Anda di halaman 1dari 28

MENGAPA SAYA BELUM HAMIL???

STEP 1
1. Infertilitas:
Ketidakmampuanistriuntukhamildanmelahirkananakhidupatauketidakm
ampuansuamimenghamiliistri.
Sepasangsuamiisterisetelahbersenggamasecarateratur 2-3 kali
seminggutanpamemakaimetodepencegahanbelummengalamikehamila
nselama 1 tahun.
2. TORCH : Infeksi yang disebabkanoleholehToxoplasamaGondii, Rubela,
CMV, Herpes Simpleks
3. Urethritis Gonorrhoea:
Penyakitkelamin/menularseksualdisebabkanolehbakterinesseria
gonorrhea, terdapat duh tubuh, berwarnaputih
STEP 2

1.
2.

Apadefinisidankriteriainfertilitas?

Apahubungansuamimerokokberat, minum alcohol


dansukaberendam di air panas?

3.
4.
5.
6.
7.
8.
9.
10.
11.

Apahubunganusiadengankeluhanpasien?
Hubungan BMI dengankeluhan?
Apahubunganpekerjaandengan scenario?
Apatahapan diagnosis infertile?
ApahubunganIgGdanIgMpada scenario?
Apahubunganriwayat GO 3 tahun yang laludengansekarang?
Apahubunganpil KB 1 tahun yang laludengan scenario?
Bagaimanaedukasidanpenatalaksanaan?
Apapenyebabinfertilitas?

STEP 3

1.

Apadefinisidankriteriainfertilitas?
Page

Definisi: masalah yang dihadapiolehpasutri yang sudahmenikahselama


1
tahundanmelakukansenggamateraturtanpamenggunakanalatkontrasep
sitapibeluberhasilmemperolehkehamilan.
Dibagi 2;
-Primer: belumpernahhamilselama 1 tahun
-Sekunder: gagalmemperolehkehamilan, setelah 1
tahunpascapersalinan/abortustanpamenggunakankontrasepsiapapun.
Factor ygmmpengaruhi:
Usia: wanitasemakintua, semakin lama waktukonsepsinya. Lakilakisemakintuacoitusnyaberkurang.

Frekuensicoitusnya 3 kali seminggu


Merokokbilaberlebihanmengurangijumlahsperma.
Pembedahan, pembedahan organ
reproduksibisamenimbulkanmasalahinfertiitaskarenadapatmenyebabka
nperybahananatomisataukerusakansarafnyaterutamalaki-laki
InfeksiMenularseksual, menyebabkanradangpangguljugabisa
Obat-obatan, bisamenyebabkanimpotensi. Bisajugamengganggufungsi
spermatogenesis(obatanti kanker, antihipertensi)
Radiasi, bisamenyebabkangangguanfungsi gonad.

2.

Apapenyebabinfertilitas?
Padalaki-laki
-Gangguanspermatogenesisnya<20juta/ml
minum alcohol dansukaberendam di air panas
Karenakemungkinanterlalu lama berendam di air
panassehinggaprosuksispermanyaberkurang.Suhu normal testis 3435oC, jikaadakenaikansuhu 2-3 derajadcelciusbisamengganggu proses
pembentukansperma.Presentasidapatmembuahiseltelurmenurun.
Suhu testis Lebihdingindarisuhutubuh.
-cairanseminalis<2ml
-Obstruksiduktus
-Ketidakmampuan coitus
-pekerjaan yang berkaitandenganradiasi, tingkat stressorpH sperma
-Infeksimenularseksual
-Varikokelvaskularisasinyaterganggu
Padaperempuan
Page

-gangguanpada tuba falopi, ex salphingitis


-gangguanovulasi
-endometriosis
-hormonal
-infeksipada vagina, berpengaruhpadasperma yang
masukakanmenggangumasuknyasperma
-PekerjaanpH di vagina

3.

Apahubungansuamimerokokberat?
Merokok.
12-40 batang/hariberat,
Ada gas(radikalbebas) danpartikel(TAR, nikotin, benzofenol,dll)
FisiologisnyaadaRadikalbebasada di
spermadanantioksidanuntukmengimbangi/menurunkan.
Jikaterlalutinggiradikalbebasnyadaripadaantioksidanakanmerusaksper
ma.
Alkohol
LH akanmenurur, maka testosterone yang dihasilkanakanmenurunjuga.
Jikahalituterjadiakanmenyebabkanselleydigrusaktestosteronturunin
fertilitas.
Selleydig u/ memproduksispermadanmemproduksitestoteron.
Selsertolipematangan .jikarusak,
Mengganggupematangandarisperma yang dapatmenyebabkaninfertil
Mempengaruhikelenjarhipofisisnya.Bisaatropi testis juga,
produksinyajugamenurun.
Fisiologihepar?

4.

Apahubunganusiadengankeluhanpasien?
Semakinbertambahnyausia, tingkatkesuburannyamenurun.
20-24 tahun 6-9%
25-29 tahunmakinnaik
30-34 tahunjadi 30%
>35 tahunmeningkattajam.
Kesuburanpriadiawalisaatmasukpubertas, ditandai organ2
reproduksinya.Keadaanstabil 20 tahun. Dan puncaknya 25 tahun,
setelahitu lama-lama akanmenurun. Maksimal 60 tahunakanmenurun.
Padawanita, kemampuannyamenurun>35 tahun,
cadanganseltelurnyamulaimenipis.

Page

5.

Hubungan BMI dengankeluhan?


Hubunganobesitaspadapria penis
kecil.Saatsenggamaterjadigangguan.Gangguandarisperma yang
dikeluarkan.
Estrogennyameningkat=testosterone turun. Bahandasar estrogen
lemak, nantinyabisamenurunya libido.
Padawanita, estrogen meningkatgangguanovulasi.
Leptin, hormone yang dihasilkansel-sellemak, 167 as.amino di
jar.adiposit, tingkatnyaproporsionaldenganlemakditubuh,
Masalahovulasijikalemaknyaberlebihandikarenakantekananberlebihan
di tubanya.
Padapria, hormone androgen menjadi
estrogennantinyatestosteronnyaturun.
Hubungan AFL terhadapinfertilitas?

6.

Apahubunganpekerjaandengan scenario?
Dihubungkandengan stress, meningkatkan hormone
kortisol(meningkatkan metabolism glukosa),
akanjugabisamengurangikualitasspermadanpembentukanspermanya.
HormonRf amidebisamenghentikankemampuanreproduksilaki-laki.
Otakjugaakanmenghasilkanneuropetidasaat
stresssehinggamerusakreproduksinya.
Stress terlalubanyak,
menyebabkanrangsangberlebihankejantunghormontidakseimbang,
reproduksinyajugaterganggu

Mekanismekortisol?
Mekanisme stress?

7.
8.

Apatahapan diagnosis infertile?

ApahubunganIgGdanIgMpada scenario?
IgM toxoplasmaAb yang meningkatdalamdarah
IgGtoxomenetapseumurhidupsaatterinfeksi.
JikaIgG +, terkenainfeksi primer.
Padawanita
Wanitaterinfeksiterusmenerussalurantelurnyabisaterinfeksidanmenye
mpitsampaitertutupsehinggaseltelurnyatidaksampaiterbuahiolehsper
ma

Page

PadaPria, bisamenyebabkanpembengkakan
KGBmenyebabkankemandulan.
IgG,sudahterkenapajanan.
IgM, sedangterinfeksiToxo.MIngguawalpuncakAbIgM, setelah 2
mingguIgMmenurun.
IgGpuncakterpajannyapada 1 atau 3 bulan, danbertahanseumurhidup.

9.

Apahubunganriwayat GO 3 tahun yang laludengansekarang?


Infeksinyabisamenimbulkanjaringanparutsehinggabisamenyumbatsalur
anreproduksi

10.

Apahubunganpil KB 1 tahun yang laludengan scenario?


-Pil KB dicernadalamtubuh 24 jam. Jikaseharidihentikanmakasuburlagi.
-Suntik KB 3-6 bulanbarusuburlagi
Kontrasepsilainnya

11.

Bagaimanaedukasidanpenatalaksanaan?
Tahapannya:
1. Anamnesis
Kontrol/turunkanperlahanmerokoknya
Hentikankonsumsi alcohol
Rendam air panasdihentikan
TORCH diobatidulu, gunakankondomjikainginberhubungan
Pengurangan BMI dengan Diet
Stress dikurangidenganrekreasi,dll
Mitospacingan Mengadopsianakdengankehamilan?
Hubungan hormone senangdengan pathway ini.(GAGAH)

Page

STEP 7

1.

Apa definisi dan criteria infertilitas?

Definisi
Ketidakmampuan istri untuk menjadi hamil dan melahirkan anak
hidup atau ketidakmampuan suami untuk menghamili istrinya.
Sumber : Keluarga Berencana dan Kontrasepsi; dr. Hanafi
Hartanto
Infertilitas (pasangan mandul) adalah pasangan suami istri yang
telah menikah selama satu tahun dan sudah melakukan
hubungan seksual tanpa menggunakan alat kontrasepsi, tetapi
belum memiliki anak.(Sarwono, 2000).
Infertilitas adalah pasangan yang telah kawin dan hidup
harmonis serta berusaha selama satu tahun tetapi belum hamil.
(Manuaba, 1998).
Infertilitas adalah ketidakmampuan untuk hamil dalam waktu
satu tahun.Infertilitas primer bila pasutri tidak pernah hamil dan
infertilitas sekunder bila istri pernah hamil.(Siswandi, 2006).
Pembagian Infertilitas
Infertilitas primer :
Istri
belum
pernah
hamil
walaupun
bersenggama
dan
dihadapkan
kepada
kemungkinan kehamilan selama 12 bulan
Page

Infertilitas sekunder :
Istri pernah hamil, akan tetapi kemudian tidak
terjadi kehamilan lagi walaupun bersenggama
dan
dihadapkan
kepada
kemungkinan
kehamilan selama 12 bulan
Sumber : Ilmu Kandungan; Prof. dr. Hanifa
Wiknjosastro, SpOG

2.

Apa hubungan suami merokok berat, minum alcohol dan suka


berendam di air panas?

Rokok :
Kandungan pada rokok akan masuk pada pembuluh darah arteri dorsalis
penis aterosklerosis gangguan vasodilatasi pembuluh darah gangguan
ereksi impoten bisa infertil
pil KB terhadap kasus belum hamil ? (kapan waktu pulih subur ?)Apabila
penggunaan pil KB hormonal jangka panjang akan menyebabkan kembalinya
kesuburan yang lama, karena pemberian hormone dari luar akan
mengakibatkan depresi produksi hormone-hormon endogen, seperti halnya
esterogen dan progesterone.

3.

4.
5.

Apa hubungan usia dengan keluhan pasien?


Umur istritidaklah berpengaruh, setidak-tidaknya sampai umur
30-an akhir, dan wanita berusia lebih tua mungkin memerlukan
waktu lebih lama untuk menjadi hamil
Umur suamiumur suami mempunyai efek yang bermakna pada
frekuensi senggama yang berhubungan langsung dengan
kesempatan menjadi hamil, tetapi sebaliknya umur suami
tampaknya hanya berpengaruh sedikit sekali pada kemampuan
reproduksi, kecuali pada umur lanjut (>60 tahun)
Hubungan BMI dengan keluhan?
Apa hubungan pekerjaan dengan scenario?

Page

Stress pekerjaan hormone prolaktin meningkat penekanan produksi


hormone gonadotropinproduksi LH dan FSH menurun oogenesis dan
spermatogenesis terganggu infertile
Stress hormone epinefrin meningkat gangguan vasodilatasi pembulu
daraharteri dorsalis penis vasokonstriksi gangguan ereksi impoten
infertil

6.

Apa tahapan diagnosis infertile?

I. Tahap wawancara (anamnesis)


Tahap awal merupakan wawancara untuk pengumpulan data-data
pasien tentang jatidiri, riwayat kesehatan, riwayat perkawinan
terdahulu dan sekarang, riwayat infertilitas, riwayat hubungan
seksual, dan riwayat reproduksi.
II. Tahap pemeriksaan fisik
Pemeriksaan fisik baik suami maupun istri meliputi :
Keadaan fisik secara umum, seperti tinggi, berat, sebaran
rambut, dll.
Keadaan alat-alat reproduksi, seperti testis, vagina, klitoris,
rahim, dll.
A. Pemeriksaan sperma
Untuk menilai sperma maka dilakukan pemeriksaan atas
jumlah spermatozoa, bentuk dan pergerakannya.
Sebaiknya sperma yang diperiksa, ditampung setelah
pasangan tidak melakukan coitus sekurang2nya selama
3 hari dan sperma tersebut hendaknya diperiksa pada 1
jam setelah keluar.
Ejakulat yang normal sifatnya sbb:
Volume 2-5 cc
Jumlah spermatozoa 100-120 juta per cc
Pergerakan 60% dari spermatozoa

masih

bergerak selama 4 jam setelah dikeluarkan


Bentuk abnormal 25%

Page

Pria yang infertile spermatozoanya 60 juta per


cc atau lebih
Subfertil 20-60 juta per cc
Steril 20 juta per cc atau

Untuk

pennilaian

kurang
lebih lanjut

perlu

diperiksa

17

ketosteroid, gonadotrofin dalam urin, dan biopsy dari


testis.
B. Pemeriksaan ovulasi
Terjadinya ovulasi dapat kita ketahui dengan berbagai
pemeriksaan:
1. Pencatatan suhu basal kalau siklus ovulatoar, maka
suhu basal bersifat bifasis. Sesudah ovulasi terjadi
kenaikan

suhu

basal

disebabkan

pengaruh

progesterone

2. Dengan pemeriksaan vaginal smear; pembentukan


progesterone menimbulkan perubahan2 sitologi pada
sel2 superfisial
3. Pemeriksaan lendir serviks adanya progesterone
menimbulkan perubahan sifat lender serviks ialah
lendir tersebut menjadi kental, juga gambaran fern
(daun pakis) yang terlihat pada lendir yang telah
dikeringkan hilang
4. Pemeriksaan endometrium

kuretase

pada

hari

pertama haid haid atau pada fase premenstrual


Page

menghasilkan endometrium dalam stadium sekresi


dengan gambaran histoogi yang khas
5. Pemeriksaan hormone seperti estrogen,

ICSH,

pregnadiol
C. Pemeriksaan lendir serviks
Keadaan dan sifat lendir serviks sangat mempengaruhi
keadaan spermatozoa:
1. Kentalnya lendir serviks
Lendir serviks yang cair

lebih

mudah

dilalui

spermatozoa
Pada stadium proliferasi lendir serviks agak cair
karena pengaruh estrogen, sebaliknya pada stadium
sekresi lendir serviks lebih kentak karena pengaruh
progesteron
2. pH lendir serviks
lendir serviks bersifat alkalis dengan pH 9
pada suasana yang alkalis spermatozoa dapat hidup
lebih lama.
Suasana menjadi asam pada cervisitis
3. enzim proteolitik
tripsin, kemotripsin mempengaruhi

viskositas

lendir serviks
4. dalam lendir serviks juga ditemukan Ig yang dapat
menimbulkan aglutinasi dari spermatozoa
5. berbagai kuman2 dalam lendir serviks

dapat

membunuh spermatozoa
biasanya baik tidaknya lendir serviks diperiksa
dengan:
SIMS HUHNER TEST
Pemeriksaan lendir serviks dilakukan post coitum sekitar
waktu ovulasi
Dianggap baik jika terdapat 5 spermatozoa yang motil
per high powerfield
Sims huhner test yang baik menandakan:
- teknik koitus baik
- lendir serviks normal
- estrogen ovarial cukup
- sperma cukup baik
KURZROCK MILLER TEST
Page

Dilakukan pada pertengahan siklus kalau hasil sims


huhner test kurang baik
Satu tetes lendir serviks diletakkan berdampingan
dengan tetes sperma pada obyek glass; dilihat apakah
ada penetrasi spermatozoa. Kalau tidak ada invasi
spermatozoa, lendir serviks kurang baik.
D. Pemeriksaan tuba
Untuk mengetahui keadaan tuba dapat dilakuakan:
- Pesturbasi (insuflasi) rubin test (utuh tidaknya
-

tuba)
Histerosalpingografi bentuk cavum uteri, bentuk

liang tuba, sumbatan nampak jelas


Kuldoskopi keadaan tuba dan ovarium
Laparoskopi dapat diketahui genitalia interna dan

sekitarnya
E. Pemeriksaan endometrium
Pada stadium premenstrual atau pada hari pertama haid
dilakukan mikrokuretase.
Endometrium yang normal

harus

memperlihatkan

hambaran histologik yang khas untuk stadium sekresi.


Kalau tidak ditemukan stadium sekresi maka:
- Endometrium tidak bereaksi dengan progesterone
- Produksi progesterone kurang
Sumber : Ginekologi, FK UNPAD
III.Tahap pemeriksaan laboratorium
Pria
Analisis sperma untuk mengetahui mutu air mani dan
spermatozoanya, meliputi jumlah sperma/ml, bentuk, gerakan,
jumlah dan persentase yang hidup serta pencairan air mani.
Wanita
Pemantauan ovulasi, untuk menentukan apakah ovarium
menghasilkan sel telur yang matang. Pemantauan ovulasi ini
dapat dilakukan dengan beberapa cara :
Riwayat siklus haid: siklus haid yang teratur dan normal, nyeri
per-tengahan siklus, perdarahan atau peningkatan luah atau
Page

cairan va-gina (vaginal discharge), mastalgia prahaid


menandakan ovulasi telah terjadi.
Uji pakis: pemeriksaan pada hari ke-23-28 siklus haid, istri
diminta datang untuk pengambilan getah serviks dari kanal
endoserviks ke-mudian dikeringkan pada gelas objek dan
diperiksa pengaruh estro-gen. Jika tidak terdapat pola daun
pakis dan kristal getah serviks berarti ovulasi telah terjadi.
Suhu Basal Badan (SBB): SBB diperiksa setiap bangun pagi
hari se-belum melakukan aktivitas apapun. Nilainya ditandai
pada kertas grafik. Jika wanita berovulasi, grafik akan
memperlihatkan pola bifasik dengan tukik pada pertengahan
siklus.
Sitologi vagina atau sitologi endoserviks: memantau
perubahan pada sel-sel yang tereksfoliasi selama fase luteal
(pengaruh progesteron).
Biopsi endometrium (mikrokuretase): dapat dilakukan secara
poliklinis dengan pembiusan ringan atau tanpa pembiusan.
Dengan memakai kuret kecil. Dilakukan pada 5-7 hari sebelum
hari haid berikutnya.
Laparoskopi diagnostik : melihat secara langsung adanya
bintik ovu-lasi atau korpus luteum sebagai hasil ovulasi.
Peneraan hormon: menentukan kadar hormon dalam darah,
urin mau-pun liur (saliva). Kadar normal dalam satu siklus :

Jenis
hormon

Satuan

FSH
LH
PRL
E2
P

mUI/ml
mUI/ml
ng/ml
pg/ml
ng/ml

Fase siklus haid


Praovulasi
Ovulasi
5-20
5-15
25-75
<5

15-45
30-40
5-25
200-600
5-8

Pasca
ovulasi
5-12
5-15
100-300
10-30

Histeroskopi: dapat memperlihatkan lukisan endometrium


yang bening kekuningan, yang sesuai dengan fase luteal.

Page

Ultrasonografi: dapat memantau perkembangan folikel dan


menentukan saat ovulasi. Pemeriksaan dilakukan secara
serial.
Penilaian rahim dan saluran telur dapat dilakukan dengan
beberapa cara :
Biopsi endometrium: selain untuk penilaian ovulasi, juga
dapat untuk pemeriksaan histologik lain, misalnya biakan
terhadap
tuberkulosis,
menilai
adanya
hiperplasia
endometrium. Terkadang dijumpai adanya hiperplasia fokal
meskipun siklus berovulasi berdasarkan peneraan homon P
plasma pada pertengahan fase luteal. Oleh karena itu perlu
dilakukan pemeriksan rasio P/E2 dan PRL/E2 bersamaan
dengan biopsi endometrium.
Uji insuflasi/pertubasi: CO2 ditiupkan melalui kanal serviks
dan dibuat rekaman kymograf terhadap tekanan uterus,
perubahan tekanan ber-arti tuba Falloppii paten. Gas ini juga
dapat didengar dengan stesto-skop atau dilihat dengan sinar
X.
Hidrotubasi: prinsipnya sama dengan pertubasi hanya yang
diguna-kan adalah cairan yang mengandung antibiotika
Kanamycin 1 gram, deksametason 5 mg dan antipasmodik
cair.
Histerosalpingogram: dilakukan pada paro-pertama siklus
haid, larutan radioopak disuntikkan melalui kanal serviks ke
dalam rahim dan saluran telur. Perjalanan larutan tersebut
dipantau di layar dengan penguat bayangan.
Histeroskopi : melihat secara langsung keadaan permukaan
endome-trium.
Laparoskopi : melihat secara langsung dan menguji
patensinya de-ngan menyuntikkan larutan biru metilen atau
indigokarmin, dan de-ngan melihat pelimpahannya ke dalam
rongga peritoneal. Laparoskopi juga dapat memperlihatkan
perlekatan pelvis, endometriosis, dan patologi ovarium tetapi
tidak dapat menggambarkan keadaan rongga uterus.
Ultrasonografi atau endosonografi: menilai bentuk, ukuran,
serta patologi uterus maupun tebal endometrium.
Analisis infeksi TORSH-KM (toksoplasma, rubella, sitomegalus,
herpes sim-pleks, klamidia, mikoplasma).
Page

Uji pasca-sanggama (UPS) untuk melihat apakah air mani sudah


memancar dengan baik ke puncak vagina selama sanggama.
UPS dilakukan 2-3 hari sebelum perkiraan ovulasi. Pasien diminta
datang 2-8 jam setelah sangga-ma normal. Getah serviks diisap
dari kanal endoserviks dan diperiksa de-ngan mikroskop, jika
terdapat 20 spermatozoa per lapang pandang besar (LPB= x400)
maka kemungkinan hamil cukup besar, antara 1-20 spermatozoa
per LPB sudah memuaskan.
IV. Pemeriksaan Lanjutan
Pemeriksaan
endoskopi
adalah
pemeriksaan
dengan
menggunakan alat teleskop (teropong) yang dimasukkan ke dalam
rongga tubuh melalui saluran alami (kanal serviks: pada
histeroskopi; kanal servik-rongga rahim, mulut saluran telur: pada
tuboskopi/Falloposkopi), suatu pembedahan kecil (di daerah pusar
atau umbilikus: pada laparoskopi; di puncak cekungan vagina
belakang atau forniks posterior: pada hidrolaparoskopi). Ada 4
(empat) macam endoskopi dalam bidang ginekologi:
Histeroskopi atau teropong rongga rahim
Laparoskopi atau teropong rongga perut
Tuboskopi/Falloposkopi atau teropong rongga salutan telur
Hidrolaparoskopi atau teropong rongga panggul disertai
penggenangan cairan
Histeroskopi digunakan untuk:

melihat keadaan saluran mulut rahim, rongga rahim, mulut


dalam saluran telur, besarnya rongga rahim, warna atau
kejernihan selaput rahim,
untuk membedakan polip endometrium dan leiomiom
submukosum;
untuk memastikan perlekatan dalam rahim dan kelainan
bawaan dalam rahim; untuk me-ngenali kelainan-kelainan
pada histerogram;
untuk penatalaksanaan operasi pada sekat rahim yang
menyebabkan keguguran berulang. Laparoskopi digunakan
Page

untuk melihat berbagai kelainan di dalam rongga panggul


(pelvis) atau rongga perut (abdomen) misalnya kista (tumor)
indung telur (ova-rium), tumor rahim (miom uterus),
perlekatan di rongga panggul akibat infeksi atau
endometriosis, bintil-bintil (lesi) endometriosis yang tidak
terlihat dengan alat ultrasonografi, pembengkakan saluran
telur (hidrosalpinks), dan juga bebe-rapa kelainan bawaan
rahim seperti rahim dua-tanduk (uterus bikornis) atau
tiadanya indung telur (agenesis ovarii).
Tuboskopi atau Falloposkopi digunakan untuk melihat bagian
dalam saluran telur, baik permukaannya maupun rongganya,
misalnya adakah perlekatan akibat infeksi, penyempitan bawaan,
dan hilangnya bulu getar (silia) selaput lendir (mu-kosa) saluran
telur.
Hidrolaparoskopi merupakan suatu teknik mutakhir untuk
melihat suatu gangguan fungsi dan anatomik ujung saluran telur
atau cekungan di belakang rahim (kavum Douglas), misalnya
perlekatan ujung saluran telur (fimbria), endometriosis, miom
uterus subserum di bagian belakang rahim atau kista ovarium.
Pemeriksaan endoskopi tidak dilakukan begitu saja pada semua
wanita, melainkan harus dengan dasar yang jelas, misalnya pada
wanita infertil yang telah melaku-kan pemeriksaan infertilitas
dasar sebelumnya tetapi belum diketahui penyebab infertilnya,
dan pada wanita yang diduga adanya endometriosis, miom, tumor
atau kanker rahim.
Sumber :http://kuliahbidan.wordpress.com/2008/07/19/kesuburanfertilitas/

7.
8.

Apa hubungan IgG dan IgM pada scenario?


Apa hubungan riwayat GO 3 tahun yang lalu dengan sekarang?

Page

9.
10.

Apa hubungan pil KB 1 tahun yang lalu dengan scenario?


Bagaimana edukasi dan penatalaksanaan?
Terapi Sederhana pada Infertilitas
Terapi infertilitas sering tidak berhasil, hanya 25 50% dari semua
pasangan suami-isteri yang mendapat pengobatan berhasil
melahirkan bayi hidup.Keberhasilan terapi umumnya tergantung
dari penyebab infertilias.
Pada umumnya, bila infertilitas di sebabkan oleh infeksi yang di
sderita sebelumnya.Baik kerusakan tuba fallopii maupun sumbatan
epididymas atau vas deferens, maka prognosa adalah jelek.
Terapi operatif pada kedua keadaan tersebut.Meskipun di
lakukan oleh ahli bedah yang sudah berpengalaman dan pada
penderita penderita yang telah di seleksi dengan ketat, hanya
berhasil mendatangkan kehamilan pada tidak lebih 20 30%
kasus.Sedangkan kemungkinan timbulnya kehamilan ektopik
setelah tubopiasti adalah 6 15%.
Kelainan kelaina ovulasi yang mendapat terapi memberi hasil
yang lebih baik, dengan angka kehamilan sampai 50 60%.
Untuk beberapa keadaan, terapi tidak memberikan perbedaan
yang berarti. Misalnya, endometriosis ringan, varicocele dan
infertilitas yang tidak di ketahui penyebabnya (20% dari kasus),
angka kehamilan umumnya hampir sama, baik yang mendapat
terapi maupun yang tidak mendapat terapi.
Terapi infertilitas memerlukan waktu yang lama dan biayanya
mahal.
Beberapa kasus mungkin mudah di obati. Pasangan suami isteri
dengan infertilitas yang tidak di ketahui penyebabnya. Mungkin
hanya merupakan keadaan subfertil saja dan sering dapat menjadi
hamil dengan pertolongan sederhana seperti perencanaan waktu
sanggama yang bersamaan dengan saat ovulasi.
Infertilitas yang di sebabkan oleh infeksi asimptomatis.
Umumnya gonorrhea atau infeksi Chlamydia atau mycoplasma
dapat di obati dengan antibiotika.
Bila jumlah spermatozoa rendah dan tidak dapat diobati dengan
medikamentosa atau bila ada persoalan dengan ejakulasi, salah
satu cara pengobatan adalah dengan inseminasi artefisial dengan
semen suami (AIH).
Pada kelainan kelainan ovulasi, dapat di berikan terapi
medikamentosa, misalnya dengan clomiphene sitrat per oral di
mulai pada hari ke-5 haid dan di minum selama 5 hari. Clomiphene

Page

sitrat merangsang ovulasi dengan jalan meniadakan efek suppresifovulasi dari estrogen selama bagian pertama dari siklus haid.
Bila dengan dosis 50 mg per hari ovulasi belum timbul, dapat di
berikan dosis lebih tinggi sampai 250 mg perhari selama 10 hari
pada siklus siklus berikutnya. Pada 70 80% akan timbul ovulasi,
dan angka kehamilan bervariasi antara 30 50%.
Clomiphene sitrat hanya menyebabkan sedikit efek samping
yang serius, pada dosis rendah mungkin terjadi pembesaran
ovarium dan rasa tidak enak di perut, pada dosis lebih tinggi
mungkin juga timbul gangguan penglihatan atau rasa panas di
wajah (hot flushes). Resiko timbulnya kehamilan multiple
tampaknya rendah.
Hanya sayang bahwa harga clomiphene sitrat relatif mahal.
Bromberpane
kadang

kadang
di
gunakan
untuk
merangsangtimbulnya ovulasi pada wanita dengan kadar prolaktin
yang tinggi. Dosis 7,5 mg per hari akan menurunkan kadar
prolaktin dan ovulasi umumnya timbul setelah 30 90 hari
pengobatan dengan angka kehamilan bervariasi antara 50 90%.
Harga bromocriptine juga mahal.
Terapi sederhana pada infertilitas relatif sangat terbatas.
Pengobatan infertilitas umumnya lebih rumit dan mahal, misalnya
salah satu cara terbaru, in vitio fertilization dan embryo transfer,
merupakan satu contoh betapa kompleksnya pengobatan
infertilitas ini.
Konseling Perihal Fertilitas dan Infertilitas
Pasangan suami isteri yang mengalami keterlambatan dalam
konsepsi atau yang memakai kontrasepsi tetapi merencanakan
untuk mempunyai anak di waktu yang akan dating. Harus
mengetahui keadaan keadaan apa saja yang dapat mengurangi
atau menambah fertilitas mereka, antara lain :
1. Partner seks yang banyak
Partner seks yang banyak meninggikan resiko terkena PHS,
termasuk infeksi pelvis dengan akibat kerusakan tuba fallopii yang
irreversbel dan kehamilan ektopik; di samping itu juga
memperbesar resiko terjadinya neoplasma intra-ephitelial seviks
(CIN) dan kondisi kondisi lain yang memerlukan terapi dari
jaringan serviks. Terapi tersebut dapat menimbulkan luka perut
atau merusak sel mucus serviks dan mengurangi kemungkinan
menjadi hamil.
Pada beberapa wanita dengan partner seks yang banyak, dapat
timbul antibodi terhadap spermatozoa.

Page

2.

3.

4.

5.

6.

Pemakaikan kondom secara teratur, kecuali bila ingin hamil.Dapat


mengurangi PHS, CIN dan pembentukan antibodi terhadap
spermatozoa.
Kesadaran akan fertilitas = Fertility awareness
Selama masa kehidupan reproduksi serang wanita, perubahan
perubahan hormonal yang siklis di isyaratkan dalam beberapa cara
yang dapat di ukur.
Dengan mencatat perubahan perubahan lendir serviks, suhu
badan basal, mittelschmerz, seorang wanita akan sadar perihal
status fertilitasnya.
Teknik sanggama
Beberapa peneliti berpendapat bila uterus dalam posisi antefleksi,
maka agar dapat terjadi kehamilan, posisi sanggama yang terbaik
adalah wanita berbaring terlentang dengan kedua pinggul di
tunjang dan di tinggikan dengan bantuan bantal.
Dan di perkirakan bahwa tetap dalam posisi terlentang selama 20
menit atau lebih setelah sanggama selesai, akan memberi lebih
banyak kesempatan kepada spermatozoa untuk berhubungan
dengan serviks.
Lubrikans
Beberapa lubrikans seperti K-Y jelly mempunyai sifat spermisid; dan
tanpa di ketahui oleh pasangan suami-isteri di gunakan sebagai
lubrikans sedangkan sebenarnya mereka menginginkan terjadinya
kehamilan.
Pembilasan Vagina (Douching)
Meskipun merupakan metode kontrasepsi yang sama sekali tidak
bias di andalkan pembilasan vagina pada pasangan suami-isteri
yang keadaan fertilitasnya sudah rendah, dapat membunuh
spermatozoa yang sangat di perlukan.
Medikamentosa
Beberapa medikamentosa dapat mempengaruhi fertilitas pria
dengan menyebabkan impotensi, ejakulasi retrograde atau
gangguan sementara spermatogenesis.
Narkotik,
trankuiliser
(phenothiazines),
monoamine-oxidase
inhibitors, guanethedine dan metildopa dapat menimbulkan
impotensi; sedangkan obat anti malaria, nitrofurantoin, cimetidine,
beberapa antihipertensi dan methotrexate dapat mempengaruhi
produksi spermatozoa.
Diethylstilbestrol (DES) dapat mengurangi fertilitas pria maupun
wanita. Angka kejadian untuk karsinoma testis, abnormalitas
spermatozoa dan testis yang tidak turun (cryptorchidismus) dapat
lebih tinggi pada pria yang mempunyai hubungan dengan DES.
Page

7. Iradiasi
Epitel germinal testis (yang menutupi terbulus seminifors) dapat
terganggu (sementara dan/atau irreversible, oleh iradiasi, dan
dapat terjadi kelainan kelainan kromosom.Di samping itu,
iradiasidapat mempertinggi resiko karsinoma testis.
Pada wanita, iradiasi dapat menyebabkan kegagalan dari ovarium.
8. Kerja Fisik / Jasmani
Beberapa atlet wanita (pelari jarak jauh atau penari professional)
dapat mengalami amenore yang irreversibel.
Pria yang sering mandi / berendam dalam air hangat / panas dapat
menyebabkan peninggian suhu skrotum sehingga terjadi
penurunan produksi spermatozoa.
9. Pakaian ketat
Pakaian ketat yang di pakai oleh pria mempunyai efek yang sama
dengan mandi / berendam air hangat / panas dan menyebabkan
peninggian suhu skrotum dengan akibat terjadi penurunan
produksi spermatozoa.
10.
Pekerjaan
Beberapa jenis pekerjaan seperti supir truk jarak jauh, dapat
menyebabkan oligospermia oleh karena hubungan / keterbukaan
terhadap panas.
11.
Nutrisi / Gizi
Status gizi yang jelek dapat memberikan efek umum yang buruk
terhadap fertilitas.Meskipun tampaknya gangguan terhadap
konsepsi belum timbul selama belum terjadi kelaparan yang
sebenarnya.
Sebaliknya, obesitas dapat mengurangi frekuensi ovulasi dan
mengurangi frekuensi sanggama, sehingga mempengaruhi
fertilitas dan kemungkinan konsepsi.
12.
Merokok / Alkohol
Merokok / tembakau dan alkohol dapat menyebabkan kualitas
spermatozoa yang jelek pada beberapa kasus.
Marijuana juga menyebabkan berkurangnya motilitas dan jumlah
spermatozoa.
Pada wanita hamil, merokok dan alkohol dapat memberikan efek
negative terhadap janin yang sedang tumbuh.
13.
Polusi
Pb, asap beracun dan kontak dengan pestisida disangka
mempunyai hubungan dan/atau sebagai penyebab dari infertilitas.
14.
Pembedahan / Operasi
Berbagai macam tindakan pembedahan dan beberapa pengobatan
medik dapat memberikan dampak pada fertilitas.Bila pengobtan

Page

terssebut memang di perlukan, bisa akan penderita perihal


dampaknya terhadap fertilitas.
1. Syarat pemeriksaan infertilitas
a. Istri yang berumur antara 20-30 tahun baru akan diperiksa setelah
berusaha untuk mendapat anak selama 12 bulan. Pmeriksaan
dapat dilakukan lebih dini apabila :
o Pernah mengalami keguguran berulang
o Diketahui mengidap kelainan endokrin
o Pernah mengalami peradangan rongga panggul atau rongga perut
dan
o Pernah mengalami bedah ginekologik
b. Istri yang berumur antara 31-35 tahun dapat diperiksa pada
kesempatan pertama pasangan itu datang ke dokter
c. Istri pasangan infertile yang berumur antara 36-40 tahun hanya
dilakukan pemeriksaan infertilitas kalau belum mempunyai anak
dari perkawinan ini
d. Pemeriksaan infertilitas tidak dilakukan pada pasangan infertile
yang salah satu anggota pasangannya mengidap penyakit yang
dapat membahayakan kesehatan istri atau anaknya.
a. Umur wanita telah mencapai akhir 30-an
b. Haid ireguler
c. Riwayat medis dari pasangan suami istri, termasuk parotitis pada
pria, abortus berulang kali, kehamilan ektopik
d. Dismenore atau dispareunia
e. Bila istri pernah memakai IUD dimasa lampau, pernah mengalami
infeksi pelvis
f. Pernah melakukan hubungan dengan DES (diethylstilbestrol
dapat mengurangi fertilitas pada pria atau wanita)
Sumber : Keluarga Berencana dan Kontrasepsi; dr. Hanafi
Hartanto

A. Wanita
Pengetahuan tentang siklus menstruasi, gejala lendir serviks puncak dan
waktu yang tepat untuk coital
Pemberian terapi obat, seperti;
1. Stimulant ovulasi, baik untuk gangguan yang disebabkan oleh supresi
hipotalamus, peningkatan kadar prolaktin, pemberian tsh .
Page

2. Terapi penggantian hormon


3. Glukokortikoid jika terdapat hiperplasi adrenal
4. Penggunaan antibiotika yang sesuai untuk pencegahan dan
penatalaksanaan infeksi dini yang adekuat
GIFT ( gamete intrafallopian transfer )
Laparatomi dan bedah mikro untuk memperbaiki tuba yang rusak secara luas
Bedah plastic misalnya penyatuan uterus bikonuate,
Pengangkatan tumor atau fibroid
Eliminasi vaginitis atau servisitis dengan antibiotika atau kemoterapi
B. Pria
Penekanan produksi sperma untuk mengurangi jumlah antibodi autoimun,
diharapkan kualitas sperma meningkat
Agen antimikroba
Testosterone Enantat dan Testosteron Spionat untuk stimulasi kejantanan
HCG secara i.m memperbaiki hipoganadisme
FSH dan HCG untuk menyelesaikan spermatogenesis
Bromokriptin, digunakan untuk mengobati tumor hipofisis atau hipotalamus
Klomifen dapat diberikan untuk mengatasi subfertilitas idiopatik
Perbaikan varikokel menghasilkan perbaikan kualitas sperma
Perubahan gaya hidup yang sederhana dan yang terkoreksi. Seperti, perbaikan
nutrisi, tidak membiasakan penggunaan celana yang panas dan ketat
Perhatikan penggunaan lubrikans saat coital, jangan yang mengandung
spermatisida

PENANGANAN BERDASARKAN ETIOLOGI

1. Varikokel. Tindakan yang saat ini dianggap paling tepat adalah dengan
operasi berupa pengikatan pembuluh darah yang melebar (varikokel)
tersebut. Sebagian besar penelitian menunjukkan manfaat tindakan ini
walaupun metodologi penelitiannya belum sempurna karena tanpa

Page

pembanding. Suatu penelitian dengan pembanding menunjukkan


keberhasilan tindakan pada 66 persen penderita berupa peningkatan
jumlah sperma dan kehamilan, dibandingkan dengan hanya 10 persen
pada kelompok yang tidak dioperasi.
2. Infertilitas yang tidak diketahui penyebabnya merupakan masalah
bermakna karena meliputi 20 persen penderita. Penanggulangannya
berupa pemberian beberapa macam obat, yang dari pengalaman
berhasil menaikkan jumlah dan kualitas sperma. Namun sebagian
besar penelitian yang dilakukan dengan menggunakan pembanding,
tidak menunjukkan perbaikan bermakna. Usaha menemukan penyebab
di tingkat kromosom dan keberhasilan manipulasi genetik tampaknya
menjadi titik harapan di masa datang.
3. Adanya penyumbatan di saluran sperma hanya dapat dipastikan
dengan operasi. Bila sumbatan tidak begitu parah, dengan bantuan
mikroskop dapat diusahakan koreksinya. Pada operasi yang sama,
dapat juga dipastikan ada atau tidaknya produksi sperma di buah
zakar.
4. Sesuai dengan kelainan yang ditemukan, maka penyebab lain bisa
diatasi dengan koreksi hormonal dan penghentian obat-obatan yang
diduga menyebabkan gangguan sperma.
5. Namun, usaha-usaha di atas ada kalanya belum berhasil untuk
meningkatkan kualitas dan kuantitas sperma, sehingga diperlukan
teknik reproduksi bantuan. Termasuk dalam hal ini adalah inseminasi
bantuan dan inseminasi in-vitro (IVF/bayi tabung), yang sangat
membantu mengatasi masalah infertilitas pria.
INSEMINASI BUATAN

Page

Inseminasi buatan demi kelahiran seorang anak, cara ini di luar kebiasaan,
karena biasanya melalui hubungan seksual langsung antara laki-laki dengan
perempuan, terjadi melalui dua jalan yang mendasar:
1- Jalan inseminasi dalam, hal ini dengan menyuntikkan sperma laki-laki di
tempat yang sesuai dalam tubuh wanita.
2- Jalan inseminasi luar, di antara sperma laki-laki dengan telur wanita dalam
tabung uji dalam laboratorium medis kemudian telur yang sudah dibuahi
tersebut ditanam dalam rahim seorang wanita.

Jalan Inseminasi Dalam:


Cara pertama, benih jantan diambil dari laki-laki beristri lalu disuntikkan
pada tempat yang sesuai di dalam saluran rahim atau dalam rahim
istrinya sehingga benih itu bertemu secara alami dengan sel telur yang
dipancarkan oleh indung telur istrinya, maka terjadilah pembuahan yang
selanjutnya adalah bersemayam di dinding rahim dengan izin Allahseperti yang terjadi dalam persetubuhan. Cara ini digunakan jika suami
mempunyai keterbatasan karena suatu sebab sehingga dia tidak berhasil
menyampaikan spermanya ke sasarannya pada saat terjadi persetubuhan.
Cara kedua, benih jantan di ambil dari seorang laki-laki lalu ia disuntikkan
di tempat yang sesuai pada istri orang lain sehingga terjadi pembuahan
dari dalam dan selanjutnya menempel di dinding rahim sebagaimana
dalam cara yang pertama. Cara ini digunakan manakala suami mandul
tidak mempunyai bibit dalam spermanya sehingga benih jantan diambil
dari orang lain.

Jalan Inseminasi Luar:


Cara ketiga, benih jantan diambil dari suami demikian juga sel telur dari
istrinya, lalu keduanya diletakkan dalam tabung uji medis dengan syaratsyarat fisika tertentu sehingga benih jantan milik suami membuahi sel
telur milik istri dalam wadah uji, setelah pembuahan ini mulai terbagi dan
Page

meningkat jumlahnya, dalam waktu yang sesuai dipindahkan dari tabung


uji ke rahim istri itu sendiri, pemilik sel telur agar ia menempel pada
dinding rahimnya, maka ia tumbuh dan terbentuk seperti janin lainnya, di
akhir masa kehamilan istri melahirkan anak laki-laki atau anak
perempuan. Ini yang dikenal dengan bayi tabung yang dibuktikan oleh
penemuan ilmiyah yang dimudahkan oleh Allah, sampai hari telah ada
beberapa anak yang lahir melalui cara ini, laki-laki, perempuan dan
kembar, beritanya diekspos oleh koran-koran internasional dan mediamedia informasi lainnya. Cara ini digunakan manakala istri mandul akibat
tersumbatnya saluran di antara rahim dengan indung telurnya.
Cara keempat, inseminasi luar dalam tabung uji antara benih jantan yang
diambil dari suami dan sel telur yang diambil dari seorang wanita yang
bukan istrinya, mereka menyebutnya dengan relawan, kemudian kedua
benih yang telah bertemu ini di masukkan ke dalam rahim istrinya. Cara
digunakan manakala indung telur istri tidak berfungsi atau rusak sama
sekali namun rahimnya sehat dan mungkin menerima pertemuan kedua
benih padanya.
Cara kelima, inseminasi luar dalam tabung uji di antara benih jantan dari
seorang laki-laki dan sel telur dari seorang wanita yang bukan istrinya,
mereka menamakannya dengan dua orang relawan kemudian kedua
benih yang telah bertemu ini dimasukkan ke dalam rahim wanita lain yang
bersuami. Mereka menggunakan cara ini manakala wanita yang bersuami
di mana kedua benih itu di masukkan kepadanya mandul karena indung
telurnya rusak namun rahimnya sehat, suaminya mandul dan keduanya
menginginkan seorang anak.
Cara keenam, inseminasi dilakukan di luar dalam tabung uji di antara
benih suami istri kemudian dimasukkan kepada seorang wanita yang
menjadi relawan untuk mengandungnya. Mereka menggunakan cara ini
manakala istri tidak mampu untuk hamil karena suatu sebab pada
rahimnya, namun sel telurnya sehat dan aktif, atau dia memang tidak
berminat untuk hamil, maka ada seorang wanita yang sukarela
menggantikannya.
Inilah cara-cara inseminasi buatan yang diwujudkan oleh ilmu demi
mengatasi sebab-sebab terhambatnya kehamilan
Page

11.

Apa penyebab infertilitas?

Faktor2 pada pria


40%
Faktor2 pada wanita
- gangguan ovulasi
10 %
- adhesi pelvis / penyakit tuba
20%
- problem lendir servik
5%
- faktor2 lain
(misal : hypothayroidi, immunologik dll)
5%
Tidak diketahui penyebabnya
20%

Pada wanita :
2. Ovarium gagal menghasilkan ovum, sehingga
kemungkinan konsepsi tidak terjadi
3. Tuba fallopi dapat tersumbat, berkelok-kelok, atau
mengalami
infeksi
(TBC
genital)mencegah
pergerakan normal dari ovum atau spermatozoa di
dalam tuba fallopi
Penyebab utama tuba fallopi yang tersumbat :
o PHSgonorrhea, Chlamydia
o Infeksi post partum
o Infeksi post abortus
4. Uterus berbentuk abnormal atau endometrium tidak
adekuat atau mengalami infeksi, sehingga mencegah
implantasi atau kelangsungan hidup dari embrio
5. Serviks
mengalami
malformasi,
infeksi
atau
mengeluarkan sekret atau mukus yang abnormal
6. Infeksi sitemik, gangguan keseimbangan hormonal,
atau kelainan genetik dapat menyebabkan kematian
janin
7. Factor lain :
o alcohol,
tembakau,
obat-obat
tertentu
(barbiturate, tranquilizer, narkotik, sitostatika), zat
penyebab polusi lingkungan (Pb, pestisida,
radiasi)
o malnutrisi berat
o efek dari sirkumsisi wanita
Sumber : Keluarga Berencana dan Kontrasepsi; dr. Hanafi
Hartanto

Page

Pada Wanita
Gangguan organ reproduksi
a. Infeksi vagina sehingga meningkatkan keasaman
vagina yang akan membunuh sperma dan
pengkerutan vagina yang akan menghambat
transportasi sperma ke vagina
b. Kelainan pada serviks akibat defesiensi hormon
esterogen yang mengganggu pengeluaran mukus
serviks. Apabila mukus sedikit di serviks, perjalanan
sperma ke dalam rahim terganggu. Selain itu, bekas
operasi pada serviks yang menyisakan jaringan parut
juga dapat menutup serviks sehingga sperma tidak
dapat masuk ke rahim
c. Kelainan pada uterus, misalnya diakibatkan oleh
malformasi uterus yang mengganggu pertumbuhan
fetus, mioma uteri dan adhesi uterus yang
menyebabkan terjadinya gangguan suplai darah
untuk perkembangan fetus dan akhirnya terjadi
abortus berulang
d. Kelainan
tuba
falopii
akibat
infeksi
yang
mengakibatkan adhesi tuba falopii dan terjadi
obstruksi sehingga ovum dan sperma tidak dapat
bertemu
Gangguan ovulasi
Gangguan
ovulasi
ini
dapat
terjadi
karena
ketidakseimbangan hormonal seperti adanya hambatan
pada sekresi hormon FSH dan LH yang memiliki
pengaruh besar terhadap ovulasi.Hambatan ini dapat
terjadi karena adanya tumor kranial, stress, dan
penggunaan obat-obatan yang menyebabkan terjadinya
disfungsi hipothalamus
dan hipofise.Bila
terjadi
gangguan sekresi kedua hormon ini, maka folicle
mengalami hambatan untuk matang dan berakhir pada
gengguan ovulasi.
Kegagalan implantasi
Wanita dengan kadar progesteron yang rendah
mengalami
kegagalan
dalam
mempersiapkan
endometrium untuk nidasi. Setelah terjadi pembuahan,
proses nidasi pada endometrium tidak berlangsung
baik. Akiatnya fetus tidak dapat berkembang dan
terjadilah abortus
Page

Endometriosis
Abrasi genetis
Faktor immunologis
Apabila embrio memiliki antigen yang berbeda dari ibu,
maka tubuh ibu memberikan reaksi sebagai respon
terhadap benda asing.Reaksi ini dapat menyebabkan
abortus spontan pada wanita hamil.
Lingkungan
Paparan radiasi dalam dosis tinggi, asap rokok, gas
ananstesi, zat kimia, dan pestisida dapat menyebabkan
toxic pada seluruh bagian tubuh termasuk organ
reproduksi yang akan mempengaruhi kesuburan.
Pada Pria
Ada beberapa kelainan umum yang dapat menyebabkan
infertilitas pada pria yaitu :
Abnormalitas sperma; morfologi, motilitas
Abnormalitas ejakulasi; ejakulasi rerograde, hipospadia
Abnormalitas ereksi
Abnormalitas cairan semen; perubahan pH dan
perubahan komposisi kimiawi
Infeksi pada saluran genital yang meninggalkan jaringan
parut sehingga terjadi penyempitan pada obstruksi
pada saluran genital
Lingkungan; Radiasi, obat-obatan anti cancer
Abrasi genetik
Sumber :http://asuh.wikia.com
FAKTOR RESIKO
1.
FAKTOR
Usia wanita
Usia laki-laki
Frekuensi koitus
Masa koitus
Lubrikan

DAMPAK
Semakin tua usia (diatas 40 tahun), semakin lama
waktu untuk konsepsi
Frekuensi koitus berkurang dengan meningkatnya
usia
Ada korelasi positif antara frekuensi koitus dengan
angka kehamilan
Koitus
pada
masa
ovulasi
(hari
10-15
memaksimalkan kemungkinan ovulasi, karena ovum
hanya hidup kira-kira 12-24 jam
Lubrikan seperti K-Y jelly mengandung spermisidal
dan
bila
digunakan
untuk
lubrikasi
dapat
menghambat konsepsi

Page

Merokok/ alcohol

Jika berlebihan dapat meperburuk kualitas sperma.


Penggunaan marijuana dapat mengurangi jumlah
dan motilitas sperma
Pembedahan
Pembedahan organ reproduksi atau pada panggul
wanita atau laki2 dapat menimbulkan masalah
fertilitas karena terjadinya perbahan anatomi atau
kerusakan pada syaraf terutama pada laki2.
Infeksi saluran genitalia Gonorea dan klamidia adalah PMS utama yang
yang ditularkan secara mengakibatkan penyekit radang panggul dan
seksual (infeksi traktus gangguan fertilitas
genitalia)
Penyekit yang ditularkan Penyakit
seperti
tuberculosis
genitalia
tidak melalui hubungan (yangdisebabkan oleh virus), infeksi postpartum dan
seksual
posabortus juga dapat menurunkan fertilitas
Obat-obatan (missal, anti Obat-obatan
tertentu
dpat
mengakibatkan
hipertensi
dan impotensi. Ada pula obat-obatan ynag mengganggu
transquilizers)
fungsi spermatogenesis dan ovarium (misalnya,
obat anti kanker)
Radiasi
Gangguan fungsi gonad dapat terjadi karena radiasi
Sumber :Buku Acuan Nasional Pelayanan KB, 2007

Page