Anda di halaman 1dari 36

LBM 1

a. Judul : Bingung memilih metode kontrasepsi

STEP 1
1. kontrasepsi
Satu alat atau obat yg digunakan untuk mencegah terjadinya konsepsi atau
kehamilan
Kontra : mencegah konsepsi : pertemuan ovum dan sperma
2.FAM
Fibroadenoma : neoplasma jinak batas tegas Mobile biasanya ada pada wanita 25 th
Tumor berasal dari glandula dan fibrosa
3. Chlamydiasis
Infeksiyang disebabkan oleh chlamydiasp
STEP 2
1. Bagaimana fisiologi hormonal terkait dengan kontrasepsi?
2. apa saja jenis jenis kontrasepsi beserta masing2 keuntungan dan
kerugiannya?
3. apa saja yg harus dipertimbangkan dalam memilih kontrasepsi yang tepat?
4. pada pasien b apa hubungan pasien tsb memiliki riwayat operasi FAM dengan
pemilihan kontrasepsi?
5. tujuan dan syarat penggunaan kontrasepsi? Mekanisme dari efek samping
kontrasepsi?
6. apa hubungan kb dengan keadaan pada pasien A?
7. metode KB apa yang sesuai untuk pasien B yang sedang menyusui?
8. metode konseling kontrasepsi?
9. apakah ada interaksi griseofulvindengankb?

STEP 3
1. Bagaimana fisiologi hormonal terkait dengan kontrasepsi?

MEKANIS
ME KERJA KONTRASEPSI HORMONAL
1. Mekanisme Kerja Estrogen
a. Menekan ovulasi
Menekan ovulasi pd efek di hipotalamus mengakibatkan suppresi pd FSH & LH
kelenjar hypophyse. Penghambatan tampak tidak adanya estrogen pada pertengahan
siklus, tidak adanya puncak FSH dan LH pada pertengahan siklus.
b. Mencegah Implantasi
Keseimbangan estrogen-progesteron tidak tepat menyebabkan pola endometrium
abnormal sehingga menjadi tidak baik untuk implantasi. Implantasi dari ovum yang telah
di buahi dapat dihambat oleh estrogen dosis tinggi (diethylstil bestrol,ethinylestradiol ) di
berikan pertengahan siklus pd senggama yg tidak di lindungi ini disebabkan karena
tergaggunya perkembangan endometrium.

c. Mempercepat Transport gamet/ ovum


Transport gamet/ovum dipercepat oleh estrogen disebabkan efek hormonal pd
sekresi & peristaltik tuba serta kontraktilitas uterus.
d. Luteolysis
Degenerasi di corpus luteum menyebabkan penurunan cepat dari produksi
estrogen & progesteron progesteron di ovarium.
2. Mekanisme Kerja Progesteron :
a. Menghambat Ovulasi
Ovulasi dihambat karena terganggu fungsi proses hipotalamus, hypophyse,
ovarium & modifikasi dari FSH & LH pada pertengahan siklus.
b. Menghambat Implantasi
1) Implantasi dapat dicegah bila di berikan progesteron pra-ovulasi.
2) Pemberian progesteron,eksogenous (di luar jadwal) dapat menganggu kadar puncak
FSH & LH, walaupun terjadi ovulasi produksi progesteron yang berkurang dari corpus
luteum menghambat implantasi
3) Pemberian progesteron secara sistemik untuk jangka panjang / lama menyebabkan
endometrium mengalami istirahat & atropi
c. Memperlambat Transport gamet/ ovum
1) Pengangkutan ovum dpt di perlambat bila diberikan progesteron sebelum fertilisasi.
2) Pengangkutan ovum yg lambat dapat menyebabkan peningkatan insiden implantasi
ektopik tuba.
d. Luteolysis
Pemberian jangka lama progesteron menyebabkan fungsi corpus luteum tidak
adekuat pada siklus haid.
e. Mengentalkan Lendir servic
1) Dalam 48 jam setelah pemberian progesteron,sudah tampak lendir servik yang kental
sehingga motilitas dan daya penetrasi sperma terhambat ak bersabat dengan sperma
2) Lendir servik yang tidak tidak ramah untuk sperma adalah lendir yang jumlahnya sedikit
dan kental
MEKANISME HORMON PENUNDA HAID
Haid dapat terjadi kerena perubahan hormon progesterone selama masa subur
dalam satu siklus haid. Haid seperti telah disebutkan diatas bahwa setelah terjadinya
ovulasi maka kadar hormon progesteron mulai naik dan menuju kadar puncak
kemudian drop lalu haid, dengan kejadian ini lalu diberi obat/hormone agar kadar
puncak progesteron dipertahankan sehingga progesterone tidak drop dan tidak terjadi
haid sesaat. Hal ini efektif dapat dilakukan hanya dalam satu atau dua siklus haid saja.
Pemberian obat hormonal yang sering diberikan adalah noretisteron.
2. apa saja jenis jenis kontrasepsi beserta masing2 keuntungan dan kerugiannya?

menyusui

JENIS METODE KB PASCA PERSALINAN


NON HORMONAL
1.Metode Amenore Laktasi (MAL)
MetodeAmenoreaLaktasi(MAL)adalahkontrasepsiyangmengandalkanpembe
rianAirSusuIbu(ASI)secaraeksklusif,artinyahanyadiberikanASItanpatambahan
makananataupunminumanapapunlainnya.
Syaratuntukdapatmenggunakan:Menyusuisecarapenuh(fullbreastfeeding),l
ebihefektifbilapemberianlebihdari8kalisehari
Carakerja:Penundaan/penekananovulasi
Efeksamping:Tidakada
2.Kondom
3.Alat Kontrasepsi Dalam Rahim (AKDR)
4.Kontrasepsi Mantap (Tubektomi dan Vasektomi)
HORMONAL
1.Progestin: pil, injeksi dan implan
2.Kombinasi: pil dan injeksi
KETERBATASANMETODE AMENORE LAKTASI (MAL)
Perlupersiapansejakperawatankehamilanagarsegeramenyusuidalam30men
itpascapersalinan.
Mungkinsulitdilaksanakankarenakondisisosial.
Efektifitastinggihanyasampaikembalinyahaidatausampaidengan6bulan.
TidakmelindungiterhadapIMStermasukvirushepatitisB/HBVdanHIV/AIDS

Sumber:
Pedoman Pelayanan Keluarga Berencana Pasca Persalinan
di Fasilitas Kesehatan (BKKBN dan Kemenkes R.I., 2012)
2. apa saja yg harus dipertimbangkan dalam memilih kontrasepsi yang tepat?
PERTIMBANGAN DALAM MEMILIH METODE KONTRASEPSI
Metode kontrasepsi sempurna belum dapat diciptakan oleh manusia. Setiap metoda
kontrasepsi memiliki keuntungan dan kerugian masing- masing. Terkadang seorang wanita
mencoba berbagai macam alat kontrasepsi sebelum menemukan metoda kontrasepsi yang
cocok dan memuaskan.Perawat perlu memberikan pertimbangan-pertimbangan yang
membantu seorang wanita memilih metoda yang paling memenuhi kebutuhan mereka.
Pertimbangan-pertimbangan tersebut antara lain:
1.Keamanan
Keamanan metode kontrasepsi merupakan pertimbangan utama dalam penggunaanya.
Status kesehatan yang berbeda beda terkadang menyebabkan beberapa alat kontrasepsi
tidak aman digunakan. Contohnya oral kontrasepsi tidak dianjurkan pada wanita dengan
tromboplebitis atau stroke karena hormon yang dikandungnya dapat meningkatkan resiko
keparahan penyakit tersebut dan diafragma (cap servix) tidak aman digunakan pada
wanita dengan riwayat toxic shock syndome.
2.Perlindungan terhadap penyakit menular seksual
Tidak ada kontrasepsi yang 100% efektif mencegah Penyakit Menular Seksual. Resiko
paparan terhadap Penyakit Menular Seksual harus dipertimbangkan dalam memberikan
konseling tentang pilihan alat kontrasepsi. Kondom pria memberikan perlindungan yang
baik terhadap penularan Penyakit Menular Seksual. Kondom ini harus dupakai jika salah
satu pasangan mengidap Penyakit Menular Seksual meskipun pasangan tersebut telah
menggunakan alat kontrasepsi lain.
3.Efektifitas
Efektifitas suatu alat kontrasepsi ditentukan oleh keberhasilan atau kegagalan alat
kontrasepsi tersebut melindungi seseorang wanita dari kehamilan. Metoda sterilisasi
dianggap yang paling efektif namun tidak dapat digunakan pada pasangan yang ingin anak
lagi dikemudian hari. IUD juga merupakan metoda yang efektif tapi terkadang tidak
menjadi pilihan karena efek samping atau kepercayaan yang dianut oleh pasangan.
4.Pilihan pribadi dan kecendrungan
Pilihan pribadi dan kecendrungan juga merupakan hal penting dalam memilih metode
kontraseps. Jika seorang wanita berasumsi bahwa kontrasepsi yang dipilih terlalu sulit
digunakan, menghabiskan banyak waktu atau terlalu banyak aturan akan menurunkan
motifasi dan kekonsistenan pasangan tersebut untuk menggunakannya. Pendidikan yang
diterima tentang metode kontrasepsi akan mempengaruhi persepsi pasangan terhadap
kontrasepsi.
5.Education needed
Beberapa metoda kontrasepsi tidak membutuhkan pendidikan khusus, seperti kondom.
Namun ada beberapa metode yang membutuhkan informasi lengkap agar metode tersebut
menjadi efektif.
6.Efek samping
Efek samping penggunaan metoda kontrasepsi harus dijabarkan dengan lengkap kepada
pasangan. Jika pasangan sudah mengetahui efek sampingnya lalu kemudian tetap memilih
kontrasepsi tersebut, mereka akan lebih dapat bertoleransi pada efek samping yang
ditimbulkan daripada pasangan yang tidak mengetahui efek samping sama sekali.
7.Pengaruh pada kepuasan seksual
Metode coitus related contraceptive, seperti spermisida dan metoda barrier, harus
digunakan sebelum berhubungan seksual. Hal ini dapat menurunkan kepuasan seksual dan
meningkatkan resiko penurunan minat terhadap metoda tersebut.
8.Ketersediaan
Kondom dan spermisida dapat diperoleh tanpa resep dokter. Pasangan dapat memiliki
bahan ini tanpa harus berkonsultasi terlebih dahulu. Hal ini penting dipertimbangkan pada
pasangan yang tidak dapat terbuka pada tenaga kesehatan tentang aktivitas seksual.

9.Biaya
Pada pasangan berpenghasilan rendah, faktor biaya menjadi hal penting dalam pemilihan
metoda kontrasepsi. Pasangan tersebut mungkin akan lebih suka memilih menggunakan
kondom daripada metoda sterilisasi yang relatif lebih mahal.
10.Agama dan kepercayaan
Agama dan kepercayaan akan mempengaruhi pilihan. Penganut katolik roma tidak
memperkenankan metoda kontrasepsi apapun selain metoda alamiah.
11.Budaya
Budaya juga mempengaruhi pemilihan metoda kontrasepsi. Keturunan afrika-amerika
banyak memilih sterilisasi pada wanita daripada sterilisasi pria, sedangkan pria latin tidak
berminat tehadap penggunaan kondom dan menganut kebudayaan memiliki banyak
keturunan.
Pada beberapa daerah, kontrasepsi tidak akan pernah digunakan sampai pasangan
tersebut berhasil memperoleh anak laki-laki.
12.Informed consent
Beberapa meroda kontrasepsi memiliki efek yang berbahaya. Oleh karena itu, informed
consent perlu disertakan untuk menyatakan bahwa pasangan mengerti resiko dan
keuntungan dari metoda yang mereka pilih sehingga dapat menjadi aspek legal perawat.
ada beberapa faktor yang mempengaruhi dalam metode kontrasepsi diantaranya:
1.Umur
Umur berperan dalam pola pelayanan kontrasepsi kepada masyarakat yang
berkaitan dengan memperhatikan kurun reproduksi sehat , dimana pada wanita
dengan umur 20-30/35 tahun merupakan fase menjarangkan kehamilan sehingga
dibutuhkan alat kontrasepsi yang mempunyai efektivitas cukup tinggi,reversibilitas
cukup tinggi karena peserta masih mengharapkan punya anak lagi,dapat dipakai 24 tahun yaitu sesuai dengan anak yang direncanakan, tidak menghambat air susu
ibu (ASI) karena ASI adalah makanan terbaik untuk bayi sampai umur 2 tahun dan
akan mempengaruhi angka kesakitan dan kematian anak maka dari itu alat
kontrasepsi suntik dapat di jadikan pilihan kedua setelah IUD (Hartanto, 2003).
Pada wanita berumur < 20 tahun merupakan fase menunda atau mencegah
kehamilan sehingga wanita tersebut dapat memilih alat kontrasepsi dengan
reversebilitas tinggi, artinya kembalinya kesuburan dapat terjamin 100% maka
prioritas penggunaan alat kontasepsi bisa menggunakan pil oral, penggunaan
kondom kurang menguntungkan karena pasangan muda masih tinggi frekuensi
senggamanya sehingga akan mempunyai kegagalan tinggi (Hartanto, 2003).
Periode umur wanita di atas 30 tahun, terutama diatas 35 tahun sebaiknya
mengakhiri kehamilan setelah mempunyai 2 orang anak. Sehingga pilihan utama
alat kontrasepsinya adalah kontrasepsi mantap misalnya vasektomi atau tubektomi
karena kontrasepsi ini dapat dipakai untuk jangka panjang dan tidak menambah
kelainan yang sudah ada. Pada masa usia tua kelainan seperti penyakit jantung,
darah tinggi, keganasan dan metabolik biasanya meningkat, oleh karena itu
sebaiknya tidak diberikan cara kontrasepsi yang menambah kelainan tersebut
(Hartanto, 2003).
2.Jumlah anak
Jumlah anak seorang wanita dapat mempengaruhi cocok tidaknya suatu metode
secara medis. Secara umum, AKDR tidak dianjurkan bagi wanita nulipara karena
pemasangan yang lebih sulit, dan kemungkinan AKDR dapat mengganggu
kesuburan di masa depan (Sherris & Wells, 2005).
Pada ibu setelah mempunyai 2 orang anak atau lebih sebaiknya mengakhiri
kesuburan . Dianjurkan untuk tidak punya anak lagi , karena alasan medis dan
alasan lainnya, sehingga dianjurkan untuk ibu untuk menggunakan kontrasepai
mantap (Hartanto, 2003).
3.Pendidikan
Faktor pendidikan seseorang sangat menentukan dalam pola pengambilan
keputusan dan menerima informasi dari pada seseorang yang berpendidikan
rendah. Pendidikan merupakan salah satu faktor yang sangat menentukan

pengetahuan dan persepsi seseorang terhadap pentingnya suatu hal, termasuk


pentingnya keikutsertaan dalam KB. Kepandain membaca dan menulis
memudahkan penyebaran keterangan tentang KB, tapi juga mengenai tentang
pengertian dasar tentang bagaimana dan mengapa berbagai cara membatasi
kelahiran yang di batasi selama ini berhasil dan apa keuntungan ditiap-tiap cara
tersebut
4.Pengetahuan
Kontrasepsi pada umumnya digunakan untuk merencanakan sebuah keluarga.
Jumlah alat kontrasepsi yang tersedia pun sangat beragam dengan segala kelebihan
dan kekurangannya. Bagi perempuan yang ingin menggunakan alat kontrasepsi
khususnya kontrasepsi suntik harus membekali diri dengan pengetahuan mengenai
kontrasepsi suntik sebelum untuk memutuskan Menurut Glasier dan Gebbie (2005)
ada beberapa faktor lain yang mempengaruhi dalam memilih metode kontrasepsi di
antaranya:
1.Kunjungan berkala ke klinik
Wanita yang tinggal di tempat terpencil atau mereka yang sering berpegian
mungkin memilih metode yang tidak mengharuskan mereka tidak berkonsultasi
secara teratur dengan petugas keluarga berencana.
2.Peran petugas
Pada beberapa metode, petugas hanya memiliki peran satu kali. Pada metode yang
lain, petugas perlu bertemu langsung dengan pemakai selama beberapa kali setiap
tahun (obat suntik setiap bulan atau setiap tiga bulan saat ini tidak dipasarkan
secara bebas sehingga pemakai perlu berkunjung secara berkala).
3.Frekuensi tindakan yang dibutuhkan
Beberapa pemakai mungkin menginginkan suatu metode yang tidak atau sedikit
yang memerlukan tindakan dari pihak mereka. Pengontrolan kelahiran yang perlu
anda pikirkan empat kali setahun adalah slogan untuk metode suntikan depo
medroksiprogesteron asetat (DMPA) yang diberikan setiap 3 bulan.
4.Kerjasama pasangan
Setiap metode memiliki rentang peran anggota pasangan yang luas, yang perlu
dilakukan oleh masing-masing anggota pasangan tersebut. Pada beberapa metode,
misalnya sterilisasi, AKDR, atau implant, salah satu pasangan memikul seluruh
tanggung jawab. Bagi yang lain, misalnya pantang berkala atau koitus interuptus,
keduanya harus bersedia untuk bekerjasama.
5.Privasi
Peserta keluarga berencana mungkin menempatkan beberapa pertimbangan privasi
sebagai hal yang sangat penting. Terutama wanita muda atau wanita yang
hubungan seksualnya secara sosial tidak dibenarkan, mungkin akan sangat
menginginkan metode yang tidak menarik perhatian.
6.Frekuensi hubungan seksual
Pemakai yang jarang berhubungan seksual mungkin kurang tertarik dengan
metode-metode, misalnya kontrasepsi oral, yang memerlukan tindakan setiap hari.
Apabila suatu pasangan monogami terpisah dalam waktu yang lama, misalnya
akibat migrasi bekerja, maka metode seperti pantang berkala tentu kurang sesuai,
karena pantang berkala mungkin mengganggu aktivitas seksual selama interval
yang singkat yang memungkinkan bagi mereka untuk melakukan hubungan
seksual.
7.Rencana untuk kesuburan dimasa mendatang
Perlu di tentukan apakah dan kapan pemakai memilki rencana untuk hamil dimasa
mendatang. Banyak metode yang dianjurkan atau menjadi paling efektif dari segi
biaya hanya apabila wanita tidak memiliki rencana hamil dalam waktu dekat.
8.Biaya
Biaya dari suatu srategi keluarga berencana mencakup biaya metode itu sendiri,
waktu yang dikorbankan wanita dan petugas, serta biaya tak langsung lainnya,
termasuk ongkos berkunjung ke klinik. Studi mengenai biaya semacam ini sangat
sulit dilakukan, sehingga jarang dilakukan. Metode keluarga berencana juga sangat
bervariasi dalam hal biaya pemakai dan penyebaran petugas sepanjang waktu.

KTI : M. Ilyas (FKUII)


http://medicine.uii.ac.id/index.php/KTI/FAKTOR-FAKTOR-YANG-MEMPENGARUHIPEMILIHAN-KONTRASEPSI-SUNTIK-DI-KECAMATAN-NGAGLIK-SLEMANYOGYAKARTA.html

Rekomendasi Prkatik Pilihan untuk Penggunaan Kontrasepsi


4. pada pasien b apa hubungan pasien tsb memiliki riwayat operasi FAM dengan
pemilihan kontrasepsi?

Penggunaan kontrasepsi oral terutama kontrasepsi oral kombinasi diduga


dapat menyebabkan resiko kanker payudara. Hal ini disebabkan karena estrogen
didalam tubuh berlebihan yang berasal dari eksogen, dimana bila estrogen
berlebihan didalam tubuh maka merupakan faktor resiko terhadap insiden kanker
payudara. Mekanisme klasik estrogen akan berpengaruh terhadap laju
lintasan mitosis dan apoptosis serta mengejawantah menjadi risiko kanker payudara
dengan memengaruhi pertumbuhan jaringan epitelial. Laju proliferasisel yang
sangat cepat akan membuat sel menjadi rentan terhadap kesalahan genetika pada
proses replikasi DNA oleh senyawa spesifik oksigen reaktif yang teraktivasi
oleh metabolitestrogen. (Chen, 2010).
Jalur Reseptor Estrogen memainkan peran penting dalam perkembangan
kanker payudara. Keikutsertaan metabolit estrogen genotoksik dan reseptor
estrogen diperantaraisignaling genomik dan non-genomik yang mempengaruhi
proliferasi sel dan apoptosis pada jaringan payudara. (Ningrum, 2009)
Mekanisme jalur non genomik pada reseptor estrogen melibatkanjalur PI3K
dan Ras, dimana akan mengakibatkan posporilasi sehingga mempengaruhi proses
transkripsi gen. Bila estrogen yang diproduksi berlebihan maka akan menimbulkan
efek proliferasi yang berlebihan pula.
Sedangkan mekanisme jalur genomik estrogen yang ada dalam tubuh di
terima oleh reseptor estrogen yang berada pada nukleus sehingga mempengaruhi
proses transkripsi sel.
Perluasan pada kedua jalur ini memberi kontribusi pada karsinogenesis
diperantarai eksogen dan caranya, dimana polimorfisme genetik dan faktor
lingkungan memodifikasi efek jalur-jalur ini membutuhkan eksplorasi ke depannya.
(Ningrum, 2009)
Selain penggunaan kontrasepsi oral kombinasi ada faktor lain yang diduga
berpengaruh pada kejadian kanker payudara yaitu FGFR2. Dimana FGFR2 adalah
reseptor tirosin kinase yang terlibat dalam sejumlah sinyal transduksi sel yang
berkontribusi terhadap pertumbuhan sel dan diferensiasi sel (Eswarakumar
VP,2005). FGFR2 penting dalam pengembangan sejumlah jaringan termasuk
payudara dan ginjal. FGFR2 diduga berhubungan dengan kanker payudara
Berdasarkan hasil studi diduga bahwa ada keterkaitan antara gen FGFR2 dan
kejadian kanker payudara terutama yang disertai dengan reseptor estrogen positif
dan progesteron positif. Penelitian ini melibatkan keterkaitan SNP pada intron 2 dari
gen, yang mana merupakan tempat faktor transkripsi mengikat estrogen.
Sumber:

Hubungan Kontrasepsi Pil dengan Tumor/Kanker Payudara di Indonesia


Anna Maria Sirait, Ratih Oemiati, Lely Indrawati
Pusat Penelitian dan Pengembangan Biomedis dan Farmasi, Badan Penelitian
dan Pengembangan, Departemen Kesehatan RI

5. tujuan dan syarat penggunaan kontrasepsi? Mekanisme dari efek samping


kontrasepsi?

Tujuan umum program KB


Tujuan umum untuk lima tahun kedepan mewujudkan visi dan misi program KB yaitu
membangun kembali dan melestarikan pondasi yang kokoh bagi pelaksana program KB dimasa
mendatang untuk mencapai keluarga berkualitas tahun 2015.
Tujuan Penggunaan Kontrasepsi
Menurut Saifuddin (2006). Tujuan penggunaan kontrasepsi adalah sebagai berikut :
a. Menunda Kehamilan
b. Menjarangkan kehamilan
c. Mengakhiri kesuburan
3. Syarat Penggunaan Kontrasepsi
Syarat syarat kontrasepsi
menurut Saifuddin (2006) antara lain sebagai berikut :
a. Aman pemakaiannya dan dapat dipercaya
b. Lama kerja dapat diukur menurut keinginan
c. Tidak mengganggu hubungan persetubuhan
d. Sederhana, sedapat-dapatnya tidak perlu dikerjakan oleh seorang dokter
e. Harganya murah supaya dapat dijangkau masyarakat luas
f.Dapat menerima pasangan suami istri
g. Tidak memerlukan bantuan medik atau kontrol yang terlambat selama
pemakaian.
http://digilib.unimus.ac.id/download.php?id=6229
6. apa hubungan kb dengan keadaan pada pasien A?
Pasien A : chlamydiasis, hepatitis kronis, DM, tekanan darah 160/90
Efek Samping
Efek Samping Minor
Gabungan kontrasepsi hormonal mempengaruhi hampir setiap sistem dalam tubuh.
Kontrasepsi steroid dimetabolisme oleh hati dan mempengaruhi metabolisme
karbohidrat, lipid, plasma protein, asam amino, vitamin dan faktor pembekuan.
Banyak efek samping yang dilaporkan, khususnya sakit kepala, penambahan berat
badan dan kehilangan libido, adalah umum di kalangan wanita tidak menggunakan
kontrasepsi hormonal. Mereka mungkin berkaitan langsung dengan kontrasepsi
steroid termasuk retensi cairan, mual dan muntah, chloasma, mastalgia dan
pembesaran payudara. Semua kecuali chloasma (yang semakin buruk dengan
bertambahnya waktu) meningkat dalam waktu 3 sampai 6 bulan. Dosis estrogen
yang berbeda atau jenis progestogen atau cara pemberian yang berbeda dapat
membantu jika waktu saja tidak dapat memecahkan masalah. Untuk wanita
penggunan pil dengan keluhan mual yang persisten, menjadi indikasi pemberian
patch. Efek samping (nyata atau dirasakan) sering mengakibatkan penghentian

penggunaan; 73% wanita Inggris pada semua umur mengeluhkan terjadinya


penambahan berat badan sebagai suatu kelemahan dari penggunaan pil.
Efek Samping Serius
Penyakit Kardiovaskuler
Telah lama diketahui bahwa risiko terjadinya emboli deep-venous
thrombosisandpulmonary meningkat pada wanita yang menggunakan pil oral
kombinasi. Ini berhubungan dengan dosis estrogen, dan jumlahnya secara
substansial telah diturunkan dengan formulasi yang mengandung dosis rendah
estradiol ethinyl yaitu 20-35 g. Bahkan dengan risiko yang meningkat, kejadian
dengan menggunakan pil oral kombinasi hanya 3-4 per 10.000 perempuan per
tahun. Selain itu, risikonya lebih rendah dari taksiran kehamilan 5-6 per 10.000
wanita per tahun. Risiko terjadinya tromboemboli berkurang dengan cepat ketika pil
oral kombinasi dihentikan.
Mereka yang paling berisiko untuk terjadinya trombosis vena dan emboli ialah
wanita dengan defisiensi protein C atau S. Faktor klinis lain yang meningkatkan
risiko trombosis vena dan emboli dengan menggunakan pil oral kombinasi adalah
hipertensi, obesitas, diabetes, merokok, dan gaya hidup kurang gerak. Penggunaan
kontrasepsi selama sebulan sebelum dilakukannya operasi besar meningkatkan dua
kali lipat risiko tromboemboli pasca operasi . menyeimbangkan risiko tromboemboli
dengan wanita dengan kehamilan yang tidak diinginkan selama 4 sampai 6 minggu
diperlukan untuk membalikkan efek trombogenik dari pil oral kombinasi sebelum
operasi.
Menurut World Health Organization Collaborative Study, peningkatan stroke iskemik
dan hemoragik pada wanita perokok yang lebih muda dari 35 tahun adalah sekitar
10 dan 25 peristiwa per 1 juta wanita per tahun, masing-masing. Beberapa studi
telah menyimpulkan bahwa penggunaan pil oral kombinasi pada wanita yang sehat
sehat, wanita tidak merokok tidak berhubungan dengan peningkatan risiko stroke .
Sebaliknya, wanita yang memiliki hipertensi, merokok, atau sakit kepala migrain
dengan aura visual dan menggunakan kontrasepsi oral memiliki peningkatan risiko
stroke. Karena risiko stroke adalah mutlak rendah, tetapi American College of
Obstetricians and Gynecologists telah menyimpulkan bahwa pil oral kombinasi
dapat dipertimbangkan untuk wanita dengan migren yang tidak memiliki tandatanda neurologis fokal jika mereka dinyatakan sehat, wanita muda bukan perokok
dengan tekanan darah normal kurang dari 35 tahun. Pada meta-analisis baru-baru
ini dari 17 penelitian observasional migrain dengan kualitas yang baik dihubungkan
dengan resiko yang relatif dari stroke ialah 2,16 (CI 95%: 1,89-2,48) dan pengguna
kontrasepsi oral mengalami peningkatan delapan kali lipat dalam risiko stroke bila
dibandingkan dengan bukan pengguna. Banyak orang salah mengartikan sakit
kepala mereka sebagai migrain dan oleh karena itu adalah penting untuk mencari
tahu riwayat pasien sebelum menolak untuk menuliskan resep pil oral kombinasi
bagi wanita dengan riwayat migrain.
Penggunaan pil oral kombinasi meningkatkan resiko dari stroke iskemik yang
berlipat ganda, namun terjadinya risiko stroke perdarahan tetap tidak berubah.
Merokok dan hipertensi meningkatkan risiko stroke tiga sampai sepuluh kali.
Namun, stroke juga jarang terjadi pada wanita usia reproduksi.

Neoplasia Ganas
Pil oral kombinasi dapat mengurangi risiko beberapa kanker dan dapat juga
meningkatkan risiko beberapa kanker lainnya pula. Sebagian besar data yang
didapat berhubungan dengan penggunaan pil oral kombinasi dengan dosis tinggi
estrogen dan progestin yang tinggi, namun penelitian menunjukkan bahwa sediaan
dosis yang lebih rendah juga cenderung memiliki efek yang sama pada risiko
kanker.
Kanker Payudara
Analisis dari 54 studi menemukan terjadinya peningkatan risiko kanker payudara
yang kecil (resiko relatif = 1,24). Risiko kelebihan tersebut terjadi pada wanita
dengan penyakit lokal, dan terdapat penurunan nilai pada penyakit metastatik.
Pengamatan bahwa durasi penggunaan pil oral kombinasi tidak meningkatkan risiko
kanker payudara menyangkal berpendapat sebelumnya. Risiko kanker payudara
menghilang setelah 10 tahun penghentian penggunaan pil. Dengan demikian,
wanita yang menggunakan pil dari usia 15 sampai usia 35 tahun memiliki risiko
kanker payudara yang sama pada usia 50 sebagai wanita sebanding dengan wanita
yang tidak pernah menggunakan pil oral kombinasi. Karena insiden kanker
payudara masih rendah pada usia saat menggunakan pil oral kombinasi adalah hal
yang umum, sehingga efek yang kecil akan mempengaruhi jumlah wanita yang
relatif kecil. Misalnya, di antara wanita yang berhenti menggunakan pil oral
kombinasi pada usia 25 tahun, risiko kumulatif dari usia 25 sampai 34 tahun
diperkirakan didiagnosis kanker yaitu 1 per 10.000 wanita. Pada wanita yang
menghentikan penggunaan pil oral kombinasi pada usia 40, ketika tingkat insidensi
lebih tinggi, diperkirakan akan terjadi 19 kasus kanker yang didiagnosis pada usia
40 sampai 49 tahun.
Kanker Serviks
Data risiko kanker serviks pada pengguna pil juga sulit diinterpretasikan karena
metode penghalang memberikan perlindungan dan setiap hubungan yang
diidentifikasi dalam studi epidemiologi berhubungan juga dengan hasil penyesuaian
perilaku seksual yang buruk. 10 studi kasus meta-analisis baru-baru ini, wanita
infeksi yang persisten dari infeksi virus papiloma manusia (HPV) yang
menggunakan kontrasepsi hormonal (terutama kombinasi) lebih dari 5 tahun
memiliki risiko relatif kanker serviks yang meningkat dari 2.8. Penggunaan
kontrasepsi hormonal selama lebih dari 10 tahun meningkatkan risiko relatif sampai
4.0. Jadi, meskipun adanya kekhawatiran bahwa perilaku seksual yang buruk di
kalangan wanita yang menggunakan metode kontrasepsi berbeda mungkin menjadi
pengganggu, bukti yang terjadi dijumlahkan dan didapatkan adanya asosiasi yang
berarti antara penggunaan pil oral kontrasepsi dengan kanker serviks.
Bukti saat ini menunjukkan peningkatan risiko adenokarsinoma antara pengguna
jangka panjang tetapi ini adalah tumor yang langka.
Kanker Ovarium, Endometrium Dan Colon
Terdapat bukti yang substansial menggunakan pil oral kombinasi dapat melindungi
terhadap kanker ovarium dan kanker endometrium. Terdapat juga pengurangan

50% risiko kanker ovarium epitelial setelah 5 tahun penggunaan pil oral kombinasi.
Efek perlindungan berlangsung selama setidaknya 10 tahun setelah penggunaan pil
dihentikan. Efeknya mungkin berhubungan dengan pengurangan jumlah ovulasi,
dan oleh karena itu terdapat kasus ruptur kapsul ovarium. Penggunaan pil oral
kombinasi juga mengurangi risiko kanker endometrium. Efeknya sangat
berhubungan dengan lamanya penggunaan (pengurangan resiko 20% setelah 1
tahun, 50% setelah 4 tahun) dan tetap berlanjut selama 15 tahun setelah berhenti
minum pil KB. Terdapat juga beberapa bukti yang menyatakan bahwa pil oral
kombinasi mungkin juga memberi perlindungan terhadap kanker colon.
Infeksi
Ada data yang bertentangan mengenai peran pil oral kombinasi dengan kandidiasis
vulvovaginal yang episodik, walaupun laporannya menyatakan jumlahnya lebih
rendah dari vaginosis bakteri. Sebagian besar tetapi tidak semua studi
menunjukkan peningkatan laju infeksi Chlamydia trachomatis pada pengguna pil
oral kombinasi, tetapi tidak dengan Neisseria gonorrhoeae. pil oral kombinasi tidak
menurunkan kejadian penyakit radang panggul (PID) tetapi memodifikasi keparahan
klinis. Beberapa tetapi tidak semua studi menunjukkan bahwa pil oral kombinasi
meningkatkan kerentanan terhadap infeksi virus human immunodeficiency (HIV)
dan perjalanan penyakitnya
Efek Samping
Efek Samping Minor
Gangguan Pendarahan
Efek samping yang paling umum dan menyebabkan penghentian pil oral kombinasi
yaitu pola pendarahan yang tidak dapat diterima. Termasuk amenorea jika wanita
belum diperingatkan. Dosis rendah progestogen tunggal (pil dan implan)
berhubungan berhubungan dengan tingginya insidensi pendarahan vagina yang
tidak teratur. Hal ini disebabkan progestogen berpengaruh terhadap fungsi ovarium.
Pada siklus ovulasi yang normal ditandai dengan adanya haid. Ketidakkonsistenan
ovulasi dan fluktuasi produksi estrogen endogen dari pertumbuhan folikel
menjadikan perdarahan yang tidak teratur. Namun, ada juga bukti yang
menunjukkan bahwa metode progestogen hanya secara langsung mempengaruhi
vaskularisasi dari endometrium dalam meningkatkan kemungkinan terjadinya
perdarahan.Pola pendarahan yang berbeda didapatkan sesuai dengan dosis dari
progestogen dan cara pemberian obat.
Kista Folikuler Persisten
Efek dari pil kontrasepsi oral pada aktivitas ovarium juga menyebabkan insidensi
kista ovarium fungsional, atau lebih akurat sebagai folikel persisten. Telah ditaksir
bahwa satu dari lima wanita yang menggunakan pil oral progestogen tunggal akan
mendapatkan kista yang ditunjukkan oleh USG. Biasanya asimtomatis, folikel
yang persisten dapat menyebabkan nyeri abdomen atau dispareunia. Sebagian
gejala ini akan hilang dengan kembalinya menstruasi sehingga pengobatannya
hanya bersifat konservatif saja.
Efek Samping Serius

Disebabkan metode kontrasepsi progestogen tunggal lebih jarang digunakan


daripada pil kombinasi, data dalam penggunaan yang lama juga sedikit. Follow up
jangka panjang (5 tahun) lebih dari 16.000 wanita yang menggunakan Norplant
(implant) dilaporkan tidak menunjukkan masalah kesehatan seperti penyakit
kardiovaskuler dan neoplasia.
Penyakit Kardiovaskuler
Tidak terdapat bukti terjadinya peningkatan resiko stroke, miokard infark atau
tromboemboli vena yang berhubungan dengan pil kontrasepsi oral. Hubungan
antara tromboemboli vena dan progestogen yang digunakan untuk pengobatan
kondisi ginekologi seperti perdarahan uterus disfungsi yang anovulatoar yang sering
diobati oleh pil kontrasepsi oral yang akhirnya menjadi kontraindikasi bila diberikan
dengan faktor resiko tromboemboli vena.
Penyakit Keganasan
Depo-Provera memberikan proteksi yang tinggi terhadap karsinoma endometrium
namun secara teoritis juga melindungi kanker ovarium namun belum ada data yang
mendukung hal ini. Tidak terdapat data pada resiko kanker serviks meskipun
seluruh kontrasepsi hormonal mempunyai peran dalam menjadikan kanker serviks.
Penggunaan kontrasepsi progestogen tunggal selama 5 tahun dihubungkan dengan
peningkatan resiko kanker payudara sebesar 1,17% secara signifikan.
Kepadatan Tulang
Inhibisi ovulasi komplit oleh Depo-Provera menyebabkan hipoestrogenisme dan
amenorea. Hipoestrogenisme berhubungan dengan penurunan kepadatan tulang.
Ini didapatkan dari studi penggunaan Depo-Provera yang berhubungan dengan
pengurangan kepadatan tulang dibandingkan dengan yang bukan pengguna. Ini
dapat mempengaruhi anak perempuan yang belum mencapai puncak dari massa
tulang. Hasil dari studi cross sectional terbatas dan tidak konsisten, meskipun
begitu, 2 buah studi prospektif telah melaporkan adanya penurunan densitas tulang
pada pengguna Depo-Provera lebih dari 2 tahun berusia antara 12 sampai 21
tahun dibandingkan dengan kontrasepsi non hormonal.

7. metode KB apa yang sesuai untuk pasien B yang sedang menyusui?


CARA KERJA MAL
Konsentrasi prolaktin meningkatkan sebagai respons terhadap stimulus

pengisapan berulang ketika menyusui. Dengan intensitas dan frekuensi


yang cukup, kadar prolaktin akan tetap tinggi. Hormon prolaktin yang
merangsang produksi ASI juga mengurangi kadar hormon LH yang
diperlukan untuk memelihara dan melangsungkan siklus menstruasi.

Kadar prolaktin yang tinggi menyebabkan ovarium menjadi kurang sensitif

terhadap perangsangan gonadotropin yang memang sudah rendah, dengan


akibat timbulnya inaktivasi ovarium, kadar esterogen yang rendah dan
anovulasi. Bahkan pada saat aktivitas ovarium mulai pulih kembali, kadar
prolaktin yang tinggi menyebabkan fase luteal yang singkat dan fertilitas
menurun.

Jadi, intinya cara kerja Metode Amenore Laktasi (MAL) ini adalah dengan

penundaan atau penekanan ovulasi


MAL dapat digunakan sebagai kontrasepsi apabila :

Belum mengalami haid sejak melahirkan.


Menyusui secara penuh ( full breast feading ), tanpa memberikan makanan
atau minuman tambahan selain dari ASI.
Umur bayi kurang dari 6 bulan, karena pada bayi yang telah mencapai usia
tersebut membutuhkan nutrisi tambahan selain dari ASI, sehingga nantinya bayi
akan menghisap kurang sering dan metode ini tidak lagi efektif
http://repository.usu.ac.id/handle/123456789/19135
8. metode konseling kontrasepsi?
9. apakah ada interaksi griseofulvindengan kb?
Kontrasepsi hormonal estrogen da akan dimetabolisme dalam darah tergantung
ain sitokrom p450 dan memengaruhi wkt paruh waktu di usus direaktifkan lagi
Antibiotik griseofulvin AB untuk chlamydiasis dapat menurunkan kerja kontrasepsi
hormonaldg cara meningktkanenz sitokrom, membunuh bakteri clostridia di usus.
tdk semua AB memengaruhi KB
10. interaksi obat yang dapat memengaruhi kerja kontrasepsi?
Sebagian dokter/klinisi melaporkan adanya sejumlah wanita yang gagal berKB karena minum antibiotika selama penggunaan pil KB, terutama tetrasiklin atau
golongan penisilin, sementara para ilmuwan belum bisa mengklaim secara kuat
bahwa penggunaan secara bersama dua obat tersebut menurunkan konsentrasi
obat kontrasepsi oral dalam darah, terutama etinil estradiol (senyawa aktif dalam
pil KB).
Selama ini dianggap bahwa interaksi demikian hanya signifikan untuk sebagian
kecil wanita saja. Sebagian wanita ini menunjukkan bioavailabilitas (ketersediaan
hayati) etinil estadiol yang rendah, karena adanya first pass metabolisme yang
berlebihan dan memiliki sirkulasi enterohepatik etinil estradiol yang besar. First
pass metabolism adalah metabolisme atau perombakan obat oleh hati menjadi
bentuk yang tidak aktif/metabolitnya. Studi ilmiah mengenai konsentrasi etinil
estradiol dalam darah yang diminum bersamaan dengan antibiotika hanya
melibatkan sejumlah terbatas pasien karena masalah logistik dan biaya, dan belum
melibatkan kelompok wanita yang rentan terhadap kehamilan, sehingga masih
sulit diambil kesimpulan yang kuat tentang hal tersebut. Boleh jadi, kasus
nyonya Susi adalah karena dia termasuk kelompok wanita yang rentan tersebut.
Namun karena diperkirakan bahwa antara 60 sampai 70 juta wanita di dunia
menggunakan
pil
KB,
dan
banyak
yang
juga
menggunakan
obat
antibiotika/antijamur selama penggunaan kontrasepsi oral tesebut, maka adanya
interaksi ini perlu dipertimbangkan dan diketahui.
Bagaimana mekanisme terjadinya interaksi antara pil KB dengan obat
antibiotika/antijamur ?
Etinil estradiol adalah estrogen pilihan yang banyak digunakan dalam pil KB, dan
merupakan senyawa yang aktif utama pil KB. Dari total zat aktif dalam satu pil,
hanya kira-kira 40-50 %-nya saja yang dapat mencapai peredaran darah sistemik
dalam bentuk tidak berubah, dengan rentang variasi individual berkisar 10 s/d
70%. Sisanya dimetabolisir selama first pass metabolisme melalui saluran
pencernaan dan liver/hati. Etinil estradiol yang telah melalui peredaran darah akan

diserap oleh tubuh, dan sisa yang tidak terserap akan mengalami konjugasi dengan
senyawa sulfat, terutama di dinding saluran cerna, lalu ditranspor di pembuluh
darah vena ke dalam liver dimana akan terjadi hidroksilasi dan konjugasi dengan
asam glukoronat. Dengan proses metabolisme ini, etinil estradiol berubah menjadi
senyawa yang tidak aktif, yang pada akhirnya akan dikeluarkan melalui feses/tinja.
Proses hidroksilasi ini dikatalisir oleh suatu enzym spesifik yang disebut sitokrom
P450, yang dipengaruhi oleh sifat genetik, yang berarti tergantung pada sifat gen
manusia. Dengan demikian, hal ini dapat menjelaskan mengapa setiap individu,
termasuk dari etnik yang berbeda, bisa memiliki perbedaan kemampuan untuk
memproses hidroksilasi etinil estradiol dalam tubuh. Estrogen yang tidak
terhidroksilasi akan mengalami konjugasi dengan glukoronat, dan kemudian
diekskresikan ke dalam empedu, lalu masuk ke dalam usus dan dikeluarkan
melalaui tinja. Tetapi, sebagian dari estrogen yang melalui usus tadi masih dapat
diproses lagi oleh suatu bakteria usus yaitu spesies Clostridia kembali menjadi
bentuk yang aktif/bebas dan dapat mengalami re-sirkulasi dalam peredaran darah
sistemik dan mengalami penyerapan lagi.
Ada beberapa keadaan di mana secara teroritik antimikroba (antibiotika/antijamur)
dapat mempengaruhi penyerapan, metabolisme dan pengeluaran etilen estradiol,
menurunkan potensinya serta dapat menyebabkan pendarahan, bahkan kegagalan
KB, yaitu kehamilan. Rifampisin, suatu antibiotika yang digunakan untuk mengobati
TBC, adalah yang pertama kali dilaporkan menyebabkan berkurangnya efek pil KB
pada sekitar tahun 1971 di Jerman. Di antara 88 wanita yang menggunakan pil KB
dan Rifampisin, 62 orang diantaranya dilaporkan mengalami gangguan menstruasi
dan 5 orang gagal berKB atau hamil. Rifampisin adalah induser yang poten
terhadap enzym sitokrom P450, sehingga meningkatkan proses metabolisme etinil
estradiol menjadi senyawa tak aktif, yang pada gilirannya menyebabkan
berkurangnya konsentrasi pil KB tersebut dalam tubuh dan menyebabkan efeknya
jadi berkurang.
Griseofulvin, suatu obat jamur, juga dilaporkan memiliki efek yang serupa, yaitu
mengurangi efek kontrasepsi oral. Obat jamur lain yang dilaporkan dapat
menurunkan potensi pil KB adalah itraconazole, namun mekanismenya belum
diketahui secara pasti. Yang menarik, obat kelompok triazol yang lain yaitu
ketaconazole, dan fluconazole, dilaporkan menghambat enzim sitokrom P450, yang
berarti mengurangi metabolisme pil KB menjadi bentuk tak aktifnya, yang pada
gilirannya meningkatkan efek pil KB-nya. Namun karena belum ada data
epidemiologi yang akurat, masih sulit untuk menyimpulkan secara pasti interaksi
obat jamur dengan kontrasepsi oral.
Selain dengan cara meningkatkan kerja enzim pemetabolisme tersebut, antibiotika
juga dapat mengurangi efek pil KB dengan cara membunuh bakteria usus yang
dibutuhkan untuk memproses etinil estradiol menjadi senyawa bebas yang bisa
dire-sirkulasi dan dire-absorpsi. Dengan terbunuhnya bakteri usus yang berguna,
yaitu Clostridia, maka proses reabsorpsi obat akan terhambat, kadar zat aktif dalam
tubuh jadi berkurang, yang berarti mengurangi efek pil KB. Antibiotika seperti
penisilin dan tetrasiklin dilaporkan dapat menyebabkan kegagalan pil KB. Di
Selandia baru pada tahun 1987, 23% dari 163 kasus kehamilan yang dilaporkan
adalah akibat kegagalan pil KB karena digunakan bersama dengan antibiotika.
Namun sekali lagi, masih terdapat kesulitan metodologi dalam studi ilmiah tentang
interaksi obat ini. Karena penggunaan parameter yang berbeda, sebagian studi
menyatakan tidak ada interaksi yang signifikan antara obat antimikrobia ini dengan
pil KB, sementara studi yang lain menyatakan sebaliknya.
Sebuah penelitian yang dilakukan pada kelinci, seperti dilaporkan oleh sebuah jurnal
ilmiah Contraception tahun 1997, menunjukkan bahwa antibiotika amoksisilin tidak

memiliki efek signifikan terhadap kadar etinil estradiol dalam darah, yang berarti
tidak mempengaruhi efek pil KB. Hasil penelitian yang serupa juga ditemui pada
antibiotika tetrasiklin. Sebuah studi (tahun 1991) pada 7 orang wanita yang
menggunakan kontrasepsi oral dan tetrasiklin secara bersama menunjukkan bahwa
tetrasiklin tidak mengurangi secara signifikan kadar etinil estradiol dalam darah.
Penelitian lain yang melibatkan generasi baru antibiotika yaitu roxithromycin dan
dirirthromycin juga gagal menunjukkan efek yang siginifikan pada pemakaian
kombinasi dengan pil KB. Namun demikian, karena penelitian semacam ini pada
manusia umumnya hanya melibatkan sejumlah terbatas wanita, boleh jadi hasilnya
tidak bisa menggambarkan hasil yang mungkin terjadi pada sekelompok wanita
yang memiliki respon yang berbeda.
Bagaimana sebaiknya ?
Walaupun menurut beberapa studi di atas, kemungkinan kejadian interaksi ini
hanya terbatas, terutama pada wanita yang memiliki aktivitas enzim
pemetabolisme dan sirkulasi enterohepatik yang berlebihan, namun sampai saat ini
tidak ada cara untuk mengindentifikasi apakah seorang wanita termasuk kelompok
tersebut atau tidak. Karena itu, untuk menghindari kemungkinan kegagalan pil KB,
adalah lebih bijaksana jika pasien maupun dokter penulis resep berhati-hati
terhadap adanya kombinasi antibiotika/antijamur dengan pil KB. Bagi wanita yang
mengkonsumsi rifampisin dalam jangka panjang, sebaiknya memilih cara
kontrasepsi yang lain, misalnya dengan suntik KB, spiral, kondom, atau lainnya.
Wanita yang menggunakan obat jamur griseofulvin juga perlu waspada terhadap
berkurangnya efek pil KB, dan sebaiknya tidak menggantungkan diri pada cara
kontrasepsi ini. Cara lain adalah dengan menghindari kontak seksual selama 7 hari
pertama pemakaian antibiotika dan 7 hari berikutnya. Jadi tegasnya, jika Anda
mendapatkan resep antibiotika, sementara Anda sedang menggunakan pil KB,
maka sampaikan pada dokter Anda dan konsultasikan mengenai kemungkinan
interaksi ini. Dan yang penting, gunakan juga cara kontrasepsi lain untuk
mendukung kerja pil KB yang digunakan selama Anda mengkonsumsi
antibiotika/antijamur. Bagaimanapun, berhati-hati akan lebih baik daripada
terlanjur hamil tanpa direncanakan, apalagi diinginkan.
https://zulliesikawati.wordpress.com/tag/pil-kb/
11. penatalaksanaan dari efek samping kontrasepsi?

Penanganan dan Efek Samping Masalah Kontrasepsi


A. Penanganan Efek Samping dan Masalah Kondom
Efek samping atau masalah
Penanganan
Kondom rusak atau diperkirakan bocor Buang dan pakai kondom baru atau pakai
(sebelum berhubungan)
spermisida digabung kondom
Kondom bocor atau dicurigai ada curahan di Dicurigai ada kebocoran, pertimbangkan
vagina saat berhubungan
pemberian Morning after Pill.
Dicurigai adanya rekasi alergi (spermisida)
Reaksi alergi, meskipun jarang, dapat
sangat mengganggu dan berbahaya. Jika
keluhan menetap dan sudah berhubungan
dan tidak ada gejala IMS, berikan kondom
alami (produk hewani : lamb skin atau
gut) atau bantu klien memilih metode lain.
Mengurangi kenikmatan hubungan seksual
Jika penurunan kepekaan tidak bisa
ditolerir biarpun dengan kondom yang
lebih tipis, anjurkan pemakaian metode
lain.
Penanganan efek samping dan masalah Minipil

b.

a. Amenorhea
Penanganan :
Pastikan hamil atau tidak, jika tidak hamil tidak perlu tindakan khusus (cukup konseling).
Bila amenore berlanjut atau hal tersebut membuat klien khawatir rujuk ke klinik
Bila hamil, hentikan pil dan lanjutkan kehamilan. Jelaskan kepada klien bahwa minipil sangat
kecil menimbulkan kelainan pada janin.
Bila diduga terjadi kehamilan ektopik, rujuk pasien. Jangan berikan obat-obatan hormonal untuk
menimbulkan haid. Kalaupun diberikan tidak ada gunanya.
Perdarahan tidak teratur (spotting)
Penanganan :
Bila tidak menimbulkan masalah kesehatan/tidak hamil, tidak perlu tindakan khusus.
Bila klien tetap saja tidak dapat menerima kejadian tersebut, berikan alternatif kontrasepsi lain.

Penanganan efek samping dan masalah Pil kombinasi


1. Amenorea/spooting
Penanganan:
periksaan dalam atau tes kehamilan,billa tidak hamil danklien minum pil dengan benar,
tenanglah. Tidak datang haid kemungkinan besar karena kurang adekuatnya efek estrogen
terhadap endometrium.Tidak perlu pengobatan khusus. Coba berikan pil dengan dosis estrogen
50 g atau dosis estrogen tetap tetapi dosis progestin dikurangkan bila klien hamil intrauterin
hentikan pil dan yakinkan pasien, bahwa pil yang telah diminumnya tidak ada punya efek pada
janin.
2. Mual, pusing atau muntah (reaksi anafilatik)
Penanganan:
Tes kehamilan atau pemeriksaan genikologik. Bila tidak hamil, sarankan minum pil saat makan
malam atau sebelum tidur.
3. Pendarahan pervaginam/spotting
Penanganan:
Tes Kehamilan atau pemeriksaan gynekologi. Sarankan minum pil pada waktu yang sama.
Jelaskan bahwa pendarahan/spotting hal yang bisa terjadi pada 3 bulan pertama, dan lambat laun
akan berhenti. Bila pendarahan atau spotting hal yang bisaterjadi,ganti pil dengan dosis estrogen
lebih tinggi sampai pendarahan teratasi, lalu kembali ke dosis awal. Bila pendarahan timbul lagi
lanjutkan lagi dengan dosisi 50ug atau ganti dengan metode kontrasepsi lain.
B. Penanganan Efek Samping dan Masalah Suntik Progestin

1. Amenore ( tidak terjadi perdarahan atau spotting )


Bila tidak hamil, pengobatan apapun tidak perlu. Jelaskan bahwa darah haid tidak terkumpul
dalam Rahim. Nasihati untuk kembali keklinik.
Bila telah terjadi kehamilan, rujuk klien, hentikan penyuntikan.
Bila terjadi kehamilan ektopik, rujuk klien segera
Jangan berikan terapi hormonal untuk menimbulkan perdarahan karena tidak akan berhasil.
Tunggu 3-6 bulan kemudian, bila tidak terjadi perdarahan juga rujuk ke klinik.
2. Perdarahan/perdarahan bercak ( spotting )
Informasikan bahwa perdarahan ringan sering dijumpai, tetapi hal ini bukanlah masalah serius
dan biasanya tidak memerlukan pengobatan. Bila klien tidak dapat menerima perdarahan tersebut
dan ingin melanjutkan suntikan, maka dapat disarankan 2 pilihan pengobatan
1 siklus pil kontrasepsi kombinasi ( 30-35 g etinilestradiol ), ibuprofen ( sampai 800 mg,
3x/hari untuk 5 hari ), atau obat sejenis lain. Jelaskan bahwa selesai pemberian pil kontrasepsi
kombinasi dapat terjadi perdarahan. Bila terjadi perdarahan banyak selama pemberian suntikan
ditangani dengan pemberian 2 tablet pil kontrasepsi kombinasi/hari selama 3-7 hari dilanjutkan
dengan 1 siklus pil kontrasepsi hormonal atau diberi 50 g etinilestradiol atau 1,25 mg esterogen
equin konjugasi untuk 14-21 hari.
3. Meningkatnya/menurunnya berat badan

Informasikan bahwa kenaikkan/penurunan berat badan sebanyak 1-2 kg dapat saja terjadi.
Perhatian diet klien bila perubahan berat badan terlalu mencolok. Bila berat badan berlebihan,
hentikan suntikan dan anjurkan metode kontrasepsi lain.
Suntik kombinasi
Keadaan
Anjuran
Tekanan darah tinggi
<180/110 mmHg dapat diberikan,
tetapi perlu pengawasan
Kencing manis
Dapat diberikan pada kasus tanpa
komlpikasi dan kencing manisnya
terjadi < 20 tahun, perlu di awasi
Migraine
Bila tidak ada gejala neurologic
yang berhubungan dengan sakit
kepala, boleh diberikan
Menggunakan obat tuberculosis/obat epilepsy
Mempunyai penyakit anemia bulan sabit
( sickle sell )

C. Penanganan Efek Samping Atau Masalah yang Sering Ditemukan Implan


1. Amenorea
Penanganan :
Pastikan hamil atau tidak, dan bila tidak hamil, tidak memerlukan penanganan khusus, cukup
konseling saja

Bila klien tetap saja tidak dapat menerima, angkat implant dan anjurkan menggunakan
kontrasepsi lain

Bila terjadi kehamilan dan klien ingin melanjutkan kehamilan, cabut implant dan jelaskan,
bahwa progestin tidak berbahaya bagi janin. Bila diduga terjadi kehamilan ektopik, klien dirujuk.
Tidak ada gunanya memberikan obat hormone untuk memancing timbulnya perdarahan.
2. Perdarahan bercak (spotting) ringan
Jelaskan bahwa perdarahan ringan sering ditemukan terutama pada tahun pertama. Bila tidak
ada masalah dank lien tidak hamil, tidak diperlukan tindakan apapun. Bila klien tetap saja
mengeluh masalah perdarahan dan ingin melanjutkan pemakaian implant dapat diberikan pil
kombinasi 1 siklus, atau ibu profen 3 x 800 mg selama 5 hari. Terangkan kepada klien bahwa
akan terjadi perdarahan setelah pil kombinasi habis. Bila terjadi perdarahan lebih banyak dari
biasa, berikan 2 tablet pil kombinasi untuk 3-7 hari dan kemudian dilanjutkan dengan 1 siklus pil
kombinasi, atau dapat juga diberikan 50 g etinilestradiol, atau 1,25 mg esterogen equin
konjugasi untuk 14-21 hari.
3. Ekspulsi

Cabut kapsul yang ekspulsi, periksa apakah kapsul yang lain masih ditrempat dan apakah
terdapat tanda-tanda infeksi didaerah insersi. Bila tidak ada infeksi dan kapsul lain masih berada
pada tempatnya, pasang kapsul baru 1 buah pada tempat insersi yang berbeda. Bila ada infeksi
cabut seluruh kapsul yang ada dan pasang kapsul baru pada lengan yang lain atau anjurkan klien
menggunakan kontrasepsi lain.
4. Infeksi pada daerah insersi

Bila terdapat infeksi tanpa nanah, bersihkan dengan sabun dan air atau antiseptic. Berikan
antibiotic yang sesuai untuk 7 hari. Implant jangan dilepas dan klien diminta kembali 1 minggu.
Apabila tidak membaik, cabut implant dan pasang yang baru pada sisi lengan yang lain atau cari
metode kontrasepsi yang lain. Apabila ditemukan abses, bersihkan dengan antiseptic, insisi dan
alirkan pus keluar, cabut implant, lakukan perawatan luka, berikan antibiotic oral 7 hari.
5. Berat badan naik atau turun
Informasikan kepada klien bahwa perubahan berat badan 1-2 kg adalah normal. Kaji ulang diet
klien apabila terjadi perubahan berat badan 2 kg atau lebih. Apabila perubahan berat badan ini
tidak dapat diterima, bantu klien mencari metode lain.
D. AKDR Progestin
Penanganan efek samping atau masalah yang sering dijumpai
1. Amenore
Pastikan hamil atau tidak. Bila klien tidak hamil, AKDR tidak perlu dicabut, cukup konseling
saja. Salah satu efek samping menggunakan AKDR yang mengandung hormone adalah

2.

3.

4.

5.

amenorea ( 20-50 % ). Jika klien tetap saja menganggap amenorea yang terjadi sebagai masalah,
maka rujuk klien. Jika terjadi kehamilan kurang dari 13 minggu dan benang AKDR terlihat,
cabut AKDR. Nasihatkan agar kembali keklinik jika terjadi perdarahan, kram, cairan vagina
berbau, atau demam. Jangan mencabut AKDR jika benang tidak kelihatan dan kehamilannya
lebih 13 minggu. Jika klien hamil dan ingin meneruskan kehamilannya tanpa mencabut AKDR
nya, jelaskan kepadanya tentang meningkatnya resiko keguguran, kehamilan preterm, infeksi dan
kehamilannya harus diawasi ketat.
Kram
Pikirkan kemungkinan terjadi infeksi dan beri pengobatan yang sesuai. Jika kram nya tidak
parah dan tidak ditemukan penyebabnya, cukup diberi analgetik saja. Jika penyebabnya tidak
dapat ditemukan dan menderita kram berat, cabut AKDR, kemudian ganti dengan AKDR baru
atau cari metode kontrasepsi lain.
Perdarahan yang tidak teratur dan banyak
Sering ditemukan terutama pada 3-6 bulan pertama. Singkirkan infeksi panggul atau kehamilan
ektopik, rujuk klien bila dianggap perlu. Bila tidak ditemukan kelainan patologik dan perdarahan
masih terjadi, dapat diberi ibuprofen 3 x 800 mg untuk 1 minggu, atau pil kombinasi 1 siklus
saja. Bila perdarahan banyak beri 2 tablet pil kombinasi untuk 3-7 hari saja, atau boleh juga
diberi 1,25 mg esterogen equin konjugasi selama 14-21 hari. Bila perdarahan terus berlanjut
sampai klien anemia, cabut AKDR dan bantu klien memilih metode kontrasepsi lain.
Benang hilang
Periksa apakah klien hamil. Bila tidak hamil dan AKDR masih ditempat, tidak ada tindakan
yang perlu dilakukan. Bila tidak yakin AKDR masih berada didalam Rahim dan klien tidak
hamil, maka klien dirujuk untuk dilakukan pemeriksaan rontgen ( USG ). Bila tidak ditemukan,
pasang kembali AKDR sewaktu datang haid. Jika ditemukan kehamilan dan benang AKDR tidak
kelihatan, lihat penanganan amenorea.
Cairan vagina atau dugaan penyakit radang panggul
Bila penyebabnya kuman gonococcus atau klamidia, cabut AKDR dan berikan pengobatan yang
sesuai. Penyakit radang panggul yang lain cukup diobati dan AKDR tidak perlu dicabut. Bila
klien dengan penyakit radang panggul dan tidak ingin memakai AKDR lagi, berikan antibiotic
selama 2 hari dan baru kemudian AKDR dicabut dan bantu klien untuk memilih metode
kontrasepsi lain.

E. AKDR Non Hormonal


Penanganan efek samping atau masalah yang sering dijumpai
1. Amenorea
Periksa apakah sedang hamil, apabila tidak, jangan lepas AKDR, laukakn konseling dan selidiki
penyebab amenorea apabila tidak dikehendaki. Apabila hamil, jelaskan dan sarankan untuk
melepas AKDR apabila talinya terlihat dan kehamilan kurang dari 13 minggu. Apabila benang
tidak terlihat atau kehamilan lebih dari 13 minggu ,AKDR jangan dilepaskan. Apabila klien
sedang hamil, dan ingin mempertahankan kehamilanya tanpa melepas AKDR menjelaskan
adanya risiko kemungkinan terjadinya kegagalan kehamilan dan infeksi serta perkembangan
kehamilan harus diperhatikan.
2. Kejang

Pastikan dan tegaskan adanya penyakit radang panggul dan penyebab lain dari kekejangan.
Tanggulangi penyebabnya apabila ditemukan. Apabila tidak ditemukan penyebabnya beri
analgetik untuk sedikit meringankan. Apabila klien mengalami kejang yang berat,lepaskan
AKDR dan bantu klien menentukan metode kontrasepsi yang lain.
3. Perdarahan vagina yang hebat dan tidak teratur
Pastikan dan tegaskan adanya infeksi pelvik dan Kehamilan ektopik, apabila tidak ada kelainan
patologis, perdarahan berkelanjutan serta perdarahan hebat, lakukan konseling dan pemantauan.
Beri ibuproven (800 mg, 3 x sehari selama 1 minggu). Untuk mengurangi perdarahan dan
berikan tablet besi(1 tablet setiap hari selama 1-3 bulan).
4. Benang yang hilang
Pastikan adanya kehamilan atau tidak. Tanyakan apakah AKDR terlepas. Apabila tidak hamil
dan AKDR tidak lepas, berikan kondom. Periksa talinya di dalam saluran endoserviks dan

kavum uteri (apabila memungkinkan adanya peralatan dan tenaga terlalu letih) setelah masa haid
berikutnya. Apabila tidak ditemukan rujuklah ke dokter.
5. Adanya pengeluaran cairan dari vagina atau dicurigai ada PRP

Pastikan pemeriksaan untuk IMS.lepaskan AKDR apabila ditemukan menderita atau sangat
dicurigai menderita GO atau infeksi clamidia, lakukan pengobatan yang memadai.
DAFTAR PUSTAKA
Saifuddin, Abdul Bari.2006.Buku Panduan Praktis Pelayanan Kontrasepsi.Jakarta:Yayasan Bina
Pustaka Sarwono Prawirohardjo
12. indikasi pemakaian kontrasepsi?

13. hubungan siklus haid yang tak teratur dengan kb 3 bulan?


BISA MEMEMNGARUHI SIKLUS MENS YAITU LAMBAT DAN TDK TERATUR DAN BISA
TRJADI PERDARAHAN DILUAR MENS, SUHU TUBUH NAIK, LIANG SENGGAMA KERING.
Suntikan kb 3 bulan mengandung progesteron 150mg disuntikan tiap 3 bulan sekali
sehingga mes lambat dan tak teratur.