Anda di halaman 1dari 16

CorPulmonaleetcausaPPOK

ChatrineWijanarko
NIM:102012158Kelompok:E5
FakultasKedokteranUniversitasKristenKridaWacana2012,Jl.ArjunaUtaraNo.6
Jakarta11510,Telp:02156942061,Fax:021563173
email:Chatrine.wijanarko@yahoo.com
Pendahuluan
LatarBelakang
Jantung adalah sebuah organ berotot dengan empat ruang yang terletak di
ronggadadadibawahperlindungantulangiga,sedikitkesebelahkiristernum.Ukuran
jantunglebihkurangsebesargenggamantangankanandanberatnyakirakira250300
gram. Jantung mempunyai empat ruang yaitu atrium kanan, atrium kiri, ventrikel
kanan,danventrikelkiri.
Kor pulmonal menurut WHO adalah perubahan pada struktur dan fungsi
ventrikelkanan.Terdapatnyaedemadangagalnapasjugadiajukanuntukmenetapkan
adanyakorpulmonalsecaraklinis.WalaupunprevalensiPPOKdiAmerikaSerikat
adalahkirakira15juta,prevalensipastidarikorpulmonalsulituntukditentukan,
karena ia tidak muncul pada semua kasus PPOK, serta karena kurang sensitifnya
pemeriksaan fisik dan uji rutin untuk deteksi hipertensi pulmonal. Kor pulmonal
diperkirakanterdapatsebanyak67%darisemuajenispenyakitjantungdewasadi
AS,denganPPOKakibatbronkhitis kronikatauemfisemasebagaifaktorkausatif
pada lebih dari 50% kasus. Secara global, insiden kor pulmonal bervariasi antar
negara, tergantung pada prevalensi merokok, polusi udara, dan faktor risiko lain
terkaitpenyakitparuparu.
Korpulmonaldapatdisebabkanadanyahipertensipulmonalyangdiakibatkan
oleh penyakit yang menyerang paru atau vaskularisasinya. Hipertensi pulmonal
menghasilkan pembesaran ventrikel kanan (hipetrofi atau dilatasi) dan berlanjut
menjadigagaljantungkanan.PenyakitParuObstruktifKronik(PPOK)merupakan
penyebabutamainsufisiensirespirasikronik,kirakira8090%kasus.

Sebagianbesarkondisiyangmenyebabkankorpulmonalbersifalkronikdan
progresiflambat,namunpasienbisadatangdengangejalaakutdanmembahayakan
jiwa.Dekompensasimendadaktersebutmunculketikaventrikelkanantidakmampu
mengkompensasi pada pemaksaan kebutuhan tambahan yang tibatiba, yang
diakibatkanolehprogresifitasdaripenyakitdasaratauprosesakutyangmakinberat.
Tingginyaangkakematianyangdapatterjadiakibatpenyakitinimakapenegakkan
diagnosisharuslahdengantepatdansegera.Adanyapenegakkandiagnosisyangtepat
dapatmengurangiangkakematianolehkarenapenyakitini.Olehkarenapentingya
menegakkandiagnosis yang tepat dansegeramakaoleh sebabitu kami membuat
refratdenganjudulKorPulmonaleKronikini.
RumusanMasalah
Seoranglakilakiusia50tahundatangkedokterdengankeluhansesaknafas
yangsemakinmemberatsejak5hariyanglalu.
Hipotesis
Seoranglakilaki50tahunsesaknafaskarenaterkenaCorPumonaleetcausa
PPOK.
Pembahasan
AnatomidanFisiologiJantung
Jantung adalah sebuah organ berotot dengan empat ruang yang terletak di
ronggadadadibawahperlindungantulangiga,sedikitkesebelahkiristernum.Ukuran
jantunglebihkurangsebesargenggamantangankanandanberatnyakirakira250300
gram. Jantung mempunyai empat ruang yaitu atrium kanan, atrium kiri, ventrikel
kanan,danventrikelkiri.Atriumadalahruangansebelahatasjantungdanberdinding
tipis,sedangkanventrikeladalahruangansebelahbawahjantung.danmempunyai
dindinglebih tebal karena harus memompa darah ke seluruh tubuh. Atrium kanan
berfungsisebagaipenampungdarahrendahoksigendariseluruhtubuh.Atriumkiri

berfungsimenerimadarahyangkayaoksigendariparuparudanmengalirkandarah
tersebutkeparuparu.1
Ventrikelkananberfungsimenerimadarahdariatriumkanandanmemompak
annyakeparuparu.Ventrikelkiriberfungsiuntukmemompakandarahyangkaya
oksigenkeseluruhtubuh.Jantungjugaterdiridaritigalapisanyaitulapisanterluar
yangmerupakanselaputpembungkusdisebutepikardium,lapisantengahmerupakan
lapisanintidarijantungterdiridariototototjantungyangdisebutmiokardiumdan
lapisanterluaryangterdiridarijaringanendotelyangdisebutendocardium.1
Siklus jantung merupakan kejadian yang terjadi dalam jantung selama
peredarandarah.Gerakanjantungterdiridari2jenissyaitu(sistolik)danrelaksasi
(diastolik). Sistolik merupakan sepertiga dari siklus jantung. Kontraksi dari ke2
atrium terjadi secara serentak yang disebut sistolik atrial dan relaksasinya disebut
diastolikatrial.Lamakontraksiventrikel0,3detikdantahaprelaksasinyaselama
0,5detik.Kontraksikeduaatriumpendek,sedangkankontraksiventrikellebihlama
danlebihkuat.Dayadorongventrikelkiriharuslebihkuatkarenaharusmendorong
darah ke seluruh tubuh untuk mempertahankan tekanan darah sistemik. Meskipun
ventrikelkananjugamemompakandarahyangsamatapitugasnyahanyamengalirkan
darahkesekitarparuparuketikatekanannyalebihrendah.1
Curah jantung merupakan volume darah yang di pompa tiap ventrikel
permenit. Pada keadaan normal(fisiologis) jumlahdarah yangdipompakanoleh
ventrikel kanandan ventrikel kiri sama besarnya. Bila tidak demikian akan terjadi
penimbunandarahditempattertentuJumlahdarahyangdipompakanpadasetiapkali
sistolikdisebutvolumesekuncup.
Dengan

demikian

curah

jantung

volume

sekuncupxfrekuensidenyutjantungpermenit.Umumnyapadatiapsistolikventrikel
tidakterjadi pengosongan ventrikel,hanyasebagiandari isi ventrikel
yangdikeluarkan.Jumlahdarahyangtertinggalinidinamakanvolumeresidu.Besar
curahjantungseseorangtidakselalusama,bergantungpadakeaktifantubuhnya.Curah
jantung orang dewasa dalam keadaan istirahat lebih kurang 5 liter dan dapat
meningkatatomenurundalamberbagaikeadaan.1
Pada saat jantung normal dalam keadaan istirahat, maka pengaruh sistem
parasimpatis dominan dalam mempertahankan kecepatan denyut jantung sekitr 60

hingga 80 denyut per menit. Kecepatan denyut jantung dalam keadaan sehat
dipengaruhi oleh pekerjaan, tekanan darah, emosi, cara hidup, dan umur. Pada
keadaannormaljumlahdarahyangdipompakanolehventrikelkanandanventrikelkiri
samasehinggatidakterjadipenimbunan.1

Definisi
Istilah kor pulmonal masih sangat populer dalam literatur medis, namun
definisinya masih bervariasi. Kirakira empat puluh tahun yang lalu WHO
mendefinisikan kor pulmonal sebagai hipertrofi ventrikel kanan yang disebabkan
olehpenyakityangmempengaruhifungsidan/ataustrukturparuparu.Definisiini
nyatanya memiliki nilai terbatas dalam klinis praktis. Sehingga diajukan untuk
menggantiistilahhipertrofidenganperubahanpadastrukturdanfungsiventrikel
kanan.Terdapatnyaedemadangagalnapasjugadiajukanuntukmenetapkanadanya
korpulmonalsecaraklinis.2
Kor pulmonal disebabkan oleh hipertensi pulmonal yang diakibatkan oleh
penyakit yang menyerang paru atau vaskularisasinya. Hipertensi pulmonal
menghasilkan pembesara pembesaran ventrikel kanan (hipetrofi atau dilatasi) dan
berlanjut dengan berjalannya waktu menjadi gagal jantung kanan. Penyakit Paru
ObstruktifKronik(PPOK)merupakanpenyebabutamainsufisiensirespirasikronik,
kirakira 8090% kasus. Penyakit jantung kanan yang disebabkan oleh penyakit
primerpadajantungkiriataupenyakitjantungkongenitaltidakdiperhitungkan.3
Sebagianbesarkondisiyangmenyebabkankorpulmonalbersifalkronikdan
progresiflambat,namunpasienbisadatangdengangejalaakutdanmembahayakan
jiwa.Dekompensasimendadaktersebutmunculketikaventrikelkanantidakmampu
mengkompensasi pada pemaksaan kebutuhan tambahan yang tibatiba, yang
diakibatkanolehprogresifitasdaripenyakitdasaratauprosesakutyangmakinberat.3
Epidemiologi
Walaupun prevalensi PPOK di Amerika Serikat adalah kirakira 15 juta,
prevalensipastidarikorpulmonalsulituntukditentukan,karenaiatidakmunculpada

semuakasusPPOK,sertakarenakurangsensitifnyapemeriksaanfisikdanujirutin
untukdeteksihipertensipulmonal.Korpulmonaldiperkirakanterdapatsebanyak67
%darisemuajenispenyakitjantungdewasadiAS,denganPPOKakibatbronkhitis
kronik atau emfisema sebagai faktor kausatif pada lebih dari 50% kasus. Secara
global, insiden kor pulmonal bervariasi antar negara, tergantung pada prevalensi
merokok,polusiudara,danfaktorrisikolainterkaitpenyakitparuparu.4

Etiologi
Korpulmonalkronikadalahkeadaandisfungsiyangdiakibatkanolehberbagai
etiologidanmekanismepatofisiologi(tabel1):
1)
2)
3)
4)

Vasokonstriksiparu(sekunderdarihipoxiaalveolaratauasidosis)
Reduksianatomidaridasarpembuluhdarahparu(emfisema,emboliparu,dll)
Peningkatanviskositasdarah(polisitemia,sicklecelldisease,dll)
Peningkatanalirandarahparu
Penyebab paling banyak pada kor pulmonale kronik adalah Penyakit Paru

Obstruktif Kronik (PPOK) meliputi bronkitis kronik atau emfisema. Pada pasien
PPOKtejadipeningkataninsidensidarikelainanventrikelkananyangberhubungan
denganpeningkatan keparahan daridisfungsiparu. Contohnyahipertropiventrikel
kananyangterjadisebanyak40%padapasiendenganFEV<1.0Ldanpada70%
denganFEV1<0.6L.
Patofisiologi
Kelainanfisiologispadakelompokpenyakitiniberhubungandenganfungsi
respirasidandapatjugaberhubungandenganhemodinamikpadasirkulasipulmonal
yangdapatdiklasifikasikansebagiberikut:
1) Gangguanfungsirespirasi
Penurunanfungsirespirasiyangberhubungandengan4bagian:
a) Kelainanventilasiobstruksi
Kelainansepertiobstruksialiranudarapadatrakeobronkhial.
b) Kelainanventilasipenyempitan
Kelainanreduksidarikapasitasventilatortanpaobstruksidarialiranudara
c) Kelainanpadadifusiudarapulmonal

Kelainan pertukaran udara antara alveoli dan kapiler darah pulmonal yang
berhubungandengankelainananatomiataufungsional.
2) Reduksipadarasioventilasidanperfusi
Hasil akhir dari kelainan fungsional jantung dan paru terlihat dari tekanan
oksigendankarbondioksidadaraharteri.Interaksibeberapagangguanpadafungsi
terlihat pada beberapa penyakit, contohnya pada bronkitis kronik dengan
emfisemapadagangguanobstruksiventilasiudaratapiiniberhubungandengan
tingkat kerusakan pada difusi udara pada pulmonal dan reduksi pada rasio
ventilasi dan perfusi. Pada fibrosis pulmonal yang berat kelainan yang terjadi
beruparestriksipadaventilasiudaratapibisajugaberhubungandenganreduksi
padadifusiudaradanrasioperfusiventilasi.
3) Kelainanhemodinamikpadasirkulasipulmonal
Resistensi pembuluh darah pulmonal pada tekanan darah dan aliran darah
dapatberhubungandengankerjapadaventikelkanan.Hipertopiventrikelkanan
pada kor pulmonale kronik berasal dari peningkatan kerja yang behubungan
denganberubahnyahemodinamikpadasirkulasiparu.Sepertimekanismeyang
trjadipadaorangnormalsaatberolahraga.Dimanaterjadiperubahanalirandan
tekanan untuk mengkompensasi kebutuhan tubuh. Peningkatan resistensi
pembuluhdarahparudapatberhubungandengan:
a) Obstruksipadapembuluhdarahpulmonal
Sepertipadatrombosis,embolimengakibatkanperubahanyangterjadipada
dindingpembuluhdarahyangakhirnyaterjaditekanandariluarkedinding
pembuluhdarah.
b) Reduksi ukuran dari dasar pembuluh kapiler pulmonal yang terjadi pada
reseksiparuatauemfisema.
c) Perubahanfungsionaldimanaterjadiperubahanpadakemampuanpembuluh
darahpulmonaldanefeknyayangberhubunganantarakapasitaspadadasar
pembuluhdarahdanalirandarahatauvolume.
Faktor penyebab yang bervariasi akan menghasilkan peningkatan resistensi
pembuluhdarahpulmonalyangberhubungandenganbervariasinyaderajatpenyakit
yang terjadi berdasarkan penyakit primer yang mendasari tersebut. Perubahan
Fungsional tampak pada seringnya terjadi hipoksemi yang berhubungan dengan
kelainanpadafungsirespirasi.Faktorfaktorpentinglainnyabisaterjadipdatekanan
karbondioksidaadanyashuntsdanfaktordarahitusendiriyangmembuatterjadinya
perubahanpadajantungdanparu.

Padabanyakkasus,mekanismeterjadinyakorpulmonalkronikberhubunganjuga
dengan hipertensi pulmonal. Pada emfisema, contohnya, banyak kombinasi dari
penyebabpenyakitiniyangdapatmenyebabkanterjadinyapenyakitkorpulmonale
kronik.Yaitusepertiterjadinyakompresipembuluhdarahkapilerdenganpeningkatan
tekanan intraalveolar, vasokonstriksi sekunder hingga terjadinya hipoksemia dan
hiperkapnia,hipervolemiadanpolisitemiadanpeningkatanoutputjantung.
Padabronkitisakanmenyebabkanterjadinyahipoventilasialveolar,peningkatan
efekdarihipoksemiadanhiperkapnia.Kelainaninidapatterlihatpadafungsirespirasi
danresistensipembuluhdarahpulmonalyangseringterjadipadapenyakityangsama.
Penyakityangmendasariiniyangdapatsalingberkorelasisehinggamenjadipenyakit
korpulmonalkronik.
Curah jantung dari ventrikel kanan dann kiri disesuaikan dengan preload,
kontraktilitasdanafterload.Meskidindingventrikelkanantipis,namunmasihdapat
memenuhikebutuhansaatterjadialiranbalikvenayangmeningkatmendadak(seperti
saatmenariknapas).6
Peningkatan afterload akan menyebabkan pembesaran ventrikel kanan yang
berlebihan. Hal ini terjadi karena tahanan di pembuluh darah paru sebagai akibat
gangguan pembuluh darah itu sendiri maupun akibat kerusakan parenkim paru.
Peningkatanafterloadventrikelkanandapatterjadikarenahiperinflasiparuakibat
PPOK dimana terjadi kompresi kapiler alveolar dan perubahan ukuran pembuluh
darahparu.Peningkataninijugadapatterjadiketikavolumeparuturunmendadak
akibatreseksiparu.Padaretriksiparuketikapembuluhdarahmengalamikompresi
danberubahbentukmakadapatjugaterjadipeningkatanafterloadventrikelkanan.
Dapat juga terjadi peningkatan afterload ventrikel kanan pada vasokonstriksi paru
denganhipoksiaatauasidosis.6
Perubahan hemodinamik kor pulmonal paru pada PPOK dari normal menjadi
hipertensipulmonal,korpulmonaldanakhirnyamenjadikorpulmonalyangdiikuti
dengangagaljantung.6Teoriyanglaindapatditerimayaituterjadinyakorpulmonale
kronik adalah karena terjadinya hipoksia alveolar yang mendasari terjadinya
remodelingpadadasarpembuluhdarahparu(hipertropipadaototpadapembuluh
darahkapilerparu,pembentukanototpadapembuluhdaraharteriolpadaparudan
fibrosispadatunikaintima)bergabungdengankelainanlainnya.Remodellinginiakan

membuat peningkatan resistensi pembuluh darah paru dan akhirnya menjadi


hipertensipulmonal.Seringnyaremodellingpadapembuluhdarahparudapatdilihat
pada pasien PPOK non hipoksemia dengan derajat penyakit sedang hingga berat.
Faktor fungsional lainnya akan saling berhubungan. Seperti terjadinya asidosis
hiperkapniadanhiperviskositasyangdisebabkanolehpolisitemia.7
Pada idiopatik fibrosis pulmonal peningkatan resistensi pembuluh darah paru
dikarenakanfaktoranatomissepertiterjadinyakerusakandasarpembuluhdarahparu
ataukompresiarterioldankapilerolehkarenaprosesfibrosis.Hipertensipulmonal
meningkatkan kerja ventrikel kanan dimana akan menyebabkan terjadinya
pembesaran ventrikel kanan (hipertropi dan dilatasi) yang akhirnya akan terjadi
disfungsi ventrikular (sistolik dan diastolik). Yang akhirnya dapat menyebabkan
terjadinyagagaljantungkanan.Dapatterlihatpadaterjadinyaudemperifer.Interval
onsetantarahipertensipulmonaldanterjadinyagagaljantungkanandapatbervariasi
padatiappasien.7
Diagnosis
Anamnesis
Tidakadagejalaklinisyangkhasyangterjadiberhubungandenganhipertropi
ventrikel kanan. Gejala klinis yang terlihat adalah berupa hipertensi pulmonal,
termasukadanyadispnusaatberaktivitas,fatig,letargi,nyeridadadansinkope.
Fatig, letargi dan sinkope saat beraktivitas merupakan pengaruh dari
peningkatanoutputjantungselamatekanansaatberaktivitastersebutkarenaobstruksi
pembuluhdarahpadaarteriolparu.Anginatipikalakandapatterlihat.Mekanisme
terjadinyaanginabelumterlalujelas,sesuaidengantekananpadaarteridaniskemik
ventrikelkananyangdapatterlihat.Iskemikventrikelkanandapatdiakibatkanoleh
hipoksemiaselamaberaktivitassehinggadapatterjadinyaangina.
DiagnosiskorpulmonalditegakkandenganmenemukantandaPPOK;asidosis
danhiperkapnia,hipoksia,polisitemiadanhiperviskositasdarah,hipertensipulmonal
(diketahui dengan adanya gambaran EKG P pulmonale dengan deviasi aksis ke
kanan.PadafotoThoraksterdapatpelebarancabangparudihilus),hipertrofi/dilatasi
ventrikel kanan dan gagal jantung kanan (ditegakkan dengan adanya peningkatan

tekananvenajugularis,hepatomegali,asitesmaupunedematungkai).2Anamnesis
mungkin ditemukan adanya sesak nafas, riwayat batuk yang sudah lama, batuk
berdarahdannyeridada.

PemeriksaanFisik
Pada Kor Pulmonale Kronik dapat dideteksi dari hipertensi pulmonal dan
hipertropi ventrikel kanan, terkadang dapat berhubungan dengan kegagalan fungsi
ventrikelkanan.Peningkatanintensitasdarikomponenpulmonalpadasuarajantung,
akandapatdipalpasi.Padaauskultasijantungdapatterdengaradanyamurmursistolik
ejeksi, pada derajat penyakit yang lebih parah dapat terdengar adanya murmur
regurgitasi diastolik pulmonal. Hipertropi ventrikel kanan terlihat pada prominent
gelombang A pada pulsasi vena jugular. Kegagalan ventrikel kanan akan
menyebabkanterjadinyahipertensivenasistemik.Sehinggadapatterjadipeningkatan
tekananvenajugulardenganprominengelombangV,suaraketigaventrikelkanan
dan highpitched tricuspid regurgitant murmur. Murmur pada ventrikel kanan dan
galopterdengarpadasaatinspirasi.Padaemfisemayangberat,peningkatandiameter
AP (anteroposterior) dada sehingga membuat auskultasi akan susah didengar dan
perubahanposisiimpulseventrikelkanan.
JugularVeinPressure
Pemeriksaanvenajugularismemberikaninformasimengenaitekananatrium
kanan.Tekananvenajugularispalingbaikdinilaijikapasienberbaringdengankepala
membentuk sudut 300. Tekanan vena jugularis dinilai dalam satuan cm
H2O(normalnya52 cm) dengan memperkirakan jarak vena jugularis dari bidang
diatassudutsternal.PadaHFstadiumdini,tekananvenajugularisdapatnormalpada
waktuistirahatnamundapatmeningkatsecaraabnormalseiringdenganpeningkatan
tekanan abdomen

(abdominojugular reflux positif). Gelombangvbesar

mengindikasikankeberadaanregurgitasitrikuspid.

Pemeriksaanhepardanhepatojugularreflux
Jika ditemukan, pembesaran hati biasanya nyeri pada perabaan dan dapat
berdenyut selama systole jika regurgitasi trikuspida terjadi. Ascites sebagai tanda
lajut, terjadi sebagai konsekuensi peningkatan tekanan pada vena hepatica dan
drainasevenapadaperitoneum.Jaundice,jugamerupakantandalanjutpadaCPC,
diakibatkan dari gangguan fungsi hepatic akibat kongesti hepatic dan hypoxia
hepatoseluler,danterkaitdenganpeningkatanbilirubindirectdanindirect.
Edematungkai
Edema perifer merupakan manifestasi cardinal pada gagal jantung kanan,
namuntidakspesifikdanbiasanyatidakditemukanpadapasienyangditerapidengan
diuretic. Edema perifer biasanya sistemik dan dependen pada CPC dan terjadi
terutamapadadaerahAchillesdanpretibialpadapasienyangmampuberjalan.Pada
pasien yang melakukan tirah baring, edema dapat ditemukan pada daerah sacral
(edemapresacral)danskrotum.Edemaberkepanjangandapatmenyebabkanindurasi
danpigmentasiadakulit.
Edema pada pasien Kor Pumonale Kronik pada PPOK yang berat
berhubungandengangagaljantungkanan,padapasienyanglainudemdapatterjadi
tanpa diikuti gejala gagal jantung kanan. Hiperkapnia dapat terjadi. Berhubungan
denganadanyaretensiNapadatubuhpasien.
PemeriksaanLaboratorium
Pemeriksaanlaboratoriumdibutuhkanuntukmengetahuisejauhmanagagal
jantungkanantelahmengganggufungsifungsiorganlainseperti:hati,ginjaldan
lainlain.
Gejalayangjarangterjadiberhubungandenganhipertensipulmonal:batuk,
hemoptisis,hoarseness(penekanannervuslaringealdengandilatasiarteripulmonal)
Kegagalanjantungkananyangberatdapatmenyebabkanterjadinyakongestihepatik
yangakhirnyadapattterjadinyaanoreksidanrasatidaknyamanpadakuadrankanan
atasperut.

PemeriksaanPenunjang
1) Rontgendada
Karakteristik pada rontgen pada hipertensi arteri pulmonal terlihat adanya
pemebsesaranpadasentralarteripulmonal.Pada95%pasiendenganPPOKdan
hipertensipulmonal,diameterdaricabangkebawaharteripulmonalkananadalah
lebih besar 20mm. Gagal jantung kanan akan terlihat ventrikular kanan dan
dilatasi atrial kanan pada rontgen dada. Pembesaran ventrikular menyebabkan
penurunan ukuran retrosetenal. Bagaimanapun, beberapa kelainan yang bisa
ditemukaninidapatjugaditemukanpadakifosis,hiperinflasiparu,pembesaran
ventrikularkiri,ataupenyakitparuintersisial.
2) Elektrokardiogram
Akanterlihattandahipertropiventrikelkanan.Yaitudeviasiaksiskanandan
rasioR/Slebihdari1padaleadV1,peningkatanamplitudogelombangPpada
leadII(Ppulmoale)merupakantandapembesaranatriumkanan,inkomplitatau
komplitRightBundleBranchBlock,padaakutkorpulmonale,denganemboli
pulmonaleakut,akanterlihatgambaranklasikpadagelombangSdileadIdenan
QdanTinvertedpadaleadIII.
3) Doplerekokardiografi
Merupakanpemeriksaannoninvasifpadapenilaiantekananarteripulmonal.
Inimerupakantekhnisdenganmenghitungfungsionaltrikuspidinsufisiensiyang
selaluadapasiendenganhipertropiatrium.Maksimumregurgitasitrikuspidjet
velocityakanterekamdantekananarteripulmonalakandikalkulasikandengan
rumusBernoulli.
4) Tesfungsiparu
Padapasiendenganriwayatpenyakitparudenganfungsijantungnormal.Pada
penyakitparuintersisialyangberat(denganvolumeparudibawah50%normal)
hipertensi pulmonale sekunder, sewaktu restriksi sedang akan menyebabkan
terjadinyahipertensiarteripulmonalitusendiri.
5) BiopsiParu
Pemeriksaan patologik sering dilakukan pada intraoperative untuk melihat
ireversibelarteripulmonal.Kateterisasijantungpadapembuluhdarahpulmonal
yangresistendanresponvasodilatoryangadekuatdapatmembantuterapiyang
akandilakukan.
Tatalaksana

Terapipengobatanuntukkorpulmonalkronikadalahlebihterfokuskepada
pengobatan pada penyakit paru yang mendasari terjadinya kor pulmonal dan
memperbaiki oksigenasi dan fungsi venrikel kanan (RV) dengan meningkatkan
kontraktilitasRVdanmenurunkanvasokonstriksiparuparu.4
Terapi suportif kardiopulmonal pada pasien yangmengalami korpulmonal
akut dengan akibat kegagalan ventrikel kanan ialah pemberian cairan dan
vasokonstriktor(contohnya:epinefrin)supayatekanandarahdapatdipertahankan.
Terapi oksigen, diuretik, vasodilator , digitalis, teofilin dan terapi antikoagulasi
diberikanuntukmanajemenjangkapanjangkorpulmonal.4
Terapiuntukkorpulmonalkronik:4,6
i)

Terapi oksigen adalah penting untuk pasien yang mempunyai penyakit


paru obstruktif yang mendasari CPC contohnya PPOK Biasanya pada
CPC PaO2 adalah dibawah 55 mmHg.Terapi oksigen akan meredakan
vasokonstriksi paru kemudian akan meningkatkan kardiak output dan

ii)

memperbaikihipoksemiajaringandanmemperbaikifungsirenal.
Terapi diuretik digunakan untuk menurunkan pengisian volume
ventrikel kanan (RV) pada pasien CPC dan juga pada penyakit
berhubungan dengan edem perifer .Agen ini akan meningkatkan fungsi
pada kedua belah ventrikel tetapi diuretic mungkin menyebabkan efek
terbalik hemodinamik ketika tidak digunakan dengan hatihati.
Pengeluaran cairan yang banyak dapat menurunkan kardiak output .
Selain itu bisa juga menyebabkan hipokalemia ketika cairan banyak

iii)

dikeluarkan.
Terapivasodilator
Terapi nifedipine dan diltiazem akan menurunkan tekanan
pulmonar.Selainituadajugadigunakankelasvasodilatoryanglainyaitu
agonisbeta,nitratdanangiotensincovertingenzyme(ACE)tetapipada
umumnya vasodilator gagal menunjukkan perbaikan pada pasien yang

iv)

datingdenganPPOKjaditidakrutindigunakan
Agenglikosidakardiak
Penggunaan agen glikosida kardiak seperti digitalis pada pasien kor
pulmonal.Ageninidigunakandenganhatihatidantidakdigunakanpada
kejadian fase akut insuffisiensi respiratorik dengan level fluktuasi

hipoksiadanasidosis.Pasienyangmengalamihipoksemiaatauasidosis
adalahmeningkatresikountukterjadinyaaritmia.
v)

Teofilin
Padaefekbronkodilatorteofilindidapatkandapatmenurunkanresistensi
vaskular pulmonal dan tekanan arteri pulmonar pada pasien CPC yang
didasariolehPPOK.Theofilinmerupakanefekinotropiklemahdandengan
inimeningkatkanejeksiventrikelkanandankiri.Dosisrendahteofilinjuga
di cadangkan untuk efek anti inflamasi yang membantu untuk control

vi)

penyakitmendasariparusepertiPPOK
Warfarin
Antikoagulasidenganterapiwarfarindirekomendasikanpadapasienyang
memiliki resiko tinggi terjadinya tromboembolisme.,Pada kebaikan
antikoagulasi ini meningkat perbaikan symptom pada pasien dengan

vii)

hipertensiarteripulmonary(PAH).
Flebotomi diindikasikan pada pasien dengan CPC dan hipoksia kronik
yang disebabkan oleh polisitemia yang dapat didefinisikan ketika
hematokritny 65% atau lebih. Flebotomi digunakan untuk menurunkan
tekanan arteri pulmonal yang jelas dan menurunkan resistensi vascular
pulmonal,tetapitidakadanyabuktipeningkatansurvivalhidup.

Diagnosisbanding
Gagaljantung
Suatu keadaan yang terjadi saat jantung gagal memompakan darah dalam
jumlahyangmemadaiuntukmencukupikebutuhanmetabolisme(supplyunequalwith
demand), atau jantung dapat bekerja dengan baik hanya bila tekanan pengisian
(ventricularfilling)dinaikan.Gagaljantungjugamerupakansuatukeadaanakhir(end
stage)darisetiappenyakitjantung,termasukaterosklerosispadaarterikoroner,infark
miokardium,kelainankatupjantung,maupunkelainankongenital.
Simtomaparaklinisyangditemukanpadagagaljantungterutamaadalahdisfungsisel
jantung, antara lain mekanisme pembersihan kalsium dari sitoplasma, defisiensi
retikulum sarkoplasma beserta protein transpor CaATPase dan regulator
fosfolamban.

Hipertensipulmonal
Hipertensipulmonaladalahsuatupenyakityangditandaidenganpeningkatan
tekanandarahpadapembuluhdaraharteriparuparuyangmenyebabkansesaknafas,
pusingdanpingsanpadasaatmelakukanaktivitas.Berdasarpenyebabnyahipertensi
pulmonal dapat menjadi penyakit berat yang ditandai dengan penurunan toleransi
dalammelakukanaktivitasdangagaljantungkanan.
Hipertensi pulmonal terbagi atas hipertensi pulmonal primer dan sekunder.
Hipertensi pulmonal primer adalah hipertensi pulmonal yang tidak diketahui
penyebabnya sedangkan hipertensi pulmonal sekunder adalah hipertensi pulmonal
yangdisebabkanolehkondisimedislain.Istilahinisaatinimenjadikurangpopuler
karena dapat menyebabkan kesalahan dalam penanganannya sehingga istilah
hipertensi pulmonal primer saat ini diganti menjadi Hipertensi Arteri Pulmonal
Idiopatik.
Komplikasi
Komplikasipadakorpulmonalialahsinkop,hipoksia,kongestihepatikpasif
dankematian.4
Prognosis
Prognosis CPC bervariasi dengan penyakit patologi yang mendasarinya.
Perkembangan pada CPC adalah akibat dari penyakit pulmonar primer biasanya
memilikiprognosisyanglebihburuk.Sebagaicontoh,pasien denganPPOKyang
memicuterjadinyaCPCmemiliki30%5tahunsurvivalhidup.4
Prognosis pada kejadian akut yang disebabkan oleh embolisme pulmonar
masifataupenyakitacuterespiratorydistresssyndrome(ARDS)tidakmenunjukkan
pergantunganadaatautidakdisertaidenganCPCD.Terdapatbeberapafaktoryang
mungkinmenyebabkanmortalitidalamrumahsakittermasukyaitu:4
1. Usiamelebihi65tahun
2. tirahbaringlebihdari3hari
3. SinusTakikardia

4. Takipnue
Penutup

Istilah kor pulmonal masih sangat populer dalam literatur medis, namun

definisinya masih bervariasi. Kirakira empat puluh tahun yang lalu WHO
mendefinisikan kor pulmonal sebagai hipertrofi ventrikel kanan yang disebabkan
olehpenyakityangmempengaruhifungsidan/ataustrukturparuparu.Definisiini
nyatanya memiliki nilai terbatas dalam klinis praktis. Sehingga diajukan untuk
menggantiistilahhipertrofidenganperubahanpadastrukturdanfungsiventrikel
kanan.Terdapatnyaedemadangagalnapasjugadiajukanuntukmenetapkanadanya
korpulmonalsecaraklinis.
Tidakadagejalaklinisyangkhasyangterjadiberhubungandenganhipertropi
ventrikel kanan. Gejala klinis yang terlihat adalah berupa hipertensi pulmonal,
termasuk adanya dispnu saat beraktivitas, fatig, letargi, nyeri dada dan sinkope.
Anamnesismungkinditemukanadanyasesaknafas,riwayatbatukyangsudahlama,
batukberdarahdannyeridada.
Pada Kor Pulmonale Kronik dapat dideteksi dari hipertensi pulmonal dan
hipertropi ventrikel kanan, terkadang dapat berhubungan dengan kegagalan fungsi
ventrikelkanan.Peningkatanintensitasdarikomponenpulmonalpadasuarajantung,
akandapatdipalpasi.Padaauskultasijantungdapatterdengaradanyamurmursistolik
ejeksi, pada derajat penyakit yang lebih parah dapat terdengar adanya murmur
regurgitasi diastolik pumonal. Hipertropi ventrikel kanan terlihat pada prominent
gelombangApadapulsasivenajugular.
Pemeriksaan Penunjang meliputi rontgen dada ,elektrokardiogram, Dopler
ekokardiografi ,tes fungsi paru dan biopsi paru. Terapi pengobatan untuk kor
pulmonalkronikadalahlebihterfokuskepadapengobatanpadapenyakitparuyang
mendasariterjadinyakorpulmonaldanmemperbaikioksigenasidanfungsivenrikel
kanan(RV)denganmeningkatkankontraktilitasRVdanmenurunkanvasokonstriksi
paruparu.4

DaftarPustaka
1. ScanlonVC,SandersT.Essentialsofanatomyandphysiologyfifthedition.
2007.F.ADaviscompany.Philadelphia.Hal.274278,296
2. WeitzenblumE.ChronicCorPulmonale.Heart.2003;89:22530.
3. BhattacharyaA.CorPulmonale.JIACM.2004;5(2):12836.
4. SovariAA,Corpulmonaleoverviewofcorpulmonalemanagement.diakses
dari http:// emedicine.medscape.com/article/165139overviev pada 20 Juli
2013.
5. American HeartAssociation. Chroniccor pulmonale: Reportofanexpert
comittee.1963.hal594615
6. Harun S., Ika PW. Kor pulmonal kronik dalam Buku Ajar Ilmu Penyakit
DalamjilidIIIedisiIV.2008.Hal.169596.
7. ShujaatA.etal.PulmonaryhypertensionandchroniccorpulmonaleinCOPD.
InternationaljournalofCOPD.2007:2(3)273282.