Anda di halaman 1dari 22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

nophienov
AfineWordPress.comsite

BAKTERIBATANGGRAMNEGATIF
BABI
PENDAHULUAN
1.1LatarBelakang
Seiringdengankemajuanperkembanganilmupengetahuandanteknologi
khususnyadibidangkesehatanyangmoderndancanggihdalampenanganan
kesehatanbaiksecarakuratif,promotif,rehabilitative,danpreventifsangat
memberikanmanfaatbagimanusia.Denganberkembangnyapengetahuan
teknologikesehatan,halinitidaklepasdaripengaruhpenyakityangmenyerang
manusiadenganlatarbelakangyangberbedasehinggaperlunyapembaharuan
secaraberkelanjutandemiterealisasinyaupayakesehatan.
Bakterigramnegatifadalahbakteri(http://id.wikipedia.org/wiki/Bakteri)yang
tidakmempertahankanzatwarna(http://id.wikipedia.org/wiki/Zat_warna)
kristalviolet(http://id.wikipedia.org/w/index.php?
title=Kristal_violet&action=edit&redlink=1)sewaktuprosespewarnaanGram
(http://id.wikipedia.org/wiki/Pewarnaan_Gram)sehinggaakanberwarnamerah
biladiamatidenganmikroskop(http://id.wikipedia.org/wiki/Mikroskop).Disisi
lain,bakterigrampositif(http://id.wikipedia.org/wiki/Grampositif)akan
berwarnaungu.Perbedaankeduanyadidasarkanpadaperbedaanstruktur
dindingsel(http://id.wikipedia.org/wiki/Dinding_sel)yangberbedadandapat
dinyatakanolehprosedurpewarnaanGram.Proseduriniditemukanpada
tahun1884olehilmuwanDenmark(http://id.wikipedia.org/wiki/Denmark)
bernamaChristianGramdanmerupakanprosedurpentingdalamklasifikasi
bakteri.BakterigrampositifsepertiStaphylococcusaureus
(http://id.wikipedia.org/wiki/Staphylococcus_aureus)(bakteripatogen
(http://id.wikipedia.org/wiki/Patogen)yangumumpadamanusia)hanya
mempunyaimembranplasma(http://id.wikipedia.org/wiki/Membran_plasma)
tunggalyangdikelilingidindingseltebalberupapeptidoglikan
(http://id.wikipedia.org/wiki/Peptidoglikan).Sekitar90%daridindingsel
tersebuttersusunataspeptidoglikan
(http://id.wikipedia.org/wiki/Peptidoglikan)sedangkansisanyaberupamolekul
lainbernamaasamteikhoat(http://id.wikipedia.org/w/index.php?
title=Asam_teikhoat&action=edit&redlink=1).Disisilain,bakterigramnegatif
(sepertiE.coli(http://id.wikipedia.org/wiki/E._coli))memilikisistemmembran
gandadimanamembranpasmanyadiselimutiolehmembranluarpermeabel
https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

1/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

(http://id.wikipedia.org/w/index.php?title=Permeabel&action=edit&redlink=1).
Bakteriinimempunyaidindingseltebalberupapeptidoglikan,yangterletakdi
antaramembrandalamdanmembranluarnya.
Enterobacteriaceaeadalahkelompokbatanggaramnegatifyangbesardan
heterogen;denganhabitatalaminyadisalurancernamanusiadanhewan
familinyamemilikibanyakgenus(Escherichia,shigela,salmonella,enterobakter,
klebsiela,serratia,proteus,danlainlain).
Dalammakalahkaliiniakandibahasbakterigramnegatifyangbersifatpatogen
padamanusia.Bakteriinidikatakanpatogenkarenatidakmemfermentasi
laktosapadasaluranintestine.BakteritersebutdiantaranyaadalahSalmonella,
Shigella,Pseudomonas,danVibrio.
1.2RumusanMasalah
1.
2.
3.
4.
5.
6.
7.

Apadefinisibakteri?
Apadefinisibakterigramnegatif?
Apaperbedaanbakterigramnegatifdanbakterigrampositif?
ApaitubakteriSalmonelladanbagaimanabakteriSalmonellaitu?
ApaitubakteriShigelladanbagaimanabakteriShigellaitu?
ApaitubakteriPseudomonasdanbagaimanabakteriPseudomonasitu?
ApaitubakteriVibriodanbagaimanabakteriVibrioitu?

1.3Tujuan
1.
2.
3.
4.
5.
6.
7.

Mengetahuidefinisibakteri
Mengetahuidefinisibakterigramnegatif
Mengetahuiperbedaanbakterigramnegatifdanbakterigrampositif
MengetahuiapaituSalmonelladanbagaimanaSalmonellaitu.
MengetahuiapaituShigelladanbagaimanaShigellaitu.
MengetahuiapaituPseudomonasdanbagaimanaPseudomonasitu.
MengetahuiapaituVibriodanbagaimanaVibrioitu.

BABII
TINJAUANPUSTAKA
2.1DefinisiBakteri
Bakterimerupakanmikrobaprokariotikuniselularyangberkembangbiak
secaraaseksualdenganpembelahansel.Bakteritidakberklorofilkecuali
beberapayangbersifatfotosintetik.Bakteriadayangdapathidupbebas,parasit,
saprofit,patogenpadamanusia,hewandantumbuhan.Bakteritersebarluasdi
alam,dalamtanah,atmosfer(sampai+10kmdiatasbumi),didalamlumpur,
dandilaut.Bakterimempunyaibentukbulat,batang,danlengkung,namun
bentukbakterijugadapatdipengaruhiolehumur.Bakteridapatmengalami
https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

2/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

perubahanbentukyangdisebabkanfaktormakanan,suhu,danlingkungan,
jugadapatmengalamipleomorfi,yaitubentukyangbermacammacamdan
teraturwalaupunditumbuhkanpadasyaratpertumbuhanyangsesuai.
Umumnyabakteriberukuran0,510.Bakteridiklasifikasikanberdasarkan
deskripsisifatmorfologidanfisiologi.Bakteridibagimenjadi1kelompok
(grup),denganCyanobacteriapadagrup20.Pembagianiniberdasarkanbentuk,
sifatgram,kebutuhanoksigen,danapabilatidakdapatdibedakanmenurut
ketiganyamakadimasukkankedalamkelompokkhusus.
2.1.1DefinisiBakteriGramNegatif
Bakterigramnegatifadalahbakteriyangtidakmempertahankanzatwarna
kristalvioletsewaktuprosespewarnaanGram
(http://id.wikipedia.org/wiki/Pewarnaan_Gram)sehinggaakanberwarnamerah
biladiamatidenganmikroskop(http://id.wikipedia.org/wiki/Mikroskop).Disisi
lain,bakterigramnegatif(sepertiE.coli)memilikisistemmembrangandadi
manamembranpasmanyadiselimutiolehmembranluarpermeabel.Bakteriini
mempunyaidindingseltebalberupapeptidoglikan,yangterletakdiantara
membrandalamdanmembranluarnya.
Banyakspesiesbakterigramnegatifyangbersifatpatogen
(http://id.wikipedia.org/wiki/Patogen),yangberartimerekaberbahayabagi
organismeinang(http://id.wikipedia.org/wiki/Inang).Sifatpatogenini
umumnyaberkaitandengankomponentertentupadadindingselgramnegatif,
terutamalapisanlipopolisakarida
(http://id.wikipedia.org/wiki/Lipopolisakarida)(dikenaljugadenganLPSatau
endotoksin(http://id.wikipedia.org/wiki/Endotoksin)).
2.1.2PerbedaanBakteriGramNegatifdanBakteriGramPositif
Karakteristik

Grampositif

Gramnegative

Dindingsel

Homogendantebal(2080
nm)sertasebagianbesar
tersusundaripeptidoglikan.
Polisakaridalaindanasam
teikoatdapatikut
menyusundindingsel.

Peptidoglikan(27nm)di
antaramembrandamdan
luar,sertaadanyamembran
luar(78nmtebalnya)yang
terdiidarilipid,protein,dan
lipopolisakarida

Bentuksel

Bulat,batangataufilamen

Bulat,oval,batanglurusatau
melingkarseprtitandkoma,
heliksataufilamen;beberapa
mempunyaiselubungatau
kapsul

Reproduksi

Pembelahanbiner

Pembelahanbiner,kadang
kadangpertunasan

Metabolisme

Kemoorganoheterotrof

Fototrof,kemolitoautotrof,
ataukemoorganoheterotrof

https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

3/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

Motilitas

Kebanyakannonmotil,bila
motiltipeflagelanyaadalah
petritrikus(petritrichous)

Motilataunonmotil.Bentuk
flageladapatbervariasi
polar,lopotrikus
(lophtrichous),petritrikus
(petritrichous).

Anggota
tubuh
(apendase)

Biasanyatidakmemiliki
apendase

Dapatmemilikipili,fimbriae,
tangkai

Endospora

Beberapagrupdapat
membentukendspora

Tidakdapatmembentuk
endospora

Berikutiniadalahklasifikasibakterigramnegatif.

2.2BakteriBatangGramNegatifSalmonella
Salmonelaumumnyabersifatpatogenuntukmanusiaatauhewanbila
masukmelaluimulut.Organismeiniditularkandarihewandanprodukhewan
kemanusia,danmenyebabkanenteritis,infeksisistemik,dandemamenterik.
2.2.1MorfologidanKlasifikasi
Salmonellasp.adalahbakteribatanglurus,gramnegatif,tidakberspora,
bergerakdenganflagelperitrik,berukuran24mx0.50,8m.Salmonellasp.
tumbuhcepatdalammediayangsederhana(Jawetz,dkk,2005),hampirtidak
pernahmemfermentasilaktosadansukrosa,membentukasamdankadanggas
dariglukosadanmanosa,biasanyamemporoduksihidrogensulfideatauH2S,
padabiakanagarkoloninyabesarbergaristengah28milimeter,bulatagak
cembung,jernih,smooth,padamediaBAPtidakmenyebabkanhemolisis,pada
mediaMacConceykoloniSalmonellasp.Tidakmemfermentasilaktosa(NLF),
konsistensinyasmooth(WHO,2003)Salmonellasp.tahanhidupdalamairyang
dibekukandalamwaktuyanglama,bakteriiniresistenterhadapbahankimia
tertentu(misalnyahijaubrillian,sodiumtetrathionat,sodiumdeoxycholate)
yangmenghambatpertumbuhanbakterienteriklain,tetapisenyawatersebut
bergunauntukditambahkanpadamediaisolasiSalmonellasp.
Padasampelfeses.KlasifikasikumanSalmonellasp.sangatkompleks,biasanya
diklasifikasikanmenurutdasarreaksibiokimia,serotipeyangdiidentifikasi
menurutstrukturantigenO,H,danViyangspesifik(Jawetz,dkk,2005
;Bennasar,A.,etal,2000).Menurutreaksibiokimianya,Salmonellasp.dapat
diklasifikasikanmenjaditigaspesiesyaituS.typhi,S.enteritidis,S.cholerasuis,
disebutbagankauffmanwhite(Irianto,2006).Berdasarkanserotipenyadi
klasifikasikanmenjadiempatserotipeyaituS.paratyphiA(SerotipegroupA),
S.ParatyphiB(SerotipegroupB),S.ParatyphiC(Serotipegroup),danS.
typhidariSerotipegroupD(Jawetz,2005).
2.2.2Identifikasi
https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

4/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

Kingdom:Bakteria
Philum:Proteobakteria
Class:GammaProteobakteria
Ordo:Enterobakteriales
Famili:Enterobakteriaceae
Genus:Salmonella
Spesies:S.typhi,S.enteritidis,S.cholerasuis
2.2.3PatogenesisdanGambaranKlinis
SalmonellaThypi,SalmonellaCholeraesuis,danmungkinjugaSalmonella
ParatyphiBbersifatinfeksiusuntukmanusia,daninfeksiolehorganisme
tersebutdidapatkandarimanusia.Namun,sebagianbesarsalmonellabersifat
pathogenterutamabagihewanyangmenjadireservoiruntukmenjadimanusia:
unggas,babi,hewanpengerat,hewanternak,binatangpiaraan(darikurakura
hinggaburungkakatua),danbanyaklainnya.
Organismeinihampirselalumasukmelaluiruteoral,biasanyabersama
makananatauminumanyangterkontaminasi.Dosisefektifrataratauntuk
menimbulakninfeksiklinisatausubklinispadamanusiaadalah105108
Salmonella.Beberapafactorpejamuyangmenimbulkanresistensiterhadap
infeksiSalmonellaadalahkeasamanlambung,floranormalususdankekebalan
usus.

2.2.4PenyakityangDisebabkanOlehBakteriiJenisIni
BerikutmacammacampenyakityangdisebabkanolehSalmonellayaitu:
1. 1.DemamEnterik(DemamTifoid)
HCLdalamlambungberperansebagaipenghambatmasuknyaSalmonellatyphi
danbakterilain.JikaSalmonellatyphimasukbersamasamacairan,makaterjadi
pengenceranHCLyangmengurangidayahambatterhadap
mikroorganismepenyebabpenyakityangmasuk.DayahambatHCLiniakan
menurunpadawaktuterjadipengosonganlambung,sehinggaSalmonellatyphi
dapatmasukkedalamususpenderita.Salmonellatyphiseterusnyamemasuki
folikelfolikellimfeyangterdapatdidalamlapisanmukosaatausubmukosa
usus,bereplikasidengancepatuntukmenghasilkanlebihbanyakSalmonella
typhi.Setelahitu,Salmonellatyphimemasukisaluranlimfedanakhirnya
mencapaialirandarah.Dengandemikianterjadilahbakteremiapadapenderita.
Denganmelewatikapilerkapileryangterdapatdalamdindingkandung
empeduatausecaratidaklangsungmelaluikapilerkapilerhatidankanalikuli
empedu,makabakteridapatmencapaiempedudanlarutdisana.
Melaluiempeduyanginfektifterjadilahinvasikedalamususuntukkedua
kalinyayanglebihberatdaripadainvasitahappertama.Invasitahapkeduaini
menimbulkanlesiyangluaspadajaringanlimfeususkecilsehinggagejala
gejalaklinikmenjadijelas.Demamtifoidmerupakansalahsatubekteremiayang
disertaiolehinfeksimenyeluruhdantoksemiayangdalam.Berbagaimacam
https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

5/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

organmengalamikelainan,contohnyasistemhematopoietikyangmembentuk
darah,terutamajaringanlimfoidususkecil,kelenjarlimfeabdomen,limpadan
sumsumtulang.Kelainanutamaterjadipadaususkecil,hanyakadangkadang
padakolonbagianatas,makaSalmonellaparatyphiBdapatmenimbulkanlesi
padaseluruhbagiankolondanlambung.
Padaawalminggukeduadaripenyakitdemamtifoidterjadinekrosissuperfisial
yangdisebabkanolehtoksinbakteriatauyanglebihutamadisebabkanoleh
pembuntuanpembuluhpembuluhdarahkecilolehhiperplasiasel
limfoid(disebutseltifoid).
Mukosayangnekrotikkemudianmembentukkerak,yangdalammingguketiga
akanlepassehinggaterbentukulkusyangberbentukbulatataulonjongtak
teratur.Padaumumnyaulkustidakdalammeskipuntidakjarangjika
submukosaterkena,dasarulkusdapatmencapaidindingototdariususbahkan
dapatmencapaimembranserosa.
Padawaktukeraklepasdarimukosayangnekrotikdanterbentukulkus,
makaperdarahanyanghebatdapatterjadiataujugaperforasidariusus.Kedua
komplikasitersebutyaituperdarahanhebatdanperforasimerupakanpenyebab
yangpalingseringmenimbulkankematianpadapenderitademamtifoid.
Meskipundemikian,beratnyapenyakitdemamtifoidtidakselalusesuaidengan
beratnyaulserasi.Toksemiayanghebatakanmenimbulkandemamtifoidyang
beratsedangkanterjadinyaperdarahanususdanperforasimenunjukkanbahwa
telahterjadiulserasiyangberat.Sedangkanperdarahanususdanperforasi
menunjukkanbahwatelahterjadiulserasiyangberat.Padaserangandemam
tifoidyangringandapatterjadibaikperdarahanmaupunperforasi.Pada
stadiumakhirdaridemamtifoid,ginjalkadangkadangmasihtetap
mengandungkumanSalmonellatyphisehinggaterjadibakteriuria.
Makapenderitamerupakanurinarykarierpenyakittersebut.Akibatnyaterjadi
miokarditistoksik,ototjantungmembesardanmelunak.Anakanakdapat
mengalamiperikarditistetapijarangterjadiendokaritis.Tromboflebitis,
periostitisdannekrosistulangdanjugabronkhitissertameningitiskadang
kadangdapatterjadipadademamtifoid.
1. 2.BakterimiadenganLesiFokal
KeadaaniniumumnyadisebabkanolehS.choleraesuis,tetapijugadapat
disebabkanolehserotypesalmonellaapapun.Setelahinfeksimelaluimulut,
terjadiinvasidinikealirandarah(dengankemungkinanlesifokaldiparu,
tulang,meningens,danlainlain),tetapimanifestasidiususseringtidakada.
BayidananakanakjauhlebihrentanterhadapinfeksiterutamaSalmonella,
mudahdicapaidenganmenelansejumlahkecilbakteri.Telahmenunjukkan
bahwa,padabayi,pencemaranbisamelaluiinhalasidebubakterisarat.Setelah
masainkubasisingkatbeberapajamsampaisatuhari,kumanberkembangbiak
didalamlumenususmenyebabkanradangususdengandiareyangsering
mucobernanahdanberdarah.Padabayi,dehidrasidapatmenyebabkan
keadaanparahtoksikosis.Normalnyatidakadasepsis,tetapibisaterjadisebagai
komplikasipadapasienusialanjutmelemah(penyakitHodgkin),misalnya.
Lokalisasiekstraintestinalyangmungkin,terutamaSalmonellameningitispada
anakanak,osteitis,dll.Salmonella(misalnya,Salmonellaentericasubsp.
entericaserovarenteritidis)dapatmenyebabkandiare,yangbiasanya
tidakmemerlukanantibiotikpengobatan.Namun,padaorangyangberisiko
sepertibayi,anakkecil,orangtua,infeksiSalmonellabisamenjadisangatserius,
https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

6/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

mengarahkekomplikasi.Jikahalinitidakdiobati,padapasienHIVdanorang
orangdengankekebalantubuhrendahbisamenjadisakitparahAnakdengan
anemiaselsabityangterinfeksiSalmonellabisaterjadiosteomyelitis.
1. 3.Enterokolitis
Enterokolitismerupakanmanifestasiinfeksisalmonellayangpalingsering
terjadi.DiASSalmonellathypimuriumdanSalmonellaenteriditislebih
menonjol,tetapienterokolitisdapatdisebabkanolehlebihdari1400serotype
Salmonellagrup1.Delapanhingga48jamsetelahtertelannyasalmonellatimbul
mual,sakitkepala,muntahdandiarehebat,denganbeberapaleukositdidalam
feses.Seringtimbuldemamringantetapibiasanyasembuhsendiridalam23
hari.Terdapatlesiinflamasipadausushalusdanususbesar.Bakterimiajarang
terjadi,kecualipadapasienyangmengalamiimunodefisiensi.Biakandarah
baiasanyanegative,tetapibiakanfesesbiasanyapositifuntuksalmonelladan
dapattetappositifselamabeberaoaminggusetelahpenyakitsembuhsecara
kinis.
2.2.5UjiDiagnostikLaboratorium
Spesimen
Darahuntukbiakanharusdiambilberulangkali.Padademamentericdan
septikimia,biakandarahseringpositifdalamminggupertamapenyakit.Biakan
sumsumtulangdapatbermanfaat.Biakanurinedapatpositifdalamminggu
kedua.Specimenfesesjugaharusdiambilberulangulang.Padademementeric,
fesesakanmemberikanhasilpositifmulaiminggukeduaatauketiga,pada
enterokolitisselamaminggupertama.Biakanpositifdaridrainaseduodenum
menunjukkanadanyasalmonelladitraktusbilliardpadaorangcarrier.
MetodebakteriologiuntukisolasiSalmonella
Biakanpadamediumdiferensial:MediumEMB,MacConkeyataudeoksikolat
memungkinkandeteksicepatorganismeyangtidakmemfermentasilaktosa.
OrganismeGrampositifsedikitdihambat.MediumBismuthsulfit
memungkinkandeteksicepatSalmonellayangmembentukkolonihitamkarena
produksiH2S.
Biakanpadamediumselektif:bahanditanampadalempengagarSS
(SalmonellaShigella).AgarHektoenatauagardeoksikolatsitrat,merupakan
tempatSalmonelladanShigellaakantumbuhsubur,melebihiorganisme
Enterobacteriaceaelainnya.
Biakanpadamediumdiperkaya:bahan(biasanyatinja)diletakkankedalam
kalduselenitFataukaldutetrationat,keduanyamenghambatbakteriusus
normaldanmemungkinkanperkembangbiakanSalmonella.Setelah
pengeramanselama12hari,biakaniniditanamipadaperbenihandiferensial
danselektif.
IdentifikasiAkhir:kolonipadaperbenihanpadatyangdicurigaidiidentifikasi
dengantesbiokimiadantesaglutinasidenganserumspesifik.
MetodeSerologi
Teknikserologidigunakanuntukmengidentifikasibiakanyangtidakdiketahui
denganserumyangdiketahui,dandapatjugadipergunakanuntukmenentukan
titerantibodypadapenderitayangtidakdiketahuipenyakitnya,meskipunyang
https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

7/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

belakanganinitidakbegitubermanfaatdalamdiagnosisinfeksiSalmonella.
Tesaglutinasimikroskopikcepat:dalamtesini,serumyangdiketahui
dicampurdenganbiakanyangtidakdiketahuipadakacaobjek.Penggumpalan,
bilainiterjadidapatdilihatdalambeberapamenit.Tesinikhususnya
bermanfaatuntukidentifikasipendahuluanbiakansecaracepat.
Tesaglutinasipengencerantabung(teswidal):Aglutininserummeningkat
dengancepatselamaminggukeduadanketigapadainfeksiSalmonella.
Sekurangkurangnyadiperlukanduabahanserum,yangdiperolehdengan
selangwaktu710hariuntukmembuktikanadanyakenaikantiterantibody.
Serumyangtidakdikenaldiencerkanberturutturut(duakalilipat)laludites
terhadapantigenSalmonella.Hasilnyaditafsirkansebagaiberikut:
a)TiterOyangtinggiataukenaikantiterO(1:160)menunjukkanadanya
infeksiaktif.
b)TiterHyangtinggi(1:160)menunjukkanbahwapenderitaitupernah
divaksinasiataupernahterinfeksi.
c)TiterViyangtinggiterdapatpadabeberapapembawabakteri.
HasiltesserologicuntukpenderitaSalmonellaharusdiinterprestasikansecara
hatihati.Kemungkinanadanyaantibodyreaksisilangmembatasipenggunaan
serologidalamdiagnosisinfeksiSalmonella.
2.2.6ResistensidanImunitas
InfeksiolehSalmonellaTyphiatauSalmonellaParatyphibiasanyamenimbulkan
imunitasdalamtingkattertentu.Infeksiulangdapatterjadibiasanyalebih
ringandaripadainfeksipertama.AdanyaantiboditerhadapOdanVidalam
sirkulasiberhubungandenganresistensiterhapatpenyakitdaninfeksi.Namun,
kekambuhandapatterjadidalam23minggusetelahpenyembuhanmeskipun
telahterbentukantibodi.AntibodiIgAsekretorikdapatmencegahpenempelan
salmonelapadaepitelusus.
OrangdenganhemoglobinS/S(penyakitselsabit)sangatrentanterhadap
infeksisalmonella,terutamaosteomielitis.OrangdenganhemoglobinA/S(ciri
selsabit)mungkinlebihrentandaripadaindividunormal(orangdengan
hemoglobinA/A).
2.2.7Pengobatan
Demamenterikdanbakteremiadenganlesifokalmemerlukanterapi
antimikroba,sedangkansebagianbesarkasuseterokolitistidakmembutuhkan
terapitersebut.Terapiantimikrobaterhadapenteritissalmonelapadaneonatus
sangatpenting.Padaenterokolitis,gejalaklinisdaneksresisalmoneladapat
menjadilebihlamaolehterapiantimikroba.Penggantiancairandanelektrolit
sangatpentinguntukdiarebarat.
Tetapiantimikrobaubtukinfeksisalmonelayanginvasifadalahdengan
menggunakanampisilin,trimetroprimsulfametoksazon,atausefalosporin
generasiketiga.Resistansiterhadapbanyakobatyangditransmisikansecara
genetikolehplasmidberbagaibakterienterikmerupakanmasalahpadainfeksi
salmonela.Ujisensitivitasmerupakanpemeriksaanpenunjangyangpenting
untukmemilihantibiotikyangsesuai.
https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

8/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

Padasebagianbesarcarrier,organismemenetapdikandungempedu(terutama
jikaterdapatbatuempedu)dandisaluranempedu.Beberapacarrierkronik
dapatdiobatihanyadenganmenggunakanampisilin,tetapipadakebanyakan
kasuskolesistektomiharusdikombinasikandenganterapiobat.
2.2.8Epidemologi
Fesesyangberasaldariorangtidakdicurigaimengidappenyakitsubklinisatau
carriermerupakansumberkontaminasiyanglebihpentingdaripadakasus
klinisyangjelassegeradiisolasi;misal,bilacarrieryangbekerjasebagai
pengelolamakananakanmengeluarkanorganismeitu.Banyakhewan,
termasukhewanternak,binatangpengerat,danunggas,secaraalamiterinfeksi
denganberbagaisalmoneladanmengandungbakterisalmonelayangtinggi
padaayamkemasantelahdipublikasikansecaraluas.
Carrier
Setelahinfeksinyataatausubklinis,beberapaindividuterusmenyimpan
salmoneladidalamjaringannyaselamawaktuyangtidaktentu.Tigapersen
individuyangsembuhdaritifoidmenjadicarrierpermanen,mempunyai
organismedidalamkandungempedu,saluranempedu,ataukadangkadangdi
dalamususatausalurankemih.
SumberInfeksi
Sumberinfeksiadalahmakanandanminumanyangterkontaminasidengan
salmonela.Berikutadalahsumbersumberinfeksiyangpenting:
1. Air,kontaminasidenganfesesseringmenimbulkanepidemikyangluas.
2. Susudanproduksusulainnya(eskrim,keju,puding),kontaminasidengan
fesesdanpaterurisasiyangtidakadekuatataupenangananyangsalah.
Beberapawabahdapatditelusurisampaisumberkumannya.
3. Kerang,dariairyangterkontaminasi.
4. Telurbekuataudikeringkan,dariunggasyangterinfeksiatau
terkontaminasisaatpemrosesan.
5. Dagingdanprodukdaging,darihewanyangterinfeksi(ternak)atau
kontaminasiolehfesesmelaluihewanpengeratataumanusia.
6. Obatrekresai,mariyuanaatauobatlainnya.
7. Pewarnahewan,pewarnaan(misal,carmine)digunakanuntukobat,
makanan,dankosmetik.
8. Hewanpiaraan,kurakura,anjing,kucing,dll.
2.2.9PencegahandanPengendalian
Tindakansanitasiharusdilakukanuntukmencegahkontaminasimakanandan
airolehhewanpengeratatauhewanlainyangmengeluarkansalmonela.Hewan
ternak,daging,danteluryangterinfeksiharusdimasaksampaimatang.Carrier
tidakbolehdiizinkanbekerjasebagaipemegangmakanandanmerekaharus
melakukantindakanpencegahanhigienisyangketat.
DuainjeksisuspensiSalmonellaTyphiyangdimatikandenganaseton,diikuti
olehinjeksiboosterbeberapabulankemudian,memberikanresistensiparsial
terhadapinokulumbasiltifoidyangkeciltetapitidakterhadapinokulumyang
besar.PemberianstrainmutanSalmonellaTyphiyangtidakvirulensecaraoral

https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

9/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

memberikanperlindunganyangbermaknadidaerahdenganedemisitastinggi.
Vaksinterhadapsalmonelalainkurangmemberiperlindungandantidak
dianjurkan.
2.3BaktetiBatangGramNegatifPseudomonas
2.3.1Definisi
KumanPseudomonasberbentukbatangbergerakdanmenghasilkanpigmen
yangmudahlarutdalamairdanberdifusididalammediumpertumbuhan.
Kumaniniterdapatbanyakpadatanah,sampah,airdanudara.Diantara30
speciesdariPseudomonasyangdiketahiuihanyasatuyangpathogenterhadap
hewandanmanusiayaituPseudomonasaeruginosa.Sedillet(1850)seorangahli
bedahPerancissudahmelihatadanyaeksudatyangberwarnabirukehijauan
padapakaianpakaianoperasi.Fordas(1860)dapatmengisolasiKristaldarikain
linenyangterkenalukabernanahdanmenamakannyapyocianine.Gessard
dapatmengisolasipenyebabnyadanterusdipelajarinyasampaitahun1882
1925.
2.3.2MorfologidanIdentifikasi
Kumaniniberbentukbatangpendeklurusataubengkok.Ukuran0,513
mikron.Bergerakaktifdengansatuataulebihflagelladanflagellanyaterletak
padakeduaujungkuman.TidakbersporadantidakberselubungsertaGram().
SifatpertumbuhanPseudomonasaeruginosapada3742C,pertumbuhanpada
42CmembantumembedakannyadarispesiesPseudomonaspadakelompok
fluoresenbersifatoksidasepositif.
SifatBiakantumbuhaerob,membentukpigmenbirukehijauandandalam
keadaananaerobtidakmembuatpigmen.Tumbuhdimediabiasa,dimedia
padatbentukkolonibesartidakteratur,abuabugelapdanterlihatadanya
untaianpadatepinya.Pigmendisebarkandalammediumpertumbuhan.
Pseudomonasaeruginosabersifataerobikobligatyangtumbuhdengancepat
padaberbagaitipemedia,kadangmemproduksibaumanissepertiangguratau
jagung.
2.3.3KlasifikasiPseudomonas
Kingdom:Bacteria
Phylum:Proteobacteria
Class:GammaProteobacteria
Order:Pseudomonadales
Family:Pseudomonadaceae
Genus:Pseudomonas
Species:Pseudomonasaeruginosa
2.3.4StrukturAntigendanToksin
Pseudomonasaeruginosamemiliki2macamantigenyaituantigenHdan
antigenOdanpalingsedikitada7tipeantigenPseudomonasaeruginosayang
telahditetepkan.Lipopolisakaridamenentukankekhususanantigen.Vaksin
https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

10/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

daritipetipeiniyangdiberikanpadapenderitahighriskakanmemberikan
perlindunganterhadapsepsisPseudomonas10harikemudian.Pengobatan
sepertiinidiberikanpadakasuskasusleukemia,lukabakar,fibrosiskristikdan
penekananimmune.
BanyakgalurPseudomonasaeruginosamemproduksieksotosinAyang
menyebabkanjaringannekrosisdanjikabentukmurnidisuntikkanpada
binatangdapatmematikan.Toksinmembloksintesisproteindengansebuah
mekanismeyangidentikdengantoksindifteria,meskipunstrukturkeduatoksin
tidakidentik.AntitoksinterhadapeksotoksinAditemukandibeberapaserum
manusia,termasukpadapasienyangsembuhdariinfeksiPseudomonas
aeruginosa.
2.3.5Patogenesis
Pseudomonasaeruginosamenjadipatogenikhanyajikaberadapadatempat
dengandayatahantidaknormal,misalnyadiselaputlenderdankulityang
rusakakibatkerusakanjaringan:jikamenggunakankateterpembuluhdarah
atausalurankencing,ataupadaneutropeniasepertikemoterapikanker.Bakteri
menempeldanmenyerangselaputlendirataukulit,menyebardanberakibat
penyakitsistemik.
2.3.6Patologi
FaktoryangmenentukandayapatogenadalahLPSmiripdenganyangadapada
Enterobacteriaceae;eksotoksinA,suatutransferasaADPribosamiripdengan
toksindifteriyangmenghentikansintesisproteindanmenyebabkannekrosisdi
dalamhati;eksotoksinSyangjugamerupakantransferasaADPribosayang
mampumenghambatsintesisproteineukariota.
Produksienzimenzimdantoksintoksinyangmerusakbarriertubuhdanselsel
inangmenentukankemampuanPseudomonasaeruginosamenyerangjaringan.
EndotoksinP.aeruginosasepertiyangdihasilkanbakterigramnegatiflain
menyebabkangejalasepsisdansyokseptik.EksotoksinAmenghambatsintesis
proteineukariotikdengancarakerjayangsamadengancarakerjatoksindifteria
(walaupunstrukturkeduatoksininitidaksama)yaitukatalisispemindahan
sebagianADPribosildariNADkepadaEF2.
2.3.7GambaranKlinis
Kumaninidapatmenginfeksitratusuregenitalis,septicemia,ulcuscornea,
gastroenteritispadaanakanakdanmeningitis.Pseudomonasaeruginosa
menybabkaninfeksipadalukabakarmenghasilkannanahberwarnahijaubiru.
Penyeranganpadasalurannafaskhususnyarespiratoryangtercemar
mengakibatkanpneumonianekrotika.Bakteriseringditemukanpadaotitis
ekternaringanpadaperenang.Infeksipadamata,yangmengarahpada
kerusakanmatadengancepat,biasanyaterjadisesudahlukaatauoperasimata.
SebagianbesarinfeksiPseudomonasaeruginosa,gejaladantandanyatidak
spesifikdanberkaitandenganorganyangterserang.
2.3.8UjiLaboratoriumDiagnostik
1. Spesimen:Spesimendarilukakulit,nanah,darah,cairanspinal,sputung
danbagianlaindiambilsesuaitempatinfeksi.
2. Hapusan:Batanggramnegatifseringdilihatpadahapusan.Tidakada
karakteristikmorfologispesifikyangmembedakanPseudomonasdari
https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

11/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

enterikataubatanggramnegatiflain.
3. Biakan:Spesimenditanampadalempengagardarahdanmediadeferensial
yangbiasanyadigunakanuntukmembiakanbakteribatanggramnegatif
enterik.Pseudomonasaeruginosatidakmeragikanlaktosadanmudah
dibedakandaribakteriperagilaktosa.Pembiakanmerupakantesspesifik
daridiagnosisinfeksiPseudomonasaeruginosa.

2.3.9ResistensidanImunitas
o
Kumaninisensitiveterhadapdesinfektanbiasadanpadapemanasan55 C,
dalam1jammati.Kumaninidapatmencairkangelatindantidakmembentuk
H2S.Indol()dankadangkadangterjadifalseindol(+),haliniterjadibila
dipakaireagensiaEhrlichdansebaiknyamemakaireagensiadariKovac.Tidak
memecahurea.Pseudomonasaeruginosayangbarudiisolirdarijaringantubuh
mampumembentui2macampigmen,yaitu:
Pyocinineadalahberwarnahijaukebiruanyangdapatlarutdalamairdan
chloroformdanmempunyaikemampuanantijasadrenik
Fluorescineberwarnakehijauhijauan,berfluoresensi,larutdalamairdan
tidaklarutdalamchloroform.
2.3.10PenyakitpadaManusia
Pseudomonasaeruginosatersebarluasdiduniadanterdapatditanah,sampah,
airdanudara.Pseudomonasaeruginosadapatberadapadaorangsehat,dimana
bersifatsaprofit.Inimenyebabkanpenyakitpadamanusiadenganketahanan
tubuhyangtidaknormal.Infeksipadamanusiaadalahkarenakulittercemar
olehPseudomonasaeruginosadanadanyapredisposisisepertilecetatauberupa
lukalukatusuk.
2.3.11Pengobatan
Pseudomonasaeruginosameningkatsecaraklinikkarenaresistenterhadap
berbagaiantimikrobadanmemilikikemampuanuntukmengembangkantingkat
MultiDrugResistance(MDR)yangtinggi.DefinisidariMDRPA(MultiDrug
ResistancePseudomonasaeruginosa)adalahresistenpalingtidakterhadap3
antimikrobayaitukelaslaktam,carbapenem,aminoglikosida,dan
fluoroquinon.
P.aeruginosatidakbolehdiobatidenganterapiobattunggalkarenatingkat
keberhasilanrendahdanbakteridengancepatjadiresisten.Polakepekaan
bakteriinibervariasisecarageografik.Maka,diperlukanteskepekaansebagai
pedomanuntukpemilihanterapiantimikroba.Penisillinbekerjaaktifterhadap
P.aeruginosaantaralain:tikarsilin,mezlosilin,danpipeasilindigunakan
dengandikombinasikanbersamaaminoglikosidabiasanyagentamisin,
tobramisin/amikasin.ObatlainyangaktifterhadapP.aeruginosaantaralain
aztreonam;imipinem;kuinolonbaru,termasuksiprofloksasin.Sefalosporin
generasibaru,seftazidimdansefoperaksonaktifmelawanP.aeruginosa.
SeftazidimdigunakansecaraprimerpadaterapiinfeksiP.aeruginosa.
2.3.12EpidemiologidanPengendalian

https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/
12/22
Pseudomonasaeruginosamerupakansebuahpathogennosokomialutama,dan

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

Pseudomonasaeruginosamerupakansebuahpathogennosokomialutama,dan
metodeuntukmengontrolinfeksimiripdenganpathogennosokomiallain.
KarenaPseudomonastumbuhcepatdalamlingkunganyanglembab,perhatian
khususseharusnyadiberikanpadabakcuci,bakmandi,penangasair,shower
danareabasahlainnya.Untuktujuanepidemiologik,galurbiasdibedakan
berdasarkanpiosindanserotypelipopolisakarida.
Vaksindaritipeyangtepatpadapasiendenganresikotinggi,dapatmencegah
sepsisakibatPseudomonas.Pengobatansepertiitusudahdigunakansebagai
percobaanpadapasiendenganleukemia,lukabakar,kistikfibrosis,dan
imunosuppresi.
Pseudomonasaeruginosaseringkalimerupakanfloranormalyangmelekat
padatubuhkitadantidakakanmenimbulkanpenyakitselamapertahanan
tubuhnormal.Karenaitu,upayapencegahanyangpalingbaikadalahdengan
menjagadayatahantubuhagartetaptinggi.Upayapencegahanpenularan
penyakitpadapasienyangdirawatdirumahsakitdilakukandengancarakerja
steril/aseptisyangdilakukanolehsetiappersonilrumahsakit(medisdan
paramedis)denganpenuhrasatanggungjawab.

2.4BakteriBatangGramNegatifShigella
Habitataslishigellaterbataspadasalurancernamanusiadanprimatalain,
tempatorganismeinimenimbulkandisenteribasilar.
2.4.1MorfologidanIdentifikasi
1. Cirikhasorganisme
Shigellaadalahbatanggramnegatifyangrampingbentukkokobasilditemukan
padabiakanyangmuda.
1. Biakan
Shigellabersifatfakultatifanaerobtetapitumbuhpalingbaiksecaraaerob.
Koloniberbentukkonveks,bulat,transparandengantepiyangutuhdan
mencapaidiametersekitar2mmdalam24jam.
1. Sifatpertumbuhan
Shigellamembentukasamdarikarbonhidrattetapijarangmenghasilkangas.
Organismeinijugadapatdibagimenjdiorganismeyangmemfermentasikan
manitoldantidakmemfermentasikanmanitol.
2.4.2StrukturAntigen

Shigellamemilikistrukturantigenyangkompleks.Terdapattumpangtindih 13/22
https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

Shigellamemilikistrukturantigenyangkompleks.Terdapattumpangtindih
padasifatserologikberbagaispesies,dansebagianorganismememilikiantigen
Oyangsamadenganbasilenteriklain.AntigenOsomatikshigellaadalah
lipopolisakarida.

2.4.3PatogenesisdanPatologi
Infeksishigellahampirslaluterbatasdisalurancernajarangterjadiinvasike
alirandarah.Prosespatologiyangpalingpentingadalahinvasikeselepitel
mukosa(misal,selM),denganmenginduksifagositosis,keluardarivakuola
fagositik,bermultiplikasidanmenyebardidalamsitoplasmaselepitel,dan
menyebarkeselyangadadidekatnya.Mikroabsesdidindingususbesardan
ileumterminalmenyebabkannekrosismembranmukosa,ulserasisuprfisial,
perdarahandanmembentukpseudomembranpadadaerahulserasi.
Pseudomembraniniterdiridarifibrin,lekosit,debrissel,membranmukosa
yangnekrotik,danbakteri.
2.4.4Toksin
Endotoksin
Padaautolisis,semuashigellamelepaskanlipopolisakaridayangtoksik.
Endotoksininikemungkinanyangberperanmenimbulkaniritasipadadinding
usus.
Eksotoksinshigelladysenterae
Sdysenteriaetipe1(basilshiga)menghasilkaneksotoksinyangtidaktahan
panasyangdapatmengenaiususdansistemsarafpusat.Eksotoksininiadalah
proteinyangbersifatantigenik(merangsangproduksiantitoksin)danbersifat
mematikauntukhewanpercobaan.Sebagienterotoksin,zatinimenimbulkan
diaresepertiverotoksinEcoli.Padamanusiaenterotoksinmenghambat
reabsorsiguladanasamaminodiusushalus.Aktifitasyangbersifattoksikini
berbedadengansifatinvasifshigellapadadisentri.
2.4.5GambaranKlinik
Setelahmasainkubasiyangpendek(12hari),secaramendadaktimbulrasa
nyeriperut,demam,dandiarecair.Diareinidisebabkanolehkerjaenterotoksin
diusushalus.Sehariataubeberapaharikemudian,ketikainfeksimengenai
ileumdankolom,jumlahfesesmeningkat.Feseslebihkentaltetapisering
mengandunglendirdandarah.PenyakityangdisebabkanolehSdysenterae
kadangkadangdapatsangatparah.
Padapemulihan,kebanyakkanorangmengeluarkanbasildisentridalamwaktu
singkat,tetapibeberapaorangtetapmenjadicarrierususkronikdandapat
mengalamiseranganpenyakitsecaraberulang.Setelahsembuhdariinfeksi,
kebanyakanorangmembentukantibodisirkulasiterhadapshigella,tetapi
antibodiinitidakmencegahterjdiinfeksiulang.
2.4.6UjiDiagnostikLaboratorium
Spesimen.

https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/
Fesessegar,lendir,danusapanrektumdapatdigunakanuntukbiakan.

14/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

Fesessegar,lendir,danusapanrektumdapatdigunakanuntukbiakan.
Ditemukanbanyakleukositpadafesesdankadangkadangjugaditemukan
beberapaseldarahmerahpadapemeriksaanmikroskopik.Spesimenserum,
apabiladibutuhkan,harusdiambildenganjarak10hariuntukmelihatkenaikan
titerantibodiaglutinasi.
Biakan
Bahandigoreskanpadamediumdiferensial(misalnya,agarMacConkeyatau
EMB)danmediumefektifyangmenekanEnterobacteriaeceaelaindan
organismegrampositif.Koloniysngtidakberwarna(laktosanegatif)
diinokulasipadaagartripletgulabesi.Organismeyangtidakmenghasilkan
H2S,yangmenghasilkanasamtetapitidakmenghasilkangaspadapangkaldan
bagianmiringyangbasadimediumagartripletgulabesi,dantidakmotil
sebaiknyadilakukanpemeriksaanaglutinasislidedenganantiserumspesifik
shigella.
Orangnormalseringmemilikiaglutininterhadapbeberapaspesiesshigella.
Namun,serangkaianpenentuantiterantibodidapatmenunjukan
peningkatanantibodiyangspesifik.Serelogitidakuntukdigunakan
mendiagnosisinfeksishigella.

2.4.7Imunitas
Infeksidiikutiolehresponsantibodispesifiktipe.Injeksishigelayangtelahmati
merangsangproduksiantibodidiserumtetapitidakdapatmelindungimanusia
dariinfeksi.antibodiIgAdiususmungkinpentingdalammembatasiinfeksi
ulang,antibodiinidapatdistimulasidenganpemberianstrainshigelahidup
yangtelahdilemahkanmelaluioralsepertivaksinpercobaan.Antibodiserum
terhadapantigensomatikshigellaeadalahIgAM.
2.4.8Pengobatan
Siprofloksasin,ampisilin,doksisiklin,dantrimetoprimsulfametoksazol
merupakaninhibitoryangpalingseringuntukisolatshigelladandapat
menekanseranganklinisdisentriakutdanmemperpendekdurasigejala.Obat
obattersebutmungkintidakdapatmembasmioeganismetersebutdarisaluran
cerna.Resistansiterhadapbanyakobatdapatditransmisikanolehplasmid,dan
infeksiyangresistantelahmenyebarluas.Banyakkasusyangdapatsembuh
sendiri.Pemberianopioidsebaiknyadihindarkanpadadisenterishigella.
2.4.9Epidemologi,Pencegahan,danPengendalian
Shigeladitularkanmelaluimakanan,jari,feses,danlalatdarisatukeorang
lain.Kebanyakankasusinfeksishigelaterjadipadaanakberusia10tahun.S
dysenteriaedapatmenyebarluas.Kemoprofilaksismassalselamaperiode
tertentu(misal,padapersonelmiliter)telahdicoba,tetapistrainshigellayang
resistencenderungmunculdengancepat.Karenamanusiaadalahpejamu
utamashigelapatogenyangtelahdiketahui,usahapengendalianharus
ditujukanuntukmengeliminasiorganismedarireservoirdengancara:
(1)pengendaliansanitasiair,makanan,danusus,pembersihansaluranair,dan
pengendalianlalat.
(2)isolasipasiendandisinfeksiekskreta.
https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

15/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

(3)deteksikasuskasussubklinisdancarrier,terutamapengelolamakanan
(4)terapiantibiotikpadainduvituyangterifeksi.
2.5BakteriBatangGramNegatifVibrio
2.5.1MorfologidanIdentifikasi
1. ciriorganisme:V.Choleraeberbentukkoma,batangkurvadenganpanjang
24mikro.Motilaktifdikarenakanmemilikiflagelapolar.Vibriobisa
menjadibatangyanglurusyangmiripdenganbakterienterikgramnegatif.
2. Kultur:V.Choleraemenghasilkankoloniyangcembung,halusdanbulat
keruh(opaque)danbergranulbiladisinari.Tumbuhdenganbaikpadasuhu
o
37 Celciuspadaberbagaijenismedia,yangmengandunggarammineral
sebagaisumberkarbondannitrogen.
3. SifatPertumbuhan:V.Choleraebiasanyamemfermentasisukrosadan
manosa.Tesoksidasepositifmerupakanlangkahkuncidalamidentifikasi
dariV.Cholerae.Sebagianspesiesadalahhalototerant,danNaClsering
menstimulasipertumbuhannya.Beberapadiantaranyabersifathalofilik,
membutuhkankehadiranNaCluntukpertumbuhan.
2.5.2PatogenesisdanPatologi
V.choleraeadalahpatogenterhadapmanusia.Jikamediatoradalahmakanan
sebanyak102104organismediperlukan,karenakapasitasbuferyangcukup
darimakanan.Beberapapengobatandapatmenurunkankadarasamdalam
perutmembuatseseoranglebihsensitifterhadapinfeksiV.Cholerae.
Kolerabukanmerupakaninfeksiyanginvasif.Tidakmencapaialirandarah
tetapitetapdidalamsaluranusus.V.Choleraeyangvirulenmenempelpada
mikrovilipermukaanselepitelial.Disanamerekaakanmemperbanyakdan
melepaskanracunkolera.
2.5.3Gambaranklinis
Sekitar60%infeksiyangdisebabkanolehV.choleraecenderungtidakbergejala.
Periodeinkubasiselama14hariuntuksampaitimbulgejala.Gejalayangtimbul
mual,muntah,sertadiarehebatdisertaikramperut.Tinjayangmiripcucian
beras(ricewaterstool)mengandungmukus,selepitel,dansejumlahbesar
vibrio.Penderitaakankehilangancairandanelektrolitdengancepatyangdapat
mengarahpadadehidrasiberat,syok,dananuria.Tingkatkematiandengan
tanpapengobatanadalah25%dan50%.Bagaimanapunkasusberatdanringan
tidakmudahdibedakandaripenyakityanglain.
2.5.4UjiLaboratoriumDiagnostik
a.Spesimen:spesimenuntukkulturterbentukdarigumpalanmukusdaritinja.
b.Hapusan:pengamatandenganmikroskoplapangangelapataufasekontras
memperlihatkanvibrioyangmotildengancepat.
c.Kultur:beberapapemeriksaantinjadapatdiinkubasiselama68jamdalam
kaldutaurocholatepeptone(pH8,09,0).Organismedarikulturinidapat
diwarnaiataudisubkultur.

https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/
d.UjiSpesifik:organismeV.Choleraediidentifikasilebihjauhdenganuji

16/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

d.UjiSpesifik:organismeV.Choleraediidentifikasilebihjauhdenganuji
aglutinasislidemenggunakanantiOkelompokantiserumO1dan0139dan
denganreksibiokimia.

2.5.5Kekebalan
Asamlambungmenyediakanbeberapaperlidungandalammelawankolera
vibrio.Setiapserangankoleradiikutidengankekebalanterhadapinfeksi,tetapi
durasisertaderajatkekebalantidakdiketahui.Antibodiyangmiripdalam
serumakanmunculsetelahinfeksitetapihanyabertahanselamabeberapa
bulan.Kehadiranantibodiantitoksintidakdihubungkandenganperlindungan.
2.5.6Resistensi
WabahkoleradisebabkanolehVibriocholeraO1racundanO139(Benggala
regangan)merupakanmasalahkesehatanmasyarakatyangutamadi
kebanyakannegaraberkembang.Mengingatpergeseranyangdilaporkandalam
epidemiologidanpolaresistensiantibiotikpadapenelitianinidilakukanuntuk
menilaiperkembanganresistensiterhadapobatesensialseperti
fluoroquinolonesselamapengobatankolera.
Spesimentinjayangdikumpulkandari1184pasiendengan
kolera.KerentananpengujianantimikrobaisolatV.choleraedilakukandengan
metodedifusi.Dari1184sampelfesesdiperiksa,670(56,6%)positifuntukV.
kolera20012006.V.choleraeElTorOgawa(54,6%)adalahlebihumumdari
serotipeInaba(32,5%).Selama20042006V.choleraeInabamunculsebagai
serotipedominan.Ketahananterhadapasamnalidiksat,furazolidondan
kotrimoksasolterusmenerustinggi(100%).Resistensiantibiotikganda(MAR)
V.choleraeO1Inabaisolatmenunjukkanpeningkatanresistensiterhadap
ciprofloxacindenganMIC>4mcg/ml,tetapisebagianbesarsemuatetaprentan
terhadapantibiotiklainseperti,gentamisin,tetrasiklindankloramfenikol.V.
choleraememilikikeberadaanpermanendilingkungandanselamaperiode
diam,kelangsunganhidupmerekadalambadanairmemungkinkandisipasi
polaresistensiterhadapserotipeyangberbedaataustrainV.choleraeO1dan
karenaituadakebutuhanuntukobservasikonstan.

2.5.7Penyakityangdisebabkanmikroorganismejenisini
Penyakitkolera(cholera)adalahpenyakitinfeksisaluranususbersifatakut
yangdisebabkanolehbakteriVibriocholerae,bakteriinimasukkedalamtubuh
seseorangmelaluimakananatauminumanyangterkontaminasi.Bakteri
tersebutmengeluarkanenterotoksin(racunnya)padasaluranusussehingga
terjadilahdiare(diarrhoea)disertaimuntahyangakutdanhebat,akibatnya
seseorangdalamwaktuhanyabeberapaharikehilanganbanyakcairantubuh
danmasukpadakondisidehidrasi.
PenyebaranPenularanPenyakitKolera
Koleradapatmenyebarsebagaipenyakityangendemik,epidemik,atau
pandemik.Meskipunsudahbanyakpenelitianbersekalabesardilakukan,
namunkondisipenyakitinitetapmenjadisuatutantanganbagidunia
https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

17/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

kedokteranmodern.BakteriVibriocholeraeberkembangbiakdanmenyebar
melaluifeaces(kotoran)manusia,bilakotoranyangmengandungbakteriini
mengkontaminasiairsungaidansebagainyamakaoranglainyangterjadi
kontakdenganairtersebutberesikoterkenapenyakitkoleraitujuga.
Misalnyacucitanganyangtidakbersihlalumakan,mencucisayuranatau
makanandenganairyangmengandungbakterikolera,makanikanyanghidup
diairterkontaminasibakterikolera,Bahkanairtersebut(sepertidisungai)
dijadikanairminumolehoranglainyangbermukimdisekitarnya.
GejaladanTandaPenyakitKolera
Padaorangyangfeacesnyaditemukanbakterikoleramungkinselama12
minggubelummerasakankeluhanberarti,tetapisaatterjadinyaserangan
infeksimakatibatibaterjadidiaredanmuntahdengankondisicukupserius
sebagaiseranganakutyangmenyebabkansamarnyajenisdiareygdialami.
Akantetapipadapenderitapenyakitkoleraadabeberapahaltandadangejala
yangditampakkan,antaralainialah:
Diareyangencerdanberlimpahtanpadidahuluiolehrasamulasatau
tenesmus.
Feacesataukotoran(tinja)yangsemulaberwarnadanberbauberubahmenjadi
cairanputihkeruh(sepertiaircucianberas)tanpabaubusukataupunamis,
tetapisepertimanisyangmenusuk.
Feaces(cairan)yangmenyerupaiaircucianberasinibiladiendapkanakan
mengeluarkangumpalangumpalanputih.
Diareterjadiberkalikalidandalamjumlahyangcukupbanyak.
Terjadinyamuntahsetelahdidahuluidengandiareyangterjadi,penderita
tidaklahmerasakanmualsebelumnya.
Kejangototperutbisajugadirasakandengandisertainyeriyanghebat.
Banyaknyacairanyangkeluarakanmenyebabkanterjadinyadehidrasi
dengantandatandanyaseperti;detakjantungcepat,mulutkering,lemahfisik,
matacekung,hypotensidanlainlainyangbilatidaksegeramendapatkan
penanganpengganticairantubuhyanghilangdapatmengakibatkankematian.
2.5.8Pengobatan
Penderitayangmengalamipenyakitkoleraharussegeramandapatkan
penaganansegera,yaitudenganmemberikanpengganticairantubuhyang
hilangsebagailangkahawal.PemberiancairandengancaraInfus/Dripadalah
yangpalingtepatbagipenderitayangbanyakkehilangancairanbaikmelalui
diareataumuntah.Selanjutnyaadalahpengobatanterhadapinfeksiyang
terjadi,yaitudenganpemberianantibiotik/antimikrobialsepertiTetrasiklin,
DoxycyclineataugolonganVibramicyn.Pengobatanantibiotikinidalamwaktu48
jamdapatmenghentikandiareyangterjadi.
Padakondisitertentu,terutamadiwilayahyangterserangwabahpenyakit
kolerapemberianmakanan/cairandilakukandenganjalanmemasukkanselang
darihidungkelambung(sonde).Sebanyak50%kasuskolerayangtergolang
https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

18/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

berattidakdapatdiatasi(meninggaldunia),sedangkansejumlah1%penderita
kolerayangmendapatpenanganankurangadekuatmeninggaldunia.
Bagianyangpalingpentingdalamterapiadalahmenggantiairdanelektrolit
untukmengurangidehidrasidankekurangangaram.Tetrasiklindapat
mengurangikeluarnyatinjapadakoleradanmemperpendekmasaekskresi
vibrio.
2.5.9Epidemiologi,PencegahandanPengendalian
KasusyangpalingbesarterjadidiAfrika,dimanajutaanorangmenderitakolera
danberlanjuthinggaabadke21.PenyakitinimulaijarangdiAmerikaUtara
sejakpertengahantahun1800an,tetapifokusendemiktetapadadiPantaiGulf
LouisianadanTexas.
Penyakitinimenyebarmelaluikontakorangkeorangyangmelibatkanindividu
yangmenderitaringanatauawaldanmelaluiair,makanandanserangga.
Pengidapitusendirimencapaipuncaknyaselama34minggu,danpengidap
yangbenarbenarkronisjarangterjadi.Vibriodapatbertahanhidupdalamair
hingga3minggu.
Carapencegahandanmemutuskantalipenularanpenyakitkoleraadalah
denganprinsipsanitasilingkungan,terutamakebersihanairdanpembuangan
kotoran(feaces)padatempatnyayangmemenuhistandarlingkungan.Lainnya
ialahmeminumairyangsudahdimasakterlebihdahulu,cucitangandengan
bersihsebelummakanmemakaisabun/antiseptik,cucisayurandanganair
bersihterutamasayuranyangdimakanmentah(lalapan),hindarimemakan
ikandankerangyangdimasaksetengahmatang.
Biladalamanggotakeluargaadayangterkenakolera,sebaiknyadiisolasidan
secepatnyamendapatkanpengobatan.Bendayangtercemarmuntahanatau
tinjapenderitaharusdisterilisasi,searanggalalat(vektor)penularlainnya
segeradiberantas.Pemberianvaksinasikoleradapatmelindungiorangyang
kontaklangsungdenganpenderita.
Kontroldanpengawasandilakukanmelaluipendidikandanperbaikan
sanitasi,khususnyamakanandanair.Pasiendiisolasi,ekskresinyadidesinfeksi,
danorangorangkontakdiawasi.Penyuntikanvaksinberulangmengandung
ekstraklipopolisakaridadapatmemberikanperlindunganyangterbataske
orangyangrentan,tetapitidakefektifsebagaialatkontrolepidemik.

https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

19/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

BABIII
PENUTUP
3.1Kesimpulan
Bakterigramnegatifadalahbakteri(http://id.wikipedia.org/wiki/Bakteri)yang
tidakmempertahankanzatwarna(http://id.wikipedia.org/wiki/Zat_warna)
kristalviolet(http://id.wikipedia.org/w/index.php?
title=Kristal_violet&action=edit&redlink=1)sewaktuprosespewarnaanGram
(http://id.wikipedia.org/wiki/Pewarnaan_Gram)sehinggaakanberwarnamerah
biladiamatidenganmikroskop(http://id.wikipedia.org/wiki/Mikroskop).
Bakterigramnegatif(sepertiE.coli(http://id.wikipedia.org/wiki/E._coli))
memilikisistemmembrangandadimanamembranpasmanyadiselimutioleh
membranluarpermeabel(http://id.wikipedia.org/w/index.php?
title=Permeabel&action=edit&redlink=1).Bakteriinimempunyaidindingsel
tebalberupapeptidoglikan,yangterletakdiantaramembrandalamdan
membranluarnya.
Enterobacteriaceaeadalahkelompokbatanggaramnegatifyangbesardan
heterogen;denganhabitatalaminyadisalurancernamanusiadanhewan
familinyamemilikibanyakgenus(Escherichia,shigela,salmonella,enterobakter,
klebsiela,serratia,proteus,danlainlain).Bakteriinidikatakanpatogenkarena
tidakmemfermentasilaktosapadasaluranintestine.Bakteritersebutdiantaranya
adalahSalmonella,Shigella,Pseudomonas,danVibrio.
Salmonelaumumnyabersifatpatogenuntukmanusiaatauhewanbilamasuk
melaluimulut.Organismeiniditularkandarihewandanprodukhewanke
manusia.Salmonellasp.adalahbakteribatanglurus,gramnegatif,
tidakberspora,bergerakdenganflagelperitrik,berukuran24mx0.50,8m.
Salmonellasp.tumbuhcepatdalammediayangsederhana,hampirtidak
pernahmemfermentasilaktosadansukrosa,membentukasamdankadanggas
dariglukosadanmanosa,biasanyamemporoduksihidrogensulfideatauH2S,
padabiakanagarkoloninyabesarbergaristengah28milimeter,bulatagak
cembung,jernih,smooth,padamediaBAPtidakmenyebabkanhemolisis.
Bakteriinimenyebabkanpenyakitdemanenterik(demamtifoid),bakteremia
denganlesifokal,danenterokolitis.

https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/
KumanPseudomonasberbentukbatangbergerakdanmenghasilkanpigmen 20/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

KumanPseudomonasberbentukbatangbergerakdanmenghasilkanpigmen
yangmudahlarutdalamairdanberdifusididalammediumpertumbuhan.
Kumaniniterdapatbanyakpadatanah,sampah,airdanudara.Diantara30
speciesdariPseudomonasyangdiketahiuihanyasatuyangpathogenterhadap
hewandanmanusiayaituPseudomonasaeruginosa.Bakteriinimenyebabkan
penyakitpadamanusiadenganketahanantubuhyangtidaknormal.Infeksi
padamanusiaadalahkarenakulittercemarolehPseudomonasaeruginosadan
adanyapredisposisisepertilecetatauberupalukalukatusuk.
Shigellaadalahbatanggramnegatifyangrampingbentukkokobasilditemukan
padabiakanyangmuda.Habitataslishigellaterbataspadasalurancerna
manusiadanprimatalain,tempatorganismeinimenimbulkandisenteribasilar.
V.Choleraeberbentukkoma,batangkurvadenganpanjang24mikro.Motilaktif
dikarenakanmemilikiflagelapolar.Vibriobisamenjadibatangyanglurusyang
miripdenganbakterienterikgramnegatif.Kolerabukanmerupakaninfeksi
yanginvasif.Tidakmencapaialirandarahtetapitetapdidalamsaluranusus.V.
Choleraeyangvirulenmenempelpadamikrovilipermukaanselepitelial.Disana
merekaakanmemperbanyakdanmelepaskanracunkolera.
3.2Saran
Bakterimakhlukkecilyangjarangkitasadarikeberadaanya.Makajika
terjangkitsalahsatupenyakitdaribakterikitajanganmeremehkangejalaawal
yangdialamikarenaumumnyagejalaawalnyasangatbiasa.Karenajika
diremehkanbisasajamenjadiakut.Harusmengikutitahaptahappencegahan
yaitudenganmenjagakebersihandiri.Adapunsarandaripenulisyakni:
1.supayakitaselalumenjagakebersihanlingkunganhidupkitaagar
terhindardarikontaminasidenganbakteri.
2.Agarmewaspadaisejakdinipencegahandanpengobatanpenyakit.
3.DanyangpalingpentingadalahMencegahlebihbaikdaripada
mengobati.

DAFTARPUSTAKA
Anonim,Pseudomonas,http://en.wikipedia.org/wiki
(http://en.wikipedia.org/wiki)
http://semangatuntukperubahan.blogspot.com/2012/02/makalah
mikrobiologi.html
(http://semangatuntukperubahan.blogspot.com/2012/02/makalah
mikrobiologi.html)
http://ayu1508.wordpress.com/tag/batang/
(http://ayu1508.wordpress.com/tag/batang/)
http://Scrib.ac.id(http://scrib.ac.id/)
http://www.infopenyakit.com/2007/12/penyakitkoleracholera.html
(http://www.infopenyakit.com/2007/12/penyakitkoleracholera.html)
Brooks,Geo.F,dkk.2005.MIKROBIOLOGIKEDOKTERAN.Jakarta:SalembaMedika.
https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

21/22

4/18/2015

BAKTERIBATANGGRAMNEGATIF|nophienov

abbottS:Klebsiella,Enterobacter,Citrobacter,Serratia,PlesiomonasandOther
th
Enterobacteriaceae.In:ManualofClinicalMicrobiology,8 ed.MurrayPRetal
(editors).ASMPress,2003.
BoppCAetal:Escherichia,Shigella,andSalmonella.In:ManualofClinical
th
Microbiologi,8 ed.MurrayPRetal(editors).ASMPress,2003.
DupontHL:Shigellaspecies(bacillarydesentry).In:Mandell,Douglas,and
th
BennettssPrinciplesandPracticeofInfectiousdisease,5 ed.MandelGL,Bennett
JE,DorlinR(editors).ChurchillLivingstone,2000.
EisensteinBI,AzaleznikDF:Enterobacteriaceae.In:Mandell,Douglas,and
th
BennettssPrinciplesandPracticeofInfectiousdisease,5 ed.MandelGL,Bennett
JE,DorlinR(editors).ChurchillLivingstone,2000.
FarmerJJIII:EnterobacteriaceaeIntroductionandIdentification.In:Manualof
th
ClinicalMicrobiology,8 ed.MurrayPRetal(editors).ASMPress,2003.
MillerSI,PeguesDA:Salmonellaspecies,includingSalmonellatyphi.In:Mandell,
th
Douglas,andBennettssPrinciplesandPracticeofInfectiousdisease,5 ed.Mandel
GL,BennettJE,DorlinR(editors).ChurchillLivingstone,2000.
Gambar:www.google.com(http://www.google.com/)

MARCH2,2013BYNOVIEANTASARI
BLOGATWORDPRESS.COM.|THEFIORETHEME.
Follow

Follownophienov

RelatedSearches

BuildawebsitewithWordPress.com

?
OrangUtan
OpticalStores
PrescriptionEyeglasses
ColorContacts
DesignerGlasses
PrescriptionGlasses
PerbedaanGramPositifDanGramNegativePengertianBakteriHalofilikSerta
PembagianKelompokBerdasarkanKadarNacl
DesignerEyewear
ExteriorHousePainting
SingaporeZoo
AdvanceElite

https://nophienov.wordpress.com/2013/03/02/arahkebjakandanstrategipembangunankesehatanselamatahun20102014/

22/22