQ \DQJ PHQXQMXNNDQ KXEXQJDQ OLQHDU GDUL ODSRUDQ NHXDQJDQ
NHODV9,,,$-HODVNDQPDNQDYDULDEHOGDQELODQJDQELODQJDQSDGDSHUVDPDDQ\DQJNDPX
EXDW
G %DJDLPDQD NDOLDQ PHQHQWXNDQ MLND JUDN WDEHO GDQ SHUVDPDDQ GDUL ODSRUDQ NHXDQJDQ
.HODV9,,,$DGDODKOLQHDU"

.id


 +DGL PHPEHOL GXD 7VKLUW GDQ VHEXDK VZHDWHU GL SDVDU GHQJDQ WRWDO KDUJD 5S
.HWLNDVDPSDLGLUXPDKGLDPHQ\HVDONDUHQDVDODKVDWX7VKLUW\DQJGLDEHOLMDKLWDQQ\DUXVDN
'LDPHPXWXVNDQXQWXNPHQXNDUVDWX7VKLUWXQWXNVHEXDKVZHDWHU
D $NKLUQ\D +DGL PHQXNDUNDQ 7VKLUWQ\D QDPXQ GLD KDUXV PHPED\DU 5S ODJL
NDUHQDVZHDWHUOHELKPDKDOGDULSDGD7VKLUW
E %HUDSDNDKKDUJDPDVLQJPDVLQJEDUDQJ\DQJGLEHOL+DGL"-HODVNDQDODVDQPX

ht

tp

://

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 0DODPLQLVHEXDKOPDQLPDVLWHUEDUXVHGDQJGLSXWDUGLVHEXDKELRVNRS%HEHUDSDRUDQJ
GHZDVDGDQDQDNDQDNVHGDQJPHQJDQWULPHPEHOLWLNHW
D %HUDSDUXSLDKELD\DWLNHW\DQJDNDQGLWDJLKROHKSHWXJDVSHQMXDODQWLNHWSDGDJDPEDU
NHWLJD"
E %HUDSDUXSLDK\DQJDNDQNDOLDQED\DUMLNDNDPXSHUJLPHQRQWRQOPGLELRVNRS"


0$7(0$7,.$

246

Buku Guru Kelas VIII SMP/MTs



Semester 2

 %DKDUXGGLQPHPEXDWPRGHOMHPEDWDQGDULEDWDQJND\X.HWLNDPHPEDQJXQMHPEDWDQGLD
PHPLOLNLLGHGHQJDQPHPEXDWSRODVHJLWLJDVHSHUWLGLEDZDKLQL%DQ\DNQ\DEDWDQJND\X
EHUJDQWXQJSDGDEDQ\DNQ\DEDWDQJND\X\DQJEHUDGDGLEDJLDQEDZDK

%DWDQJND\XEDJLDQEDZDK 

%DQ\DNEDWDQJND\XNHVHOXUXKDQ 
D 6DOLQGDQOHQJNDSLWDEHOEHULNXW




%DWDQJND\XEDJLDQEDZDK 
%DQ\DNEDWDQJND\XNHVHOXUXKDQ 

-HPEDWDQ.D\X

%DQ\DN
EDWDQJND\X
NHVHOXUXKDQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

%DWDQJND\X
EDJLDQEDZDK

.id











E 7XOLVNDQSHUVDPDDQ\DQJPHQJKXEXQJNDQEDQ\DNND\XNHVHOXUXKDQWGHQJDQEDQ\DN
ND\XEDJLDQEDZDKE-HODVNDQEDJDLPDQDNDOLDQPHPSHUROHKSHUVDPDDQ
F $SD\DQJNDOLDQNHWDKXLWHQWDQJVLIDWVHJLWLJDGDQSHUVHJLSDQMDQJ\DQJPHPEXDWPRGHO
GLDWDVOHELKEDLNGDULSDGDPRGHOMHPEDWDQGLEDZDK

tp

://


 +DGLPHPEHOLGXD7VKLUWGDQVHEXDKVZHDWHUGLSDVDUGHQJDQWRWDOKDUJD5S
.HWLND VDPSDL GL UXPDK GLD PHQ\HVDO NDUHQD VDODK VDWX7VKLUW \DQJ GLD EHOL MDKLWDQQ\D
UXVDN'LDPHPXWXVNDQXQWXNPHQXNDUVDWX7VKLUWXQWXNVHEXDKVZHDWHU$NKLUQ\D+DGL
PHQXNDUNDQ7VKLUWQ\DQDPXQGLDKDUXVPHPED\DU5SODJLNDUHQDVZHDWHUOHELK
PDKDOGDULSDGD7VKLUW
 %HUDSDNDKKDUJDPDVLQJPDVLQJEDUDQJ\DQJGLEHOL+DGL"-HODVNDQDODVDQPX

ht

 'LEHULNDQVXDWXVLVWHPSHUVDPDDQEHULNXW
 SN 
 SN 
 %LVDNDKNDOLDQPHQHPXNDQQLODLSGDQN"-HODVNDQDODVDQPX



.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

247

=+

SoalPengayaan

1. Benar atau salah:

adalah persamaan linear dua variabel.

2. Jelaskan dengan kata-kata, bagaimana untuk melengkapi pasangan berurutan


untuk
.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

3. Dalam buku Prinsip-prinsip Penyakit Dalam yang dikarang oleh Isselbacher


(1999), jumlah darah dalam tubuh bergantung pada berat badan dan jenis kelamin.
Aturan untuk menaksir jumlah darah dalam tubuh adalah:
Untuk pria: jumlah darah (mL) = 69 berat badan (dalam kilogram)
a. Ilmar memiliki berat badan 65 Kg. Taksirlah berapa liter banyak darah dalam
tubuh Ilmar.
b. Pak Bondan memiliki berat badan dua kali berat badan Ilmar. Apakah pak Bondan memiliki dua kali jumlah darah Ilmar? Jelaskan.
4. Jika x dan y merupakan bilangan bulat non negatif yang memenuhi
,
banyak pasangan bilangan
yang memenuhi persamaan tersebut adalah
5. Bila x dan y bilangan asli yang memenuhi persamaan
adalah

, nilai terkecil

6. Anis membeli 4 buku tulis dan 4 pensil seharga Rp11.000,00. Budi membeli 3
buku tulis dan 5 pensil yang sama dan membeli di toko yang sama dengan Anis
seharga Rp11.200,00.
a. Berapakah harga setiap buku tulis?
b. Berapakah harga setiap pensil?

ht

tp

://

7. Diketahui ada dua kotak di atas meja, masing-masing berisi bola-bola kecil. Bila
bola dikotak A ditambah dengan bola-bola dikotak B, maka banyak bola adalah 35
buah. Namun jika bola-bola dikotak A diambil sebanyak bola-bola dikotak B, maka
banyak bola dikotak A tinggal 11 buah. Berapa banyak bola-boa pada masing-masing kotak?
8. Suatu persegi panjang memiliki keliling 28 cm. Jika lebarnya kurang 2 cm dari
panjangnya, maka luas daerah persegi panjang itu adalah ...
9. Seorang pedagang majalah berhasil menjual majalah A dan majalah B sebanyak 28
eksemplar. Harga 1 majalah A adalah Rp6000.00 dan harga 1 eksemplar majalah B
Rp9000.00 Jika hasil penjualan kedua majalah tersebut Rp216.000.00 berapakah
banyak masing-masing majalah tersebut?

248

Buku Guru Kelas VIII SMP/MTs

Semester 2

10. Harga 4 buah buku tulis dan sebuah pensil adalah Rp 5.600.00 Sedang harga
5 buah buku tulis dan 3 buah pensil adalah Rp 8.400.00.Berapa harga masingmasing buku dan pensil?
11. Jumlah dua bilangan adalah 41, sedang selisih kedua bilangan itu adalah 19. Berapa masing-masing bilangan itu?

. Nilai terkecil dari ab

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

13. Misalkan a dan b bilangan bulat sehingga


adalah

.id

12. Sebuah mesin produksi A menghasilkan barang 100 buah per jam.Mesin produksi
B menghasilkan barang 150 buah per jam.Jumlah jam kerja kedua mesin tersebut
dalam sehari adalah 20 jam.Jika dalam sehari kedua mesin diharapkan menghasilkan barang sebanyak 2.600 buah,berapa jam mesin A dan mesin B harus bekerja
dalam sehari?

14. Banyaknya selesaian pasangan bilangan bulat positif persamaan


adalah

15. Bilangan 43 dapat dinyatakan ke dalam bentuk 5a + 11b, karena untuk a = 13


dan b = -2, nilai dari 5a + 11b adalah 43. Manakah dari tiga bilangan 37, 254, dan
1986 yang tidak dapat dinyatakan dalam bentuk 5a + 11b?

://

16. Dapat dinyatakan sebagai 3x+7y sebab jika x diganti dengan 3 dan y diganti
dengan 1 diperoleh 3.3 + 7.1 yang bernilai 16. Tujuh bilangan antara 100 dan 122
yang dapat dinyatakan ke dalam bentuk
adalah .

ht

tp

17. Harga 4 buah baju dan 3 buah celana adalah Rp. 545.000,00, harga 1 buah celana
dan 2 buah baju adalah Rp. 235.000,00. Jika kita membeli 3 buah baju dan 4 buah
celana maka kita harus membayar sebesar
18. Pada fungsi f(x) = ax + b. Jika = 12 dan

= 8, maka f(4) = ...

19. Jika 3x y = 15 dan x + 3y = 3, maka hasil dari x 2y =


20. Himpunan penyelesaian dari sistem persamaan
adalah

dan

MATEMATIKA

249

Pedoman
Penilaian
No
1

Capaian
B

Keterangan
Bila Buku Siswa terselesaikan dengan baik

<B

Bila ada bagian dari Buku Siswa yang tidak


terselesaikan

Portofolio:
a) Uji Kompetensi
b) Soal dari tempat
lain

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan mampu menyelesaikannya dengan
baik

.id

Aspek Penilaian
Keterselesaian Buku
Siswa

Bila memilih soal dari Uji Kompetensi dengan


kategori Mudah dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan kurang mampu
menyelesaikannya dengan baik

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o
B+

Bila memilih soal dari Uji Kompetensi dengan


kategori Sedang dan mampu menyelesaikannya
dengan baik

B , B
B+, B,
B

Bila memilih soal dari Uji Kompetensi


A, B+ , dengan kategori Mudah dan kurang mampu
B, B menyelesaikannya dengan baik
Bila Proyek terselesaikan dan manpu
A
mempresentasikan dengan Baik
A, B+, Bila ada bagian dari Proyek yang tidak terselesaikan
atau kurang mampu mempresentasikan
B

://

ht

tp

Tugas Projek

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan kurang mampu menyelesaikannya
dengan baik
Bila memilih soal dari Uji Kompetensi
dengan kategori Sedang dan kurang mampu
menyelesaikannya dengan baik

Bila Proyek tidak terselesaikan samasekali

Keterangan: - Nilai KKM = B




250

- Aspek penilaian Nomor 1 adalah syarat nilai yang


harus terpenuhi, sedangkan Aspek penilaian Nomor 2
adalah penambahan nilai.

Buku Guru Kelas VIII SMP/MTs

Semester 2

Persamaan
Kuadrat

Bab 2

Kata Kunci
Persamaan kuadrat
Akar
Faktor

.id

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

K ompetensi
D asar

Menentukan akar
persamaan kuadrat dengan
satu variabel yang tidak
diketahui.

Pengalaman
Belajar

Faktorisasi

b.

Melengkapi kuadrat sempurna

c.

Rumus kuadratik

://

a.

tp

2.

Menentukan akar
persamaan kuadrat satu
variabel dengan cara:

Menyelesaikan masalah persamaan kuadrat berkaitan dengan kehidupan nyata.

ht

1.

Saat kalian melempar bola ke udara, ketinggian bola


tergantung pada tiga faktor, yaitu posisi awal, kecepatan
saat bola di lemparkan, dan gaya gravitasi. Gravitasi bumi
menyebabkan bola yang terlempar ke atas mengalami
percepatan ketika benda semakin mendekati bumi . Besar
percepatan gravitasi bumi sebesar 9,8 m/s2. Ini berarti bahwa
kecepatan bola ke bawah meningkat 9,8 m/s untuk setiap
detik di udara. Jika kalian menyatakan ketinggian bola pada
setiap waktu dengan suatu persamaan, maka persamaan yang
terbentuk adalah persamaan kuadrat.

MATEMATIKA
37
MATEMATIKA

251

Peta
Konsep
Persamaan
Kuadrat

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Aplikasi
Persamaan
Kuadrat

ht

tp

://

Akar
Persamaan
Kuadrat

252

KelasKelas
VIII SMP/MTs
38 Guru
Buku
VIII SMP/MTs

Semester
2 2
Semester

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Abu Abdallah Muhammad ibnu


Musa al-Khwarizmi, kerap dijuluki
sebagai Bapak Aljabar, karena
sumbangan ilmu pengetahuan Aljabar
dan Aritmatika. beliau merupakan
seorang ahli matematika dari Persia
yang dilahirkan pada tahun 194 H/780
M, tepatnya di Khwarizm, Uzbeikistan.
Selain terkenal sebagai seorang
ahli matematika, beliau juga adalah
astronomer dan geografer yang hebat.
Berkat kehebatannya,
Khawarizmi
terpilih sebagai ilmuwan penting di
pusat keilmuwan yang paling bergengsi
pada zamannya, yakni Baital-Hikmah
atau House of Wisdom yang didirikan
khalifah Abbasiyah
di Metropolis
Intelektual World, Baghdad.

Al-Khwarizmi
(780 - 850)

://

Kitab Al-Jabr Wal Muqabalah merupakan


kitab pertama dalam sejarah dimana
istilah aljabar muncul dalam konteks
disiplin ilmu. Sumbangan Al-Khwarizmi
dalam ilmu ukur sudut juga luar biasa. Tabel ilmu ukur sudutnya yang berhubungan dengan
fungsi sinus dan garis singgung tangen telah membantu para ahli eropa memahami lebih
jauh tentang ilmu ini. Ia mengembangkan tabel rincian trigonometri yang memuat fungsi
sinus, kosinus dan kotangen serta konsep diferensiasi. Kitab yang telah ditulisnya yaitu
1) Al-Jabr wal Muqabalah: Beliau telah mencipta pemakaian secans dan tangens dalam
penyelidikan trigonometri dan astronomi, 2) Hisab al-Jabr wa al-Muqabalah: Beliau telah
mengajukan contoh-contoh persoalan matematika dan mengemukakan 800 buah masalah
yang sebagian besar merupakan persoalan yang dikemukakan oleh Neo Babylonian dalam
bentuk dugaan yang telah dibuktikan kebenarannya oleh al-Khawarizmi, 3) Sistem Nomor :
Beliau telah memperkenalkan konsep sifat dan ia penting dalam sistem Nomor pada zaman
sekarang. Karyanya yang satu ini memuat Cos, Sin dan Tan dalam selesaian persamaan
trigonometri , teorema segitiga sama kaki dan perhitungan luas segitiga, segi empat dan
lingkaran dalam geometri.

tp

(Sumber: www.id.wikipedia.org)

ht

Beberapa hikmah yang mungkin bisa kita petik antara lain:


1. Kita harus jeli melakukan pengamatan fenomena yang ada di sekitar kita.
2. Kita harus mau dan mampu melakukan pembuktian-pembuktian tentang fenomena
alam sekitar yang merupakan bukti kekuasaan Tuhan melalui keilmuan yang diketahui
manusia. Dengan demikian, kita dapat memperkuat keyakinan pada Tuhan.
3. Kita harus semangat dalam melakukan aktivitas positif yang telah direncanakan
untuk memperkuat ketahanan sik dan psikis dalam menghadapi tantangan.

MATEMATIKA
253
39

253

Membelajarkan 2.1

0HQHQWXNDQ$NDU
3HUVDPDDQ.XDGUDW

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

1. Amati dan kenali


terlebih beberapa
kegiatan dalam
kehidupan nyata yang
berkaitan dengan
persaman kuadrat,
seperti: kawat yang
dibengkokkan, panjang
dan lebar taman yang
diketahui keliling dan
luasnya, dll.

.id

Menentukan Akar Persamaan Kuadrat


dengan Memfaktorkan

2. Identifikasi siswasiswa yang biasanya


agak sulit membuat
pertanyaan.

ht

tp

://

3. Identifikasi pula
bentuk bantuan apa
yang perlu diberikan
agar siswa mampu
membuat pertanyaan
dan bernalar.

Kenalkan bentuk
persamaan kuadrat
kepada siswa dan
aplikasinya. Minta siswa
untuk menentukan suatu
persamaan menjadi bentuk
umum persamaan kuadrat.
254

.HJLDWDQ 

0HQHQWXNDQ$NDU3HUVDPDDQ
.XDGUDW'HQJDQ0HPIDNWRUNDQ

3HUVDPDDQNXDGUDWVDWXYDULDEHODGDODKVXDWXSHUVDPDDQ\DQJPHPLOLNLSDQJNDWWHUWLQJJLQ\DGXD
%HEHUDSDFRQWRKEHQWXNSHUVDPDDQNXDGUDW\DLWX[ [ [[ [ 
[ [  GDQODLQQ\D6HFDUDXPXPEHQWXNSHUVDPDDQNXDGUDWDGDODK[E[F GHQJDQ
DDEF5
D[E[F 

NRQVWDQWD

.RQVWDQWDDGDODKVLPERO\DQJPHQXQMXNNDQ
ELODQJDQWHUWHQWX.RQVWDQWD\DQJWHUGDSDWSDGD
VXNXD[GDQE[ELVDMXJDGLVHEXWNRHVLHQ

'DODPNHKLGXSDQVHKDULKDULNLWDGDSDWPHQMXPSDLEHEHUDSDPDVDODK\DQJWHUNDLWGHQJDQSHUVDPDDQ
NXDGUDW3HUKDWLNDQPDVDODKEHULNXW
&RQWRK 

7XOLVNDQEHQWXNXPXPSHUVDPDDQNXDGUDW[[ [[
$OWHUQDWLI
3HQ\HOHVDLDQ

[[ [[
[[ [
[[ 
-DGLEHQWXNVHGHUKDQDSHUVDPDDQNXDGUDW[[ [[DGDODK[[ 
'DODPNHKLGXSDQVHKDULKDULNLWDGDSDWPHQMXPSDLEHEHUDSDPDVDODK\DQJWHUNDLWGHQJDQSHUVDPDDQ
NXDGUDW3HUKDWLNDQPDVDODKEHULNXW
&RQWRK 
-RKDQGDQ0DULREHNHUMDEHUVDPDVDPDPHQJHFDWGLQGLQJGDODPZDNWXPHQLW-LND-RKDQEHNHUMD
VHQGLULDQLDPHPHUOXNDQZDNWXOHELKODPDGDULSDGDZDNWX\DQJGLSHUOXNDQ0DULR%HUDSDZDNWX
\DQJGLSHUOXNDQ-RKDQGDQ0DULRPDVLQJPDVLQJXQWXNPHQJHFDWGLQGLQJ"



.HODV9,,,60307V

Buku Guru Kelas VIII SMP/MTs

6HPHVWHU

Semester 2

Ajak siswa untuk mengamati Contoh 2.2


dan penyelesaiannya. kenalkan siswa tentang
akar persamaan kuadrat serta cara menetukan
akar persamaan kuadrat.

.HJLDWDQ\DQJGLODNXNDQ-RKDQGDQ0DULRGDSDWGLVDMLNDQGDODPWDEHOEHULNXW

.XDQWLWDVGLQGLQJ

/DMX NXDQWLWDVGLQGLQJZDNWX

:DNWX

0DULR


W

-RKDQ


W  

W

%HUVDPD






D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3HNHUMD

3HUVDPDDQXQWXNPHQ\HOHVDLNDQPDVDODKLQLDGDODK

'LVHGHUKDQDNDQPHQMDGL

.id

7DEHO3HQ\HOHVDLDQSHNHUMDDQ-RKDQGDQ0DULR





  
W
W   





  W W 
W

W  



W W  W W 
W  
W

W W 




 W W

W W

WW
W


W

WW
WW
WW
W W
DWDXW 

://

W DWDXW  QLODLW WLGDNEHUODNXNDUHQDZDNWXVHODOXSRVLWLI

tp

-DGL-RKDQPHPHUOXNDQZDNWXPHQLWXQWXNPHQJHFDWGLQGLQJVHQGLULDQGDQ0DULRPHPHUOXNDQ
ZDNWX PHQLWXQWXNPHQJHFDNGLQGLQJVHQGLULDQ

ht

6HFDUDXPXPEHQWXNSHUVDPDDQNXDGUDWDGDODKD[E[F 
GHQJDQDEFELODQJDQUHDOGDQDDGLVHEXWNRHVLHQ[ENRHVLHQ[FNRQVWDQWD
$NDUSHUVDPDDQNXDGUDWGDULD[E[F DGDODKQLODL[\DQJPHPHQXKLSHUVDPDDQWHUVHEXW
&DUDPHQHQWXNDQDNDUSHUVDPDDQNXDGUDWDGDWLJDFDUD
  0HPIDNWRUNDQ
  0HOHQJNDSL.XDGUDW6HPSXUQD
  5XPXV.XDGUDWLN

0$7(0$7,.$



MATEMATIKA

255

3DGDNHJLDWDQEHODMDU%DEVHPHVWHUNDOLDQWHODKPHPSHODMDULWHQWDQJSHUNDOLDQEHQWXNDOMDEDU
6HNDUDQJFREDNDOLDQSHUKDWLNDQNHPEDOLSHUNDOLDQEHQWXNDOMDEDUEHULNXW
7DEHO3HUNDOLDQEHQWXNDOMDEDU
[ [   [ [
[[[
[[
-DGL
[ [  [[

[[ [ [

-DGL

[[ [ [


[ [   [  [
[[[
[[
-DGL
 [ [  [[

%DJDLPDQDMLNDVHEDOLNQ\D GDULEDZDKNHDWDV "


[ [  [[

[[  [  [

[[  [ [

%HQWXNVHSHUWLLQLGLVHEXWGHQJDQ0HPIDNWRUNDQ

.id

'HQJDQPHPSHUKDWLNDQ7DEHOVHODQMXWQ\DFDUDPHPIDNWRUNDQWHUVHEXWGDSDWGLJXQDNDQXQWXN
PHQHQWXNDQ DNDU SHUVDPDDQ NXDGUDW .DOLDQ GDSDW PHQJDPDWL FDUD PHQHQWXNDQ DNDU SHUVDPDDQ
NXDGUDWGHQJDQFDUDPHPIDNWRUNDQSDGD7DEHOEHULNXW
$\R
.LWD$PDWL

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Ingatkan siswa tentang


perkalian bentuk aljabar
yang telah dipelajari di
semester 1

7DEHO&DUDPHQHQWXNDQDNDUSHUVDPDDQNXDGUDWGHQJDQPHPIDNWRUNDQ
%HQWXN[E 

 







[
[ [ 

[ DWDX[ 
[ DWDX[ 

-DGLKLPSXQDQVHOHVDLDQQ\DDGDODK^`

Ayo
Kita Amati


[
[

[ [ 
[ DWDX[
[ DWDX[ 






-DGLKLPSXQDQVHOHVDLDQQ\DDGDODK^`



.HODV9,,,60307V

 






[[
[  
[ [ 
[ DWDX[
[ DWDX[ 
[ [ 






-DGLKLPSXQDQVHOHVDLDQQ\DDGDODK^`
 





[[
[ [ 

[ DWDX[ 
[ DWDX[ 

-DGLKLPSXQDQVHOHVDLDQQ\DDGDODK^`

6HPHVWHU

ht

tp

://

1. Ajak siswa untuk


mengamati cara
menentukan akar
persamaan kuadrat
dengan cara
memfaktorkan yang
tersaji pada tabel.
2. Minta siswa
memperhatikan
bentuk umum dan cara
memfaktorkan dari
persamaan kuadrat.
3. Berikan beberapa
pancingan pertanyaan
tentang cara
penyelesaian persamaan
kuadrat yang tersaji pada
tabel tersebut agar siswa
memahami bagaimana
menentukan akar
persamaan kuadrat.

 





%HQWXND[E[F 

256

Buku Guru Kelas VIII SMP/MTs

Semester 2

%HQWXN[E 

%HQWXND[E[F 



[
[


[ [ 

[ DWDX[ 
[ DWDX[ 

 






  [[
 [ [ 


[ DWDX[ 


[ DWDX[ 


-DGLKLPSXQDQVHOHVDLDQQ\DDGDODK^`

"


-DGLKLPSXQDQVHOHVDLDQQ\DDGDODK^ `


$\R.LWD
0HQDQ\D

7HUNDLW GHQJDQ IRNXV SHUKDWLDQ GL DWDV FRED EXDWODK SHUWDQ\DDQ \DQJ PHPXDW VXDWX SHUVDPDDQ
NXDGUDWD[E[F GHQJDQDEGDQFWHUWHQWX NDOLDQWHQWXNDQVHQGLUL 
6HGLNLW
,QIRUPDVL

.id

)DNWRUQRO
'DODPPHQHQWXNDQDNDUSHUVDPDDQNXDGUDWGHQJDQFDUDPHPIDNWRUNDQKDUXVPHPSHUKDWLNDQ
SULQVLSSHUNDOLDQGHQJDQQRO\DLWXMLNDKDVLOSHUNDOLDQGXDELODQJDQDGDODKQROPDNDVDODKVDWX
DWDXNHGXDIDNWRUQ\DDGDODKQRO

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o




-LNDDE PDNDD DWDXE DWDXNHGXDQ\D

&RQWRK 






[ [  
[  DWDX [  
[ DWDX[ 
-DGLVHOHVDLDQGDUL [ [  DGDODK[ DWDX[ 

0HPIDNWRUNDQEHQWXND[E[FD 




3HUVDPDDQNXDGUDW[E[F GDQSTELODQJDQEXODWKDVLOSHPIDNWRUDQQ\DDGDODK [S [T 


-LNDEHQWXN [S [T GLNDOLNDQPDNDGLSHUROHK













[S [T 





[T[S[ST
[ TS [ST
[ ST [ST

'HQJDQGHPLNLDQSHUVDPDDQNXDGUDW[E[F HNXLYDOHQGHQJDQ
SHUVDPDDQNXDGUDW[ ST [ST
-DGLST EGDQTT F



tp

://

0$7(0$7,.$

Suruh siswa membuat


pertanyaan berdasarkan
Tabel 2.3 pada buku
siswa. Minta salah
satu siswa untuk
menyampaikan pertanyaan,
kemudian minta siswa
lain untuk menjawab
dan mendiskusikan
jawabannya.

ht

Ayo Kita
Menanya

Sedikit
Informasi
Ajak siswa untuk
mengamati dan memahami
strategi memfaktorkan
berbagai bentuk persamaan
kuadrat
MATEMATIKA

257

&RQWRK 

7HQWXNDQDNDUDNDUVHOHVDLDQGDULEHQWXN[[ 
$OWHUQDWLI
3HQ\HOHVDLDQ

&DULODKGXDELODQJDQ\DQJPHUXSDNDQIDNWRUGDULGDQMLNDGLMXPODKVDPDGHQJDQ
0LVDONDQGXDELODQJDQWHUVHEXWDGDODKSGDQTPDNDST GDQST 
S

ST

ST

ST

ST


















'HQJDQGHPLNLDQELODQJDQ\DQJPHPHQXKLQLODLS GDQT 
-DGLEHQWXN[[ GDSDWGLIDNWRUNDQPHQMDGL






[[ 
[ [  
[ DWDX[ 
[ DWDX[ 

-DGLKLPSXQDQVHOHVDLDQQ\DDGDODK^`

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Arahkan siswa untuk


memahami langah-langkah
penyelesaian dari contoh
soal yang disajikan.

&RQWRK 

7HQWXNDQQLODL[\DQJPHPHQXKLSHUVDPDDQNXDGUDW[ 
$OWHUQDWLI
3HQ\HOHVDLDQ

[

[[ 

.id





WXOLVSHUVDPDDQ
WXOLVEHQWXNODLQVHKLQJJDWDPSDNNRHVLHQ['XDELODQJDQ\DQJ
MLNDGLNDOLNDQPHQJKDVLONDQGDQMLNDGLMXPODKNDQKDVLOQ\D
DGDODKGDQ

XEDK[PHQMDGL[[
[[[
EHULWDQGDNXUXQJ3HUKDWLNDQEDKZDEHUXEDKPHQMDGL
[[  [  
[ [  [ 

IDNWRUNDQEHQWXNDOMDEDUGDODPNXUXQJ
[ [  

JXQDNDQVLIDWGLVWULEXWLI
[ DWDX[ 
IDNWRUQRO
[ DWDX[ 

VHOHVDLNDQ
-DGLQLODL[\DQJPHPHQXKLSHUVDPDDQNXDGUDW[ DGDODK[ DWDX[ 'HQJDQNDWD
ODLQKLPSXQDQVHOHVDLDQGDULSHUVDPDDQNXDGUDW[ DGDODK^`

.HODV9,,,60307V

6HPHVWHU

tp

://






ht

Minta siswa untuk memperhatikan Contoh 2.4 dan 2.5 dan penyelesaiannya.
Diskusikan dengan siswa perbedaan strategi yang dilakukan untuk menentukan
akar persamaan kuadrat.

258

Buku Guru Kelas VIII SMP/MTs

Semester 2

0HPIDNWRUNDQEHQWXND[E[F D

.DOLDQVXGDKPHQJHWDKXLEDJDLPDQDFDUDPHPIDNWRUNDQSHUVDPDDQNXDGUDWD[E[F GHQJDQ
D-LNDNDOLDQSHUKDWLNDQNHPEDOLWDEHOGLNHJLDWDQ$\R.LWD$PDWLPDNDWHUGDSDWSHUVDPDDQ
NXDGUDW \DQJ PHPSXQ\DL QLODL D   %DJDLPDQDNDK FDUD NDOLDQ XQWXN PHPIDNWRUNDQ SHUVDPDDQ
NXDGUDWGHQJDQD"
8QWXNPHQJHWDKXLEDJDLPDQDFDUDPHQHQWXNDQDNDUSHUVDPDDQNXDGUDWD[E[F GHQJDQD
DPDWLSURVHGXUEHULNXW
[[ 
[[ [

%DJLDQWHQJDK\DNQL[DNDQGLXUDLNDQVHKLQJJDSHPIDNRWUDQDNDQ
OHELKPXGDKGLODNXNDQ

NDOLNDQQLODLDGDQF\DNQLGDQDNDQPHQJKDVLONDQ
7HQWXNDQ GXD ELODQJDQ ODLQ MLND GLNDOLNDQ PHQJKDVLONDQ  GDQ MLND GLMXPODKNDQ PHQJKDVLONDQ E
\DNQL

ST

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

'DULWDEHOGLDWDVGDSDWNLWDNHWDKXLEDKZDQLODLNHGXDELODQJDQWHUVHEXWDGDODKGDQ0DNDQLODL
NRHVLHQ[\DNQLEGDSDWGLMDEDUNDQVHEDJDLEHULNXW

.id

0LVDOGXDELODQJDQWHUVHEXWDGDODKSGDQTPDNDGDSDWNHGXDELODQJDQWHUVHEXWWDPSDNSDGDWDEHO
EHULNXW

[[

[

[[[

 [[  [  

EHULWDQGDNXUXQJ

[ [  [  

IDNWRUNDQEHQWXNDOMDEDUGDODPNXUXQJ

 [ [ 

JXQDNDQVLIDWGLVWULEXWLI

MDEDUNDQ[PHQMDGLKDVLOSHQMXPODKDQ[[

6HKLQJJDXQWXNPHQHQWXNDQDNDUDNDUSHUVDPDDQNXDGUDW[[ GDSDWGHQJDQPXGDK
GLVHOHVDLNDQ

[[
[ [  

IDNWRUNDQ
[  DWDX [  
IDNWRUQRO


VHOHVDLNDQ
[ DWDX[  

-DGLDNDUDNDUSHUVDPDDQNXDGUDW[[ DGDODK[ DWDX[ 


'HQJDQNDWDODLQ



KLPSXQDQVHOHVDLDQGDULSHUVDPDDQNXDGUDW[[ DGDODK^ `




tp

://

0$7(0$7,.$

ht

Minta siswa untuk memperhatikan contoh persamaan kuadrat dengan nilai a 1.


Diskusikan dengan siswa perbedaan strategi yang dilakukan untuk menentukan akar
persamaan kuadrat dengan a = 1.

MATEMATIKA

259

&RQWRK 
7HQWXNDQDNDUDNDUSHUVDPDDQNXDGUDW[[ 
3HQ\HOHVDLDQ
[[ 
[[ 

VHOHVDLNDQ

.id

[[[ 
[[  [  
[ [  [  
[ [  
[ DWDX[ 


[   DWDX[  



WXOLVSHUVDPDDQ
NDOLNDQGHQJDQ  KDVLOQ\DDGDODK'XDELODQJDQODLQ\DQJ
GLNDOLNDQ PHQJKDVLONDQ  GDQ MLND GLMXPODKNDQ PHQJKDVLONDQ 
DGDODKGDQ
XEDK[PHQMDGL[[
EHULWDQGDNXUXQJ
IDNWRUNDQEHQWXNDOMDEDUGDODPNXUXQJ
JXQDNDQVLIDWGLVWULEXWLI
IDNWRUQRO

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o



-DGLDNDUDNDUSHUVDPDDQNXDGUDW[[ DGDODK[   DWDX[  'HQJDQNDWDODLQ


 
KLPSXQDQVHOHVDLDQGDULSHUVDPDDQNXDGUDW[[ DGDODK^   `
 

$\R.LWD
0HQDODU

0HQHQWXNDQ3HUVDPDDQ.XDGUDW%DUX

6HWHODKNDOLDQPHPSHODMDULEDJDLPDQDPHQHQWXNDQDNDUDNDUSHUVDPDDQNXDGUDWDGDNDODQ\DNDOLDQ
PHPEXDWSHUVDPDDQEDUX\DQJVXGDKGLNHWDKXLQLODLDNDUDNDUQ\D
0LVDONDQSHUVDPDDQNXDGUDWEDUXPHPLOLNLDNDUDNDUSGDQT0DNDGDSDWGLQ\DWDNDQEDKZD[ S
GDQ[ T
[ SGDSDWGLWXOLV[S GDQ[ SGDSDWGLWXOLV[S 6HKLQJJDSHUVDPDDQNXDGUDW\DQJ
GLEHQWXNDGDODK
[S [T  

[S[T[ST 

[ S[T[ ST 


[ ST [ST 



.HODV9,,,60307V

6HPHVWHU

ht

tp

://

-DGLSHUVDPDDQNXDGUDW\DQJVXGDKGLNHWDKXLDNDUDNDUQ\DSGDQTDGDODK[ ST [ST 

Ayo Kita
Menalar

Ajak siswa untuk


mengamati langkahlangkah menentukan
persamaan kuadrat jika
yang diketahui adalah akarakar persamaannya.
260

Buku Guru Kelas VIII SMP/MTs

Semester 2

&RQWRK 
3HUVDPDDQNXDGUDW\DQJDNDUDNDUQ\DGDQDGDODK
3HQ\HOHVDLDQ
0LVDODNDUDNDU\DQJGLNHWDKXLDGDODK[ GDQ[ PDNDGDSDWGLQ\DWDNDQGDODPEHQWXN
[ GDQ[ 6HKLQJJDSHUVDPDDQNXDGUDW\DQJGLEHQWXNDGDODK
[ [  
[[ 
[[ 
-DGLSHUVDPDDQNXDGUDW\DQJDNDUDNDUQ\DGDQDGDODK[[ 
&RQWRK 

.id

3HUVDPDDQNXDGUDW[[ PHPSXQ\DLDNDUDNDUSGDQT

$OWHUQDWLI
3HQ\HOHVDLDQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

7HQWXNDQSHUVDPDDQNXDGUDWEDUX\DQJDNDUDNDUQ\DSGDQT

0LVDONDQS [GDQT [DGDODKSHUVDPDDQNXDGUDW\DQJEDUX


/DQJNDK

0HQHQWXNDQDNDUDNDUSHUVDPDDQNXDGUDW

[[ 

WXOLVSHUVDPDDQ

[[[ 

MDEDUNDQ[PHQMDGL[[.DUHQDGXDELODQJDQ\DQJMLNDGLNDOLNDQ
KDVLOQ\DGDQMLNDGLMXPODKNDQKDVLOQ\DDGDODKGDQ

[[  [  

EHULWDQGDNXUXQJ

[ [  [  

IDNWRUNDQEHQWXNDOMDEDUGDODPNXUXQJ

[ [  

JXQDNDQVLIDWGLVWULEXWLI

[ DWDX[ 

IDNWRUQRO

[ DWDX[ 

VHOHVDLNDQ

$NDUDNDUSHUVDPDDQNXDGUDW[[ DGDODKSGDQTPDNDS GDQT 


/DQJNDK

0HQHQWXNDQDNDUDNDUSHUVDPDDQNXDGUDWEDUX

$NDUDNDUSHUVDPDDQNXDGUDW[[ DGDODKSGDQTPDNDS GDQT 

tp

://

6HKLQJJDDNDUDNDUSHUVDPDDQNXDGUDW\DQJEDUXDGDODK[ S  GDQ[ T  

ht

0$7(0$7,.$



Minta siswa untuk memperhatikan Contoh 2.7 dan 2.8 dan penyelesaiannya.
Diskusikan dengan siswa perbedaan strategi yang dilakukan untuk menentukan
persamaan kuadrat.

MATEMATIKA

261

/DQJNDK

0HQHQWXNDQSHUVDPDDQNXDGUDWEDUX

3HUVDPDDQNXDGUDWEDUXGHQJDQDNDUDNDU[GDQ[DGDODK
[[ [[  
[  [  

VXEVWLWXVL[GDQ[

[ [   

VHGHUKDQDNDQ

[[ 

JXQDNDQVLIDWGLVWULEXWLI

-DGLSHUVDPDDQNXDGUDWEDUX\DQJDNDUDNDUQ\DSGDQTDGDODK[[ 

0DVDODK 
:XUL GDQ (GL PHQ\HOHVDLNDQ VHEXDK SHUVDPDDQ NXDGUDW 'DODP PHQ\HOHVDLNDQ :XUL PHPEXDW
NHVDODKDQGDODPPHQXOLVNRQVWDQWDGDQGLDPHPSHUROHKDNDUDNDUGDQ6HGDQJNDQ(GLPHPEXDW
NHVDODKDQGDODPPHQXOLVNRHVLHQ[GDQPHPSHUROHKDNDUDNDUGDQ%DJDLPDQDNDKEHQWXN
SHUVDPDDQNXDGUDW\DQJGLVHOHVDLNDQ:XULGDQ(GL"

Sedikit
Informasi

.id

6HGLNLW
,QIRUPDVL
-LND[GDQ[PHUXSDNDQDNDUDNDUSHUVDPDDQNXDGUDWD[E[F PDNDMXPODKDNDUDNDUQ\D
E
F
GDQKDVLONDOLNHGXDDNDUQ\D[[  
D
D

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

\DNQL[[  

Minta siswa untuk


mengamati informasi
tentang jumlah dan hasil
kali akar-akar persamaan
kuadrat.

D -XPODKGDQKDVLONDOLDNDUDNDUGDULSHUVDPDDQNXDGUDW[[ EHUWXUXWWXUXWDGDODK


GDQ


E -LNDMXPODKDNDUDNDUVHEXDKSHUVDPDDQNXDGUDWDGDODK  GDQKDVLONDOLNHGXDDNDUQ\D

DGDODK 


PDNDSHUVDPDDQNXDGUDWLWXDGDODK[[ 


$\R.LWD
%HUEDJL

Ayo Kita
Berbagi



.HODV9,,,60307V

6HPHVWHU

://

1. Ajak siswa untuk


menukarkan hasil
penalarannya dengan
teman sebangkunya.

6HOHVDLNDQODK0DVDODKGDODPNHJLDWDQEHUQDODUGDQVHOLGLNLODKNHEHQDUDQGDULPDVDODKGDODP
6HGLNLW,QIRUPDVL6HWHODKVHOHVDLPHQMDZDEWXNDUNDQKDVLONHUMDNDOLDQGHQJDQWHPDQVHEDQJNX
3HULNVDSHULNVDNHEHQDUDQSHQ\HOHVDLDQQ\DGDQMDZDEDQQ\D

ht

tp

2. Mintalah mereka
memeriksa apakah
kedua jawabannya
memiliki makna yang
sama. Secara santun,
persilahkan mereka
saling berkomentar,
menanggapi
komentar,
memberikan usul dan
menyepakati kalimatkalimat yang paling
tepat
262

Buku Guru Kelas VIII SMP/MTs

Semester 2

"

?!

/DWLKDQ 

 7HQWXDQDNDUSHUVDPDDQEHULNXW
D [
E [[
F [[
 1\DWDNDQSHUVDPDDQ [  [ [ GDODPEHQWXNXPXPSHUVDPDDQNXDGUDW
 $NDUDNDUSHUVDPDDQ[[ DGDODKGDQ7HQWXNDQSHUVDPDDQNXDGUDWEDUX
\DQJDNDUDNDUQ\D  GDQ  
 -LNDSGDQTDGDODKDNDUDNDUSHUVDPDDQ[[ PDNDSHUVDPDDQNXDGUDWEDUX\DQJ
DNDUDNDUQ\DSGDQT
 'LNHWDKXLDNDUDNDUSHUVDPDDQNXDGUDW[[ DGDODKPGDQQ7HQWXNDQSHUVDPDDQ
NXDGUDWEDUX\DQJDNDUDNDUQ\DPQGDQPQ

Latihan

Berikan tugas kepada


siswa untuk mengerjakan
Latihan 2.1 secara mandiri
dan mengumpulkannya
kepada guru.

D[E[ 

D[E[ 

[ D[E  

[ D[E  

[ DWDXD[E 

[ DWDXD[E 

E
[ DWDX[   
D

[ DWDX[ 

.id

 3HUJXQDNDQSHPIDNWRUDQVHEDJDLEHULNXWXQWXNPHQMDZDEVRDODI

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

E
D

D 7HQWXNDQKLPSXQDQVHOHVDLDQSHUVDPDDQ[[ 

E 7HQWXNDQKLPSXQDQVHOHVDLDQGDULSHUVDPDDQNXDGUDW[[ 


F 7HQWXNDQQLODL[\DQJPHPHQXKLSHUVDPDDQNXDGUDW[[ [[
G 7HQWXNDQKLPSXQDQVHOHVDLDQGDUL [   [ [
H -XPODKVHPXDDNDUSHUVDPDDQ D


D   D


I -XPODKNXDGUDWDNDUDNDUSHUVDPDDQ [  [ [

 7HQWXNDQQLODLS\DQJPHPHQXKL[[ GHQJDQ[GDQ[PHUXSDNDQDNDUDNDU


SHUVDPDDQ[[S 

 7HQWXNDQ SHUVDPDDQ NXDGUDW \DQJ DNDUDNDUQ\D EHUNHEDOLNDQ GHQJDQ DNDUDNDU


SHUVDPDDQ[[ 

ht

tp

://

0$7(0$7,.$



1. Periksalah apakah
semua siswa
sudah mampu
mengidentifikasi
persamaan kuadrat,
memfaktorkan dan
menentukan akar-akar
persamaan kuadrat.
2. Mintalah siswa untuk
melakukan refleksi dan
menuliskan hal penting
dari apa yang telah
dipelajarinya
MATEMATIKA

263

Membelajarkan 2.2

.HJLDWDQ 

0HQHQWXNDQ$NDU3HUVDPDDQ.XDGUDW
GHQJDQ0HOHQJNDSNDQ.XDGUDW6HPSXUQD

ht

tp

://

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

1. Amati dan kenali


terlebih dahulu
ciri-ciri persamaan
kuadrat yang dapat
menggunakan metode
melengkapi kuadrat
sempurna dalam
menentukan akar
persamaan kuadrat.
2. Buat siswa menjadi
kelompok berpasangpasangan untuk
mempermudah
pengamatan guru
3. Identifikasi siswasiswa yang biasanya
agak sulit membuat
pertanyaan.
4. Identifikasi pula
bentuk bantuan apa
yang perlu diberikan
agar siswa mampu
membuat pertanyaan
dan bernalar.

.id

Menentukan Akar Persamaan Kuadrat


dengan Melengkapkan Kuadrat Sempurna

Kenalkan kepada siswa


tentang sifat akar pada
persamaan kuadrat beserta
contohnya sebelum
melakukan pembahasan
tentang cara menentukan
akar persamaan kuadrat
dengan cara melengkapkan
kuadrat sempurna.
264

6HODLQ PHQHQWXNDQ DNDU SHUVDPDDQ GHQJDQ FDUD PHPIDNWRUNDQ NDOLDQ GDSDW PHPSHUOXDV WHNQLN
SHQ\HOHVDLDQSHUVDPDDQNXDGUDWGHQJDQFDUDPHOHQJNDSNDQNXDGUDWVHPSXUQD6HEHOXPPHPSHODMDUL
OHELKODQMXWNDOLDQSHUOXPHQJHQDOWHUOHELKGDKXOXWHQWDQJVLIDWDNDU

&RQWRK 

 $NDUSHUVDPDDQNXDGUDW[ 

(NXLYDOHQGDULSHUVDPDDQNXDGUDW[ DGDODK[ DWDX[ 

'DSDWGLVHGHUKDQDNDQPHQMDGL[ DWDX[ 

-LND[ NGLPDQDNVHEDUDQJELODQJDQUHDOPDND[  N DWDX[  N

 $NDUSHUVDPDDQ [  




6HVXDLVLIDWDNDUNXDGUDWPDNDGLSHUROHK[ 

6HKLQJJD[ \DQJPHQXQMXNNDQDGDGXDDNDU\DLWX

[ DWDX[ 
[ DWDX[ 

0DVDODK 

0HWRGH \DQJ WHODK NDOLDQ SHODMDUL VHEHOXPQ\D UHODWLI PXGDK XQWXN GLWHUDSNDQ$NDQ WHWDSL WLGDN
VHPXD SHUVDPDDQ NXDGUDW GDSDW GLVHOHVDLNDQ VHFDUD ODQJVXQJ PHQJJXQDNDQ PHWRGH WHUVHEXW
6HKLQJJDNLWDKDUXVPHQJHPEDQJNDQPHWRGHSHQ\HOHVDLDQSHUVDPDDQNXDGUDW\DQJODLQ$\RDPDWL
NHJLDWDQEHULNXW
 [ 
 [[ 
 [ 
 [[ 
 [ 
 [[ 

$OWHUQDWLI3HPHFDKDQ0DVDODK
8QWXNPHQ\HOHVDLNDQPDVDODKGLDWDVD\RDPDWLNHJLDWDQEHULNXW



.HODV9,,,60307V

Buku Guru Kelas VIII SMP/MTs

6HPHVWHU

Semester 2

Ayo
Kita Amati
1. Arahkan siswa
untuk mengamati
cara menentukan
akar persamaan
kuadrat dengan cara
melengkapkan kuadrat
sempurna yang tersaji
pada Tabel 2.4.

.id

8UDLDQ EHULNXW LQL PHUXSDNDQ FDUD ODLQ \DQJ GDSDW NDOLDQ JXQDNDQ XQWXN PHQHQWXNDQ DNDU \DQJ
PHPHQXKLSHUVDPDDQNXDGUDW&REDSHUKDWLNDQGHQJDQVHNVDPD
7DEHO0HQHQWXNDQDNDUSHUVDPDDQNXDGUDWGHQJDQFDUDPHOHQJNDSLNXDGUDWVHPSXUQD
%HQWXN[E 
  [

[ 

2. Berikan beberapa
pancingan pertanyaan
tentang cara
penyelesaian persamaan
kuadrat dengan cara
melengkapkan kuadrat
sempurna yang tersaji
pada Tabel 2.4 dan
memastikan siswa
mengamati konsep
dengan benar.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

$\R
.LWD$PDWL




%HQWXND[E[F 

  [[

[[ 



[[ 






[ 
 
[ 

[ DWDX[ 

-DGLKLPSXQDQVHOHVDLDQQ\DDGDODK
^`

 






[
[ 

[ 
 
[ 

[ DWDX[ 

-DGLKLPSXQDQVHOHVDLDQQ\DDGDODK
^`









[ 
[ 
[
[ 
[ [ 

-DGLKLPSXQDQVHOHVDLDQQ\DDGDODK
^`


 



  [[



[[



 

[[ 


[   


://

tp









ht









   





[   


[   




[   




[

 
   
 

[

[ DWDX[ 

-DGLKLPSXQDQVHOHVDLDQQ\DDGDODK







 
   
 

^`

0$7(0$7,.$



MATEMATIKA

265

%HQWXN[E 

[

[  

[ 
 
[ 

[ DWDX[ 
-DGLKLPSXQDQVHOHVDLDQQ\DDGDODK
^`

%HQWXND[E[F 
  [[



[[





x2 + x
x2+


x+






[


[



+ 



=
=

   







[








x1 =



+






x2 =







= 3

[


atau x2 = 3


D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

x1 =

.id

 





Jadi, himpunan selesaiannya



adalah { , 3}


"

$\R.LWD
0HQDQ\D

7HUNDLW GHQJDQ IRNXV SHUKDWLDQ GL DWDV FRED EXDWODK SHUWDQ\DDQ \DQJ PHPXDW VXDWX SHUVDPDDQ
NXDGUDW[E GDQD[E[F GHQJDQDEGDQFWHUWHQWX NDOLDQWHQWXNDQVHQGLUL 
0LVDO-LNDWHUGDSDWSHUVDPDDQNXDGUDW[[ 
PDQDNDKFDUD\DQJSDOLQJPXGDKXQWXNPHQHQWXNDQQLODLGDULSHUVDPDDQNXDGUDWWHUVHEXWDQWDUD
PHQJJXQDNDQFDUDPHPIDNWRUDQGHQJDQFDUDPHOHQJNDSNDQNXDGUDWVHPSXUQD"

Ayo Kita
Menanya

8QWXN PHPSHUNXDW SHPDKDPDQ NDOLDQ WHQWDQJ SHUVDPDDQ NXDGUDW FRED NDOLDQ JDOL EHEHUDSD
LQIRUPDVLGDULEXNXUHIHUHQVLPDWHPDWLNDDWDXLQWHUQHWWHQWDQJKDOEHULNXW
 &DULODKSHUVDPDDQNXDGUDW PLQLPDO \DQJPHPSXQ\DLDNDUGDQ
 &DUDPHQHQWXNDQDNDUSHUVDPDDQNXDGUDWGHQJDQUXPXVNXDGUDWLN



.HODV9,,,60307V

6HPHVWHU

ht

tp

://

Minta siswa untuk


menanyakan dan menulis
hal yang ingin mereka
ketahui dari Ayo Kita
Mengamati. Diskusikan
pertanyaan yang telah
diajukan siswa. Pilih
pertanyaan yang sesuai
dengan masalah.
Seandainya tidak ada
siswa yang mengajukan
pertanyaan, berikan
pertanyaan tentang
melengkapi kuadrat
sempurna.

$\R.LWD
0HQJJDOL,QIRUPDVL

266

Buku Guru Kelas VIII SMP/MTs

Semester 2

%HQWXN[E 

[

[ 
[ 
 
[ 

[ DWDX[ 

%HQWXND[E[F 
  [[



-DGLKLPSXQDQVHOHVDLDQQ\DDGDODK
^`

[[



=


x2 + x
x2+



x+




[


[



+ 



   







[








x1 =



+






x2 =







= 3

[


atau x2 = 3


Jadi, himpunan selesaiannya



adalah { , 3}


"

$\R.LWD
0HQDQ\D

Suruh siswa untuk


menanyakan dan menulis
hal yang ingin mereka
ketahui dari Ayo Kita
Mengamati. Diskusikan
pertanyaan yang telah
diajukan siswa. Pilih
pertanyaan yang sesuai
dengan masalah.
Seandainya tidak ada
siswa yang mengajukan
pertanyaan, berikan
pertanyaan tentang
melengkapi kuadrat
sempurna.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

x1 =

Ayo Kita
Menanya

.id

 





7HUNDLW GHQJDQ IRNXV SHUKDWLDQ GL DWDV FRED EXDWODK SHUWDQ\DDQ \DQJ PHPXDW VXDWX SHUVDPDDQ
NXDGUDW[E GDQD[E[F GHQJDQDEGDQFWHUWHQWX NDOLDQWHQWXNDQVHQGLUL 
0LVDO-LNDWHUGDSDWSHUVDPDDQNXDGUDW[[ 
PDQDNDKFDUD\DQJSDOLQJPXGDKXQWXNPHQHQWXNDQQLODLGDULSHUVDPDDQNXDGUDWWHUVHEXWDQWDUD
PHQJJXQDNDQFDUDPHPIDNWRUDQGHQJDQFDUDPHOHQJNDSNDQNXDGUDWVHPSXUQD"

$\R.LWD
0HQJJDOL,QIRUPDVL

8QWXN PHPSHUNXDW SHPDKDPDQ NDOLDQ WHQWDQJ SHUVDPDDQ NXDGUDW FRED NDOLDQ JDOL EHEHUDSD
LQIRUPDVLGDULEXNXUHIHUHQVLPDWHPDWLNDDWDXLQWHUQHWWHQWDQJKDOEHULNXW
 &DULODKSHUVDPDDQNXDGUDW PLQLPDO \DQJPHPSXQ\DLDNDUGDQ
 &DUDPHQHQWXNDQDNDUSHUVDPDDQNXDGUDWGHQJDQUXPXVNXDGUDWLN

.HODV9,,,60307V

6HPHVWHU

Menggali
Informasi

ht

tp

=+

://



1. Mintalah siswa pergi ke perpustakaan untuk mencari informasi dari buku referensi
Matematika atau internet.
2. Arahkan siswa untuk bekerja dan memanfaatkan waktu dengan sebaik mungkin,
kemudian kembali ke kelas dan periksa apakah pertanyaan sudah dijawab dengan
lengkap dan sesuai.
a. x2 1 = 0, 4x2 4 = 0
b. Cara menentukan akar persamaan kuadrat dengan rumus kuadratik.
3. Mintalah siswa menuliskan informasi yang diperolehnya pada buku tulis.
4. Periksalah apakah informasi yang diperoleh siswa tersebut telah sesuai/benar.
MATEMATIKA

267

Pembuktian Rumus Kuadratik


Dari bentuk umum persamaan kuadrat
ax2 + bx + c = 0
Bagi kedua ruas untuk mendapatkan a = 1

Tambahkan kedua ruas dengan

b
c
x=

a
a

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Dengan teknik melengkapkan kuadrat di ruas kiri diperoleh


2
b
b2
c

x
+

2
2a
a
4a

.id

x2 +

Tambahkan kedua ruas dengan

Lalu samakan penyebut di ruas kanan

Kedua ruas diakar (dipangkatkan setengah)

tp

://

Tambahkan kedua ruas dengan

ht

Sehingga didapat rumus kuadrat

268

Buku Guru Kelas VIII SMP/MTs

Semester 2

6HGLNLW
,QIRUPDVL
0XQJNLQNDOLDQSHUQDKPHQGHQJDUNDWD'LVNULPLQDQ'LVNULPLQDQ ' SDGDSHUVDPDDQNXDGUDW
D[E[F GHQJDQD"\DLWX' EDF

Sedikit
Informasi

&RQWRK 

1. Berikan siswa
kesempatan untuk
memahami informasi
yang tersaji tentang
Diskriminan pada
persamaan kuadrat.

D [[ 


E [[ 
$OWHUQDWLI
3HQ\HOHVDLDQ
'LVNULPDQ' EDF
D '   E'   

  

  '!  
 '

$\R.LWD
0HQDODU

2. Mintalah siswa
memperhatikan
contoh dan
penyelesaian dari
masalah yang
berkaitan dengan
diskriminan.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.DOLDQGDSDWPHQJLGHQWLNDVLMHQLVVHOHVDLDQSDGDVXDWXSHUVDPDDQNXDGUDWGHQJDQPHPSHUKDWLNDQ
GLVNULPLQDQQ\D

.id

7HQWXNDQGLVNULPLQDQGDQSDGDSHUVDPDDQNXDGUDWEHULNXW

%HUGDVDUNDQ KDVLO SHQJDPDWDQ NDOLDQ GDQ LQIRUPDVL \DQJ NDOLDQ GDSDWNDQ *XQDNDQ QDODU NDOLDQ
XQWXNPHPSHUGDODPSHPDKDPDQD\RQDODUNDQKDOEHULNXW
/HQJNDSLWDEHOEHULNXW
7DEHO'LVNULPLQDQGDQVHOHVDLDQDNDUSHUVDPDDQNXDGUDW
3HUVDPDDQNXDGUDW
[[ 
[[ 
[[ 
[ 
[[ 
[[ 
[[ 

'LVNULPLQDQ

+LPSXQDQ6HOHVDLDQ

^`





^`



^`





^`





Ayo Kita
Menalar

.HORPSRNNDQ MHQLVMHQLV VHOHVDLDQ SHUVDPDDQ NXDGUDW \DQJ NDOLDQ WHPXNDQ EHUGDVDUNDQ


GLVNULPLQDQQ\D
7XOLVNDQNHVLPSXODQ\DQJNDOLDQSHUROHKSDGDEXNXWXOLVNDOLDQ

ht

tp

://

0$7(0$7,.$



1. Dari hasil menggali


informasi, arahkan
siswa untuk
menalarkan sajian
pada tabel dan
melengkapi kolom
yang masih kosong,
sehingga diperoleh
kesimpulan yang
tepat, yaitu
Jika D > 1 maka
punya 2 akar real dan
berbeda
Jika D = 0 maka
punya 1 akar real
Jika D < 0 maka
tidak punya akar real
2. Mintalah siswa
menuliskan hasil
penalarannya pada
lembar kerja.
MATEMATIKA

269

$\R.LWD
%HUEDJL

Ayo Kita
Berbagi

"

/DWLKDQ 

 7HQWXDQDNDUSHUVDPDDQEHULNXW
D [ 
E [[ 
F [[ 
G [[ 


H [[  


D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

2. Mintalah mereka
memeriksa apakah
kedua jawabannya
memiliki makna yang
sama. Secara santun,
persilahkan mereka
saling berkomentar,
menanggapi komentar,
memberikan usul dan
menyepakati kalimatkalimat yang paling
tepat

6HWHODKNDOLDQPHQXOLVNDQSHQJDPDWDQPXVLODKNDQEHUEDJLGHQJDQWHPDQVHEDQJNX3HULNVDDSDNDK
NHGXDQ\D PHPLOLNL PDNQD \DQJ VDPD 6HFDUD VDQWXQ VLODKNDQ VDOLQJ EHUNRPHQWDU PHQDQJJDSL
NRPHQWDUPHPEHULNDQXVXOGDQPHQ\HSDNDWLNDOLPDWNDOLPDW\DQJSDOLQJWHSDW

.id

1. Ajak siswa untuk


menukarkan hasil
penalarannya dengan
teman sebangkunya.

 7HQWXNDQQLODLGLVNULPLQDQSDGDVHWLDSSHUVDPDDQQR

 -LNDQLODLGLVNULPLQDQSHUVDPDDQNXDGUDW[[F DGDODKPDNDWHQWXNDQQLODLF


 3HUVDPDDQ[T[ T  PHPSXQ\DLDNDUDNDU[GDQ[
-LND[[ PDNDWHQWXNDQQLODLT

3HUVDPDDQ P [ P [ PHPSXQ\DLDNDUNHPEDUPDNDQLODLP

 -LNDVDODKVDWXDNDUSHUVDPDDQNXDGUDW[ D [D DGDODKEHUDSDNDKQLODLD"

?!

Latihan



.HODV9,,,60307V

6HPHVWHU

ht

tp

://

Minta siswa untuk


menyelesaikan soal Latihan
2.2 dan di bahas di kelas
dengan menunjuk salah satu
siswa, sedang siswa yang
lain diminta menanggapi
dengan santun. Begitu
seterusnya untuk nomor soal
lainnya. Lakukan diskusi
baik secara klasikal maupun
kelompok untuk mengetahui
berbagai cara yang
digunakan siswa. Perhatikan
siswa yang masih
menggunakan penalaran
intuitifnya, namun jangan
pernah menyalahkannya.
270

1. Periksalah apakah semua siswa sudah mampu


menentukan akar persamaan kuadrat dengan
melengkapi kuadrat sempurna.
2. Mintalah siswa untuk melakukan refleksi dan
menuliskan hal penting dari apa yang telah
dipelajarinya.

Buku Guru Kelas VIII SMP/MTs

Semester 2

Membelajarkan 2.3
Penerapan Persamaan Kuadrat Dalam
Masalah Nyata

1. Sediakan lembar kertas HVS untuk hasil kerja siswa.


2. Buatlah tayangan slide LCD untuk menampilkan contoh aplikasi persamaan
kuadrat lainnya pada kehidupan nyata

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

1. Beri kesempatan siswa


berdiskusi dalam kelompok
untuk mengamati beberapa
contoh aplikasi persamaan
kuadrat dalam masalah
nyata.
2. Ajak mereka melakukan
refleksi terhadap contoh
yang tersedia untuk
memastikan siswa
memahami contoh tersebut
dengan baik.

.id

Sedikit
Informasi

Ayo
Kita Amati

ht

tp

://

1. Beri kesempatan
siswa berdiskusi
dalam kelompok untuk
mengamati beberapa
contoh aplikasi
persamaan kuadrat
dalam masalah nyata.
2. Ajak mereka
melakukan refleksi
terhadap contoh
yang tersedia untuk
memastikan siswa
memahami contoh
tersebut dengan baik.
3. Berikan contoh masalah
lain yang setara
melalui slide LCD dan
minta siswa mencoba
menyelesaikannya.

6HGLNLW
,QIRUPDVL

3HQHUDSDQ3HUVDPDDQ.XDGUDWGDODP0DVDODK1\DWD

.DOLDQWHODKPHPSHODMDULWHQWDQJSHUVDPDDQNXDGUDW&REDDSOLNDVLNDQSHUVDPDDQNXDGUDWWHUVHEXW
XQWXNPHQ\HOHVDLNDQPDVDODKVHKDULKDUL$PDWLODKFRQWRKEHULNXW
0DVDODK 

/XDVVHELGDQJWDQDKEHUEHQWXNSHUVHJLSDQMDQJDGDODKP-LNDSDQMDQJWDQDKLWXPOHELK
SDQMDQJGDULSDGDOHEDUQ\DEHUDSDNDKSDQMDQJGDQOHEDUVHELGDQJWDQDKWHUVHEXW"

$OWHUQDWLI3HPHFDKDQ0DVDODK

0LVDOQ\DSDQMDQJWDQDK
OHEDUWDQDK
PDNDS

/XDVWDQDK



[ [
[  [

SPHWHU
[PHWHU
[ PHWHU
[S
[S
[ [



[ DWDX[ 

[ DWDX[ 


.DUHQDXNXUDQSDQMDQJSDGDVHELGDQJWDQDKWLGDNSHUQDKQHJDWLIPDND[\DQJPHPHQXKLDGDODK
[ 
8QWXN[ PDNDSDQMDQJWDQDKDGDODK[ 
-DGLSDQMDQJGDQOHEDUWDQDKWHUVHEXWDGDODKPHWHUGDQPHWHU

0DVDODK 
.HOLOLQJVXDWXWDPDQNRWD\DQJEHUEHQWXN
SHUVHJLSDQMDQJDGDODKP
-LNDOXDVWDPDQP
EHUDSDSDQMDQJGDQOHEDUQ\D"

0$7(0$7,.$

MATEMATIKA



271

$OWHUQDWLI3HPHFDKDQ0DVDODK

0LVDOQ\DSDQMDQJWDQDK

SPHWHU

SDQMDQJOHEDU


NHOLOLQJ


PDNDS
[ PHWHU
OHEDU
S
3HUVDPDDQ3DQMDQJOHEDU /XDV
S S 


SS
SS

S  S

S  DWDXS 
8QWXNS PDNDOHEDUDGDODK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

8QWXNS PDNDOHEDUDGDODK 

.id

S DWDXS 

-DGLSDQMDQJGDQOHEDUWDPDQNRWDDGDODKPGDQP
&RQWRK 

-LNDVD\DPHQDPEDKNDQFPSDGDVDODKVDWXVLVLVXDWXSHUVHJLGDQPHQDPEDKNDQFPSDGD
VLVL\DQJODLQVD\DPHPSHURODKSHUVHJLSDQMDQJ\DQJOXDVQ\DVDPDGHQJDQGXDNDOLOXDVSHUVHJL
VHPXOD%HUDSDNDKSDQMDQJVLVLSHUVHJLVHPXOD"
3HQ\HOHVDLDQ

-LNDNLWDPLVDONDQSDQMDQJVLVLSHUVHJLVHPXODDGDODKVPDNDLQIRUPDVL\DQJNLWDGDSDWNDQGDSDW
GLQ\DWDNDQVHEDJDLEHULNXW

 u V

 V   u V  

 V   V  



V 

V   V  

ht

tp

://

  V   V  
V DWDXV 
V DWDXV 
NDUHQDXNXUDQSDQMDQJWLGDNPXQJNLQQHJDWLIPDNDSDQMDQJSHUVHJLVHPXODDGDODKFP



.HODV9,,,60307V

6HPHVWHU

Ajak siswa untuk menentukan model persamaan kuadrat dan langkah-langkah


dalam menentukan selesaiannya.

272

Buku Guru Kelas VIII SMP/MTs

Semester 2

7XJDV
3URMHN

Merangkum

&DULODKWHPDQSDVDQJDQXQWXNPHQGLVNXVLNDQWXJDVEHULNXW
7HPXNDQPDVDODKODLQ\DQJWHUNDLWSHUVDPDDQNXDGUDWGDQVHOHVDLDQQ\DGDODPNHKLGXSDQ
VHKDULKDUL
7XOLVNDQMDZDEDQNDOLDQSDGDOHPEDUNHUWDVGHQJDQUDSLGDQOHQJNDS.HPXGLDQSDMDQJNDQ
KDVLOSUR\HNNDOLDQSDGDSDSDQSHPDMDQJDQ

0HUDQJNXP 
.DOLDQWHODKPHPSHODMDULWHQWDQJSHUVDPDDQNXDGUDWGDQDSOLNDVLQ\DGDODPNHKLGXSDQVHKDULKDUL
-DZDEODKEHEHUDSDSHUWDQ\DDQEHULNXWXQWXNPHPDQWDSNDQKDOSHQWLQJ\DQJSHUOXGLSHUKDWLNDQ
SDGDPDWHULSHUVDPDDQNXDGUDW
 -HODVNDQGHQJDQFRQWRKVRDOWHQWDQJFDUDXQWXNPHQHQWXNDQDNDUDNDUSHUVDPDDQNXDGUDW

8ML
.RPSHWHQVL

6HOHVDLNDQVRDOEHULNXWGHQJDQWHOLWL

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

"

.id

 -HODVNDQWHQWDQJGHVNULPLQDQSDGDSHUVDPDDQNXDGUDW

 8EDKODKSHUVDPDDQ[ [GDODPEHQWXNXPXPSHUVDPDDQNXDGUDW


 &DULODKKLPSXQDQVHOHVDLDQGDULSHUVDPDDQNXDGUDWEHULNXW


D [[ 

E [[ 

F [[ 

Persamaan kuadrat dari variabel x


mempunyai bentuk umum
ax2 + bx + c = 0
dengan a, b, c, adalah konstanta
real dan a 0
Nilai pengganti x yang
menyebabkan pernyataan
menjadi benar disebut akar
atau penyelesaian dari
persamaan kuadrat.
Beberapa cara untuk
menentukan akar-akar
persamaan kuadrat :
a. Memfaktorkan, untuk
bentuk persamaan
kuadrat ax2 + bx + c
= 0 maka kita harus
menentukan dua bilang
yang jika dijumlahkan
hasilnya b dan dikalikan
menghasilkan c.
b. Melengkapi kuadrat
sempurna, merubah
bentuk persamaan
kuadrat menjadi bentuk
kuadrat sempurna.
c. Rumus kuadratik
b 2 + 4ac
b
x=

2a
2a
Diskriminan (D) adalah istilah
pada rumus kuadratik yang
dapat menetukan jenis akarakar persamaan kuadrat.
D = b2 4ac
Jika D > 1 maka punya 2 akar
real dan berbeda
Jika D = 0 maka punya 1 akar
real (akar yang sama)
Jika D < 0 maka tidak punya
akar real.

 %DJDLPDQDEHQWXNSHUVDPDDQNXDGUDW\DQJDNDUDNDUQ\DGDQ"

 1\DWDNDQSHUVDPDDQ [  [ [ GDODPEHQWXNXPXPSHUVDPDDQNXDGUDW


 7HQWXNDQKLPSXQDQVHOHVDLDQSHUVDPDDQNXDGUDW[[ MLND[5

 -XPODKGXDELODQJDQFDFDKDGDODK-LNDKDVLONDOLGXDELODQJDQLWX7HQWXNDQNHGXD
ELODQJDQFDFDK\DQJGLPDNVXG

 3HUVDPDDQNXDGUDW[[ PHPSXQ\DLDNDUDNDU[GDQ[3HUVDPDDQNXDGUDW\DQJ


DNDUDNDUQ\D[GDQ[DGDODK



ht

tp

://

0$7(0$7,.$

Tugas
Projek

1. Beri kebebasan siswa mencari pasangan


teman untuk mengerjakan tugas projek.
2. Mintalah siswa menulis hasil karyanya
pada lembar kertas dengan rapi dan
lengkap.
3. Kemudian memajangkan hasil projek pada
papan pemajangan.

MATEMATIKA

273

 $NDUDNDU SHUVDPDDQ [  [  P     DGDODK  GDQ  -LND    PDND QLODL P
DGDODK
 -LNDSGDQTDGDODKDNDUDNDUSHUVDPDDQ[[ PDNDSHUVDPDDQNXDGUDWEDUX\DQJ
DNDUDNDUQ\DSGDQTDGDODK
$NDUDNDUSHUVDPDDQNXDGUDW[ D [ DGDODKGDQ


-LND GDQD!PDNDQLODLD"

SHUKDWLNDQJDPEDUGLEDZDKLQL

&

'

[

6HJLWLJD $&% VLNXVLNX GL & -LND %'  [    FP $'  [ GDQ &'   FP WHQWXNDQ
SDQMDQJ%'

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id



3HUVDPDDQNXDGUDW[D[E PHPSXQ\DLDNDUDNDUGHQJDQSHUEDQGLQJDQ[[ 


MLNDDE PDNDWHQWXNDQSHUVDPDDQNXDGUDW\DQJDNDUDNDUQ\DDGDQE

.HOLOLQJVHEXDKNHEXQ\DQJEHUEHQWXNSHUVHJLSDQMDQJDGDODKP-LNDOXDVNHEXQWHUVHEXW
DGDODKPEHUDSDNDKSDQMDQJGLDJRQDONHEXQWHUVHEXW"

6XPEHUXQWXERJDQJEORJGHWLNFRP

://

Dari uraian di atas, dapat


disimpulkan
bahwa persamaan
kuadrat adalah
persamaan yang
mempunyai
satu variabel berpangkat.

.HODV9,,,60307V

6HPHVWHU

ht

tp



1. Siswa sudah mampu membuat model persamaan kuadrat dari suatu masalah dan

menentukan akar-akar persamaannya dengan berbagai cara.

2. Mintalah siswa untuk melakukan refleksi dan menuliskan hal penting dari apa

yang telah dipelajarinya.

274

Buku Guru Kelas VIII SMP/MTs

Semester 2

=+

SoalPengayaan

1. Ubahlah persamaan 2x2 = 3x 8 ke dalam bentuk umum persamaan kuadrat.


2. Carilah himpunan selesaian dari persamaan kuadrat berikut.
a. x2 5x + 6 = 0
b. x2 + 2x 15 = 0
c. x2 + 4x 12 = 0
3. Bagaimana bentuk persamaan kuadrat yang akar-akarnya 2 dan 5?

.id

d. 2x2 5x 3 = 0
4. Nyatakan persamaan 2(x2 + 1) = x(x + 3) ke dalam bentuk umum persamaan kuadrat !

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

5. Tentukan himpunan selesaian persamaan kuadrat 2x2 5x 3 = 0, jika x R!

6. Jumlah dua bilangan cacah adalah 12. jika hasil kali dua bilangan itu 35. Tentukan
kedua bilangan cacah yang dimaksud !
7. Persamaan kuadrat x2 5x + 6 = 0 mempunyai akar-akar x1 dan x2 . Persamaan
kuadrat yang akar- akarnya x1 3 dan x2 3 adalah...
a. x2 2x = 0

b. x2 2x + 30 = 0
c. x2 + x = 0

d. x2 + x 30 = 0

e. x2 + x + 30 = 0

8. Akar-akar persamaan 2x2 6x + 2m 1 = 0 adalah dan . Jika = 2, maka nilai m


adalah.....

://

a. 3
c. 3/2

e. 1/2

tp

b. 5/2

d. 2/3

ht

9. Jika p dan q adalah akar-akar persamaan x2 5x 1 = 0, maka


persamaan kuadrat baru yang akar-akarnya 2p + 1 dan 2q + 1 adalah.....
a. x2 + 10x + 11 = 0
b. x2 10x + 7 = 0
c. x2 10x + 11 = 0
d. x2 12x + 7 = 0
e. x2 12x 7 = 0
MATEMATIKA

275

10. Akar-akar persamaan kuadrat x2 + (a 1)x + 2 = 0 adalah dan .Jika = 2 dan


a > 0 maka nilai a =...
a. 2

d. 6

b. 3

e. 8

c. 4
11. Jika p dan q adalah akar-akar persamaan x2 5x 1 = 0, maka persamaan kuadrat
baru yang akar-akarnya 2p + 1 dan 2q + 1 adalah....
a. x2 + 10 x = 11
b. x2 10x + 7

.id

c. x2 10x + 11
e. x2 12x 7

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

d. x2 12x + 7

12. Akar-akar persamaan kuadrat 2x2 + mx + 16 = 0 adalah dan . Jika = 2 dan ,


positif, maka nilai m =......
a. 12

d. 8

b. 6

e. 12

c. 6

13. Akar-akar persamaan 3x2 12x + 2 = 0 adalah dan . Persamaan


kuadrat baru yang akar- akarnya ( + 2) dan ( + 2) adalah.

a. 3x2 24x + 38 = 0
b. 3x2 + 24x + 38 =0

c. 3x2 24x 38 = 0

://

d. 3x2 24x + 24 = 0

tp

e. 3x2 24x 24 = 0

ht

14.Persamaan kuadrat x2 5x + 6 = 0 mempunyai akar akar x1 dan x2. Persamaan


kuadrat yang akar akarnya x1 3 dan x2 3 adalah
a. x2 2x = 0

b. x2 2x + 30 = 0
c. x2 + x = 0
d. x2 + x 30 = 0
e. x2 + x + 30 = 0

276

Buku Guru Kelas VIII SMP/MTs

Semester 2

15.Pak Musa mempunyai kebun berbentuk persegi panjang dengan luas 192 m2. Selisih
panjang dan lebarnya adalah 4 m. Apabila disekeliling kebun dibuat jalan dengan
lebar 2 m, maka luas jalan tersebut adalah m2.
a. 96
b. 128
c. 144
d. 156
e. 168
16. Persamaan 2x2 + qx + (q 1) = 0 mempunyai akar akar x1 dan x2. Jika x12 + x22 = 4,
maka nilai q =

c. -4 dan 4
d. -3 dan 5
e. -2 dan 6

Jika nilai diskriminan persamaan kuadrat 2x2 9x + c = 0 adalah 121, maka c =


a. -8
b. -5
c. 2
d. 5
e. 8

Persamaan (1 m)x2 + (8 2m)x + 12 = 0 mempunyai akar kembar, maka nilai m =


a. -2
c. 0

ht

b. -3/2

://

18.

tp

17.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

b. -6 dan -2

.id

a. -6 dan 2

d. 3/2
e. 2

19. Kemiringan garis yang melalui titik (m, -6) dan (7, 2m) adalah m.
Berapakah nilai m?
20. Jika a dan b merupakan akar-akar dari persamaan x2 + x + 1 = 0, maka nilai dari
a2011 + b2011 adalah ...

MATEMATIKA

277

Pedoman
Penilaian
Capaian
B

Keterangan
Bila Buku Siswa terselesaikan dengan baik

<B

Bila ada bagian dari Buku Siswa yang tidak


terselesaikan

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan mampu menyelesaikannya dengan
baik

Portofolio:
a) Uji Kompetensi
b) Soal dari tempat
lain

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Aspek Penilaian
Keterselesaian Buku
Siswa

.id

No
1

B+

Bila memilih soal dari Uji Kompetensi dengan


kategori Sedang dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Mudah dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan kurang mampu
menyelesaikannya dengan baik

B , B
B+, B,
B

Bila memilih soal dari Uji Kompetensi


A, B+ , dengan kategori Mudah dan kurang mampu
B, B menyelesaikannya dengan baik
Bila Proyek terselesaikan dan manpu
A
mempresentasikan dengan Baik
A, B+, Bila ada bagian dari Proyek yang tidak terselesaikan
atau kurang mampu mempresentasikan
B

://

ht

tp

Tugas Projek

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan kurang mampu menyelesaikannya
dengan baik
Bila memilih soal dari Uji Kompetensi
dengan kategori Sedang dan kurang mampu
menyelesaikannya dengan baik

Bila Proyek tidak terselesaikan samasekali

Keterangan: - Nilai KKM = B





278

- Aspek penilaian Nomor 1 adalah syarat nilai yang


harus terpenuhi, sedangkan Aspek penilaian Nomor 2
adalah penambahan nilai.

Buku Guru Kelas VIII SMP/MTs

Semester 2

Bab 3

Lingkaran
Kata Kunci
Lingkaran
Busur
Juring
pi ()

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

K ompetensi
D asar

.id

1. Mengidentikasi unsur,
keliling, dan luas dari
lingkaran.
2. Menentukan hubungan
sudut pusat, panjang
busur, dan luas juring.
3. Menyelesaikan
permasalahan nyata
yang terkait penerapan
hubungan sudut pusat,
panjang busur, dan luas
juring.

3.
4.
5.
6.
7.

tp

2.

Mengidentikasi unsur-unsur
lingkaran.
Memahami hubungan antar
unsur pada lingkaran.
Mengidentikasi luas
juring dan panjang busur
lingkaran.
Menentukan hubungan sudut pusat dengan panjang busur.
Menentukan hubungan sudut pusat dengan luas juring.
Menentukan hubungan sudut pusat dengan sudut keliling.
Menyelesaikan permasalahan nyata yang terkait penerapan hubungan sudut pusat,
panjang busur, dan luas juring.

ht

1.

://

Pengalaman
Belajar

Lingkaran adalah salah satu bentuk geometri datar yang


banyak kita temui dan kita manfaatkan dalam kehidupan
sehari-hari. Lingkaran berguna dalam banyak bidang
kehidupan, misal: olah raga, arsitektur, dan teknologi.
Banyak alat olah raga yang memanfaatkan bentuk
lingkaran seperti pada bentuk lapangan silat, papan
target panahan, dan keranjang basket. Bagi seorang
arsitek, bentuk lingkaran dinilai memiliki bentuk yang
indah untuk mendekorasi rumah, maupun gedung
perkantoran. Seperti bentuk pintu, jendela, atap rumah.
Kemudian, pada bidang teknologi bentuk lingkaran juga
sering kita jumpai, seperti roda mobil, roda motor, setir
mobil memanfaatkan bentuk lingkaran.

MATEMATIKA
59
MATEMATIKA

279

Peta
Konsep

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Lingkaran

Hubungan
Sudut Pusat,
Panjang Busur,
dan Luas
Juring

Menyelesaikan
Permasalahan
Nyata Yang
Terkait Penerapan
Hubungan Sudut
Pusat, Panjang
Busur, Dan Luas
Juring

ht

tp

://

Unsur-Unsur
Lingkaran

280

Buku
Guru
Kelas VIII SMP/MTs
Kelas VIII SMP/MTs
60

Semester
2
Semester 2

Zu Chungzhi lahir di kota Jiankang


(Nanjing), Tiongkok pada tahun
429M. Sejak kecil ia sangat cerdas
dan suka pengetahuan di bidang
matematika dan astronomi. Pada
tahun 464, Zu Chungzhi mulai tertarik
untuk menemukan bilangan . Dari
sekiah ahli matematika Tiongkok
yang berupaya menemukan bilangan
, Zu Chungzhi mampu menemukan
bilangan yang paling akurat dengan
yang saat ini kita gunakan.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Sebelum Zu Chungzhi, ahli


matematika Tiongkok Liu Hui
mengajukan cara ilmiah untuk
menghitungkan , dengan panjang
keliling poligon beraturan di dalam
lingkaran untuk mendekati panjang
Zu Chongzhi
keliling lingkaran yang asli. Dengan
(429 - 500 M)
cara ini Liu Hui berhasil menemukan
sampai 4 angka dibelakang koma.
Sedangkan melalui penelitian pada
abad ke-50, Zu Chungzhi mampu menemukan bilangan dengan ketelitian sampai
6 angka di belakang koma dibandingkan dengan bilangan saat ini. Zu Chungzhi
juga menemukan nilai mirip dalam bentuk bilangan pecahan 355 .
113

Teladan yang bisa dicontoh dari Zu Chungzhi antara lain:

Zu Chungzhi adalah seorang yang tekun dan gigih dalam berusaha. Meskipun orangorang sebelumnya sudah menemukan yang sudah mendekati, Zu Chungzhi tetap
gigih berusaha untuk menemukan yang lebih mendekati.

ht

tp

://

Sebagai seorang Tiongkok, Zu Chungzhi punya keingintahuan terhadap ilmu


pengetahuan yang besar. Selain menemukan , Zu Chungzhi juga banyak menemukan
penemuan di bidang astronomi.

MATEMATIKA
281
61

281

Membelajarkan 3.1
Mengidentifikasi Unsur-unsur Lingkaran

.id

1. Persiapkan benda-benda sebagai model lingkaran (misal: ban sepeda, gelang


tangan, cincin, dll).Kalau sudah ada di lingkungan sekolah atau di dalam kelas,
tinggal menunjukkan kepada siswa saja.
2. Ingatkan kembali materi garis dan sudut.
3. Jika dirasa kurang kontekstual dengan daerahnya, silahkan mengembangkan
masalah sendiri, selain masalah yang disajikan di buku siswa.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

8QVXU8QVXU
/LQJNDUDQ

/LQJNDUDQDGDODKKLPSXQDQVHPXDWLWLNWLWLNSDGDELGDQJGDWDU\DQJEHUMDUDNVDPDWHUKDGDS
VXDWXWLWLNWHUWHQWX\DQJGLVHEXWWLWLNSXVDW-DUDN\DQJVDPDWHUVHEXWGLVHEXWMDULMDUL

/LQJNDUDQDGDODKVDODKVDWXNXUYDWXWXSVHGHUKDQD\DQJPHPEDJLELGDQJ
PHQMDGLGXDEDJLDQ\DLWXEDJLDQGDODPGDQEDJLDQOXDUOLQJNDUDQ

1DPD OLQJNDUDQ ELDVDQ\D VHVXDL GHQJDQ QDPD WLWLN SXVDWQ\D 3DGD


JDPEDUGLVDPSLQJFRQWRKEHQWXNOLQJNDUDQ3-DUDN\DQJWHWDSDQWDUD
WLWLNSDGDOLQJNDUDQGHQJDQSXVDWOLQJNDUDQGLQDPDNDQMDULMDULELDVDQ\D
GLVLPERONDQU

6HODLQ WLWLN SXVDW GDQ MDULMDUL PDVLK EDQ\DN LVWLODK \DQJ EHUNDLWDQ
GHQJDQ OLQJNDUDQ \DQJ DNDQ NLWD SHODMDUL SDGD .HJLDWDQ  'HQJDQ
SHPDKDPDQWHQWDQJLVWLODKLVWLODKWHUVHEXWNDOLDQELVDPHPHFDKNDQEHUEDJDLPDVDODK\DQJWHUNDLW
GHQJDQOLQJNDUDQ
6HSHUWL \DQJ GLXQJNDSNDQ SDGD SHQJDQWDU %DE /LQJNDUDQ EHQWXNEHQWXN OLQJNDUDQ EDQ\DN NLWD
MXPSDLGDODPNHKLGXSDQVHKDULKDUL%HULNXWLQLEHEHUDSDPDVDODKVHKDULKDUL\DQJEHUNDLWDQGHQJDQ
OLQJNDUDQ%LVDNDKNDOLDQPHQHPXNDQVROXVLQ\D"

Ajak siswa untuk


memahami pengertian
lingkaran. Minta beberapa
siswa untuk membuat
gambar lingkaran di
papan.

0DVDODK 

ht

tp

://

6HRUDQJWXNDQJND\X\DQJPHPEXDWSHUDODWDQUXPDKWDQJJD
SHUOX XQWXN PHPRWRQJ SDSDQ \DQJ EHUEHQWXN SHUVHJL DWDX
SHUVHJLSDQMDQJ PHQMDGL OLQJNDUDQ 7XNDQJ ND\X WHUVHEXW
PHQHPXL PDVDODK XQWXN PHQHQWXNDQ WLWLN SXVDW OLQJNDUDQ
\DQJ DNDQ GLEXDW 'DSDWNDK NDOLDQ PHPEDQWX WXNDQJ ND\X
DJDU PHQGDSDWNDQ EHQWXN OLQJNDUDQ VHEHVDU PXQJNLQ GDUL
SDSDQSDSDQWHUVHEXW"

Ajak siswa untuk


memahami Masalah 3.1
serta alternatif
pemecahannya.
Ajak siswa untuk
mempraktikkan langkah
alternatif pemecahan
Masalah 3.1 (dengan
sketsa).
282

6XPEHUSXVDWKDODOFRP

*DPEDU7XNDQJND\X

$OWHUQDWLI3HPHFDKDQ0DVDODK
/DQJNDK 6NHWVDODKEHQWXNSHUVHJLSDGDSDSDQWHUVHEXW
/DQJNDK *DPEDUODKNHGXDGLDJRQDOSHUVHJLWHUVHEXWKLQJJDEHUWHPXGLVDWXWLWLN
/DQJNDK /LQJNDUDQELVDGLJDPEDUGHQJDQSXVDWWLWLNWHUVHEXWGDQMDULMDULVHWHQJDKSDQMDQJ
VLVLSHUVHJL



.HODV9,,,60307V

Buku Guru Kelas VIII SMP/MTs

6HPHVWHU

Semester 2

0DVDODK 

*DPEDUGLVDPSLQJDGDODKIRWR
VDODK VDWX SHQLQJJDODQ VHMDUDK
\DLWX VWRQHKHQJH \DQJ EHUDGD
GL ,QJJULV 6HRUDQJ DUNHRORJ
PHQGXJDEHQWXNXWXKVWRQHKHQJH
DGDODKOLQJNDUDQ1DPXQGLDWLGDN
ELVDPHQHQWXNDQEHUDSDNDKMDULMDUL
OLQJNDUDQGDULVXVXQDQVWRQHKHQJH
NDUHQD EHQWXNQ\D KDQ\D EHUXSD
EXVXU $QGDLNDQ NDOLDQ PHQMDGL
SHQHPX WHUVHEXW DSD \DQJ NDOLDQ
ODNXNDQ XQWXN PHQHQWXNDQ SRVLVL
WLWNSXVDWVWRQHKHQJHGDQPHPEXDW
VNHWVDOLQJNDUDQ

6XPEHUMRQRVEURWKHUVZRUGSUHVVFRP

.id

*DPEDU6WRQHKHQJH

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

$OWHUQDWLI3HPHFDKDQ0DVDODK

/DQJNDK

%XDWODKVNHWVDGDULEHQWXNVWRQKHQJHWHUVHEXW

/DQJNDK

%XDWODKGXDUXDVJDULVOXUXV\DQJWHUEHQWXNGDULGXDSDVDQJWLWLNSDGDOLQJNDUDQ

/DQJNDK

%XDWODK JDULV EDJL WHJDN OXUXV SDGD NHGXD UXDV JDULV \DQJ NDOLDQ EXDW .HGXD
JDULVEDJLWHUVHEXWEHUSRWRQJDQWHSDWGLVDWXWLWLN7LWLNWHUVHEXWDGDODKWLWLNSXVDW
OLQJNDUDQ

/DQJNDK

8NXUODKMDUDNDQWDUDWLWLNSXVDWWHUVHEXWGHQJDQVXDWXWLWLNSDGDOLQJNDUDQ\DQJ
VHODQMXWQ\DGLVHEXWMDULMDUL

/DQJNDK

'HQJDQ WLWLN SXVDW GDUL MDULMDUL WHUVHEXW NDOLDQ ELVD PHQJJDPEDU XNXUDQ XWXK
VWRQHKHQJH

'DULGXDFRQWRKSHUPDVDODKDQWHUVHEXWWHODKGLVDMLNDQPDQIDDWOLQJNDUDQGDODPNHKLGXSDQWXNDQJ
ND\XGDQDUNHRORJ8QWXNPHQJLNXWLODQJNDKODQJNDKWHUVHEXWWHQWXQ\DEXNDQSHUPDVDODKDQ\DQJ
VXVDK0DVDODKQ\DDGDODK0HQJDSDODQJNDKODQJNDKWHUVHEXWEHQDU"8QWXNPHQMDZDESHUWDQ\DDQ
WHUVHEXWNDOLDQKDUXVPHPDKDPLLVWLODKLVWLODK\DQJWHUNDLWGHQJDQOLQJNDUDQVHODQMXWQ\DGLVHEXW
XQVXUXQVXU OLQJNDUDQ 0DVLK EDQ\DN ODJL SHUPDVDODKDQ \DQJ ELVD NDOLDQFDUL VROXVLQ\D GHQJDQ
PHPDKDPLXQVXUXQVXUOLQJNDUDQ3DGD.HJLDWDQNDOLDQDNDQDNDQPHODNXNDQDNWLWDVXQWXN
PHPDKDPLEHEHUDSDXQVXUOLQJNDUDQVHUWDKXEXQJDQDQWDUEHEHUDSDXQVXUOLQJNDUDQ



tp

://

0$7(0$7,.$

ht

Ajak siswa untuk memahami Masalah 3.2 serta alternatif pemecahannya. Ajak siswa
untuk mempraktikkan langkah alternatif pemecahan Masalah 3.2 (dengan sketsa).
Ajak siswa untuk menyepakati tentang istilah unsur-unsur lingkaran yang akan digunakan seterusnya pada Bab Lingkaran.

MATEMATIKA

283

0HQJLGHQWLNDVL
8QVXUXQVXU/LQJNDUDQ

.HJLDWDQ 

3HQJDODPDQEHODMDU\DQJGLKDUDSNDQVHWHODKNDOLDQPHODNXNDQNHJLDWDQDGDODK
 0DPSXPHQGHQLVLNDQXQVXUXQVXUOLQJNDUDQGHQJDQNDOLPDWVHQGLUL
 0DPSXPHPDKDPLKXEXQJDQDQWDUXQVXUXQVXUOLQJNDUDQ
 0DPSXPHQ\HOHVDLNDQSHUPDVDODKDQ\DQJWHUNDLWGHQJDQXQVXUXQVXUOLQJNDUDQ
.DWDXQVXUXQVXUOLQJNDUDQGDODPEDKDVDQLQLDGDODKLVWLODK\DQJWHUNDLWGHQJDQOLQJNDUDQ8QVXU
XQVXU\DQJDNDQNLWDSHODMDULSDGDNHJLDWDQLQLDQWDUDODLQ

Ajak siswa untuk memahami tujuan dari Kegiatan


3.1.

D 8QVXUOLQJNDUDQEHUXSDJDULV DWDXUXDVJDULV EXVXU EXVXUEHVDUEXVXUNHFLO WDOLEXVXUMDUL


MDULGLDPHWHUDSRWHPD
E 8QVXUOLQJNDUDQEHUXSDOXDVDQ-XULQJWHPEHUHQJ
%HULNXWGLVDMLNDQEHQWXNPDVLQJPDVLQJXQVXUOLQJNDUDQ\DQJGLPDNVXGGLDWDV3HUKDWLNDQEDJLDQ
GHQJDQWDQGDZDUQDPHUDKVHUWDFLULFLULGDULVHWLDSXQVXUWHUVHEXW6LODNDQNDOLDQPHUDQJNDLNDOLPDW
GDULSHPDKDPDPNDOLDQWHUKDGDSJDPEDUGDQFLULFLUL\DQJGLVDMLNDQEHULNXW

.id

$\R
.LWD$PDWL

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

D 8QVXUXQVXUOLQJNDUDQ\DQJEHUXSDJDULVGDQFLULFLULQ\D
%XVXU

&LULFLUL
i %HUXSDNXUYDOHQJNXQJ
i %HUKLPSLWGHQJDQOLQJNDUDQ
i -LNDNXUDQJGDULVHWHQJDKOLQJNDUDQ EXVXUPLQRU
-LNDOHELKGDULVHWHQJDKOLQJNDUDQ EXVXUPD\RU

.HWHUDQJDQ
8QWXNVHODQMXWQ\DMLNDWLGDNGLVHEXWNDQPD\RUDWDXPLQRUPDND\DQJGLPDNVXGDGDODKPLQRU
6LPERO$'$&'GDQ67

'

'

PLQRU

PD\RU

.HODV9,,,60307V

&

6HPHVWHU

tp

://



ht

Ayo
Kita Amati

Ajak siswa untuk


mengamati ciri-ciri busur
lingkaran yang dilengkapi
dengan bentuk visualnya.
Minta siswa untuk
mengamati bagian yang
berwarna merah pada setiap
gambar.
284

Buku Guru Kelas VIII SMP/MTs

Semester 2

-DULMDUL
&LULFLUL
i %HUXSDUXDVJDULV
i 0HQJKXEXQJDQWLWLNSDGDOLQJNDUDQGHQJDQWLWLNSXVDW
3HQXOLVDQVLPERO 2'  30 GDQ 46 
'

0
2

'LDPHWHU

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

&LULFLUL
i %HUXSDUXDVJDULV
i 0HQJKXEXQJNDQGXDWLWLNSDGDOLQJNDUDQ
0HODOXLWLWLNSXVDWOLQJNDUDQ
0

'
2

Ajak siswa untuk


mengamati ciri-ciri
jari-jari lingkaran yang
dilengkapi dengan bentuk
visualnya. Minta siswa
untuk mengamati bagian
yang berwarna merah
pada setiap gambar. Ajak
siswa untuk memahami
penulisan simbol jari-jari
(ruas garis)

7DOLEXVXU

&LULFLUL
i %HUXSDUXDVJDULV
i 0HQJKXEXQJNDQGXDWLWLNSDGDOLQJNDUDQ
)

ht

tp

://

0$7(0$7,.$



Ajak siswa untuk


mengamati ciri-ciri
diameter lingkaran yang
dilengkapi dengan bentuk
visualnya. Minta siswa
untuk mengamati bagian
yang berwarna merah
pada setiap gambar.
Ajak siswa untuk
mengamati ciri-ciri tali
busur lingkaran yang
dilengkapi dengan bentuk
visualnya. Minta siswa
untuk mengamati bagian
yang berwarna merah
pada setiap gambar.
MATEMATIKA

285

$SRWHPD
&LULFLUL
i %HUXSDUXDVJDULV
i 0HQJKXEXQJNDQWLWLNSXVDWGHQJDQVDWXWLWLNGLWDOLEXVXU
i 7HJDNOXUXVGHQJDQWDOLEXVXU
)

7LGDNPHPLOLNLDSRWHPD
WHUKDGDSWDOLEXVXU68 GL
*DPEDUWDOLEXVXU

% 8QVXUXQVXU/LQJNDUDQ\DQJ%HUXSD/XDVDQGDQ&LULFLULQ\D

.id

-XULQJ
&LULFLUL
i %HUXSDGDHUDKGLGDODPOLQJNDUDQ
i 'LEDWDVLROHKGXDMDULMDULGDQVDWXEXVXUOLQJNDUDQ
i -DULMDUL\DQJPHPEDWDVLPHPXDWWLWLNXMXQJEXVXUOLQJNDUDQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Ajak siswa untuk


mengamati ciri-ciri
apotema lingkaran yang
dilengkapi dengan bentuk
visualnya.
Minta siswa untuk
mengamati bagian yang
berwarna merah pada
setiap gambar. Untuk tali
busur yang dimaksud
untuk menjelaskan
apotema adalah sesuai
dengan tali busur pada
gambar tali busur di
halaman 65 buku siswa.

PLQRU

PD\RU
3

7HPEHUHQJ

&LULFLUL
i %HUXSDGDHUDKGLGDODPOLQJNDUDQ
i 'LEDWDVLROHKWDOLEXVXUGDQEXVXUOLQJNDUDQ

PLQRU



.HODV9,,,60307V

PD\RU

6HPHVWHU

ht

tp

://

Ajak siswa untuk


mengamati ciri-ciri juring
lingkaran yang dilengkapi
dengan bentuk visual
masing-masing. Minta
siswa untuk mengamati
bagian yang berwarna
merah pada setiap
gambar.

Ajak siswa untuk


mengamati ciri-ciri
tembereng lingkaran yang
dilengkapi dengan bentuk
visualnya. Minta siswa
untuk mengamati bagian
yang berwarna merah pada
setiap gambar.

286

Buku Guru Kelas VIII SMP/MTs

Semester 2

6HODLQLVWLODK\DQJGLVDMLNDQDGDVDWXLVWLODKODJL\DQJHUDWNDLWDQQ\DGHQJDQOLQJNDUDQ\DLWXVXGXW
SXVDW3HUKDWLNDQJDPEDUGDQFLULFLULQ\DEHULNXW

6XGXWSXVDW
DET
&LULFLUL
i 7HUEHQWXNGDULGXDVLQDUJDULV NDNLVXGXW
i .DNLVXGXWEHUKLPSLWGHQJDQMDULMDULOLQJNDUDQ
i 7LWLNVXGXWEHUKLPSLWGHQJDQWLWLNSXVDWOLQJNDUDQ
$2%

-3*

.4-

Ajak siswa untuk


mengamati ciri-ciri sudut
pusat lingkaran yang
dilengkapi dengan bentuk
visualnya. Minta siswa
untuk mengamati bagian
yang berwarna merah pada
setiap gambar.

3
*

 7DOLEXVXUDGDODK
 -DULMDULDGDODK
 'LDPHWHUDGDODK
 $SRWHPDDGDODK
 -XULQJDGDODK
 7HPEHUHQJDGDODK
 6XGXWSXVDWDGDODK

Setelah mengamati ciriciri tiap unsur-unsur lingkaran, minta siswa untuk


membuat pengertian tiap
unsur tersebut dengan kalimat mereka sendiri.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 %XVXUDGDODK

.id

'DUL SHQJDPDWDQ NDOLDQ SDGD JDPEDUJDPEDU XQVXUXQVXU OLQJNDUDQ UDQJNDLODK SHQJHUWLDQ WLDS
XQVXUWHUVHEXWGHQJDQNDOLPDWNDOLDQVHQGLUL MDQJDQWDNXWVDODK

'HQJDQ PHQJDPDWL GDUL VXGXW SDQGDQJ ODLQ FLULFLUL XQVXUXQVXU WHUVHEXW NDOLDQ ELVD PHPEXDW
SHQJHUWLDQEHUEHGDGDULVXDWXXQVXUQDPXQWHWDSPHPLOLNLPDNQDVDPD8QWXNLVWLODKEXVXUMXULQJ
WHPEHUHQJPDXSXQVXGXWMLNDWLGDNGLVHEXWNDQVHFDUDVSHVLNPLQRUDWDXPD\RUPDNDNLWDVHSDNDWL
PLQRU

"

$\R.LWD
0HQDQ\D

%HUGDVDUNDQKDVLOSHQJDPDWDQNDOLDQFREDWXOLVNDQSHUWDQ\DDQWHQWDQJKDO\DQJLQJLQNDOLDQNHWDKXL
MDZDEDQQ\D %XDWODK SHUWDQ\DDQ \DQJ PHPXDW NDWD XQVXU OLQJNDUDQ DWDX VDODK VDWX GDUL XQVXU
OLQJNDUDQJ\DQJGLVDMLNDQSDGDNHJLDWDQ$\R.LWD$PDWL

tp

://

0$7(0$7,.$



Ayo Kita
Menanya

ht

Pancing rasa ingin tahu siswa dari kegiatan pengamatan gambar pada tabel dengan
menyuruh siswa menuliskan pertanyaan.
Alternatif pertanyaan:
1. Berapakah sudut pusat terbesar lingkaran?
2. Apakah apotema selalu tegak lurus dengan tali busur?
3. Apakah apotema membagi tali busur menjadi dua bagian sama panjang?
4. Apakah perbedaan diameter dengan tali busur?
5. Apa perbedaan juring dengan tembereng?
6. Bagaimanakah hubungan jari-jari dengan diameter?
7. Bagainakah hubungan busur kecil dengan busur besar?
8. Bagaimana cara menghitung luas juring?
9. Bagaimanakan cara menghitung luas tembereng?
MATEMATIKA

287

Setelah mengamati ciri-ciri tiap unsur-unsur lingkaran, diharapkan siswa dapat


membuat pengertian busur, jari-jari, diameter, tali busur, apotema, juring, tembereng,
dan sudut pusat dengan kalimat seperti berikut mereka sendiri.

Pengertian Unsur-unsur Lingkaran

.id

1. Busur adalah himpunan titik-titik yang berupa kurva lengkung


(baik terbuka atau tertutup) dan berhimpit dengan lingkaran.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

2. Jari-jari adalah ruas garis lurus yang menghubungkan titik pada


lingkaran dengan titik pusat.

3. Diameter adalah ruas garis lurus yang menghubungkan dua titik


pada lingkaran dan melalui titik pusat. Atau tali busur yang melalui
titik pusat. Atau ruas garis lurus terpanjang yang menghubungkan
dua titik pada lingkaran.
4. Tali busur adalah ruas garis lurus yang kedua titik ujungnya pada
lingkaran. Atau ruas garis lurus yang menghubungkan dua titik
pada lingkaran.
5. Apotema adalah ruas garis terpendek yang menghubungkan titik
pusat dengan titik pada tali busur.

://

6. Juring adalah daerah di dalam lingkaran yang dibatasi oleh busur


dan dua jari-jari.

tp

7. Tembereng adalah daerah di dalam lingkaran yang dibatasi oleh


tali busur dan busur.

ht

8. Sudut pusat adalah sudut yang titik pusatnya adalah titik pusat
lingkaran.

288

Buku Guru Kelas VIII SMP/MTs

Semester 2

=+

$\R.LWD
0HQJJDOL,QIRUPDVL

&RED NDOLDQ NDLWNDQ SHQJHUWLDQ PDVLQJPDVLQJ XQVXU OLQJNDUDQ \DQJ NDOLDQ EXDW WDGL GHQJDQ
KXEXQJDQEHEHUDSDSDVDQJDQXQVXUEHULNXW
7DEHO+XEXQJDQ$QWDU8QVXUXQVXU/LQJNDUDQ
8QVXU

8QVXU

+XEXQJDQ

'LDPHWHU

-DULMDUL

%XVXUNHFLO

%XVXUEHVDU \DQJ
EHUVHVXDLDQGHQJDQ
EXVXUNHFLO

3DQMDQJGLDPHWHUDGDODKNDOLSDQMDQJMDULMDUL
-XPODKSDQMDQJEXVXUEHVDUGHQJDQEXVXUNHFLOVDPD
GHQJDQNHOLOLQJOLQJNDUDQ

%XVXU

.HOLOLQJOLQJNDUDQ

%XVXUDGDODKEDJLDQGDULNHOLOLQJOLQJNDUDQ$WDX
.HOLOLQJOLQJNDUDQDGDODKEXVXUWHUEHVDU

'LDPHWHU

'LDPHWHUDGDODKWDOLEXVXUWHUSDQMDQJ

$SRWHPD

7DOL%XVXU

$SRWHPDVHODOXWHJDNOXUXVGHQJDQVXDWXWDOLEXVXU

-XULQJ

7HPEHUHQJ

/XDV WHPEHUHQJ VDPD GHQJDQ OXDV MXULQJ GLNXUDQJL


VHJLWLJD \DQJ VLVLQ\D DGDODK GXD MDULMDUL \DQJ
PHPEDWDVLMXULQJGDQWDOLEXVXUSHPEDWDVWHPEHUHQJ

6XGXWSXVDW

-XULQJ

/XDV MXULQJ VHEDQGLQJ GHQJDQ EHVDU VXGXW SXVDW


OLQJNDUDQ DNDQGLWHPXNDQGLNHJLDWDQ

6XGXWSXVDW

%XVXU

3DQMDQJEXVXUVHEDQGLQJGHQJDQVXGXWSXVDWOLQJNDUDQ
DNDQGLWHPXNDQGLNHJLDWDQ

.ULWLVLKXEXQJDQSDGDWD7DEHO0XQJNLQNDOLDQELVDPHQHPXNDQKXEXQJDQODLQ\DQJEHUEHGD
6LODNDQNDOLDQVHEXWNDQVXDWXKXEXQJDQXQVXUXQVXUSDGDOLQJNDUDQ\DQJEHOXPDGDSDGD7DEHOGLDWDV

$\R.LWD
0HQDODU






$SDNDKVHWLDSWDOLEXVXUDGDODKGLDPHWHU"-HODVNDQ
$SDNDKVHWLDSGLDPHWHUDGDODKWDOLEXVXU"-HODVNDQ
$SDNDKOLQJNDUDQDGDODKEXVXU"-HODVNDQ
3DGDWDOLEXVXU\DQJEDJDLPDQDWLGDNPHPLOLNLSDVDQJDQHSRWHPD"-HODVNDQ
0LVDONDQGLNHWDKXLVXDWXOLQJNDUDQ%DJDLPDQDFDUDNDOLDQPHQHQWXNDQWLWLNSXVDWQ\D"
-HODVNDQ
$\R.LWD
%HUEDJL

3UHVHQWDVLNDQKDVLOGDULNHJLDWDQPHQDODU\DQJNDPXSHUROHKNHSDGDWHPDQPXVHNHODV6DMLNDQ
SXODSHQJHUWLDQGDULXQVXUXQVXUOLQJNDUDQGHQJDQEDKDVDPXVHQGLUL

6HPHVWHU

://

.HODV9,,,60307V

ht

tp



Ajak siswa untuk


memahami hubungan
beberapa unsur lingkaran
yang disajikan pada
Tabel 3.1 buku siswa.

Ayo Kita
Menalar

Minta siswa untuk


menjawab pertanyaan pada
kegiatan Ayo Kita Menalar

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

7DOLEXVXU

Menggali
Informasi

.id

Ayo Kita
Berbagi

Minta siswa untuk


menyajikan jawaban
kegiatan menalar dan
pengertian unsur yang telah
dibuat di depan kelas.

Alternatif jawaban :
1. Bukan. Hanya tali
busur yang terpanjang
yang disebut diameter.
2. Iya. Setiap ali busur
adalah tali busur
terpanjang.
3. Iya. Lingkaran adalah
busur yang kedua titik
ujungnya berhimpit.
Lingkaran adalah
busur terpanjang.
4. Tali busur yang
melalui titik pusat.
Karena titik pusatnya
termuat pada tali
busur.
5. Langkah 1:
Menggambar dua tali
busur
Langkah 2:
menggambar
kedua garis sumbu
(apotema) kedua tali
busur tersebut. Titik
perpotongan kedua
garis sumbu itu adalah
titik pusat lingkaran.
MATEMATIKA

289

?!

"

/DWLKDQ 

 7HQWXNDQMDULMDULOLQJNDUDQ\DQJGLNHWDKXLGLDPHWHUQ\DDGDODKFP

Latihan

 'LNHWDKXLSDQMDQJMDULMDULOLQJNDUDQ2DGDODKFP7HQWXNDQSDQMDQJGLDPHWHUQ\D
 $SDNDKSHUSRWRQJDQGXDGLDPHWHUVHODOXGLWLWLNSXVDW"-HODVNDQ

&

 3HUKDWLNDJJDPEDUGLVDPSLQJ
N

*DULVDGDODKJDULVVXPEXWDOLEXVXU&'

%HQDUNDKSHUSRWRQJDQNHGXDJDULVVXPEXWHUVHEXWWHSDW
GLWLWLNSXVDW"-HODVNDQ
 $GDNDKWDOLEXVXU\DQJOHELKSDQMDQJGDULGLDPHWHU"-HODVNDQ
 $SDNDKSDQMDQJDSRWHPDELVDOHELKGDULMDULMDUL"-HODVNDQ
 3HUKDWLNDQJDPEDUGLVDPSLQJ

'

6HEXWNDQPDNVLPDOEDJLDQ\DQJGLVHEXW
D

-DULMDUL

E 'LDPHWHU
F

7DOLEXVXU

G -XULQJ
H

%XVXU

I

7HPEHUHQJ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3.Lebih lengkap, diameter


adalah tali busur
terpanjang.

'

7LWLN3DGDODKSHUSRWRQJDQJDULVVXPEXNGDQO

1.Iya, bisa. Namun tidak


semua tali busur bisa
disebut diameter.

2.Iya. Semua diameter


bisa disebut sebagai tali
busur.

*DULVDGDODKJDULVVXPEXWDOLEXVXU$%

.id

Berikut disajikan alternatif


jawaban beberapa soal
latihan. Silakan guru
melengkapi jawaban
dari soal yang lain, atau
berimprovisasi dengan soal
latihan tambahan.

J $SRWHPD

&

 'LEXWXKNDQEHUDSDGLDPHWHUXQWXNPHPEDJLVXDWXOLQJNDUDQPHQMDGLEDJLDQ"
 6HRUDQJ PHPEDJL GDHUDK GL GDODP OLQJNDUDQ GHQJDQ PHQJJDPEDUNDQ  WDOL EXVXU %HUDSD
GDHUDKWHUEDQ\DN\DQJELVDGLEXDW"-HODVNDQ
%X(UQDPHPLOLNLVXDWXNXHEHUEHQWXNOLQJNDUDQ%X(UQDLQJLQPHPEDJLNXHNXHWHUVHEXW
PHQMDGLEDJLDQ\DQJVDPDGHQJDQVHEXDKSLVDX7HQWXNDQEHUDSDNDOLSDOLQJVHGLNLW%X
(UQDPHPRWRQJNXHWHUVHEXW-HODVNDQ

4.Iya. Lingkaran adalah


busur terbesar.

ht

tp

://

0$7(0$7,.$

1. Ajak siswa untuk melakukan refleksi terhadap kegiatan pembelajaran.


2. Periksa kesesuaian rangkuman yang dibuat oleh siswa.
3. Berikan soal tambahan untuk dikerjakan di rumah (jika perlu)
4. Ajak siswa untuk memberikan usulan perbaikan pembelajaran.

290

Buku Guru Kelas VIII SMP/MTs

Semester 2



Membelajarkan 3.2
Memahami Hubungan antara Sudut Pusat
dengan Sudut Keliling yang
Menghadap Busur Sama.

.id

6XGXW3XVDW'DQ
6XGXW.HOLOLQJ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Sebaiknya Ingatkan kembali


tentang sudut pusat dan
sudut keliling. Guru bisa
meminta untuk membuat
sketsa di papan. Guru
menjelaskan kepada siswa
bahwa sudut pusat dan sudut
keliling yang akan dibahas
adalah yang menghadap
busur yang sama.
Alat dan bahan yang perlu
dipersiapkan sebelum
kegiatan pembelajaran:
a. Potongan kertas
berbentuk lingkaran.
Jumlah potongan kertas
minimal sejumlah 6 kali
banyak klompok yang
akan dibentuk dalam
pembelajaran.
b. Siapkan busur derajat,
atau suruh siswa
untuk membawa busur
sendiri (disampaikan
pada pertemuan
sebelumnya).

3DGDNDJLDWDQNDOLDQVXGDKPHQJHQDOWHQWDQJLVWLODKVXGXWSXVDWGDQFLULFLULQ\D3DGDNHJLDWDQ
LQLNDOLDQDNDQGLSHUNHQDONDQGHQJDQVDWXXQVXUODJL\DLWXVXGXWNHOLOLQJ
6XGXWNHOLOLQJDGDODKVXGXW\DQJNDNLVXGXWQ\DEHUKLPSLWGHQJDQWDOLEXVXUGDQWLWLNSXVDWQ\D
EHUKLPSLWGHQJDQVXDWXWLWLNSDGDOLQJNDUDQ
$

&

*DPEDU6XGXWNHOLOLQJ$%&

://

'LVNXVLNDQ
 $SDNDKDGDVXGXWNHOLOLQJ\DQJNDNLVXGXWQ\DDGDODKVXDWXGLDPHWHUGDQVXDWXWDOLEXVXU
OLQJNDUDQ"MHODVNDQ
 $SDNDKDGDVXGXWNHOLOLQJ\DQJNHGXDNDNLVXGXWQ\DDGDODKGLDPHWHUOLQJNDUDQ"

ht

tp

3DGD *DPEDU  ELVD NLWD DPDWL VXGXW NHOLOLQJ $%& SDGD OLQJNDUDQ 2 .DNLNDNL VXGXW $%&
VLQDU%$GDQVLQDU%& PHPRWRQJOLQJNDUDQGLWLWLN$GDQ&'HQJDQNDWDODLQVXGXWNHOLOLQJ$%&
PHQJKDGDSEXVXU$&7DKXNDQNDOLDQDQWDUDVXGXWNHOLOLQJGDQVXGXWSXVDW\DQJPHQJKDGDSEXVXU
VDPD PHPSXQ\DL KXEXQJDQ NKXVXV 0DUL PHQFDUL WDKX KXEXQJDQ WHUVHEXW PHODOXL NHJLDWDQ 
$
EHULNXW

2
%

&

*DPEDU%XVXU$&



.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

291

0HPDKDPL+XEXQJDQDQWDUD6XGXW3XVDW
GHQJDQ6XGXW.HOLOLQJ\DQJ
0HQJKDGDS%XVXU6DPD

.HJLDWDQ 

3HQJDODPDQEHODMDU\DQJGLKDUDSNDQVHWHODKNDOLDQPHODNXNDQNHJLDWDQDGDODK
 0HQHPXNDQKXEXQJDQDQWDUDVXGXWSXVDWGHQJDQVXGXWNHOLOLQJ\DQJPHQJKDGDSEXVXUVDPD
 0HQHPXNDQKXEXQJDQDQWDUVXGXWNHOLOLQJ\DQJPHQJKDGDSEXVXUVDPD
 0HQHPXNDQKXEXQJDQVXGXW\DQJVDOLQJEHUKDGDSDQSDGDVHJLHPSDWWDOLEXVXU
0DVDODK 

.id

3DGD*DPEDUELVDNLWDDPDWLVXGXWNHOLOLQJ$%& $%& SDGDOLQJNDUDQ2.DNLNDNL$%&


PHPRWRQJ OLQJNDUDQ GL WLWLN $ GDQ & 'HQJDQ NDWD ODLQ VXGXW NHOLOLQJ $%& PHQJKDGDS EXVXU
$&  7DKXNDQ NDOLDQ DQWDUD VXGXW NHOLOLQJ GDQ VXGXW SXVDW \DQJ PHQJKDGDS EXVXU VDPD
$&
PHPSXQ\DLKXEXQJDQNKXVXV%DJDLPDQDNDKKXEXQJDQWHUVHEXW"
.DOLDQDNDQPHQFREDPHPDKDPLKXEXQJDQDQWDUXQVXUXQVXUWHUVHEXWGHQJDQPHODNXNDQDNWLYLWDV
PHOLSDWOLSDWNHUWDV2OHKNDUHQDLQLSDVWLNDQNDOLDQVXGDKPHPSHUVLDSNDQDODWGDQEDKDQEHULNXW
 -DQJND
 EXVXUGHUDMDW
 JXQWLQJ
 SHQJJDULV
 OHPEDUNHUWDV+96 EROHKOHELK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

$\R
.LWD$PDWL

7DEHO6XGXW.HOLOLQJGDQ6XGXW3XVDW\DQJ0HQJKDGDS%XVXU6DPD

6XGXWSXVDW

PHQJKDGDS$%



.'/
P.'/ "

PHQJKDGDS./

0(1GDQ0)1
P0(1 "GDQ
P0)1 "
PHQJKDGDS01
(

 2

$&%
P$&% "
PHQJKDGDS$%

6XGXWNHOLOLQJ

021
P021 
PHQJKDGDS01

.2/
P.2/ 
PHQJKDGDS./

$2%
P$2% 

'

&

.HWHUDQJDQVLPEROPPHQ\DWDNDQXNXUDQVXGXWVHGDQJNDQPHQ\DWDNDQQDPDVXGXW

ht

tp

Ayo
Kita Amati

://

0$7(0$7,.$

Ajak siswa untuk mengamati


gambar pada Tabel 3.2.
Minta siswa untuk
mengamati bentuk sudut
pusat dan sudut keliling pada
setiap gambar. Minta siswa
untuk memahami tentang
penulisan simbol busur,
nama sudut, dan ukuran
sudut.
292

Buku Guru Kelas VIII SMP/MTs

Semester 2



$\R.LWD
0HQDQ\D

%HUGDVDUNDQ KDVLO SHQJDPDWDQ NDOLDQ SDGD NHJLDWDQ PHQJDPDWL WXOLVNDQ SHUWDQ\DDQ WHQWDQJ KDO
\DQJLQJLQNDOLDQNHWDKXLMDZDEDQQ\D
3HUWDQ\DDQ\DQJNDOLDQEXDWDGDODKWHQWDQJKXEXQJDQVXGXWSXVDWGHQJDQVXGXWNHOLOLQJ
&RQWRKSHUWDQ\DDQ
-LNDGLNHWDKXLP $2% VXGXWSXVDW DGDODK%HUDSDNDKP $&% VXGXWNHOLOLQJ 

0HQJJDOL
,QIRUPDVL

6HEHOXPNHJLDWDQPHQJJDOLLQIRUPDVLFREDEHULNDQLGHNDOLDQPHQHQWXNDQWLWLNSXVDWVXDWXNHUWDV
\DQJEHUEHQWXNOLQJNDUDQ
3DGDNHJLDWDQ$\R.LWD$PDWLNDOLDQVXGDKPHQJDPDWLWHQWDQJJDPEDUVXGXWNHOLOLQJGDQVXGXW
SXVDW\DQJPHQJKDGDSEXVXUVDPD<DQJPHQMDGLSHUPDVDODKDQVHNDUDQJDGDODK
  %HUDSDNDKXNXUDQVXGXWNHOLOLQJMLNDVXGXWSXVDWQ\DGLNHWDKXL"DWDX
  %HUDSDNDKXNXUDQVXGXWSXVDWMLNDVXGXWNHOLOLQJQ\DGLNHWDKXL"
8QWXNPHQJHWDKXLKXEXQJDQWHUVHEXWNDOLDQSHUOXPHQFDULQ\D6DODKVDWXFDUDXQWXNPHQFDUL
WDKX KXEXQJDQ DQWDUD VXGXW SXVDW GHQJDQ VXGXW NHOLOLQJ \DQJ PHQJKDGDS EXVXU VDPD DGDODK
GHQJDQNHJLDWDQPHOLSDWOLSDWNHUWDV,NXWLNHJLDWDQEHULNXW

8NXUDQVXGXW
SXVDW

Minta siswa untuk


menuliskan beberapa
pertanyaan dari hasil
pengamatan.
Alternatif pertanyaan:
1.Bagaimanakah hubungan
sudut pusat dengan sudut
keliling?
2.Bagaimanakah hubungan
antar beberapa sudut
keliling yang menghadap
sudut pusat yang sama?

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 %XDWODKVNHWVDGXDOLQJNDUDQGHQJDQMDULMDULVDPD PLVDOFP ODOXJXQWLQJODKGHQJDQUDSL


 /LSDWODKNHGXDOLQJNDUDQVHKLQJJDPHPEHQWXNVXGXWSXVDWR/DOXWDQGDLWLWLNSDGDEXVXU
\DQJWHUEHQWXNPLVDOWLWLN$GDQ%
 %XNDVDODKVDWXOLSDWDQWHUVHEXWODOXOLSDWPHPEHQWXNVXGXWNHOLOLQJWHUWHQWX\DQJPDVLQJ
PDVLQJNDNLVXGXWQ\DPHODOXLWLWLN$GDQ% .HWHUDQJDQ0LVDONDNLVXGXWVDWXPHODOXLWLWLN
$PDNDNDNLVXGXWODLQQ\DPHODOXLWLWLN%
 %DQGLQJNDQEHVDUVXGXWNHOLOLQJGHQJDQVXGXWSXVDW\DQJWHODKNDOLDQEXDW
 /DNXNDQNHPEDOLODQJNDKVDPSDLXQWXNWLJDVXGXWSXVDWEHUEHGD
 *XQDNDQEXVXUGHUDMDWXQWXNPHQJXNXUEHVDUVXGXWSXVDW\DQJNDOLDQEXDW
 &DWDWODKKDVLOSHUFREDDQNDOLDQSDGDWDEHOEHULNXW

Ayo Kita
Menanya

.id

"

8NXUDQVXGXW
NHOLOLQJ

8NXUDQ VXGXW SXVDW


8NXUDQ VXGXW NHOLOLQJ

'DULGDWD\DQJNDOLDQFDWDWEXDWODKVLPSXODQWHQWDQJKXEXQJDQVXGXWNHOLOLQJGHQJDQVXGXWSXVDW

.HODV9,,,60307V

6HPHVWHU

tp

=+

://



Menggali
Informasi

ht

Sebelum kegiatan menggali informasi, bentuklah siswa menjadi kelompok-kelompok


yang terdiri dari 4 atau 5 siswa. Bagikan minimal 6 kertas lingkaran yang telah
dipersiapkan sebelumnya.
Cara menentukan titik pusat kertas yang berbentuk lingkaran adalah melipat kertas
berdasarkan diameternya. Perpotongan dua diameter pastilah titik pusat lingkaran.
Jangan memberi tahu terlebih dahulu cara melipat kertas yang membentuk sudutsudut tertentu. Biarkan siswa mencoba terlebih dahulu. Jika sebagian besar belum
bisa, ajari siswa cara melipat agar membentuk lipatan yang benar.
Alternatif jawaban:
Jadi dapat kita simpulkan bahwa besarnya sudut keliling yang menghadap busur
tertentu adalah setengah dari sudut pusat yang menghadap busur yang sama.
MATEMATIKA

293

Ayo Kita
Menalar
Minta siswa untuk
menjawab pertanyaan pada
kegiatan Ayo Kita Menalar.
$\R.LWD
0HQDODU

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

3HUKDWLNDQJDPEDUNHHQDPSDGDNHJLDWDQ$\R.LWD$PDWL
(
 3DGDJDPEDUWHUVHEXWVHEXWNDQVXGXWNHOLOLQJ\DQJWHUEHQWXN
)
 .HGXDVXGXWNHOLOLQJVHUWDVXGXWSXVDWPHQJKDGDSEXVXU\DQJVDPD
1
2
\DLWX
 0HQXUXWNDOLDQEDJDLPDQDNDKKXEXQJDQDQWDUDNHGXDVXGXWNHOLOLQJ
WHUVHEXW"-HODVNDQ
0
 6HDQGDLQ\D NDOLDQ PHPEXDW VHEDUDQJ VXGXW NHOLOLQJ EDUX \DQJ
PHQJKDGDS EXVXU 01 %DJDLPDQDNDK KXEXQJDQ DQWDUD VXGXW NHOLOLQJ EDUX WHUVHEXW GHQJDQ
VXGXWNHOLOLQJ0(1GDQ0)1"
 6HDQGDLQ\DNDOLDQGLVXUXKPHPEXDWVHPXDVXGXWNHOLOLQJ\DQJPHQJKDGDSEXVXU01%HUDSD
EDQ\DNVXGXWNHOLOLQJ\DQJELVDNDOLDQEXDW"
 %DJDLPDQDNDKKXEXQJDQDQWDUVHPXDVXGXWNHOLOLQJWHUVHEXW"-HODVNDQ
 %DJDLPDQDNDK KXEXQJDQ DQWDUD VHPXD VXGXW NHOLOLQJ WHUVHEXW GHQJDQ VXGXW SXVDW \DQJ
PHQJKDGDSEXVXU\DQJVDPD"-HODVNDQ
 6HDQGDLQ\DNDOLDQGLEHULNDQVXDWXNHUWDV\DQJEHUEHQWXNOLQJNDUDQ%DJDLPDQDNDKFDUDNDOLDQ
PHPEXDW VXGXW NHOLOLQJ \DQJ EHVDUQ\D WHSDW R GHQJDQ FDUD PHOLSDWOLSDW NHUWDV WHUVHEXW"
-HODVNDQODQJNDKNDOLDQ
6HJL(PSDW7DOL%XVXU

6HJLHPSDWWDOLEXVXUDGDODKVHJLHPSDW\DQJNHHPSDWWLWLNVXGXWQ\DEHUKLPSLWGHQJDQVXDWX
OLQJNDUDQ

3HUKDWLNDQVHJLHPSDWWDOLEXVXU$%&'EHULNXW

'HQJDQ NHJLDWDQ PHQDODU EHULNXW GLKDUDSNDQ NDOLDQ PDPSX


PHQHPXNDQKXEXQJDQDQWDUDGXDVXGXW\DQJVDOLQJEHUKDGDSDQ
 6HJL HPSDW WDOL EXVXU $%&' WHUVXVXQ DWDV GXD SDVDQJ VXGXW
NHOLOLQJ \DQJ VDOLQJ EHUKDGDSDQ 7XOLVNDQ NHGXD SDVDQJ VXGXW
NHOLOLQJWHUVHEXW

'
&

 $PDWL EXVXU \DQJ GLKDGDSL ROHK PDVLQJPDVLQJ VXGXW NHOLOLQJ


\DQJVDOLQJEHUKDGDSDQ%DJDLPDQDNDKNHGXDEXVXUWHUVHEXW"

 .DLWNDQGHQJDQKXEXQJDQVXGXWNHOLOLQJGDQVXGXWSXVDW\DQJ
WHODKNDOLDQWHPXNDQ/DOXVLPSXONDQKXEXQJDQDQWDUDGXDVXGXW
\DQJVDOLQJEHUKDGDSDQSDGDVHJLHPSDWWDOLEXVXUWHUVHEXW

://

$\R.LWD
%HUEDJL

3UHVHQWDVLMDZDEDQSDGDNHJLDWDQPHQDODUNDOLDQSDGDWHPDQWHPDQGLNHODV%DQGLQJNDQGHQJDQ
MDZDEDQWHPDQNDOLDQ\DQJODLQ

ht

tp

Ayo Kita
Berbagi

Mintalah beberapa
kelompok untuk menyajikan
jawaban pada kegiatan
bernalar. Jika perlu siapkan
kertas yang berbentuk
lingkaran agar siswa bisa
memperagakan kegiatan
melipat menjadi sudut
keliling ataupun sudut pusat.
294

*DPEDU6HJLHPSDWWDOL
EXVXU$%&'

Buku Guru Kelas VIII SMP/MTs

0$7(0$7,.$

Semester 2



Alternatif
Jawaban

1. Sudut keliling MEN dan MFN Sudut pusat MON


2. Busur MN

.id

3. Kedua sudut keliling besarnya adalah sama, karena menghadap



busur MN.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

4. Seandainya dibuat sudut keliling lain yang menghadap busur MN,


maka besarnya adalah sama dengan sudut keliling MEN dan MFN.
5. Tak hingga banyak sudut keliling menghadap busur MN yang bisa
dibuat.
6. Semua sudut keliling tersebut besarnya adalah sama, karena
menghadap busur yang, yaitu busur MN.

7. Besar sudut semua sudut keliling tersebut setengah dari sudut pusat
MON
8. Cara membuat sudut keliling yang besarnya tepat 90o?

ht

tp

://

Dengan melipat lingkaran menjadi dua bagian sama, sehingga membentuk


diameter lingkaran. Buatlah sudut keliling yang menghadap sudut pusat
yang dibentuk oleh diameter. Maka besar sudut keliling tersebut pasti 90o,
karena sudut pusat yang dibentuk oleh diameter
adalah 180o.

1.

Segiempat Tali Busur

berhadapan dengan
berhadapan dengan

2. Gabungan busur-busur yang dihadapi oleh masing-masing sudut


keliling yang saling berhadapan adalah lingkaran.
3. Kesimpulan : Pada segiempat tali busur, jumlah sudut yang
berhadapan adalah 180o.

MATEMATIKA

295

"

/DWLKDQ 

 6XDWXVXGXWNHOLOLQJGDQVXGXWSXVDWPHQJKDGDSEXVXU\DQJVDPD-LNDVXGXWSXVDWEHUXNXUDQ
RPDNDEHVDUVXGXWNHOLOLQJWHUVHEXWDGDODK
 'LNHWDKXLVXGXWSXVDW324GDQVXGXWNHOLOLQJ3$4%HVDUVXGXW3$4DGDODKR7HQWXNDQ
EHVDUVXGXW324
 3HUKDWLNDQJDPEDUGLVDPSLQJ

'LNHWDKXLEHVDU 0$1DGDODKR7HQWXNDQEHVDU 021
1

2
$
0
 3HUKDWLNDQVHJLHPSDW3456GLVDPSLQJ
'LNHWDKXLP 345 P 456 
7HQWXNDQP 634GDQP 563

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

 3HUKDWLNDQOLQJNDUDQ2GLVDPSLQJ

'LNHWDKXLP %$' [P %&' [

7HQWXNDQP %2'PLQRUGDQP %2'PD\RU



.HODV9,,,60307V

'

&

6HPHVWHU

ht

tp

://

5
4

1. Berikan kesempatan kepada siswa untuk memajang karyanya di dinding kelas yang
sudah dipersiapkan.
2. Ajak siswa melakukan refleksi terhadap kegiatan pembelajaran.
3. Periksa kesesuaian rangkuman yang dibuat oleh siswa.
4. Berikan soal tambahan untuk dikerjakan di rumah (jika perlu)
5. Berikan penilaian terhadap hasil karya siswa menggunakan rubrik penilaian.
6. Ajak siswa untuk memberikan usulan perbaikan pembelajaran.
296

Buku Guru Kelas VIII SMP/MTs

Semester 2

Membelajarkan 3.3

3DQMDQJ%XVXUGDQ
/XDV-XULQJ/LQJNDUDQ

2. Ajak siswa untuk


membaca kegiatan
awal pembelajarn,
yaitu asal mula
bilangan (pi).

6XGXWSXVDW$2%DWDX$2%
$

1. Ajak siswa untuk


menggali ingatannya
tentang rumus
keliling dan luas
lingkaran yang telah
dipelajari di SD.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3DGD.HJLDWDQNDOLDQVXGDKPHQGDSDWNDQLQIRUPDVLWHQWDQJFLULFLULVXGXWSXVDWSDQMDQJEXVXU
GDQMXULQJOLQJNDUDQ3DQMDQJEXVXUVHEDQGLQJGHQJDQVXGXWSXVDW\DQJPHQJKDGDSQ\D%HJLWXSXQ
XDVMXULQJVHEDQGLQJGHQJDQVXGXWSXVDW\DQJEHUVHVXDLDQGHQJDQMXULQJWHUVHEXW3HUKDWLNDQEDJLDQ
\DQJEHUZDUQDPHUDKSDGDJDPEDUEHULNXW

.id

&

Memahami Hubungan Sudut Pusat


Dengan Panjang dan Panjang Busur dan Luas Jaring

%XVXU$%DWDX$%
$

/XDV-XULQJ$2%

://

6XGXWSXVDW$2%DWDX$2%

3. Ajak siswa untuk


memahamkan proses
ditemukannya
rumus keliling
lingkaran.

ht

tp

'DULLOXVWUDVLGLDWDVNLWDELVDDPDWLSDQMDQJEXVXU$%EHUVHVXDLDQGHQJDQVXGXWSXVDWDEHJLWXSXQ
OXDVMXULQJ$2%EHUVHVXDLDQGHQJDQVXGXWSXVDWD8NXUDQVXGXWSXVDWOLQJNDUDQDGDODKDQWDUD
KLQJJD

0DVDODK 

 $SDNDKKXEXQJDQDQWDUDVXGXWSXVDWGHQJDQSDQMDQJEXVXUOLQJNDUDQ"
 $SDNDKKXEXQJDQDQWDUDVXGXWSXVDWGHQJDQOXDVMXULQJOLQJNDUDQ"
3DGDNHJLDWDQDNDQNLWDFDULWDKXKXEXQJDQDQWDUVXGXWSXVDWGHQJDQSDQMDQJEXVXUVHUWDVXGXW
SXVDWGHQJDQOXDVMXULQJ

0$7(0$7,.$



MATEMATIKA

297

Alternatif
Jawaban

Rumus luas lingkaran


yaitu
atau

3HQJDODPDQEHODMDU\DQJGLKDUDSNDQVHWHODKNDOLDQPHODNXNDQNHJLDWDQDGDODK
 0HQHQWXNDQKXEXQJDQVXGXWSXVDWGHQJDQSDQMDQJEXVXU
 0HQHQWXNDQKXEXQJDQVXGXWSXVDWGHQJDQOXDVMXULQJ
0DVLKLQJDWNDKNDOLDQGHQJDQUXPXVNHOLOLQJGDQOXDVOLQJNDUDQ\DQJVXGDKNDOLDQSHUROHK
NHWLND6'GXOX
5XPXVNHOLOLQJOLQJNDUDQ\DLWX
5XPXVOXDVOLQJNDUDQ\DLWX
0XQJNLQGXOXNDOLDQEHUWDQ\D0HQJDSDUXPXVQ\DVHSHUWLLWX"DWDX'DULPDQDNDKDVDOPXOD
UXPXVLWX"'DODPNHGXDUXPXVWHUVHEXWWHUGDSDWVXDWXNRQVWDQWD\DQJWHQWX\DLWX SL 7DKXNDK
NDPXGDULPDQDNDKDVDOPXODELODQJDQSL3DGDNHJLDWDQLQLNLWDDNDQPHQJHWDKXLDVDOXVXOELODQJDQ
VHUWDUXPXVNHOLOLQJGDQOXDVOLQJNDUDQ

6HMDUDK SL

dimana r adalah jarijari lingkaran, d adalah


diameter lingkaran, dan
adalah suatu konstanta
yang nilainya 3,14 atau
.
Nilai konstanta yang
sekarang kita kenal
adalah rasio antara
keliling lingkaran
dengan diameternya.
Jika dinyatakan dengan

%LODQJDQ  DGDODK VDODK VDWX ELODQJDQ \DQJ


GLWHPXNDQ VHMDN MDPDQ GDKXOX %LODQJDQ LWX
PHQXQMXNNDQSHUEDQGLQJDQGDULNHOLOLQJWHUKDGDS
GLDPHWHUOLQJNDUDQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

simbol

.id

Ingatkah siswa dengan


rumus keliling dan luas
lingkaran yang sudah
diperoleh ketika SD.
Rumus keliling lingkaran
yaitu
atau ,

.HJLDWDQ 

0HPDKDPL+XEXQJDQ
6XGXW3XVDWGHQJDQ
3DQMDQJ%XVXUGDQ/XDV-XULQJ

. Dengan

tp

://

kata lain
.
Karena
, maka
hubungan tersebut dapat
juga dinyatakan

EHUXVLD6HEHOXP0DVHKLPHQJJXQDNDQQLODL


 \DLWX       .HPXGLDQ VHNLWDU 



6XPEHUFDPSKDOIEORRGZLNLDFRP

*DPEDU

$UFK\PHGHV

6HEHOXP0DVHKLVHRUDQJPDWHPDWLNDZDQ<XQDQL
WHUNHQDO EHUQDPD $UFKLPHGHV PHQJJXQDNDQ
SROLJRQVHEDJDLEDQWXDQXQWXNPHQHPXNDQQLODL


GDQ

\DLWXDQWDUD



3DGDDEDGNHVHRUDQJPDWHPDWLNDZDQ&LQDEHUQDPD=X&KXQJ]KLELODQJDQ\DQJOHELK

DNXUDWGDULSDGDWHPXDQ$UFKLPHGHV1LODLLQLWHUVHEXWDGDODK
GDQHQDPVDWXDQGHVLPDO


VHSHUWL\DQJVHNDUDQJGLJXQDNDQ3DGDWDKXQVHRUDQJPDWHPDWLNDZDQ3HUVLDEHUQDPD
$O.DVKLPHQHPXNDQQLODLKLQJJDGLJLWGHVLPDO'LDPHQJJXQDNDQVWUDWHJL$UFKLPHGHV
QDPXQGLDPHOLSDWJDQGDNDQVLVLQ\DNDOL



.HODV9,,,60307V

6HPHVWHU

ht

Untuk rumus luas


lingkaran akan diberikan
kepada siswa sebagai
soal projek pada Bab ini.
Guru mengingatkan juga
tentang bagian lingkaran
yang disebut sudut pusat,
busur, serta juring. Guru
bisa memberikan projek
kepada siswa untuk
melakukan percobaan
menemukan bilangan .

%HEHUDSD RUDQJ MDPDQ GXOX PHQJJXQDNDQ


ELODQJDQ VHEDJDL ELODQJDQ %LODQJDQLWX MDXK
GDULNHDNXUDWDQQDPXQELODQJDQLWXPXGDKXQWXN
GLJXQDNDQ GDODP SHUKLWXQJDQ 2UDQJ %DELORQLD
PHQJJXQDNDQ ELODQJDQ \DQJ KDPSLU DNXUDW  

.HPXGLDQRUDQJ0HVLUNXQR\DQJGLSHUNLUDNDQ


298

Buku Guru Kelas VIII SMP/MTs

Semester 2

Minta siswa untuk


mengisi titik-titik yang
masih kosong.
Dengan kata lain K=d
Atau K=2r

:LOOLDP -RQHV VHRUDQJ PDWHPDWLNDZDQ ,QJJULV


PHPSHUNHQDONDQ VLPERO PRGHUQ XQWXN SL SDGD
WDKXQ6LPEROGLSLOLKNDUHQDGL<XQDQL
SHODIDODQ KXUXI  PHQ\HUXSDL KXUXI SL VLQJNDWDQ
SHULPHWHU NHOLOLQJ OLQJNDUDQ  6HMDODQ GHQJDQ
EHUNHPEDQJQ\D WHNQRORJL SHQHPXDQ QLODL  WHODK
OHELKGDULWULOLXQGLJLWGLEHODNDQJNRPD
1LODL NRQVWDQWD  \DQJ VHNDUDQJ NLWD NHQDO DGDODK
UDVLR DQWDUD NHOLOLQJ OLQJNDUDQ GHQJDQ GLDPHWHUQ\D
-LNDGLQ\DWDNDQGHQJDQV\PERO


.
'HQJDQNDWDODLQ .DUHQDG U
G

PDNDKXEXQJDQWHUVHEXWGDSDWMXJDGLQ\DWDNDQ. BBBBBBBBBBB



D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

/DNXNDQSHUFREDDQXQWXNPHQHPXNDQELODQJDQGHQQJDQODQJNDKODQJNDKVHEDJDLEHULNXW
D
8NXUODKNHOLOLQJGDQGLDPHWHUEHQGDGLVHNLWDUNDOLDQ\DQJEHUEHQWXNOLQJNDUDQ
E
+LWXQJODK UDVLR GDODP EHQWXN ELODQJDQ GHVLPDO  NHOLOLQJ WHUKDGDS GLDPHWHU GDUL
SHQJXNXUDQWHUVHEXW . 
G
F
/DNXNDQODQJNDKDGDQEXQWXNPLQLPDOOLPDEHQGDEHUEHGD
G
$PDWLUDVLR . GDULNHOLPDEHQGDWHUVHEXW%HQDUNDKPHQGHNDWLQLODL"
G
%XDWODKODSRUDQ\DQJPHQDULNXQWXNGLSDMDQJNDQ

Minta siswa untuk


mengerjakan Tugas
Projek 3.1 setelah
Kegiatan 3.3 selesai.

.id

7XJDV
3URMHN

3DGDNHJLDWDQLQLNLWDDNDQPHQFDULWDKXKXEXQJDQDQWDUDOXDVOLQJNDUDQVXGXWSXVDWGDQOXDV
MXULQJOLQJNDUDQVHUWDNHOLOLQJOLQJNDUDQVXGXWSXVDWGDQSDQMDQJEXVXUOLQJNDUDQ

$\R
.LWD$PDWL

0HQXUXWNDOLDQEHUDSDNDKNHOLOLQJOLQJNDUDQGLVDPSLQJ"

%DJDLPDQD NDODX \DQJ GLWDQ\DNDQ DGDODK KDQ\D EXVXU GDUL OLQJNDUDQ 0DUL NLWD WHPXNDQ UXPXV
XQWXNPHQHQWXNDQQ\D

0$7(0$7,.$



ht

tp

://

$PDWLJDULV\DQJEHUZDUQDPHUDKDGDODKJDPEDUSDQMDQJEXVXUOLQJNDUDQ\DQJEHUVHVXDLDQGHQJDQ
VXGXWSXVDWQ\DPDVLQJPDVLQJ/HQJNDSLVHO\DQJPDVLKNRVRQJSDGD7DEHOD

Ayo
Kita Amati
Ajak siswa untuk
mengamati bentuk
lingkaran yang disajikan. Minta siswa untuk
menentukan keliling
lingkaran tersebut.
MATEMATIKA

299

7DEHOD3DQMDQJ%XVXU/LQJNDUDQ

*DPEDU%XVXU



5DVLRVXGXWSXVDWD
WHUKDGDS

5DVLRSDQMDQJEXVXU
WHUKDGDSNHOLOLQJOLQJNDUDQ

D


SDQMDQJ EXVXU
.HOLOLQJ OLQJNDUDQ

    






D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id





Mintalah siswa untuk


mengamati gambar-gambar
lingkaran pada Tabel 3.3a
dan 3.3b di buku siswa.
Berilah petunjuk kepada
siswa untuk mengamati
bagian yang berwarna
merah. Minta siswa untuk
melengkapi Tabel 3.3a







.HODV9,,,60307V

6HPHVWHU

ht

tp

://

Alternatif isi Tabel 3.3a

300

Buku Guru Kelas VIII SMP/MTs

Semester 2

-LNDMDULMDULGDQVXGXWSXVDWNHWLJDJDPEDUGLEDZDKLQLGLNHWDKXLGDSDWNDKNDOLDQPHQHQWXNDQOXDV
NHWLJDGDHUDK\DQJGLZDUQDLPHUDK"

8QWXNPHQHQWXNDQOXDVJDPEDU$WHQWXQ\DPXGDK.DOLDQELVDPHQJJXQDNDQUXPXVOXDVOLQJNDUDQ
\DQJVXGDKNDOLDQNHWDKXL%DJDLPDQDGHQJDQOXDVMXULQJSDGD/LQJNDUDQ%GDQ/LQJNDUDQ&"
0DULNLWDWHPXNDQUXPXVXQWXNPHQHQWXNDQOXDVMXULQJWHUVHEXW
%HULNXWLQLGDHUDK\DQJEHUZDUQDPHUDKDGDODKJDPEDUMXULQJOLQJNDUDQ\DQJEHUVHVXDLDQGHQJDQ
VXGXWSXVDWQ\DPDVLQJPDVLQJ/HQJNDSLVHO\DQJPDVLKNRVRQJSDGD7DEHOEEHULNXW

5DVLRVXGXWSXVDWDWHUKD

GDS
*DPEDU%XVXU



OXDV  MXULQJ
OXDV OLQJNDUDQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o



D


5DVLROXDVMXULQJWHUKDGDS
NHOLOLQJOLQJNDUDQ

.id

7DEHOE/XDV-XULQJ/LQJNDUDQ



Alternatif isi Tabel 3.3b

ht

tp

://

0$7(0$7,.$

MATEMATIKA

301



D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o



.id



Ayo Kita
Menanya

$\R.LWD
0HQDQ\D

'DULSHQJDPDWDQNDOLDQWHUKDGDS7DEHODGDQEEXDWODK
SHUWDQ\DDQWHQWDQJKDO\DQJSHQWLQJXQWXNGLSHUWDQ\DNDQ
.DOLPDWWDQ\DVHEDLNQ\DWHUGDSDWNDWDMXULQJDWDXEXVXU
0LVDO
%HUDSDNDKSDQMDQJEXVXUOLQJNDUDQGHQJDQVXGXWSXVDW"
%HUDSDNDKOXDVMXULQJOLQJNDUDQ\DQJVXGXWSXVDWQ\D"



.HODV9,,,60307V

6HPHVWHU

://

Minta siswa untuk


menuliskan pertanyaan dari
hasil pengamatan gambar
yang diberikan maupun
gambar kegiatan mengamati.

"

tp

Alternatif pertanyaan:

ht

1. Berapakah luas juring


yang berwarna merah
tersebut?

2. Apakah hubungan antara


sudut pusat dengan luas
juring?
3. Apakah hubungan sudut
pusat dengan panjang
busur?
302

Buku Guru Kelas VIII SMP/MTs

Semester 2

$\R.LWD
0HQJJDOL,QIRUPDVL

8NXUDQVXGXWSXVDWVDWXOLQJNDUDQSHQXKDGDODKDQWDUDVDPSDL.DODXNLWDLQJDWNHPEDOL
SDGDNHJLDWDQNLWDGDSDWNDQLQIRUPDVLEDKZDOXDVMXULQJGDQSDQMDQJEXVXUVHEDQGLQJGHQJDQ
EHVDUQ\D VXGXW SXVDW$UWLQ\D VHPDNLQ EHVDU VXGXW SXVDW VHPDNLQ EHVDU SXOD OXDV MXULQJ GDQ
SDQMDQJEXVXUQ\D
'DULNHJLDWDQPHQJDPDWLGLDWDVGLSHUROHKULQJNDVDQLQIRUPDVLVHSHUWLEHULNXW/HQJNDSLVHO\DQJ
PDVLKNRVRQJSDGD7DEHO
7DEHO3DQMDQJEXVXUGDQ/XDVMXULQJ
5DVLRVXGXWSXVDW
WHUKDGDS

5DVLRSDQMDQJEXVXU
WHUKDGDSNHOLOLQJOLQJNDUDQ

D


SDQMDQJ EXVXU
.HOLOLQJ OLQJNDUDQ

5DVLROXDVMXULQJWHUKDGDS
OXDVOLQJNDUDQ
OXDV  MXULQJ
OXDV OLQJNDUDQ




.id


 





D


$\R.LWD
0HQDODU

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o




 $PDWLGDQEDQGLQJNDQNRORPGDQSDGD7DEHO
%DJDLPDQDUDVLRQ\D"
%XDWODKVLPSXODQWHQWDQJUXPXVPHQHQWXNDQSDQMDQJEXVXU
$%\DQJGLNHWDKXLMDULMDULQ\DUGDQVXGXWSXVDWQ\DD

0$7(0$7,.$



ht

tp

://

=+

Menggali
Informasi

Minta siswa untuk


menuliskan kembali
ringkasan pada Tabel 3.4
Tabel 3.3a dan Tabel 3.3b.
Ayo Kita
Menalar
Minta siswa untuk
menjawab pertanyaan Ayo
Kita Menalar.
MATEMATIKA

303

 $PDWLGDQEDQGLQJNDQNRORPGDQSDGDWDEHOGLDWDV
%DJDLPDQDNDKUDVLRQ\D"

%XDWODKVLPSXODQWHQWDQJUXPXVOXDVMXULQJ$2%\DQJ
GLNHWDKXLMDULMDULQ\DUGDQVXGXWSXVDWQ\D

U
2

 3DGDNRQGLVL\DQJEDJDLPDQDSDQMDQJEXVXUVDPDGHQJDQ
NHOLOLQJOLQJNDUDQQ\D"-HODVNDQ

 3DGDNRQGLVL\DQJEDJDLPDQDOXDVMXULQJVDPDGHQJDQOXDV
OLQJNDUDQQ\D"-HODVNDQ
 0DQDNDK\DQJOHELKOXDV
D -XULQJOLQJNDUDQ$GHQJDQVXGXWSXVDWDGDQMDULMDULUDWDX

E -XULQJOLQJNDUDQ%GHQJDQVXGXWSXVDW D GDQMDULMDULU


$\R.LWD
%HUEDJL

.id

 7HQWXNDQVXDWXEXVXUGHQJDQMDULMDULGDQVXGXWSXVDWWHUWHQWXVHGHPLNLDQVHKLQJJD
SDQMDQJQ\DVDPDGHQJDQEXVXUOLQJNDUDQGHQJDQMDULMDULUGDQVXGXWSXVDWD
 3HWXQMXN
 D 7HQWXNDQSDQMDQJEXVXUOLQJNDUDQ\DQJMDULMDULUGDQVXGXWSXVDWD
 E %XDWODKEXVXUEDUXGHQJDQMDULMDULWHUWHQWX\DQJGLPDNVXGGLDWDV

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3UHVHQWDVLNDQ KDVLO SHQDODUDQPX NHSDGD WHPDQWHPDQ NDOLDQ 3UHVHQWDVLNDQ UXPXV XPXP XQWXN
PHQHQWXNDQSDQMDQJEXVXUVHUWDUXPXVXPXPXQWXNPHQHQWXNDQOXDVMXULQJ

"

/DWLKDQ 

 7HQWXNDQOXDVMXULQJOLQJNDUDQ\DQJGLNHWDKXLVXGXWSXVDWQ\DGDQMDULMDULQ\DFP
 7HQWXNDQSDQMDQJEXVXUOLQJNDUDQ\DQJGLNHWDKXLVXGXWSXVDWQ\DGDQMDULMDULQ\DFP
 /LQJNDUDQ$PHPLOLNLMDULMDULFP7HQWXNDQVXGXWSXVDWGDQMDULMDULVXDWXMXULQJOLQJNDUDQ
ODLQDJDUPHPLOLNLOXDV\DQJVDPDGHQJDQOLQJNDUDQ$
 %XDWODK OLQJNDUDQ $ GHQJDQ MDULMDUL WHUWHQWX VHGHPLNLDQ VHKLQJJD OXDVQ\D VDPD GHQJDQ
MXULQJSDGDOLQJNDUDQ%GHQJDQVXGXWSXVDWGDQMDULMDULWHUWHQWX-HODVNDQ


 /LQJNDUDQSHQXKGHQJDQMDULMDULU

 VHWHQJDKOLQJNDUDQGHQJDQMDULMDULU

7HQWXNDQPDQDNDK\DQJNHOLOLQJQ\DOHELKEHVDU"



.HODV9,,,60307V

6HPHVWHU

tp

://

 'LNHWDKXL

ht

Ayo Kita
Berbagi

Minta siswa untuk


mempresentasikan
hasil dari penalaran dan
penyelidikannya kepada
teman-teman di kelas
(bisa presentasi di depan
kelas atau menjelaskan
dengan teman sebangku).
304

Buku Guru Kelas VIII SMP/MTs

Semester 2

Alternatif
Jawaban
1. Panjang busur
2. Luas juring
3. Panjang busur sama dengan keliling lingkarannya ketika sudut pusatnya adalah
360o.
4. Luas juring sama dengan luas lingkarannya ketika sudut pusatnya adalah 360o.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Luas juring B

.id

5. Luas juring A

Dari perhitungan tersebut dapat disimpulkan Luas juring B lebih dari Luas juring A
6. Soal ini adalah soal terbuka jika sudut pusatnya.
panjang busur lingkaran yang berjari-jari r dan sudut pusat adalah
Misal

Jari jari

Panjang busur

ht

tp

://

Sudut pusat

Keterangan , n adalah bilangan bulat positif, dengan

MATEMATIKA

305

7XJDV
3URMHN

U

U

7LQJJL EHQWXN \DQJ PHQ\HUXSDL MDMDUJHQMDQJ WHUVHEXW VDPD GHQJDQ MDULMDUL OLQJNDUDQ
,QJDW EDKZD OXDV MDMDUJHQMDQJ DGDODK KDVLO NDOL GDUL DODV GHQJDQ WLQJJLQ\D 6HKLQJJD
GLGDSDW5XPXVOXDVOLQJNDUDQ/  U U  U
3URMHNNDOLDQ

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Minta siswa untuk


mengerjakan Tugas
Projek 3.2. Berikan
informasi secukupnya
agar siswa bisa
mengerjakan tugas
projek dengan baik.
Beri kebebasan kepada
siswa untuk memotong
lingkaran menjadi juringjuring dengan jumlah
potongan yang berbeda
dengan yang dicontohkan
di gambar.



'HQJDQ PHPRWRQJ OLQJNDUDQ PHQMDGL SRWRQJDQ MXULQJ \DQJ VDPD NLWD GDSDW PHQ\XVXQQ\D
PHQMDGL EHQWXN \DQJ PHQ\HUXSDL MDMDUJHQMDQJ VHSHUWL SDGD JDPEDU GL EDZDK LQL 3HUKDWLNDQ
EDKZDSDQMDQJVLVLEDJLDQEDZDKGDQDWDVSHUVHJLSDQMDQJWHUVHEXWDGDODKVHWHQJDKGDULNHOLOLQJ
OLQJNDUDQ

.id

Tugas
Projek

7HPXNDQUXPXVOXDVOLQJNDUDQGHQJDQSHQGHNDWDQEDQJXQGDWDUODLQ

0HUDQJNXP 

7XOLVNDQKDOKDOSHQWLQJ\DQJWHODKNDOLDQGDSDWGDULEHODMDUPDWHULOLQJNDUDQ
 %DJDLPDQDNDKKXEXQJDQVXGXWSXVDWGHQJDQVXGXWNHOLOLQJ\DQJPHQJKDGDSEXVXUWHUVHEXW"
 %DJLPDQDNDKKXEXQJDQDQWDUDVXGXWSXVDWSDQMDQJEXVXUGDQNHOLOLQJOLQJNDUDQ"
 %DJDLPDQDNDKKXEXQJDQDQWDUDVXGXWSXVDWOXDVMXULQJGDQOXDVOLQJNDUDQ"

0$7(0$7,.$

://

Merangkum

ht

tp

Minta siswa untuk menjawab pertanyaan pada kegiatan merangkum. Jawaban siswa
ditulis dalam kotak yang telah disediakan. Jawaban siswa sebisa mungkin diperjelas
dengan keterangan lebih lanjut jika bisa.
Berilah kebebebasan kepada siswa untuk menuliskan hal penting lain selama kegiatan
pembelajaran yang belum termuat dalam jawaban rangkuman.
Alternatif rangkuman:
1. Besarnya sudut keliling adalah setengan dari sudut pusat yang dihadapnya.
2. Misal x adalah besarnya sudut pusat busur ataupun juring.
Hubungan antara sudut pusat, panjang busur, dan keliling lingkaran adalah
Panjang busur =
3. Hubungan antara sudut pusat, luas juring, dan luas lingkaran adalah
Luas juring =
306

Buku Guru Kelas VIII SMP/MTs

Semester 2



1. Ajak siswa untuk melakukan refleksi terhadap kegiatan


pembelajaran.
2. Periksa kesesuaian rangkuman yang dibuat oleh siswa.
3. Berikan soal tambahan untuk dikerjakan di rumah (jika perlu)

8ML
.RPSHWHQVL

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

"

.id

4. Minta siswa untuk memberikan usulan perbaikan pembelajaran.

 6XDWXNXHEHUEHQWXNOLQJNDUDQSDGDWGHQJDQMDULMDULFP.XHWHUVHEXWGLEDJLPHQMDGL
EDJLDQEHUEHQWXNMXULQJ\DQJVDPDOXDV7HQWXNDQ

D  6XGXWSXVDWPDVLQJPDVLQJSRWRQJDQ

E  /XDVSRWRQJDQNXHWHUVHEXW
 7HQWXNDQNHOLOLQJGDHUDK\DQJGLDUVLUSDGDEDQJXQEHULNXW
D

14 cm

14 cm

26 cm

14 cm

26 cm

 $PDWLJDPEDUGLEDZDKLQL7HQWXNDQNHOLOLQJGDQOXDVGDHUDK\DQJGLDUVLU

a)

10 cm

://

b)

14 cm

10 cm

ht

14 cm

tp

5 cm

5 cm



.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

307

3HUKDWLNDQJDPEDUGLVHEHODKLQL%HVDUVXGXW
SXVDW$2%DGDODKNHPXGLDQMDULMDULQ\D 



FP


+LWXQJODKOXDVGDHUDK\DQJGLDUVLU

A



3HUKDWLNDQJDPEDUEHULNXW
3DGDJDPEDUGLVDPSLQJSDQMDQJ$% FPGDQ
$& FP7LWLN2PHUXSDNDQWLWLNSXVDWOLQJNDUDQ
+LWXQJODK
D -DULMDULOLQJNDUDQ2
E /XDVGDHUDK\DQJGLDUVLU

.id

A



D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o




'LNHWDKXL 2$% RGDQ$% %&


3DGDJDPEDUGLVDPSLQJSDQMDQJ$% FPGDQ
$& FP7LWLN2PHUXSDNDQWLWLNSXVDWOLQJ
NDUDQ+LWXQJODK
D -DULMDULOLQJNDUDQ2
E /XDVGDHUDK\DQJGLDUVLU

://

&

'LNHWDKXLVHJLWLJD$%&\DQJNHWLJDWLWLNVXGXWQ\D
EHUDGDSDGDOLQJNDUDQ2-LNDSDQMDQJVLVLVHJLWLJD
FPWHQWXNDQOXDVGDHUDK\DQJGLDUVLU

ht

tp



2
%

0$7(0$7,.$

308

Buku Guru Kelas VIII SMP/MTs



Semester 2

 3HUKDWLNDQJDPEDUGLVDPSLQJLQL

'LNHWDKXL$(% R

+LWXQJODKEHVDU $'% $&%GDQ $%&

P
E

B
D
C




3HUKDWLNDQJDPEDUGLVDPSLQJLQL
%LOD GLNHWDKXL $3%   $4%   $5%  
PDNDWHQWXNDQEHVDU $2%

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

 3HUKDWLNDQOLQJNDUDQ2GLVDPSLQJ
'LNHWDKXLP%2' 
7HQWXNDQP%&'

 6XDWX SDEULN PHPEXDW ELVNXLW \DQJ EHUEHQWXN OLQJNDUDQ SDGDW GHQJDQ GLDPHWHU  FP
6HEDJDLYDULDVLSDEULNWHUVHEXWMXJDLQJLQPHPEXDWELVNXLWGHQJDQNHWHEDODQVDPDQDPXQ
EHUEHQWXNMXULQJOLQJNDUDQGHQJDQVXGXWSXVDWR7HQWXNDQGLDPHWHUELVNXLWWHUVHEXWDJDU
EDKDQSURGXNVLQ\DVDPDGHQJDQELVNXLW\DQJEHUEHQWXNOLQJNDUDQ

tp

://

 3DN 6DQWRVR PHPLOLNL ODKDQ GL EHODNDQJ UXPDKQ\D


EHUEHQWXNSHUVHJLGHQJDQXNXUDQSDQMDQJVLVLP
P7DPDQWHUVHEXWVHEDJLDQDNDQGLEXDWNRODP
WLGDNGLDUVLU GDQVHEDJLDQODJLUXPSXWKLDV GLDUVLU 
-LND ELD\D SHPDVDQJDQ UXPSXW 5S
P 6HGDQJNDQ ELD\D WXNDQJ SHPDVDQJ UXPSXW
5S
D 7HQWXNDQ NHOLOLQJ ODKDQ UXPSXW PLOLN 3DN
6DQWRVRWHUVHEXW
E 7HQWXNDQ DQJJDUDQ \DQJ KDUXV GLVLDSNDQ ROHK
3DN6DQWRVRXQWXNPHQJRODKODKDQWHUVHEXW

ht

28



.HODV9,,,60307V

28

6HPHVWHU

MATEMATIKA

309



'LNHWDKXL EDKZD OXDV GDHUDK \DQJ GLDUVLU VHWHQJDK GDUL OXDV


GDHUDK\DQJWLGDNGLDUVLU7HQWXNDQ$%$&

A
 D

FP

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o



.id

FP

'LNHWDKXLSHUVHJL$%&'WHUVXVXQGDULHPSDW
SHUVHJLNHFLOVDPDXNXUDQGHQJDQSDQMDQJ
VLVL FP7HQWXNDQOXDVGDHUDK\DQJGLDUVLU
EHULNXW-HODVNDQ

'LNHWDKXLGXDOLQJNDUDQ\DQJLVRVHQWULV SXVDWQ\DVDPDGL
2 -LND$% FPWHQWXNDQOXDVGDHUDK\DQJGLDUVLU
3HWXQMXN,QJDWNHPEDOLWHRUHPDS\WKDJRUDV

ht

tp

://

 6XDWXSDEULNELVNXLWPHPSURGXNVLGXDMHQLVELVNXLWEHUEHQWXNFDNUDPGHQJDQNHWHEDODQ
VDPDWHWDSLGLDPHWHUQ\DEHGD3HUPXNDDQNXH\DQJNHFLOGDQEHVDUPDVLQJPDVLQJ
EHUGLDPHWHUFPGDQFP

6XPEHUELFLVWDIIXPPDFLG
*DPEDU%LVNXLW

%LVNXLWWHUVHEXWGLEXQJNXVGHQJDQGXDNHPDVDQEHUEHGD.HPDVDQELVNXLWNHFLOEHULVLELVNXLW
GLMXDOGHQJDQKDUJD5SVHGDQJNDQNHPDVDQNXHEHVDUEHULVLELVNXLWGLMXDOGHQJDQKDUJD
5S 0DQDNDK \DQJ OHELK PHQJXQWXQJNDQ PHPEHOL NHPDVDQ ELVNXLW \DQJ NHFLO DWDX
\DQJEHVDU"7XOLVNDQDODVDQPX"

0$7(0$7,.$

310

Buku Guru Kelas VIII SMP/MTs



Semester 2

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

 6XDWX NHWLND DQDN NHODV 9,,, 6031  0DODQJ PHQJDGDNDQ VWXG\ WRXU NH .HEXQ 5D\D
3DVXUXDQ *XUX PHQXJDVL VLVZD XQWXN PHPSHUNLUDNDQ GLDPHWHU VXDWX SRKRQ \DQJ FXNXS
EHVDU(ULN'DQD9HUL1LDGDQ5LDEHULQLVLDWLIXQWXNPHQJKLWXQJGLDPHWHUSRKRQWHUVHEXW
GHQJDQPHQJXNXUNHOLOLQJSRKRQ0HUHNDVDOLQJPHQJDLWNDQXMXQJMDULVHSHUWLWHUOLKDWSDGD
JDPEDU5DWDUDWDSDQMDQJGDULXMXQJMDULNLULVDPSDLXMXQJMDULNDQDQVHWLDSVLVZDDGDODK
FP-LNDWHSDWOLPDDQDNWHUVHEXWVDOLQJEHUVHQWXKDQXMXQJMDULQ\DXQWXNPHQJHOLOLQJLSRKRQ
WHUVHEXWELVDNDKNDOLDQPHQHQWXNDQ SHUNLUDDQ SDQMDQJGLDPHWHUSRKRQWHUVHEXW"

 6XDWX EDQ PRELO EHUGLDPHWHU  FP  P  %DQ WHUVHEXW EHUJDUDQVL KLQJJD PHQHPSXK
NP6DPSDLGHQJDQEHUDSDSXWDUDQEDQWHUVHEXWKLQJJDPDVDJDUDQVLQ\DKDELV" NP
P
 6XDWXVDWHOLWEHUHGDUPHQJHOLOLQJLEXPLSDGDNHWLQJJLDQNPGDULSHUPXNDDQEXPL-LND
SHUNLUDDQGLDPHWHUEXPLDGDODKNPWHQWXNDQSDQMDQJOLQWDVDQ\DQJGLWHPSXKVDWHOLW
WHUVHEXWXQWXNVDWXNDOLPHQJRUELWPHQJHOLOLQJLEXPL

tp

://

3HUKDWLNDQJDPEDUEHULNXW
6HEXWNDQVHEDQ\DNPXQJNLQ MLNDDGD EDJLDQ\DQJGLVHEXW
D -DULMDUL
E 'LDPHWHU
F -XULQJ
G 7DOLEXVXU
*
H %XVXU
I 7HPEHUHQJ
%
J $SRWHPD
K 6XGXWNHOLOLQJ
&

ht












)
,

+
(
'



.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

311

=+

SoalPengayaan

1.

Perhatikan gambar disamping !


a.sebutkan garis yang merupakan
i. diameter
ii. apotema
iii. busur
b.juring atau sektor
c.daerah yang diarsir disebut

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

2. Tentukan keliling lingkaran yang panjang diameternya adalah 21 cm!


3. Suatu kue berbentuk lingkaran padat dengan jari-jari 14 cm. Kue tersebut dibagi
menjadi 6 bagian berbentuk juring yang sama luas. Tentukan:
a) Sudutpusat masing masing potongan.
b) Luas potongan kue
4. Tentukan keliling daerah yang diarsir pada bangun berikut!

a.
b.
14 cm

14 cm

26 cm

14 cm

26 cm

ht

tp

://

5. Tentukan panjang diameter lingkaran yang diketahui luasnya adalah 6,16 cm2 !
6. Diketahui lingkaran A dan lingkaran B. Jari-jari lingkaran A adalah 10 kali jari-jari
lingkaran B. Luas lingkaran A adalah 700 cm2. Tentukan luas lingkaran B?
7. Amati gambar di bawah ini. Tentukan keliling dan luas daerah yang diarsir!
a.
b.
10 cm
10cm
5 cm
cm
5

10 cm
cm
10

1414cm
cm

14cm
14
cm

55cm
cm

312

Buku Guru Kelas VIII SMP/MTs

Semester 2

8. Lingkaran O mempunyai jari-jari r cm. Tentukan perbandingan luas lingkaran O


dengan lingkaran P yang jari-jarinya 2 kali jari-jari lingkaran O!
9. Perhatikan gambar di bawah ini!.Besarsudut pusat AOB adalah 900, kemudian jarijarinya = 21 cm

Hitunglah luas daerah yang diarsir!

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

10. Tentukan perbandingan


P

a) POQ dg AOB
b) Panjang busur PQ dengan
busur AB
c) Luas juring POQ dengan
juring AOB

450
O

900
28 cm

11. Perhatikan gambar berikut!


C

ht

tp

://

Pada gambar disamping, panjang AB = 12


cm dan AC = 16 cm. Titik O merupakan
titik pusat lingkaran. Hitunglah:
a.Jari-jari lingkaran O
b.Luas daerah yang diarsir

12. Diketahui OAB = 55o dan AB = BC.


C

Tentukanlah besar
AOB
a.
b.
ACB
c.
ABC

B
MATEMATIKA

313

13. Perhatikan gambar di bawah ini!


A

Diketahui AEB = 62o


Hitunglah besar: ADB,
ACB, dan ABC

.id

C
14. Perhatikan gambar di bawah ini!
B

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

A
O

Bila diketahui APB


+ AQB + ARB = 1440,
maka tentukan besar AOB !

15. Luas daerah yang diarsir setengah dari luas daerah yang tidak diarsir Panjang AB
dibagi panjang AC adalah
C

://

ht

tp

16. Tiga lingkaran kongruen saling bersinggungan seperti tampak pada Gambar
berikut. Garis AB melalui ketiga titik pusat lingkaran dan garis AC merupakan
garis singgung lingkaran yang berpusat di B. Jika diketahui jari-jari lingkaran
adalah 3 cm. maka panjang DE adalah ....
D

314

Buku Guru Kelas VIII SMP/MTs

Semester 2

17. Pak Santoso memiliki lahan di belakang rumahnya berbentuk persegi dengan ukuran
panjang sisi 28 28 meter2. Taman tersebut sebagian akan dibuat kolam (tidak
diarsir) dan sebagian lagi rumput hias (diarsir). Jika biaya pemasangan rumput
Rp.50.000,- / meter2. Sedangkan biaya tukang pemasang rumput Rp.250.000,-.
a. Tentukan keliling lahan rumput milik Pak Santoso tersebut!
b. Tentukan anggaran yang harus disiapkan oleh Pak Santoso untuk mengolah
lahan tersebut !

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

://

18. Suatu pabrik membuat biskuit yang berbentuk lingkaran padat dengan diameter
5cm. Sebagai fariasi pabrik tersebut juga ingin membuat biskuit dengan ketebalan
sama namun berbentuk juring lingkaran dengan sudut pusat 90o. Tentukan diameter
biskuit tersebut agar bahan produksinya sama dengan biskuit yang berbentuk
lingkaran.
19. Suatu pabrik biskuit memproduksi dua jenis biskuit berbentuk cakram dengan
ketebalan sama, tetapi diameternya beda. Permukaan kue yang kecil dan besar
masing-masing berdiameter 7 cm dan 10 cm.

tp

Sumber: bici.staff.umm.ac.id

ht

Biskuit tersebut dibungkus dengan dua kemasan berbeda. Kemasan biskuit


kecil berisi 10 biskuit dijual dengan harga Rp7.000,00 sedangkan kemasan kue
besar berisi 7 biskuit dijual dengan harga Rp10.000,00 Manakah yang lebih
menguntungkan, membeli kemasan biskuit yang kecil atau yang besar? Tuliskan
alasanmu?

MATEMATIKA

315

Alternatif
Jawaban

Berikut disajikan jawaban serta langkah singkat penyelesaian beberapa soal.


Guru bisa mengembangkan sendiri untuk soal yang lain.

1.
2.

3. Misal

= sudut pusat Lj = Luas juring

.id

a.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

b. Lj

4. Misal d1 = jari-jari lingkaran besar, d2 = jari-jari lingkaran kecil


a. K = Keliling lingkaran besar + 2. Keliling

b.

Jadi,

ht

tp

://

5.
6.

lingkaran kecil

7.
8. Luas O : Luas P

316

Buku Guru Kelas VIII SMP/MTs

Semester 2

9.
10.
11.

(karena menghadap diameter)


(Tripel pythagoras) .

a.

12.
13.
14. Besar

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

15. Misal AB = jari-jari juring kecil


AC = jari-jari juring besar

.id

b. Luas arsir

2.Luas juring arsir = Luas daerah tidak tidak diarsir


2.luas juring kecil = luas juring besar - luas jaring kecil
3.luas jaring kecil = luas jaring besar

ht

tp

://

16.
17.
18. Misal r1 = jari-jari biskuit berbentuk lingkaran

r2 = jari-jari biskuit berbentuk juring lingkaran
Luas lingkaran = luas juring

cm

MATEMATIKA

317

Pedoman
Penilaian
No
1

Capaian
B

Keterangan
Bila Buku Siswa terselesaikan dengan baik

<B

Bila ada bagian dari Buku Siswa yang tidak


terselesaikan

Portofolio:
a) Uji Kompetensi
b) Soal dari tempat
lain

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan mampu menyelesaikannya dengan
baik

.id

Aspek Penilaian
Keterselesaian Buku
Siswa

Bila memilih soal dari Uji Kompetensi dengan


kategori Sedang dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Mudah dan mampu menyelesaikannya
dengan baik

Bila memilih soal dari Uji Kompetensi dengan


kategori Sangat Sulit dan kurang mampu
menyelesaikannya dengan baik

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o
B+

B , B
B+, B,
B

Bila memilih soal dari Uji Kompetensi


A, B+ , dengan kategori Mudah dan kurang mampu
B, B menyelesaikannya dengan baik
Bila Proyek terselesaikan dan manpu
A
mempresentasikan dengan Baik
A, B+, Bila ada bagian dari Proyek yang tidak terselesaikan
atau kurang mampu mempresentasikan
B

://

ht

tp

Tugas Projek

Bila memilih soal dari Uji Kompetensi dengan


kategori Sulit dan kurang mampu menyelesaikannya
dengan baik
Bila memilih soal dari Uji Kompetensi
dengan kategori Sedang dan kurang mampu
menyelesaikannya dengan baik

Bila Proyek tidak terselesaikan samasekali

Keterangan: - Nilai KKM = B




318

- Aspek penilaian Nomor 1 adalah syarat nilai yang


harus terpenuhi, sedangkan Aspek penilaian Nomor 2
adalah penambahan nilai.

Buku Guru Kelas VIII SMP/MTs

Semester 2

Bab 4

Bangun Ruang
Sisi Datar

Kubus
Balok
Prisma
Limas
Sisi tegak
Sisi alas
Luas Permukaan
Volume

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Kata Kunci

K ompetensi
D asar
1.

://

2.

Menentukan luas
permukaan dan volume
kubus, balok, prisma,
dan limas.
Menaksir dan
menghitung luas
permukaan dan volume
bangun ruang yang
tidak beraturan dengan
menerapkan geometri
dasarnya.

Sebuah boneka Danboard dibuat dari kertas karton board.


Boneka ini adalah kreasi dari Azuma Kiyohiko seorang
komikus serial manga Yotsuba. Bentuk boneka ini sangat unik,
yaitu action gure dengan penampilan seperti manusia dengan
ukuran mini 7 cm dan 13 cm.
Siapa pun pasti akan merasa gemas ketika melihat si boneka
ini. Bagaimana tidak boneka dapat digerakkan secara manual
dan dibentuk dengan berbagai macam gaya unik. Perusahaan
yang membuatnya menggunakan teknologi tinggi di setiap
persendian boneka ini sehingga membuatnya mampu bergerak
luwes.
Pertanyaanya sekarang: bagaimanakah cara membuat karton
boneka secara manual? Tentunya untuk menjawab pertanyaan
tersebut kita harus tahu terlebih dulu tentang materi bangun
ruang sisi datar, karena di setiap sisi bagian tertentu luasnya
harus ada yang sama.

1.
2.
3.
4.
5.

ht

tp

Pengalaman
Belajar

Menentukan luas permukaan kubus dan balok dengan menggunakan alat peraga berupa
benda nyata.
Menentukan luas permukaan prisma yang didapat dari penurunan rumus luas permukaan
balok.
Menentukan luas permukaan limas dengan syarat-syarat ukuran yang harus diketahui
Menentukan volume kubus dan balok melalui pola tertentu sehingga bisa diterapkan pada
volume prisma dan limas.
Menaksir dan meng hitung luas permukaan dan volume bangun ruang yang tidak beraturan
dengan menerapkan geometri dasarnya melalui ilustrasi yang ditunjukkan.

MATEMATIKA
89
MATEMATIKA

319

Peta
Konsep

Bangun Ruang
Sisi Datar Tidak
Beraturan

ht

tp

://

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Bangun Ruang
Sisi Datar
Beraturan

.id

Bangun Ruang
Sisi Datar

320

Kelas
VIII SMP/MTs
90 Guru
Buku
Kelas
VIII SMP/MTs

Semester
Semester2 2

Archimedes dari Syracusa (287 SM - 212 SM).


Ia belajar di kota Alexandria, Mesir. Pada waktu
itu yang menjadi raja di Sirakusa adalah Hieron
II, sahabat Archimedes. Archimedes sendiri
adalah seorang matematikawan, astronom,
lsuf, sikawan, dan insinyur berbangsa Yunani.
Ia dibunuh oleh seorang prajurit Romawi
pada penjarahan kota Syracusa, meskipun ada
perintah dari jendral Romawi, Marcellus bahwa
ia tak boleh dilukai. Sebagian sejarahwan
matematika memandang Archimedes sebagai
salah satu matematikawan terbesar dalam
sejarah, bersama-sama Newton dan Gauss.

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

Archimedes dikenal karena ide sainsnya


mengenai teori mengembang dan tenggelam.
Menurut cerita, pada suatu hari ia dimintai
Raja Hieron II untuk menyelidiki apakah
Archimedes
mahkota emasnya dicampuri perak atau tidak.
Archimedes memikirkan masalah ini dengan
(287 SM - 212 SM)
sungguh-sungguh. Hingga ia merasa sangat letih
dan menceburkan dirinya dalam bak mandi umum penuh dengan air. Lalu, ia memperhatikan
ada air yang tumpah ke lantai dan seketika itu pula ia menemukan jawabannya. Ia bangkit
berdiri, dan berlari sepanjang jalan ke rumah dengan telanjang bulat. Setiba di rumah ia
berteriak pada istrinya, "Eureka. Eureka." yang artinya "sudah kutemukan. sudah kutemukan."

Archimedes hanya perlu memperoleh jumlah kuantitas emas yang digunakan untuk membuat
mahkota itu, lalu menentukan berat jenisnya dengan proses yang sama. Jika berat jenis
mahkota itu tidak sama, berarti emas itu mengandung emas campuran. Ia berhasil menemukan
cara mengetahui volume berat jenis benda tersebut dengan memasukkannya ke dalam air.
Kemudian, mengukur berapa banyak air yang didorong oleh benda tersebut.Ia juga dikenal
sebagai matematikawan yang sangat hebat, salah satu penemukannya adalah menemukan
rumus bangun datar dan volume bangun ruang.

://

Beberapa hikmah yang mungkin bisa kita petik antara lain:

1. Setiap apa yang kita lakukan, buatlah menjadi sesuatu yang sangat berarti.

ht

tp

2. Jika kita dihadapkan dengan suatu masalah, berusahalah dengan sekuat tenaga untuk
segera mencari solusinya. Salahsatu cara supaya masalah cepat selesai adalah dengan
menenangkan diri dan merenungkan tentang masalah tersbut dan munculkanlah
pertanyaan-pertanyaan yang sesuai dengan kontek permasalahan. Misalkan: bagaimana
cara untuk mengetahuinya? Apa yang harus dilakukan? Kenapa seperti ini? Kenapa tidak
begitu? Dan lain-lain.
3. Kita harus bisa menerapkan materi yang satu dengan materi yang lainnya untuk
memecahkan masalah yang ada di sekitar kita.
4. Segala sesuatu yang dapat kita amati pada fenomena alam ini dan bisa mempertanyakannya
serta bisa memperoleh jawabannya, maka kita akan memperoleh pengetahuan baru yang
sangat bermanfaat bagi diri kita pada khususnya dan orang lain pada umumnya.

MATEMATIKA
91
321

321

Apersepsi

/XDV3HUPXNDDQ
%DQJXQ5XDQJ
%LVDNDKNDOLDQPHQ\XVXQVXDWXREMHNVHSHUWL*DPEDUEHULNXW

Guru memberikan gambaran


awal tentang bangun ruang
sisi datar yang ada kaitannya
dalam kegihupan nyata.
Siswa diberikan beberapa
pertanyaan-pertanyaan
tentang menyusun suatu
objek disusun dengan
susunan yan rapi.
Contoh:
bisakah kalian menyusun
suatu objek dengan bentuk
kubus, balok, prisma atau
limas?

6XPEHULQIREDQJXQDQEORJVSRWFRP

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

6XPEHUPDWHPDWRKLUZRUGSUHVVFRP

6XPEHUYQL[QO

*DPEDU D %DWXEDWDPHUDK E SRWRQJDQEXDKEXDKDQGDQ F ERODHPDV

&REDSHUKDWLNDQVXVXQDQEDWXEDWDPHUDKSRWRQJDQEXDKEXDKDQGDQERODHPDVSDGDJDPEDU
%DWXEDWDPHUDKSRWRQJDQEXDKEXDKDQGDQERODHPDVWHUVHEXWGLVXVXQGHQJDQUDSLGDQPHPEHQWXN
NXEXVDWDXEDORNEDJLDQOXDUQ\DWHUEHQWXNELGDQJELGDQJ\DQJPHUXSDNDQELGDQJVLVLEDORN
'DSDWNDKNDOLDQPHQJKLWXQJOXDVELGDQJVLVLQ\D"$GDEHUDSDEDWXEDWD\DQJGLJXQDNDQ"3HUKDWLNDQ
SHUSRWRQJDQDQWDUELGDQJVLVLQ\D'DSDWNDKNDOLDQPHQMHODVNDQDSDNDK\DQJWHUMDGL"&REDDPDWL
DGDNDKWLJDUXVXN\DQJEHUSRWRQJDQGLVDWXWLWLN"-LNDDGDVHEXWNDQGDQEHUDSDEDQ\DNQ\D"
8QWXNPHQJHWDKXLOHELKMDXKWHQWDQJELGDQJVLVLUXVXNGDQWLWLNVXGXWSDGDNXEXVGDQEDORNODNXNDQ
NHJLDWDQEHULNXW

.HODV9,,,60307V

6HPHVWHU

://



ht

tp

Guru mengajak siswa untuk memperhatikan susunan batu bata merah, buah-buahan dan
bola emas pada Gambar 4.1.
Batu bata merah, buah-buahan dan bola emas tersebut disusun dengan rapi dan
membentuk kubus atau balok, bagian luarnya terbentuk bidang-bidang yang
merupakan bidang sisi balok.
Bidang sisi pada gambar di atas berbentuk bidang datar yang terdiri dari 6 bidang
sisi. Banyak batu bata yang digunakan mewakili volume bentuk balok tersebut,
begitu juga banyak buah-buahan dan banyak bola emas. Perpotongan bidang sisi
dengan bidang sisi akan membentuk suatu garus yang disebut dengan rusuk. Tiga
rusuk yang berpotongan pada satu titik disebut dengan titik sudut. Titik sudut pada
kubus atau balok sebanyak 8 titik sudut.
Berilah kesempatan kepada siswa untuk mengartikan apa yang disebut dengan
bidang sisi, rusuk, dan titik sudut.
322

Buku Guru Kelas VIII SMP/MTs

Semester 2

Membelajarkan 4.1
Menentukan Luas Permukaan Kubus dan Balok

0DVDODK 

6XPEHULQGRQHWZRUNFRLG

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3HUKDWLNDQJDPEDUEHULNXWLQLDWDXDPELOODKGXDNRWDNNXHDWDXNDUGXVNHFLO\DQJEHUEHQWXNNXEXV
GDQEDORN NRWDNNXHDWDXNDUGXVNHFLO\DQJGLDPELOKDUXVEHUEHGDGHQJDQNHORPSRN\DQJODLQ 
NHPXGLDQDPDWLODK

1. Sediakan beberapa
(secukupnya) kotak
kue atau kardus kecil
yang berbentuk kubus
dan balok
2. Sediakan juga alatalat pemotong seperti
gunting, katter, atau
lainnya
3. Siapkan beberapa
macam kerangka
bangun ruang kubus
dan balok
4. Siswa dibentuk
kelompok kecil siswa
(sebanyak 4 5 orang)
yang memungkinkan
belajar secara efektif
5. Siapkan beberapa
contoh model jaringjaring balok dan kubus,
kemudian tanyakan
kepada siswa: bisakah
kalian membuat model
jaring-jaring balok atau
kubus sebanyak 21
model jaring-jaring?
6. Sediakan juga
kerangka bangun
prisma segitiga, segi
empat, dan segi lainnya
kalau memungkinkan
sertakan juga beberapa
bentuk jaringjaringnya.

.id

0HQHQWXNDQ/XDV3HUPXNDDQ
.XEXVGDQ%DORN

.HJLDWDQ 

6XPEHULLWDPLQLQJVLKZRUGSUHVVFRP

*DPEDU.RWDNNXHGDQNDUGXV

  ,ULVODK EHEHUDSD UXVXN SDGD EDQJXQ \DQJ EHUEHQWXN %DORN VHKLQJJD DSDELOD GLEXND GDQ
GLUHEDKNDQSDGDELGDQJGDWDUDNDQPHPEHQWXNEDQJXQGDWDUVHKLQJJDDNDQGLGDSDWDSD\DQJ
GLVHEXWMDULQJMDULQJEDORN
  6HODQMXWQ\DLULVODKEHEHUDSDUXVXNGHQJDQSRODLULVDQ\DQJEHUEHGDSDGDEDQJXQ\DQJEHUEHQWXN
.XEXV VHKLQJJD DSDELOD GLEXND GDQ GLUHEDKNDQ SDGD ELGDQJ GDWDU DNDQ PHPEHQWXN EDQJXQ
GDWDUPDNDDNDQGLGDSDWDSD\DQJGLVHEXWMDULQJMDULQJ.XEXV
  %DQGLQJNDQNHGXDEHQWXNMDULQJMDULQJWHUVHEXWNHPXGLDQXNXUODKGDQKLWXQJODKOXDVQ\D

://

$OWHUQDWLI3HPHFDKDQ0DVDODK

ht

tp

6DODKVDWXMDZDEDQGDULSHUWDQ\DDQSDGDPDVDODKGLDWDVDGDODKVHEDJDLEHULNXW

0$7(0$7,.$



Ajaklah siswa untuk memperhatikan dan memahami Masalah 4.1


Bagikan kotak kue atau kardus kecil kepada kelompok siswa baik yang berbentuk
balok mapun kubus, bagikan pula alat-alat pemotong seperti gunting atau katter atau
lainnya
Fokus pengamatan adalah akan melakukan suatu kegiatan pembuktian langsung
terhadap kotak kue atau kardus kecil untuk mengetahui luas seluruh pemukaannya
MATEMATIKA

323

$\R
.LWD$PDWL

Ayo
Kita Amati

 3HUKDWLNDQJDPEDUNRWDNURWLEHULNXW

FP

/
/

FP
FP

FP

/

/

/

/

LLL

LL
*DPEDU.RWDNURWLGDQMDULQJMDULQJQ\D

*DPEDUGLDWDVPHUXSDNDQJDPEDUNRWDNURWL\DQJGLJXQWLQJ GLLULV SDGDWLJDEXDKUXVXNDODV


GDQDWDVQ\DVHUWDVDWXEXDKUXVXNWHJDNQ\D\DQJGLUHEDKNDQSDGDELGDQJGDWDUVHKLQJJDPHPEHQWXN
MDULQJMDULQJNRWDNURWL
3DGDJDPEDU LLL GLGDSDWVHEDJDLEHULNXW
/ // /GDQ/ /
6HKLQJJDOXDVVHOXUXKSHUPXNDDQNRWDNURWL //////
 //  //  //
 /  /  /

     

     



.id




D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Ajaklah siswa untuk


mengamati langkahlangkah penyelesaian
Masalah 4.1
Kemudian siswa
ditugaskan untuk
menggambar sendiri
pada text box dengan
petunjuk nomor 2
pada Gambar 4.2
Motivasilah siswa
agar membuat
kesimpulan dari hasil
kegiatan yang telah di
amati.

FP

-DGLOXDVVHOXUXKSHUPXNDDQNRWDNURWLDGDODKFP

 3HUKDWLNDQJDPEDUNRWDNNXHEHULNXW/DNXNDQODKODQJNDKODQJNDKVHSHUWL*DPEDU

Alternatif
Jawaban

*DPEDU.RWDN.XH

*DPEDUPHUXSDNDQNRWDNNXH\DQJEHUEHQWXNNXEXV&REDNDOLDQJDPEDUVHQGLULSDGDNRWDN
SHUVHJLSDQMDQJ GL DWDV GHQJDQ SHWXQMXN QRPRU  *DPEDU  \DNQL LULVODK EHEHUDSD UXVXN
GHQJDQSRODLULVDQ\DQJEHUEHGDNRWDNNXHWHUVHEXWGDQJDPEDUODKMXJDMDULQJMDULQJQ\DVHUWD
XNXUODKNRWDNNXHWHUVHEXWGDQWHQWXNDQOXDVQ\D



6HPHVWHU

.HODV9,,,60307V

ht

tp

://

Perhatikan kembali gambar


kotak kue berikut:
mengiris irislah beberapa
rusuk dengan pola irisan
yang berbeda kotak roti
tersebut dan gambarlah
juga jaring-jaringnya serta
ukurlah kotak kue tersebut
dan kemudian ditentukan
luasnya.

Pada Gambar 4.4, di dapat sebagai berikut: L1 = L2 = L3 = L4 = L5 = L6


Sehingga luas seluruh permukaan kotak roti = L1 + L2 + L3 + L4 + L5 + L6

= 6 L1

= 6 (9 9)

= 6 (81)

= 486 cm2
324

Buku Guru Kelas VIII SMP/MTs

Semester 2

-LNDVXDWXNRWDNURWL\DQJEHUEHQWXNEDORNGLLULVSDGDWLJDEXDKUXVXNDODVQ\DGDQDWDVQ\DVHUWD
VDWXEXDKUXVXNWHJDNQ\DNHPXGLDQGLUHEDKNDQVHKLQJJDWHUMDGLEDQJXQGDWDUPDNDEDQJXQ
GDWDULWXGLQDPDNDQMDULQJMDULQJEDORN
'HPLNLDQMXJDSDGDNRWDNNXH\DQJEHUEHWXNNXEXVDSDELODGLLULVSDGDUXVXNUXVXNWHUWHQWXGDQ
GLUHEDKNDQSDGDEDQJXQGDWDUPDNDEDQJXQGDWDULWXGLQDPDNDQMDULQJMDULQJNXEXV
.HVLPSXODQDSD\DQJGDSDWNDOLDQDPELOGDULSHQJDPDWDQGLDWDV"

"

$\R.LWD
0HQDQ\D

-LND NDPX LQJLQ PHPEXDW NRWDN SHUQLNSHUQLN EHUEHQWXN NXEXV GDUL NHUWDV NDUWRQ GLPDQD NRWDN
SHUQLNSHUQLNWHUVHEXWPHPLOLNLSDQMDQJUXVXNFPPDNDEXDWODKSHUWDQ\DDQ\DQJPHPXDWNDWD
NDWDEHULNXW

6HGLNLW
,QIRUPDVL

&RQWRK 
+

+LWXQJODKOXDVSHUPXNDDQNXEXV$%&'()*+SDGD
*DPEDUGLVDPSLQJ

3HQ\HOHVDLDQ

FP

'
FP

FP

*DPEDU.XEXV$%&'()*+

/XDVSHUPXNDDQNXEXV V








-DGL OXDV SHUPXNDDQ EDQJXQ \DQJ EHQWXN NXEXV


DGDODKFP

://

0$7(0$7,.$



Jelaskan tugas berikutnya,


yaitu membuat pertanyaan
(questioning); pada
kegiatan ini siswa
membuat pertanyaan yang
akan diajukan kepada guru
apabila ingin membuat
pernik-pernik berbentuk
kubus dari karton. Contoh:
bagaimana cara membuat
kubus dengan ukran 12
cm? Seberapa banyak
pernik-pernik yang
dibutuhkan?

tp


$

&

ht

Ayo Kita
Menanya

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

/XDV SHUPXNDDQ EDORN DGDODK MXPODK VHOXUXK OXDV VLVL EDORN WHUVHEXW$GD GXD OXDV VLVL \DQJ
EHUKDGDSDQVDPD6HGDQJNDQOXDVSHUPXNDDQNXEXVVDPDKDOQ\DGHQJDQOXDVSHUPXNDDQEDORN
DNDQWHWDSLNDODXNXEXVOXDVVHWLDSVLVLVLVLQ\DDGDODKVDPDVHKLQJJDNDUHQDVLVLEDORNDGD
PDNDOXDVSHUPXNDDQNXEXVDGDODKOXDVVDWXVLVLQ\DGLNDOLNDQ

.id

 .XEXVGDQSDQMDQJUXVXNFP
 NXEXVGDQNHUWDVNDUWRQ
 EDQ\DNGDQSHUQLNSHUQLN
7XOLVODKSHUWDQ\DDQNDOLDQGLOHPEDUNHUMDEXNXWXOLV

Sedikit
Informasi
Kemudian ajaklah siswa
untuk memahami sedikit
informasi yang sudah
disediakan dalam buku
tersebut
MATEMATIKA

325

&RQWRK 
*

+LWXQJODKOXDVSHUPXNDDQEDORNSDGD*DPEDU

(
3HQ\HOHVDLDQ

FP

/XDVSHUPXNDDQEDORN

 SOSWOW

 

 

 

'
$

FP

&
FP

*DPEDU%DORN$%&'()*+



-DGLOXDVSHUPXNDDQEDQJXQ\DQJEHQWXNEDORNDGDODKFP

&RQWRK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

6HEXDK EDORN PHPLOLNL VLVLVLVL \DQJ OXDVQ\D  FP  FP GDQ  FP %HUDSDNDK MXPODK
SDQMDQJVHPXDUXVXNEDORNWHUVHEXW"

3HQ\HOHVDLDQ

3HUKDWLNDQJDPEDUEHULNXW

0HQXUXWLQIRUPDVLGDULVRDOPDNDGLGDSDWSO 
SW GDQOW 

'HQJDQPHQ\HOHVDLNDQVLVWHPSHUVDPDDQ\DQJDGD
PDNDGLSHUROHKVHEDJDLEHULNXW
SO u SW
OW

 u 


SO u OW
SW

 u 


SW u OW
SO

 u 


6HKLQJJDMXPODKSDQMDQJVHPXDUXVXNEDORN  SOW        FP

.HODV9,,,60307V

6HPHVWHU

ht

tp

://



1. Periksalah apakah semua kelompok


sudah mencatat hal-hal yang penting
pada kegiatan kali ini
2. Berikan penilaian terhadap proses
dan hasil karya siswa dengan
menggunakan rubrik penilaian
3. Jika dipandang perlu, berilah siswa
soal latihan 4.1 untuk dikerjakan di
rumah
326

Buku Guru Kelas VIII SMP/MTs

Semester 2

$\R.LWD
0HQJJDOL,QIRUPDVL

=+

$\R.LWD
0HQDODU
6HEXK NDUWRQ EHUXNXUDQ  P   P .DUWRQ WHUVHEXW DNDQ GLEXDW XQWXN PHEXQJNXV NDGR \DQJ
EHUXNXUDQFPFPFP-LNDNDGR\DQJDNDQGLEXDWVHEDQ\DNEXDKPDNDEHUDSDEDQ\DN
PLQLPDONDUWRQ\DQJGLEXWXKNDQ"
$\R.LWD
%HUEDJL
6HWHODKVHOHVDLPHQMDZDEWXNDUNDQKDVLOMDZDEDQNDOLDQGHQJDQNHORPSRN\DQJODLQ.HPXGLDQ
EDQGLQJNDQKDVLOMDZDEDQQ\DGLNVXVLNDQGHQJDQNHORPSRNWHUVHEXW
7XOLVODKNHVLPSXODQNDOLDQSDGDOHPEDUNHUMDEXNXWXOLV\DQJVXGDKNDOLDQVHGLDNDQ

"

/DWLKDQ 

Setelah memahami sedikit


informasi dirasa sudah
cukup, informasikan
kegiatan selanjutnya,
yaitu menggali informasi
(pada pojok pustaka atau
di perpustakaan) tentang
permasalahan yang sudah
disediakan pada buku
siswa

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 $NDQGLEXDWPRGHONHUDQJNDEDORNGDULNDZDW\DQJSDQMDQJQ\DP-LNDXNXUDQSDQMDQJ
OHEDUGDQWLQJJLQ\DDGDODKFPFPFP

D KLWXQJODKEDQ\DNNHUDQJNDEDORN\DQJGDSDWGLEXDW

E %HUDSDNDKVLVDNDZDWGDUL\DQJWHODKGLJXQDNDQXQWXNPHPEXDWEDORN
 6HEXDK$XODEHUEHQWXNEDORNGHQJDQXNXUDQSDQMDQJPHWHUOHEDUPHWHUGDQWLQJJLQ\D
PDWHU'LQGLQJEDJLDQGDODPQ\DDNDQGLFDWGHQJDQELD\D5SSHUPHWHUSHUVHJL
7HQWXNDQVHOXUXKELD\DSHQJHFDWDQ$XODWHUVHEXW
 3HUEDQGLQJDQSDQMDQJOHEDUGDQWLQJJLVHEXDKEDORNDGDODK-LNDOXDVDODVEDORN
WHUVHEXWDGDODKFPPDNDKLWXQJODKOXDVSHUPXNDDQEDORNWHUVHEXW
 'LNHWDKXLOXDVVXDWXMDULQJMDULQJEDORNDGDODKFP%DJDLPDQDFDUDPHQHPXNDQXNXUDQ
EDORNWHUVHEXW"
 3HUKDWLNDQJDPEDUNXEXVGLVDPSLQJ
 -LNDVLVLDWDVGDQVLVLEDZDKNXEXVWHUVHEXWGLFDWGHQJDQZDUQD
PHUDK VHGDQJ VLVL ODLQ GLFDW GHQJDQ ZDUQD ELUX NHPXGLDQ
NXEXV GLSRWRQJSRWRQJ PHQMDGL  NXEXV VDWXDQ 7HQWXNDQ
DQ\DNNXEXVVDWXDQ\DQJPHPLOLNLZDUQDELUXVDMD

Menggali
Informasi

.id

&REDWHPXNDQSDGDEXNXWHUWHQWXGLLQWHUQHWDWDXPHPEXDWVHQGLULMLNDGLNHWDKXLOXDVSHUPXNDDQ
EDORN DGDODK  FP %DJDLPDQD FDUD PHQHPXNDQ XNXUDQ SDQMDQJ OHEDU GDQ WLQJJL EDORN
WHUVHEXW"%HUDSDEDQ\DNNHPXQJNLQDQXNXUDQXNXUDQ\DQJNDOLDQWHPXNDQ"

 'LNHWDKXL SDGD VHWLDS VLVL NXEXV GLWXOLVNDQ VHEXDK ELODQJDQ


DVOL 6HWLDS WLWLN VXGXWQ\D GLEHUL QLODL \DQJ PHUXSDNDQ KDVLO
NDOLGDULWLJDELODQJDQSDGDWLJDVLVL\DQJEHUSRWRQJDQGLWLWLN
VXGXWWHUVHEXW-LNDMXPODKVHPXDELODQJDQSDGDWLWLNWLWLNVXGXWWHUVHEXWVDPDGHQJDQ
WHQWXNDQMXPODKVHPXDELODQJDQ\DQJGLWXOLVNDQSDGDVLVLVLVLNXEXVWHUVHEXW

Selanjutnya ajaklah siswa


untuk bernalar dengan
menggunakan rumus luas
permukaan Balok atau
Kubus yang sudah di
ketahui



://

0$7(0$7,.$

Ayo Kita
Menalar

ht

tp

Alternatif Pemecahan Masalah


Luas karton = 0,5 m 1 m

= 50 cm 100 cm

= 5000
Luas kado = 2(23 + 25 + 35)
= 2(6 + 10 + 15)
= 2(31)
= 62 cm2
Akan dibuat sebanyak 500 buah, sehingga
500 62 = 31.000 cm2
Dengan demikian Banyak minimal karton yang dibutuhkan adalah
karena hasil baginya berupa pecahan desimal, maka dibulatkan menjadi 7 karton
MATEMATIKA

327

Membelajarkan 4.2
Menentukan Luas Permukaan Prisma

.id

1. Sediakan beberapa kerangka prisma lengkap dengan jaring-jaringnya


2. Sediakan kertas HVS secukupnya
3. Siswa dibentuk kelompok kecil siswa (sebanyak 4 5 orang) yang memungkinkan
belajar secara efektif

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

0HQHQWXNDQ
/XDV3HUPXNDDQ3ULVPD

.HJLDWDQ 

3HUQDKNDKNDOLDQPHQMXPSDLEDJLDQDWDSJXEXNGDQWHQGDSHUNHPDKDQVHSHUWLJDPEDUEHULNXW"
'LPDQDNDKNDOLDQPHQMXPSDLQ\D"

6XPEHUPDWHPDWRKLUZRUGSUHVVFRP

6XPEHUVPNZLNUDPDQHW

*DPEDU*XEXNGDQWHQGD

3DGDEDJLDQDWDVJXEXNGDQWHQGDGDSDWGLJDPEDU
VHEDJDLEHULNXW
'DODPPDWHPDWLND*DPEDUGLDWDVGLVHEXWGHQJDQ
SULVPD
3HUKDWLNDQSULVPDSDGDJDPEDUGLVDPSLQJ3DGDJDPEDU
WHUVHEXWGLEDWDVLROHKGXDVLVL\DQJEHUEHQWXNVHJLWLJD
\DQJNRQJUXHQGDQVHMDMDUVHUWDWLJDVLVLQ\D\DQJ
EHUEHQWXNSHUVHJLSDQMDQJ3HUKDWLNDQPRGHOSULVPD
SDGDJDPEDUGLEDZDKLQL


://

tp

Apersepsi

*DPEDU3ULVPD

ht

Guru memberikan
gambaran awal tentang
bangun prisma yang
terdapat pada kehidupan
nyata, kemudian
dirunjukkan beberapa
macam bentuk prisma, yaitu
prisma segitiga, prisma segi
empat, prisma segi lima dan
prisma segi delapan
328

3ULVPD6HJLWLJD

3ULVPD6HJLHPSDW

3ULVPD6HJLOLPD

3ULVPD6HJLGHODSDQ

*DPEDU0RGHOPRGHO3ULVPD

8QWXNOHELKMHODVQ\DLNXWLODKODQJNDKODQJNDKNHJLDWDQEHODMDUEHULNXWLQL
0DVDODK 
3HUKDWLNDQNHPEDOLJDPEDUGLDWDV3DGDPRGHOPRGHOSULVPDWHUVHEXWDGDGXDVLVL\DQJVDOLQJ
EHUKDGDSDQOXDVQ\DDGDODKVDPD'XDVLVL\DQJOXDVQ\DVDPDPDVLQJPDVLQJGLQDPDNDQVLVLDODV
GDQVLVLDWDV6HGDQJVLVLODLQ\DQJEHUEHQWXNSHUVHJLSDQMDQJDWDXMDMDUJHQMDQJGLVHEXWVLVLWHJDN
0DVDODKQ\D VHNDUDQJ EDJDLPDQDNDK ODQJNDKODQJNDK PHQFDUL OXDV SHUPXNDDQ SULVPD WHUVHEXW"
+DOKDODSDVDMD\DQJKDUXVGLSHUKDWLNDQSDGDSULVPDWHUVHEXW"



Buku Guru Kelas VIII SMP/MTs

.HODV9,,,60307V

6HPHVWHU

Semester 2

$OWHUQDWLI3HPHFDKDQ0DVDODK
$\R
.LWD$PDWL
%HULNXWJDPEDUSULVPDVHJLWLJDVHJLHPSDWGDQVHJLHQDPEHUDWXUDQGLOHQJNDSLGHQJDQMDULQJMDULQJQ\D
7DEHOD-DULQJMDULQJSULVPD
1R

3ULVPD

alas

-DULQJMDULQJ

t
b

a
c

alas

p
l

l


alas

d
c

alas

f
a

://

0$7(0$7,.$

tp

alas

ht

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

alas

.id

Ayo
Kita Amati



Ajaklah siswa untuk


memperhatikan dan
memahami Masalah 4.2

Informasikan tugas yang


akan mereka kerjakan,
yaitu akan mengamati
kerangkan bangun
prisma dan jaringjaringnya pada
Tabel 4.1a
Fokus pengamatan
yang pertama adalah
memperhatikan dengan
teliti pada model-model
prisma dan jaringjaringnya pada
Tabel 4.1a
MATEMATIKA

329

7DEHOE/XDVSHUPXNDDQSULVPD
1R

-DULQJMDULQJ3ULVPD
c

3RWRQJDQMDULQJMDULQJSULVPD
c

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

t
p

l
p

b
b

b
a

d
d

b
b

Ayo
Kita Amati



.HODV9,,,60307V

d
e

6HPHVWHU

ht

tp

://

Fokus pengamatan adalah


memperhatikan dengan
teliti pada model-model
prisma dan jaringjaringnya pada Tabel 4.1a
Fokus pengamatan
yang kedua adalah
memperhatikan dengan
teliti pada model-model
jaring-jaringn prisma
dan potongan-potongan
jaring-jaringnya pada
Tabel 4.1b
330

Buku Guru Kelas VIII SMP/MTs

Semester 2

.HVLPSXODQDSD\DQJGDSDWNDOLDQDPELOGDULSHQJDPDWDQGLDWDV"
$\R.LWD
0HQDQ\D

%HUGDVDUNDQKDVLOSHQJDPDWDQNDOLDQFREDEXDWODKSHUWDQ\DDQ\DQJPHPXDWNDWDNDWDEHULNXW
 GXDVLVL\DQJVDOLQJEHUKDGDSDQGDQVLVLDODV
 VLVLDODVGDQVLVLDWDV
 NHOLOLQJGDQELGDQJWHJDN
7XOLVODKSHUWDQ\DDQNDOLDQGLOHPEDUNHUMDEXNXWXOLV
6HGLNLW
,QIRUPDVL

/ /XDVDODV.HOLOLQJDODVWLQJJL

&RQWRK 

l
p

alas

*DPEDU3ULVPDVHJLHPSDW

*DPEDUPHUXSDNDQSULVPDWHJDNVHJLWLJDVLNXVLNX7HQWXNDQOXDVSHUPXNDDQSULVPDWHUVHEXW

3HQ\HOHVDLDQ

$&  %&

   

  



6HKLQJJD
/ /XDVDODV.HOLOLQJDODVWLQJJL





8QWXN PHQFDUL OXDV SHUPXNDDQ SULVPD VHJLWLJD WHUVHEXW


WHUOHELKGXOXNLWDFDULSDQMDQJVHPXDDODVQ\D\DLWX

$%

Jelaskan tugas
berikutnya, yaitu
membuat pertanyaan;
pada kegiatan ini
siswa membuat
pertanyaan tentang
model-model prisma
dan jaring-jaringnya
serta potonganpotongannya. Contoh
kenapa dua sisi yang
saling berhadapan
dianggap sebagai
alas? Bukankah kalau
suatu bangun ruang
itu ada alasnya juga
ada tutupnya?

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

%DORN MXJD GDSDW GLNDWDNDQ SULVPD VHJL HPSDW VHKLQJJD OXDV


SHUPXNDDQSULVPDELVDGLGDSDWGDULOXDVSHUPXNDDQEDORN$NDQ
WHWDSLSDGDOXDVSHUPXNDDQSULVPD\DQJGLWHNDQNDQDGDODKOXDV
DODVNHOLOLQJDODVGDQWLQJJL
3HUKDWLNDQ JDPEDU  GL VDPSLQJ LQL XQWXN OXDV SHUPXNDDQ
SULVPDVHJLHPSDWVDPDGHQJDQOXDVSHUPXNDDQEDORN\DLWX
/  SOSWOW 
/ SOSWOW
/ SO SWOW
/ /XDVDODV SO W
/ /XDVDODV.HOLOLQJDODVWLQJJL
6HKLQJJDOXDVSULVPDVHFDUDXPXPDGDODK

alas

Ayo Kita
Menanya

.id

"

8 cm


  


    

-DGLOXDVSHUPXNDDQSULVPDWHJDNVHJLWLJDVLNXVLNXDGDODKFP

4c

3c

://
tp

*DPEDU3ULVPDVHJLWLJD
VLNXVLNX

0$7(0$7,.$

ht



Sedikit
Informasi

Kemudian ajaklah
siswa untuk memahami
sedikit informasi yang
sudah disediakan
dalam buku siswa,
jika dimungkinkan ada
pertanyaan tentang
informasi tersebut,
bahaslah bersama-sama
dengan siswa yang
lainnya sehingga siswa
benar-benar paham
tentang informasi
tersebut
MATEMATIKA

331

&RQWRK 

Ayo Kita
Menalar

'LNDWDKXL OXDV SHUPXNDDQ SULVPD VHJL HPSDW DGDODK  FP  $ODV SULVPD WHUVHEXW EHUEHQWXN
SHUVHJLSDQMDQJGHQJDQXNXUDQSDQMDQJFPGDQOHEDUFP7HWXNDQWLQJJLSULVPDWHUVHEXW

/XDVSHUPXNDDQSULVPDVHJLHPSDW FP
3DQMDQJDODVFPGDQOHEDUDODVFP
/ 
/XDVDODV.HOLOLQJDODVWLQJJL
 
SDQMDQJOHEDU SDQMDQJOHEDU WLQJJL


  WLQJJL


  WLQJJL
 
WLQJJL

WLQJJL

WLQJJL
WLQJJL

-DGLWLQJJLSULVPDWHUVHEXWDGDODKFP

Petunjuk Jawaban

3HUKDWLNDQ NHPEDOL 7DEHO D SDGD QRPRU  %DJDLPDQD FDUDQ\D NDOLDQ PHQHQWXNDQ OXDV
SHUPXNDDQQ\D"-LNDD FPGDQW FP-HODVNDQ
$\R
.LWD6HOLGLNL

P

$\R.LWD
%HUEDJL

.HPXGLDQODNXNDQGLVNXVLGDODPNHORPSRNNDOLDQXQWXNPHQMDZDENHGXDVRDOWHUVHEXW\DQJGLSDQGX
ROHK*XUXPXVHKLQJJDGLSHUROHKSHPDKDPDQGDQNHVLPSXODQ\DQJVDPD
7XOLVODKSHPDKDPDQGDQNHVLPSXODQ\DQJVXGDKGLSHUROHKSDGDEXNXNDOLDQ



.HODV9,,,60307V

6HPHVWHU

ht

tp

Ajaklah siswa untuk


menerapkan hasil diskusinya
pada beberapa soal yang
telas disediakan pada
buku siswa
Ayo Kita
Berbagi

Informasikan kepada siswa untuk mendikusikannya secara klasikal, dimana dalam


kegiatan ini: Guru menyuruh seluruh kelompok yang ada untuk mempresentasikan
hasil penyelesaiannya di depan kelas secara bergantian salah kelompok siswa
mempresentasikannya jawaban dari hasil dikusinya
332

P

*DPEDU7HQGD

://

Ayo
Kita Selidiki

&REDWHUDSNDQKDVLOSHQDODUDQNDOLDQSDGDVRDOVRDOEHULNXW
 3HUQDKNDKNDPXEHUNHPDK"%HUEHQWXNDSDNDKWHQGD\DQJ
NDPXSDNDL"%LODWHQGD\DQJNDPXSDNDLVHSHUWLJDPEDUWHQGD
GLVDPSLQJGDSDWNDKNDPXPHQJKLWXQJOXDVNDLQWHUNHFLO\DQJ
GLSHUOXNDQXQWXNPHPEXDWWHQGDLWX"&REDKLWXQJODK
 6HEXDKSULVPDWHJDNVHJLHQDPEHUDWXUDQ$%&'()*+,-./
PHPSXQ\DLSDQMDQJUXVXNDODVFPSDQMDQJUXVXNWHJDNFP
D *DPEDUODKEDQJXQSULVPDQ\D
E 7HQWXNDQOXDVELGDQJWHJDNQ\D
F 7HQWXNDQOXDVSHUPXNDDQSULVPD

P

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Syarat minimal yang


diketahui:
1) Perhatikan gambar alas
segi enam di samping.
2) Kemudian carilah
luas segitiga yang
panjang sisi-sisinya
10 cm.
3) Luas segitiga dikalikan
enam, sehingga
diperoleh luas alas segi
enam.
4) Selanjutnya gunakan
rumus luas permukaan
prisma, yakni
L = 2 Luas alas
+ Keliling alas tinggi.

$\R.LWD
0HQDODU

.id

Selanjutnya ajaklah siswa


untuk bernalar dengan
mencari syarat minimal
apa suatu limas sehingga
luas permukaannya bisa
dihitung.

$OWHUQDWLI
3HQ\HOHVDLDQ

Buku Guru Kelas VIII SMP/MTs

Semester 2

"

/DWLKDQ 

 $ODVVHEXDKSULVPDEHUEHQWXNVHJLWLJDVLNXVLNXGHQJDQSDQMDQJVLVLFPFPGDQ
FP-LNDWLQJJLSULVPDDGDODKFP+LWXQJODKOXDVSHUPXNDDQSULVPDWHUVHEXW
 *DPEDUGLEDZDKDGDODKSULVPD$%&'()*+'HQJDQ$%)(VHMDMDU'&*+3DQMDQJ$%
FP%& FP$( FPGDQ)% FP7HQWXNDQOXDVSHUPXNDDQQ\D

H
E

G
F
D

 'LNHWDKXLOXDVSHUPXNDDQSULVPDWHJDNVHJLHPSDWEHUDWXUDQFPGDQWLQJJLSULVPD
FP7HQWXNDQSDQMDQJVLVLDODVSULVPDWHUVHEXW

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 3HUKDWLNDQJDPEDUSULVPDEHULNXWLQL

.id

 6HEXDKSULVPDDODVQ\DEHUEHQWXNEHODKNHWXSDWGHQJDQSDQMDQJGLDJRQDOFPGDQFP
7HQWXNDQWLQJJLSULVPDMLNDOXDVSHUPXNDDQQ\DDGDODKFP

$ODVSULVPDWHUVHEXWEHUEHQWXNVHJLWLJDVLNXVLNXGHQJDQSDQMDQJ%& FPGDQ$& 


FP-LNDOXDVSHUPXNDDQSULVPDFPWHQWXNDQWLQJJLSULVPDWHUVHEXW%DJDLPDQDFDUD
NDOLDQPHQFDULOXDVELGDQJ$%)"-HODVNDQ

 'LNHWDKXLOXDVSHUPXNDDQSULVPDVHJLHPSDWDGDODKFPGHQJDQWLQJJLFP-LNDDODV
SULVPDWHUVHEXWEHUEHQWXNSHUVHJLSDQMDQJPDNDWHQWXNDQNHPXQJNLQDQNHPXQJNLQDQXNX
UDQSDQMDQJGDQOHEDUSULVPDLWX



ht

tp

://

0$7(0$7,.$

1. Periksalah apakah semua kelompok sudah mencatat hal-hal yang penting pada
kegiatan kali ini
2. Berikan penilaian terhadap proses dan hasil karya siswa dengan menggunakan
rubrik penilaian
3. Jika dipandang perlu, berilah siswa soal Latihan 4.2 untuk dikerjakan di rumah
MATEMATIKA

333

Membelajarkan 4.3
Menentukan Luas Permukaan Limas

Apersepsi

.id

Guru memberikan gambaran awal tentang bangun limas yang terdapat pada kehidupan
nyata, kemudian dirunjukkan beberapa macam bentuk limas, yaitu limas segitiga, limas
segi empat, limas segi lima dan limas segi enam.

.HJLDWDQ 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

0HQHQWXNDQ/XDV3HUPXNDDQ/LPDV

3HUKDWLNDQEDJLDQDWDSEDQJXQDQGLEDZDKLQL
%HUEHQWXNDSDNDKEDJLDQDWDSLWX"

1. Sediakan beberapa
kerangka limas
lengkap dengan jaringjaringnya
2. Sediakan buku
tertentu/pojok pustaka/
internet, dll
3. Sediakan kertas HVS
secukupnya

6XPEHUJDPEDUUXPDKEORJVSRWFRP

*DPEDU5XPDK

3DGDEDJLDQDWDSUXPDKGDSDWGLJDPEDUVHEDJDL
EHULNXW

'DODPPDWHPDWLNDJDPEDUGLVHEXWGHQJDQOLPDV
3HUKDWLNDQ OLPDV SDGD *DPEDU  GL VDPSLQJ
3DGDJDPEDUWHUVHEXWGLEDWDVLROHKVDWXDODV\DQJ
EHUEHQWXN SHUVHJLSDQMDQJ GDQ HPSDW VLVL WHJDN
\DQJEHUEHQWXNVHJLWLJD3HUKDWLNDQPRGHOOLPDV
SDGD*DPEDUGLEDZDKLQL

*DPEDU/LPDVEHUDWXUDQ

ht

tp

://

4. Siswa dibentuk
kelompok kecil siswa
(sebanyak 4 5 orang)
yang memungkinkan
belajar secara efektif

6XPEHUPDWHPDWRKLUZRUGSUHVVFRP

5. Mungkin perlu
diberikan contoh
kritik, komentar,
saran, atau pertanyaan
terhadap suatu karya
agar siswa bisa meniru
dan mengembangkan
lebih jauh sesuai
dengan materinya
334

*DPEDU0RGHOPRGHOOLPDV

8QWXNOHELKMHODVQ\DLNXWLODKODQJNDKODQJNDKNHJLDWDQEHODMDUEHULNXWLQL



.HODV9,,,60307V

Buku Guru Kelas VIII SMP/MTs

6HPHVWHU

Semester 2

0DVDODK 

Masalah

7DEHOEHULNXWDNDQGLVDMLNDQJDPEDUOLPDVEHVHUWDXNXUDQXNXUDQ\DQJGLNHWDKXL
7DEHO.DVXVOXDVSHUPXNDDQOLPDV

1R

.HWHUDQJDQ

%LVD
7LGDN%LVD

'LNHWDKXLDODVOLPDVWHUVHEXWEHUEHQWXNSHUVHJL
GHQJDQSDQMDQJ7( FPGDQ$% FP
$SDNDK/XDV3HUPXNDDQQ\DELVDGLWHQWXNDQ"

%LVD

*DPEDU

Masalah 4.3

C
E

Ajaklah siswa untuk


memperhatikan dan
memahami Masalah 4.3,
kemudian munculkanlah
pertanyaan-pertanyaan yang
mungkin.

A
T

'LNHWDKXLDODVOLPDVWHUVHEXWEHUEHQWXN
SHUVHJLGHQJDQSDQMDQJ7$ FP7& FP
GDQ$% FP
$SDNDK/XDV3HUPXNDDQQ\DELVDGLWHQWXNDQ"

7LGDN%LVD

B
A
T

B
A

6HEXDKOLPDVDODVQ\DEHUEHQWXNVHJLWLJDGHQJDQ
SDQMDQJ$& FP%& FPGDQ$% FP
$SDELODWLQJJLOLPDVFP
$SDNDK/XDV3HUPXNDDQQ\DELVDGLWHQWXNDQ"

%LVD

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

.id

6HEXDKOLPDVDODVQ\DEHUEHQWXNVHJLWLJDGHQJDQ
SDQMDQJ$& FP%& FP$% FP7$ 
FP7% FPGDQ7& FP
$SDNDK/XDV3HUPXNDDQQ\DELVDGLWHQWXNDQ"

7LGDN%LVD

$OWHUQDWLI3HPHFDKDQ0DVDODK
$\R
.LWD$PDWL

0$7(0$7,.$

3DGDJDPEDU
'LNHWDKXLDODVOLPDVWHUVHEXWEHUEHQWXNSHUVHJLGHQJDQSDQMDQJ7( FP
GDQ$% FP
$SDNDKOXDVSHUPXNDDQQ\DELVDGLWHQWXNDQ"



3HQ\HOHVDLDQ

Ayo
Kita Amati

'HQJDQ GHPLNLDQ VHODQMXWQ\D WLQJJDO FDUL


OXDVSHUPXNDDQQ\DGHQJDUXPXV
/ OXDVDODVMXPODKOXDVELGDQJWHJDN

ht

tp

://

Informasikan tugas yang akan


mereka kerjakan, yaitu akan
mengamati alternatif penyelesaian
dari Masalah 4.3, maksimal
15 menit dan aturan mainnya
sejelas mungkin sebelum mereka
mengamati.
Fokus pengamatan adalah
memperhatikan dengan teliti pada
bentuk-bentuk soal dan jawabnya
tentang luas permukaan limas
yang bisa dikerjakan dan tidak
bisa dikerjakan.

6RDOWHUVHEXWELVDGLVHOHVDLNDQNDUHQDEHQWXNDODVQ\DSHUVHJLGHQJDQXNXUDQVLVL
FPGDQWLQJJLELGDQJWHJDNQ\DMXJDVXGDKGLNHWDKXLXNXUDQQ\D\DLWXFP

3DGDJDPEDU
'LNHWDKXLDODVOLPDVWHUVHEXWEHUEHQWXNSHUVHJLGHQJDQSDQMDQJ7$ FP
7& FPGDQ$% FP
$SDNDKOXDVSHUPXNDDQQ\DELVDGLWHQWXNDQ"

3HQ\HOHVDLDQ

/  
/  
/ FP

6RDO WHUVHEXW WLGDN ELVD GLVHOHVDLNDQ NDUHQD SDQMDQJ UXVXN WHJDN 7$ WLGDN VDPD GHQJDQ SDQMDQJ
UXVXNWHJDN7&VHKLQJJDWLGDNDNDQPHPEHQWXNEDQJXQOLPDVVHJLHPSDWGDQWLQJJLGDULPDVLQJ
PDVLQJELGDQJWHJDNQ\DMXJDWLGDNGLNHWDKXLZDODXSXQVXGDKGLNHWDKXLEDKZDDODVQ\DEHUEHQWXN
SHUVHJLGHQJDQXNXUDQVLVLFP

3DGDJDPEDU
6HEXDKOLPDVDODVQ\DEHUEHQWXNVHJLWLJDGHQ J D Q  S D Q M D QJ$& FP%&
FPGDQ$% FP$SDELODWLQJJLOLPDVFP
$SDNDKOXDVSHUPXNDDQQ\DELVDGLWHQWXNDQ"

C
B
A

3HQ\HOHVDLDQ

6RDOWHUVHEXWELVDGLVHOHVDLNDQNDUHQDDODVOLPDVWHUVHEXWEHUEHQWXNVHJLWLJDVLNXVLNXGHQJDQXNXUDQ
VXGDKGLNHWDKXL6XGDKGLNHWDKXLMXJDXNXUDQWLQJJLOLPDVQ\D'HQJDQGHPLNLDQVHODQMXWQ\DOXDVPDVLQJ
PDVLQJELGDQJ\DLWXOXDVELGDQJ$&%ELGDQJ$&7ELGDQJ%&7GDQELGDQJ$%7.KXVXVXQWXNPHQFDUL
OXDVELGDQJ$%7FDULODKWHUOHELKGXOXSDQMDQJ$7GDQ%7GHQJDQPHQJJXQDNDQ3\WKDJRUDV&REDNDOLDQ
ODQMXWNDQXQWXNPHQHQWXNDQOXDVSHUPXNDDQOLPDVWHUVHEXW



.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

335

6HEXDKOLPDVDODVQ\DEHUEHQWXNVHJLWLJDGHQJDQ
SDQMDQJ$& FP%& FP$% FP7$ 
FP7% FPGDQ7& FP
$SDNDK/XDV3HUPXNDDQQ\DELVDGLWHQWXNDQ"

C
B
A

3HQ\HOHVDLDQ

6RDOWHUVHEXWWLGDNELVDGLVHOHVDLNDQNDUHQDSDQMDQJUXVXNWHJDNQ\DWLGDNVDPD\DLWX7$ FP
7% FPGDQ7& FPZDODXSXQVXGDKGLNHWDKXLEDKZDDODVQ\DEHUEHQWXNVHJLWLJDVLNXVLNX
GHQJDQXNXUDQ$& FP%& FP$% FP

"

$\R.LWD
0HQDQ\D

%HUGDVDUNDQKDVLOSHQJDPDWDQNDOLDQFREDEXDWODKSHUWDQ\DDQ\DQJPHPXDWNDWDNDWDEHULNXW
 V\DUDWGLNHWDKXLGDQOXDVSHUPXNDDQOLPDV
 VLVLDODVGDQUXVXNWHJDN
 ELGDQJWHJDNGDQOLPDV
7XOLVODKSHUWDQ\DDQNDOLDQGLOHPEDUNHUMDEXNXWXOLV

0HQJJDOL
,QIRUPDVL

&RED WHPXNDQ PLQLPDO  VRDO SDGD EXNX WHUWHQWX GL LQWHUQHW DWDX PHPEXDW VHQGLUL EHVHUWD
MDZDEDQQ\D\DQJEHUNHQDDQGHQJDQOXDVSHUPXNDDQOLPDV

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Jelaskan tugas
berikutnya, yaitu
membuat pertanyaan;
pada kegiatan ini siswa
membuat pertanyaan
tentang syarat apa
yang harus terpenuhi
agar agar suatu limas
bisa ditentukan luas
permukaannya.
Contoh:
Kenapa gambar nomor
2 dan 4 tidak bisa
dihitung?

3DGDJDPEDU

.id

Ayo Kita
Menanya

$\R.LWD
0HQDODU

=+

Menggali
Informasi

6HWHODK VHOHVDL PHQMDZDE SHUWDQ\DDQ SDGD NHJLDWDQ EHUQDODU GL DWDV .HPXGLDQ WXNDUNDQ KDVLO
NHVLPSXODQ NDOLDQ GHQJDQ NHORPSRN \DQJ ODLQ 6HODQMXWQ\D EDQGLQJNDQ KDVLO NHVLPSXODQQ\D
GLNVXVLNDQGHQJDQNHORPSRNWHUVHEXW

0$7(0$7,.$

ht

Selanjutnya ajaklah siswa


untuk bernalar dengan
mencari syarat minimal
apa suatu limas sehingga
luas permukaannya bisa
dihitung.
Syarat minimal yang di
ketahui adalah panjang
rusuk alas dan pajang rusuk
tegak tidak lebih pendek
dari tinggi limas
336



Ayo Kita
Berbagi

tp

Ayo Kita
Menalar

$\R.LWD
%HUEDJL

://

Ajaklah siswa untuk


menggali informasi
(pada pojok pustaka
atau di perpustakaan,
internet atau lainnya)
tentang soal-soal yang
berkenaan dengan luas
permukaan limas

%HUGDVDUNDQNHJLDWDQPHQJJDOLLQIRUPDVL\DQJWHODKNDOLDQGDSDWNDQ6HNDUDQJFREDNDOLDQMHODVNDQ
EDJDLPDQD FDUD PHQHQWXNDQ XNXUDQ DODV VXDWX OLPDV VHJLHPSDW EHUDWXUDQ MLND GLNHWDKXL OXDV
SHUPXNDDQ OLPDV WHUVHEXW DGDODK  FP GDQ OXDV VLVL WHJDNQ\D DGDODK  FP %HUDSD EDQ\DN
XNXUDQDODV\DQJNDOLDQWHPXNDQ"

Mintalah siswa untuk untuk menukarkan hasil


karyanya dengan kelompok yang lain, dan
pastikan kelompok tersebut memahami apa yang
harus dilakukan
Pantau bagaimana mereka mengerjakan
tugasnya dan pastikan bahwa kalimat-kalimat
yang digunakan sudah sesuai dengan kaidah
budi pekerti yang baik

Buku Guru Kelas VIII SMP/MTs

Semester 2

"

/DWLKDQ 
K

 3HUKDWLNDQOLPDVVHJLHPSDWEHUDWXUDQ
.3456GLEDZDK6HEXWNDQVHPXD
D UXVXN
E ELGDQJVLVLWHJDN
F WLQJJLOLPDV

R
M
Q

 .HUDQJNDPRGHOOLPDVGHQJDQDODVEHUEHQWXNSHUJLSDQMDQJGHQJDQSDQMDQJOHEDUQ\DPDVLQJ
PDVLQJ  FP GDQ  FP VHGDQJNDQ WLQJJL OLPDV  FP 7HQWXNDQ SDQMDQJ NDZDW \DQJ
GLSHUOXNDQ XQWXN PHPEXDW NHUDQJND
T
PRGHOOLPDVWHUVHEXW

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 6HEXDK OLPDV WLQJJLQ\D  FP GDQ


WLQJJL UXVXN WHJDNQ\D  FP -LND
DODVQ\D EHUEHQWXN SHUVHJL PDND
WHQWXNDQ

D NHOLOLQJSHUVHJL

E OXDVSHUPXNDDQOLPDV

.id

36

39

 $ODVVHEXDKOLPDVEHUEHQWXNSHUVHJLGHQJDQSDQMDQJVLVLFP-LNDMXPODKOXDVVLVLOLPDV
FPPDNDEHUDSDNDKYROXPHOLPDVWHUVHEXW"

.HODV9,,,60307V

6HPHVWHU

ht

tp



://

 *DPEDUGLEDZDKPHQXQMXNNDQVHEXDKNXEXVGHQJDQSDQMDQJUXVXNFP\DQJGLSRWRQJ
VHKLQJJD VDODK VDWX EDJLDQQ\D EHHEHQWXN OLPDV VHJLWLJD WHWUDKHGURQ  7HQWXNDQ OXDV
SHUPXNDDQNHGXDEDQJXQKDVLOSHUSRWRQJDQQ\D
FP

1. Periksalah apakah semua kelompok sudah mencatat hal-hal yang penting pada
kegiatan kali ini
2. Berikan penilaian terhadap proses dan hasil karya siswa dengan menggunakan
rubrik penilaian
3. Tulislah beberapa kelebihan dan kekurangan dalam proses belajar kali ini
4. Jika dipandang perlu, berilah siswa soal latihan 9.3 untuk dikerjakan.
MATEMATIKA

337

Membelajarkan 4.4
Menentukan Volume Kubus dan Balok
Sebelum Pelaksanaan
Kegiatan

9ROXPH%DQJXQ
5XDQJ6LVL'DWDU
0HQHQWXNDQ9ROXPH
.XEXVGDQ%DORN

.HJLDWDQ 

.id

0DVDODK 

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

3DGDNHJLDWDQNDOLLQLNDOLDQDNDQPHPSHODMDULPHQJHQDL9ROXPHNXEXVGDQEDORN
3HUKDWLNDQNXEXVVDWXDQEHULNXWLQL


*DPEDU D DGDODK .XEXV VDWXDQ \DLWX


NXEXV\DQJXNXUDQUXVXNUXVXNQ\DVDWXDQ

*DPEDUD.XEXVVDWXDQ




1. Sediakan kerangka
kubus, balok, prisma
dan limas yang lengkap
dengan garis bidang,
garis diagonal ruang.
2. Sediankan juga
beberapa bangun
kubus, balok, prism
dan limas padat.
3. Siswa dibentuk
kelompok kecil siswa
(sebanyak 4 5 orang)
yang memungkinkan
belajar secara efektif.
4. Siapkan beberapa
macam kerangka
bangun ruang kubus,
balok prisma, dan
limas beserta bangun
ruang yang padat.
5. Jika memungkinkan
sediakan slide
PowerPoint gambar
seperti pada kegiatan
Ayo Kita Menggali
Informasi dan Ayo Kita
Bernalar.
6. Sediakan juga bukubuku teks lainnya
atau ajaklah siswa ke
perpustaan atau kalau
memungkinkan ajalah
siswa ke laboratorium
komputer ketika
kegiatan Ayo Kita
Bernalar.

*DPEDUE%DORN

%DORNEHUXNXUDQVDWXDQSDGD*DPEDUEDNDQGLPDVXNNDQNXEXVGDUL*DPEDUD
EHUXNXUDQVDWXDQ
%HUDSDNDKNXEXVVDWXDQ\DQJGLEXWXKNDQXQWXNPHQJLVLEDORNKLQJJDSHQXK"

://

$SDNDKEDQ\DNNXEXVVDWXDQ\DQJPHPHQXKLEDORNKLQJJDSHQXKPHUXSDNDQYROXPHEDORN"
%DJDLPDQDNDKGHQJDQYROXPHNXEXVSDGDJDPEDU"

ht

tp

8QWXNOHELKMHODVQ\DLNXWLODKODQJNDKODQJNDKNHJLDWDQEHODMDUEHULNXWLQL

0$7(0$7,.$



Masalah 4.4.
Guru memberikan gambaran awal tentang volume kubus dan balok yang terdapat pada
Masalah 4.4. Siswa diberikan beberapa pertanyaan-pertanyaan tentang menyusun
suatu objek disusun dengan susunan yan rapi. Contoh: Berapakah kubus satuan yang
dibutuhkan untuk mengisi balok hingga penuh?Apakah banyak kubus satuan yang
memenuhi balok hingga penuh merupakan volume balok?
Bagaimanakah dengan volume kubus pada Gambar 4.16b?
338

Buku Guru Kelas VIII SMP/MTs

Semester 2

Ayo
Kita Amati
Informasikan tugas yang
akan siswa Amati, yaitu
akan mengamati susunan
kubus yang disusun ke
atas dan yang disusun
mendatar: maksimal 10
menit untuk mengamati
tabel tersebut.

.id

Dorong siswa untuk


mengamati model
susunan kubus.

$\R
.LWD$PDWL

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

$OWHUQDWLI3HPHFDKDQ0DVDODK

3HUKDWLNDQJDPEDUVXVXQDQNXEXVEHULNXWLQL.HPXGLDQDPDWLODK
7DEHO3HQJHUWLDQYROXPHEDORN

1R

%DORN







9ROXPH 9

$GDNXEXV



9 VDWXDQNXELN

$GDNXEXV



9 VDWXDQNXELN

$GDNXEXV



9 VDWXDQNXELN

$GDNXEXV



9 VDWXDQNXELN

$GDNXEXV



9 VDWXDQNXELN

$GDNXEXV



9 VDWXDQNXELN

$GDNXEXV

 

9 VDWXDQNXELN

tp
ht

%HUXNXUDQ
SOW

://

%DQ\DNNXEXV
VDWXDQ

.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

339

Contoh Pertanyaan

%DQ\DNNXEXV
VDWXDQ

%HUXNXUDQ
SOW

9ROXPH 9

$GDNXEXV   9 VDWXDQNXELN

$GDNXEXV   9 VDWXDQNXELN

  3HUKDWLNDQSRODVXVXQDQNXEXVSDGDWDEHOGLDWDV
  %DQGLQJNDQEDQ\DNQ\DVXVXQDQNXEXVSDGDWDEHOGLDWDV
  3HUKDWLNDQSRODQ\DXQWXNPHQHQWXNDQYROXPHEDORNGDQNXEXVVHFDUDXPXP

.HVLPSXODQDSD\DQJGDSDWNDOLDQDPELOGDULSHQJDPDWDQGLDWDV"

Kenapa volume gambar


1 dan 2 sama, padahal
posisinya berbeda?
Bagaimana menentukan
alasnya dari kedua
bangun tersebut?
Menggali
Informasi

$\R.LWD
0HQDQ\D

%HUGDVDUNDQKDVLOSHQJDPDWDQNDOLDQFREDEXDWODKSHUWDQ\DDQ\DQJPHPXDWNDWDNDWDEHULNXW
 9ROXPHGDQJDPEDUGDQSDGDWDEHOD
 VLVLDODVGDQNXEXVEDORN
 NXEXVGDQEDORN
7XOLVODKSHUWDQ\DDQNDOLDQGLOHPEDUNHUMDEXNXWXOLV


$\R.LWD
0HQJJDOL,QIRUPDVL

6HEHOXPPHQJJDOLLQIRUPDVLVHEDLNQ\DNDOLDQSHUKDWLNDQFRQWRKVRDOEHULNXWLQL
&RQWRK 

%HUDSDNDKYROXPHQ\D"

5 cm

3HUKDWLNDQJDPEDUEDORNGLVDPSLQJ

12 cm

C
6 cm

0$7(0$7,.$

ht

tp

://

Kemudian ajaklah
siswa untuk menggali
informasi tentang
susunan kubus-kubus
yang terdapat pada
gambar di buku siswa

"

=+

%DORN

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Jelaskan tugas
berikutnya, yaitu
membuat pertanyaan;
pada kegiatan ini siswa
berperan sebagai orang
lain, yaitu mengirangira pertanyaan apa
yang akan diajukan
ketika ia belum tahu
cara menentukan pola
susunan kubus tersebut

1R

.id

Ayo Kita
Menanya

Informasikan kegiatan
selanjutnya, yaitu
memahami sedikit
informasi tentang
permasalahan yang
sudah disediakan pada
buku siswa tersebut,
yaitu contoh beserta
jawabannya
340

Buku Guru Kelas VIII SMP/MTs

Semester 2



$OWHUQDWLI
3HQ\HOHVDLDQ
%DORNGLDWDVPHPSXQ\DLS FPO FPGDQW FP
9
SOW




-DGL9ROXPH%DORNWHUVHEXWDGDODKFP
&RQWRK 
9ROXPHVHEXDKEDORNFP+LWXQJODKOXDVSHUPXNDDQPLQLPDO\DQJGDSDWGLPLOLNLROHKEDORN
WHUVHEXW
$OWHUQDWLI
3HQ\HOHVDLDQ

.id

3HUKDWLNDQJDPEDUEDORNGLVDPSLQJ
'LNHWDKXLYROXPHEDORN FP
9 SOW 
8QWXN PHQGDSDWNDQ OXDV SHUPXNDDQ PLQLPDO PDND
GLSHUROHKSRODSHQMXPODKNHEDOLNDQGDULXNXUDQEDORN

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

   SO  SW  OW
 
S O W
SOW
WHUVHEXW\DLWX
 
1LODLWHUNHFLOGDULMXPODKNHEDOLNDQXNXUDQEDORNWHUVHEXWGLSHUROHKMLNDQLODLSOWWHUEHVDU PDNVLPXP 
DWDXQLODLQLODLSOGDQWDGDODKVDPDDWDXPHPSXQ\DLVLOLVLKPLQLPDOGDULWLJDELODQJDQWHUVHEXWGDQ
DSDELODWLJDELODQJDQWHUVHEXWGLNDOLNDQVDPDGHQJDQ\DLWXS O GDQW 
'HQJDQGHPLNLDQOXDVSHUPXNDDQQ\DDGDODK/  SOSWOW     
-DGLOXDVSHUPXNDDQPLQLPDO\DQJGDSDWGLPLOLNLROHKEDORNWHUVHEXWDGDODKFP

&RQWRK 

://

3HUKDWLNDQVXVXQDQNXEXVEHULNXWLQL

N

N

N

ht

tp

%DQ\DNQ\DVXVXQDQNXEXVSDGDNNNGDQVHWHUXVQ\DVHPDNLQEHUWDPEDKGHQJDQSRODVXVXQD
VHSHUWLSDGDJDPEDUGLDWDV
D %HUDSDEDQ\DNVXVXQDNXEXVSDGDSRODEHULNXWQ\D N "
E %HUDSDEDQ\DNVXVXQDQNXEXVSDGDN
$OWHUQDWLI
3HQ\HOHVDLDQ

%DQ\DNVXVXQDQNXEXVSDGDNDGDODKNXEXV
%DQ\DNVXVXQDQNXEXVSDGDNDGDODKNXEXV
%DQ\DNVXVXQDQNXEXVSDGDNDGDODKNXEXV



.HODV9,,,60307V

6HPHVWHU

MATEMATIKA

341

3HUKDWLNDQSRODEHULNXWLQL

Ayo Kita
Menalar

NNXEXV   NXEXV


NNXEXV   NXEXV
NNXEXV   NXEXV
PDND
NNXEXV   NXEXV


VHKLQJJD
NQNXEXV  Q NXEXV

Selanjutnya ajaklah
siswa untuk bernalar
dengan menggunakan
rumus volume kubus
untuk mengetahui
banyak kubus beton
yang diperlukan
Suruhlah mereka
untuk menuliskan
jawaban dari hasil
penalarannya

'HQJDQGHPLNLDQNLWDVXGDKPHPSXQ\DLEHQWXNXPXQ\D
\DLWXNQ  Q NXEXV
-DGLXQXN
D NDGDODKN     NXEXV
E NDGDODKN     NXEXV
6HNDUDQJ SHUKDWLNDQ NXEXVNXEXV NHFLO \DQJ GLVXVXQ
VHSHUWLWDPSDNSDGDJDPEDUEHULNXW
&RED NDOLDQ WHQWXNDQ EDQ\DNQ\D VXVXQDQ NXEXV NHFLO
WHUVHEXW

.id

$\R.LWD
0HQDODU

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

6HEXDKWXJXDNDQGLEDQJXQGHQJDQPHQXPSXNNXEXVNXEXVEHWRQ\DQJUXVXNQ\DFPVHSHUWL
WDPSDNSDGDJDPEDUGLEDZDK$QWDUVLVLVLVLNXEXV\DQJEHUGHPSHWDQGDQVLVLNXEXVGHQJDQODQWDL
DNDQGLUHNDWGHQJDQVHPHQVHWHEDOFP

Ayo Kita
Berbagi

Informasikan
kepada siswa untuk
menukarkan hasil
pekerjaannya dengan
teman sebangkunya,
kemudian
diskusikanlah

$\R.LWD
%HUEDJL

6HWHODK VHOHVDL PHQMDZDE WXNDUNDQ KDVLO MDZDEDQ NDOLDQ GHQJDQ WHPDQ VHEDQJNX .HPXGLDQ
EDQGLQJNDQKDVLOMDZDEDQQ\D'LNVXVLNDQ
7XOLVODKNHVLPSXODQNDOLDQSDGDOHPEDUNHUMDEXNXWXOLVNDOLDQ

0$7(0$7,.$

Alternatif Penyelesaian pada Kegiatan Menalar

ht

tp

://

Periksalah hasil
pekerjaan siswa!
apakah sudah benar
sesuai dengan
kaidah matematika?
Jika tidak berilah
pemahaman konsep
yang benar atau
jika ada yang sudah
benar pada kelompok
siswa: mintalah
kepada kelompok
tersebut untuk
membahasannya di
depan kelas

-LNDWLQJJLWXJX\DQJGLLQJLQNDQDGDODKPEHUDSDEDQ\DNNXEXVEHWRQ\DQJGLSHUOXNDQ"

342

Buku Guru Kelas VIII SMP/MTs

Semester 2



"

/DWLKDQ 

 6HEXDKEDNPDQGLEHUEHQWXNNXEXVPHPLOLNLSDQMDQJUXVXNP7HQWXNDQEDQ\DNDLU\DQJ
GLEXWXKNDQXQWXNPHQJLVLEDNPDQGLWHUVHEXWKLQJJDSHQXK
 6HEXDKDNXDULXPEHUEHQWXNEDORNPHPLOLNLXNXUDQSDQMDQJFPGDQWLQJJLFP-LND
YROXPHDLUGLGDODPDNXDULXPWHUVHEXWDGDODKFPWHQWXNDQOHEDUDNXDULXPWHUVHEXW
 3HUEDQGLQJDQSDQMDQJOHEDUGDQWLQJJLVHEXDKEDORNDGDODKSOW MLNDOXDV
SHUPXNDDQEDORNFPPDNDWHQWXNDQEHVDUYROXPEDORNWHUVHEXW

 6HEXDK EDWDQJ EDPEX GHQJDQ GLDPHWHU  FP GDQ SDQMDQJ  PHWHU GLLNDW GL GDVDU NRODP
EHUEHQWXNEDORNGHQJDQXNXUDQSDQMDQJPOHEDUFPGDQWLQJJLFPXQWXNGLUHQGDP
GDODP VXDWX ODUXWDQ SHQJDZHW -LND GLDVXPVLNDQ XMXQJXMXQJ EDPEX WHUWXWXS EHUDSD OLWHU
ODUXWDQSHQJDZHWKDUXVGLPDVXNNDQVDPSDLEDNPHQMDGLSHQXK"

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

 6HEXDK WDQJNL SHQDPSXQJDQ PLQ\DN WDQDK EHUEHQWXN SULVPD \DQJ DODVQ\D EHUXSD EHODK
NHWXSDW\DQJSDQMDQJGLDJRQDOGLDJRQDOQ\DPGDQP7LQJJLWDQJNLP3DGDGDVDU
WDQJNL WHUGDSDW NUDQ \DQJ GDSDW PHQJDOLUNDQ PLQ\DN WDQDK UDWDUDWD  OLWHU VHWLDS PHQLW
%HUDSDODPDZDNWX\DQJGLSHUOXNDQXQWXNPHQJHOXDUNDQPLQ\DNWDQDKGDULWDQJNLLWXVDPSDL
KDELV"

.id

 'LNHWDKXLYROXPHEDORNFP%DJDLPDQDFDUDPHQHPXNDQXNXUDQEDORNWHUVHEXW"%HUDSD
EDQ\DNNHPXQJNLQDQXNXUDQXNXUDQ\DQJNDOLDQWHPXNDQ"

 3HUKDWLNDQVXVXQDQNXEXVEHULNXWLQL

N

N

N

.HODV9,,,60307V

ht



tp

://

%DQ\DNQ\DVXVXQDQNXEXVSDGDNNNGDQVHWHUXVQ\DVHPDNLQEHUWDPEDKGHQJDQSROD
VXVXQDVHSHUWLSDGDJDPEDUGLDWDV
D %HUDSDEDQ\DNVXVXQDNXEXVSDGDSRODEHULNXWQ\D N 
E %HUDSDEDQ\DNVXVXQDQNXEXVSDGDN

6HPHVWHU

1. Periksalah apakah semua kelompok sudah mencatat hal-hal yang penting pada
kegiatan kali ini
2. Berikan penilaian terhadap proses dan hasil karya siswa dengan menggunakan
rubrik penilaian
3. Jika dipandang perlu, berilah siswa soal latihan 9.4 untuk dikerjakan di rumah
MATEMATIKA

343

Membelajarkan 4.5
Menentukan Volume Prisma

0HQHQWXNDQ
9ROXPH3ULVPD

.HJLDWDQ 

3. Siswa dibentuk
kelompok kecil
siswa (sebanyak
4 5 orang) yang
memungkinkan
belajar secara
efektif.

0DVDODK 

.id

2. Sediankan juga
beberapa prisma
padat.

3DGD.HJLDWDQNDOLDQVXGDKPHPHSHODMDULWHQWDQJOXDVSHUPXNDDQSULVPD3DGDNDJLDWDQLQL
NDOLDQ DNDQ PHPSHODMDUL WHQWDQJ YROXPH SULVPD &RED NLWD LQJDW NHPEDOL WHQWDQJ YROXPH EDORN
SDGDNHJLDWDQ9ROXPHEDORNMXJDGDSDWGLNDWDNDQVHEDJDLYROXPHSULVPDVHJLHPSDWPHQJDSD
GHPLNLDQ"

&REDSHUKDWLNDQEDORNSDGD*DPEDUGLEDZDK\DQJGLLULVPHQMDGLGXDSULVPDVHJLWLJDWHJDN
3ULVPDSULVPDVHJLWLJDWHJDN E GDQ F VDPDEHQWXNGDQXNXUDQQ\DVHKLQJJDMXPODKYROXPHNHGXD
SULVPDVHJLWLJDWHJDNLWXVDPDGHQJDQYROXPHEDORN

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

1. Sediakan prisma
yang lengkap dengan
garis bidang, garis
diagonal ruang.

(a)

(b)

R
Q
(c)

*DPEDU%DORNGDQ3ULVPD

-HODVEDKZD9ROXPHPDVLQJPDVLQJ3ULVPDVHJLWLJDLWXVDPD\DLWXVHWHQJDK9ROXPH%DORN
8QWXNOHELKMHODVQ\DLNXWLODKODQJNDKODQJNDKNHJLDWDQEHODMDUEHULNXWLQL
 %DJDLDPDQDKXEXQJDQDQWDUDOXDVDODVSULVPDGHQJDQWLQJJQ\D"

 %DJDLDPDQDSURVHGXUPHPSHUROHKYROXPHSULVPD\DQJEHUPXODGDULYROXPHEDORN"

ht

tp

://

4. Sediakan juga bukubuku teks lainnya


atau ajaklah siswa
ke perpustaan
atau kalau
memungkinkan
ajalah siswa ke
laboratorium
komputer ketika
kegiatan Ayo Kita
Bernalar.

0$7(0$7,.$



Masalah 4.5
Guru memberikan gambaran awal tentang volume prisma yang terdapat pada
Masalah 4.5. Siswa diberikan beberapa pertanyaan-pertanyaan tentang menemukan
rumus luas permukaan prisma Contoh:
Coba kita ingat kembali tentang volume balok pada kegiatan 4! Volume balok juga
dapat dikatakan sebagai volume prisma segi empat, mengapa demikian?

344

Buku Guru Kelas VIII SMP/MTs

Semester 2

$OWHUQDWLI3HPHFDKDQ0DVDODK
$\R
.LWD$PDWL
3HUKDWLNDQ JDPEDU SULVPD \DQJ GLLULV PHQMDGL GXD SULVPD VHJLWLJD WHJDN  EHULNXW LQL .HPXGLDQ
DPDWLODK
7DEHO3HQJHUWLDQYROXPHSULVPD
1R

3ULVPD

/XDVDODV /D

8NXUDQ
9ROXPH 9
WLQJJL W

W
U

/D SO

9



SOW
 SO W
/DW

R
p

Q
W

9

/D SO

W
U
t

/D SO



/DW


SOW


 SO W


D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o


SOW


9





/DW


SO W


+XEXQJDQLQLMXJDEHUODNXXQWXNVHWLDS3ULVPDEDKZD9ROXPH3ULVPDDGDODK
9ROXPH /XDVDODV[7LQJJL

6HPHVWHU

tp

://

.HODV9,,,60307V

ht



.id

Ayo
Kita Amati

Informasikan tugas
yang akan mereka
kerjakan, yaitu akan
mengamati kerangkan
bangun prisma.
Fokus pengamatan
kegiatan ini adalah
memperhatikan
dengan teliti pada
bangun prisma beserta
luas, tinggi dan
volumenya pada
Tabel 4.4
MATEMATIKA

345

"

$\R.LWD
0HQDQ\D

%HUGDVDUNDQKDVLOSHQJDPDWDQNDOLDQFREDEXDWODKSHUWDQ\DDQ\DQJPHPXDWNDWDNDWDEHULNXW
 EDORNSULVPDGDQYROXPH
 VLVLDODVGDQEDORNSULVPD
7XOLVODKSHUWDQ\DDQNDOLDQGLOHPEDUNHUMDEXNXWXOLV

Jelaskan tugas
berikutnya, yaitu
membuat pertanyaan dari
hasil pengamatannya

&RQWRK 
6HEXDK3ULVPDDODVQ\DEHUEHQWXNVHJLWLJDGHQJDQSDQMDQJVLVLVLVLQ\DFPFPGDQFP
$SDELODWLQJJLSULVPDFPEHUDSDNDKYROXPSULVPD"

F
$OWHUQDWLI
3HQ\HOHVDLDQ

9ROXPH /XDVDODV7LQJJL



 


FP

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Contoh Pertanyaan
Kenapa volume prisam
dapat diperoleh dari
volume balok? Bisakah
dengan cara lain?

6HEHOXPPHQJJDOLLQIRUPDVLVHEDLNQ\DNDOLDQSHUKDWLNDQFRQWRKVRDOEHULNXWLQL

.id

Ayo Kita
Menanya

$\R.LWD
0HQJJDOL,QIRUPDVL





-DGLYROXPHSULVPDWHUVHEXWDGDODKFP

F

C

FP

&RQWRK 

6HEXDKNDOHQJEHUEHQWXNEDORNEHUXNXUDQGPGPGPEHULVLDLUSHQXK%LODDLULWX
GLWXDQJNDQ SDGD NDOHQJ ODLQ EHUEHQWXN SULVPD \DQJ OXDV DODVQ\D  GP GDQ VXGDK WHULVL DLU
VHWLQJJLFP%HUDSDOLWHUNDKDLUSDGDNDOHQJEHUEHQWXNSULVPDVHNDUDQJ"
$OWHUQDWLI
3HQ\HOHVDLDQ

0HQXUXWLQIRUPDVLGDULVRDOEDKZDXQWXNPHQJHWDKXLEHUDSDOLWHUWLQJJLDLUVHWHODKNHWDPEDKDQ
DLUGDULNDOHQJ%DORNPDNDGLFDULWHUOHELKGDKXOXYROXPHNHWLQJJLDQDLUSDGDNDOHQJ3ULVPDEDUX
VHWHODKLWXELVDGLWHPXNDQEHUDSDNDKYROXPHDLUSDGDNDOHQJ3ULVPD\DLWX

=+

9ROXPHDLUSDGDNDOHQJ%DORN

9ROXPHNHWLQJJLDQDLUSDGDNDOHQJ3ULVPD

8NXUDQNDOHQJ%DORN

/XDVDODVNDOHQJ3ULVPD.HWLQJJLDQDLU

.HWLQJJLDQDLU



.HWLQJJLDQDLU

GP

Menggali
Informasi

0$7(0$7,.$

ht

tp

://

Informasikan kegiatan
selanjutnya, yaitu
memahami sedikit
informasi yang
terangkum dalam
contoh soal beserta
penyelesaiannya.
Kemudian siswa
diajak untuk menggali
informasi tentang
permasalahan yang
sudah disediakan pada
buku siswa
346

Buku Guru Kelas VIII SMP/MTs

Semester 2



.DOHQJ3ULVPDVXGDKWHULVLDLUVHWLQJJLFP GP
'HQJDQGHPLNLDQGDSDWGLWHPXNDQYROXPHDLUSDGDNDOHQJ3ULVPDVHNDUDQJ
9ROXPHDLUSDGD.DOHQJ3ULVPDVHNDUDQJ

/XDVDODV3ULVPD[7LQJJLDLUVHNDUDQJ

 





Ayo Kita
Menalar

-DGLEDQ\DNQ\DDLUDLUSDGDNDOHQJEHUEHQWXNSULVPDVHNDUDQJDGDODKGP OLWHU
6HNDUDQJ FRED EXDW PDVDODK VHQGLUL MLND GLNHWDKXL DODV VHEXDK SULVPD EHUEHQWXN SHUVHJL 0LVDO
SDQMDQJVLVLFPGDQWLQJJLSULVPDDGDODKFP-LNDVLVLVLVLDODVQ\DGLSHUNHFLO


NDOLWHQWXNDQ


SHUEDQGLQJDQYROXPHSULVPDVHEHOXPGDQVHVXGDKGLSHUNHFLO
$\R.LWD
0HQDODU
&REDJXQDNDQSHQDODUDQNDOLDQSDGDNDVXVEHULNXW
'LNHWDKXLYROXPHSULVPDWHJDNVHJLWLJDVLNXVLNXDGDODKFP%DJDLPDQDFDUDPHQHPXNDQXNXUDQ
DODVGDQWLQJJLSULVPDWHUVHEXW"%HUDSDEDQ\DNNHPXQJNLQDQXNXUDQXNXUDQ\DQJNDOLDQWHPXNDQ"

.id

$\R
.LWD6HOLGLNL

Selanjutnya ajaklah
siswa untuk bernalar
dengan menggunakan
rumus volume prisma
untuk mengetahui cara
menemukan ukuran
alas dan tinggi prisma,
jika volumenya
diketahui

D
bs iu
e. nd
ke uh
m d
di ar
kb i
ud
.g
o

Mintalah siswa untuk


menuliskan jawaban
dari hasil penalarannya

&REDWHUDSNDQKDVLOSHQDODUDQNDOLDQSDGDVRDOVRDOEHULNXW

 $GD GXD SULVPD VHJLWLJD VLNXVLNX \DLWX SULVPD $ GDQ SULVPD %7LQJJL NHGXD SULVPD VDPD
SDQMDQJ-LNDSDQMDQJVLVLV