Anda di halaman 1dari 118

BAB I

PENDAHULUAN
A. Latar Belakang

Undang-undang Nomor 32 tahun 2004 tentang Pemerintahan Daerah,


khususnya Bab XI yang mengatur mengenai Desa, telah berhasil menyempurnakan
berbagai aturan tentang Desa yang sebelumnya diatur dalam Undang-Undang
Nomor 22 Tahun 1999 tentang Pemerintahan Daerah. Namun dalam pelaksanaan
selama beberapa tahun ini muncul beberapa permasalahan yang perlu segera
dicermati. Pertama, UU 32/2004 belum secara jelas mengatur tata kewenangan
antara Pemerintah, Pemerintah Daerah dan Desa. Berdasarkan prinsip desentralisasi
dan otonomi luas yang dianut oleh UU Nomor 32/2004, Pemerintah hanya
menjalankan lima kewenangan, dan diluar lima kewenangan itu menjadi
kewenangan daerah. Dengan demikian konsepsi dasar yang dianut UU 32/2004,
otonomi berhenti di kabupaten/kota. Kosekuensinya, pengaturan lebih jauh tentang
Desa dilakukan oleh kabupaten/kota, dimana kewenangan Desa adalah kewenangan
kabupaten/kota yang diserahkan kepada Desa.
Semangat UU 32/2004 yang meletakan posisi Desa berada di bawah
Kabupaten/Kota tidak koheren dan konkruen dengan nafas lain dalam UU 32/2004
yang justru mengakui dan menghormati kewenangan asli yang berasal dari hak
asal-usul. Pengakuan pada kewenangan asal-usul ini menunjukkan bahwa UU
32/2004 menganut prinsip pengakuan (rekognisi). Kosekuensi dari pengakuan atas
otonomi asli adalah Desa memiliki hak mengatur dan mengurus rumah tangganya

sendiri berdasarkan asal-usul dan adat-istiadat setempat (self governing


community), dan bukan merupakan kewenangan yang diserahkan pemerintahan
atasan pada Desa.
Adanya dua prinsip/asas dalam pengaturan tentang Desa tentu saja
menimbulkan ambivalensi dalam menempatkan kedudukan dan kewenangan Desa.
Pertanyaan yang paling mendasar adalah apakah Desa memiliki otonomi? Ketidakjelasan kedudukan dan kewenangan Desa dalam UU 32/2004 membuatUU 32/2004
belum kuat mengarah pada pencapaian cita-cita Desa yang mandiri, demokratis dan
sejahtera. Sejak lahir UU 22/1999 otonomi (kemandirian) Desa selalu menjadi
bahan perdebatan dan bahkan menjadi tuntutan riil di kalangan asosiasi Desa
(sebagai representasi Desa), tetapi sampai sekarang belum terumuskan visi bersama
apa makna otonomi Desa. apakah yang disebut otonomi Desa adalah otonomi asli
sebagaimana menjadi sebuah prinsip dasar yang terkandung dalam UU 32/2004,
atau otonomi yang didesentralisasikan seperti halnya otonomi daerah? Ada banyak
kalangan bahwa otonomi Desa berdasar otonomi asli, yang berarti Desa mengurus
sendiri sesuai dengan kearifan dan kapasitas lokal, tanpa intervensi dan
tanggungjawab negara.
Namun ada banyak pandangan bahwa sekarang otonomi asli itu sudah hilang
sebab semua urusan pemerintahan sudah menjadi milik negara tidak ada satupun
urusan pemerintahan yang luput dari pengaturan negara bagi banyak kalangan yang
sudah melampui (beyond) cara pandang otonomi asli menyampaikan dan menuntut

pemberian (desentralisasi) otonomi kepada Desa dari negara, yakni pembagian


kewenangan dan keuangan yang lebih besar.
Pada jaman penjajahan misalnya, dalam Revenue-Instruction Pasal 14 jelas
ditegaskan bahwa Kepala Desa mempunyai kewajiban yang berkenaan dengan
pendataan Desa secara luas. Bahkan dalam Pasal 74 ditegaskan bahwa tanggung
jawab mengenai Pajak Desa adalah di tangan Kepala Desa serta berbagai
kewenangan lain misalnya dalam bidang penegakan hukum (Soetardjo, 1984: 137138). Berpangkal dari besarnya kewenangan Kepala Desa pada jaman penjajahan
ini, saat ini yang perlu diperhatikan adalah bagaimana Desa dapat berdaya
menjalankan berbagai kewenangan yang ada seperti dalam pengelolaan hutan Desa,
pasar Desa, batas Desa, perbaikan lingkungan, pengairan Desa dan lainnya.
Nilai demokrasi Desa juga diperdebatkan oleh banyak kalangan. Pertanyaan
yang selalu muncul adalah bagaimana makna demokrasi substansial dan demokrasi
prosedural yang tepat dan relevan dengan konteks lokal Desa? UU 32/2004
mengusung nilai demokrasi substansial yang bersifat universal seperti akuntabilitas,
transparansi dan partisipasi. Tentu banyak pihak menerima nilai-nilai universal ini,
mengingat Desa sekarang telah menjadi institusi modern. Tetapi tidak sedikit orang
yang selalu bertanya: apakah nilai-nilai universal itu cocok dengan kondisi lokal,
apakah orang-orang lokal mampu memahami roh akuntabilitas, transparansi dan
partisipasi dengan cara pandang lokal, atau adakah nilai-nilai dan kearifan lokal
yang bisa diangkat untuk memberi makna dan simbol akuntabilitas, transparansi dan

partisipasi. Sementara perdebatan pada aras demokrasi prosedural terletak pada


pilihan: permusyawaratan yang terpimpin atau perwakilan yang populis.
Dari sisi kesejahteraan, UU 32/2004 memang telah membawa visi
kesejahteraan melalui disain kelembagaan otonomi daerah. Semua pihak
mengetahui bahwa tujuan besar desentralisasi dan otonomi daerah adalah
membangun kesejahteraan rakyat. Pemerintah daerah mempunyai kewajiban dan
tanggungjawab besar meningkatkan kesejahteraan rakyat melalui kewenangan besar
dan keuangan yang dimilikinya. Tetapi visi kesejahteraan belum tertuang secara
jelas dalam pengaturan mengenai Desa. Berbagai pertanyaan selalu muncul terkait
dengan visi kesejahteraan Desa. Apakah UU 32/2004 sudah memberi amanat
pemulihan dan penguatan Desa sebagai basis penghidupan berkelanjutan
(sustanaible livelihood) bagi masyarakat Desa? Bagaimana hak-hak Desa untuk
mengelola sumberdaya alam lokal? Bagaimana pelayanan publik dan pembangunan
daerah yang memungkinkan keseimbangan pendekatan sektoral dengan pendekatan
spasial (Desa)? Bagaimana sebenarnya fungsi Desa bagi kesejahteraan rakyat Desa?
Apakah Alokasi Dana Desa (ADD) cukup memadai untuk membangun
kesejahteraan rakyat Desa?
Perdebatan mengenai otonomi, demokrasi dan kesejahteraan itu paralel
dengan pertanyaan fundamental tentang apa esensi (makna, hakekat, fungsi,
manfaat) Desa bagi rakyat. Apakah Desa hanya sekadar satuan administrasi
pemerintahan, atau hanya sebagai wilayah, atau hanya kampung tempat tinggal atau
sebagai organisasi masyarakat lokal? Apakah Desa tidak bisa dikembangkan dan

diperkuat sebagai entitas lokal yang bertenaga secara sosial,

berdaulat secara

politik, berdaya secara ekonomi dan bermartabat secara budaya?


Kedua, disain kelembagaan pemerintahan Desayang tertuang dalam UU
32/2004 juga belum sempurna sebagai visi dan kebijakan untuk membangun
kemandirian, demokrasi dan kesehteraan Desa. Isu keragaman, misalnya, selalu
mengundang pertanyaan tentang format dan disain kelembagannya. Meskipun UU
22/1999 dan UU 32/2004 mengedepankan keragaman, tetapi banyak kalangan
menilai bahwa disain yang diambil tetap Desa baku (default village), sehingga
kurang memberi ruang bagi optional village yang sesuai dengan keragaman lokal.
Format bakunya adalah Desa administratif (the local state government) atau disebut
orang Bali sebagai Desa Dinas, yang tentu bukan Desa adat yang mempunyai
otonomi asli (self governing community) dan bukan juga Desa otonom (local self
government) seperti daerah otonom. UU 32/2004 tidak menempatkan Desa pada
posisi yang otonom, dan tidak membolehkan terbentuknya Desa adat sendirian tanpa
kehadiran Desa administratif. Baik UU 22/1999 maupun UU 32/2004 menempatkan
Desa sebagai bagian (subsistem) pemerintahan kabupaten/kota.
Posisi Desa administratif itu membawa konsekuensi atas keterbatasan
kewenangan Desa, terutama pada proses perencanaan dan keuangan. Kewenangan
asal-usul (asli) susah diterjemahkan dan diidentifikasi karena keberagamannya.
Kewenangan dalam bidang-bidang pemerintahan yang diserahkan oleh/dari
kabupaten lebih banyak bersifat kewenangan sisa yang tidak dapat dilaksanakan
oleh Kebupaten/Kota dan mengandung banyak beban karena tidak disertai dengan

pendanaan yang semestinya. Misalnya kewenangan Desa untuk memberikan


rekomendasi berbagai surat administratif, dimana Desa hanya memberi rekomendasi
sedangkan keputusan berada di atasnya.

Keterbatasan kewenangan itu juga

membuat fungsi Desa menjadi terbatas dan tidak memberikan ruang gerak bagi
Desa untuk mengurus Tata Pemerintahannya sendiri.
Demikian juga dalam hal perencanaan pembangunan. Desa hanya menjadi
bagian dari perencanaan daerah yang secara normatif-metodologis ditempuh secara
partisipatif dan berangkat dari bawah (bottom up). Setiap tahun Desa diwajibkan
untuk menyelenggarakan Musrenbangdes untuk mengusulkan rencana kepada
kabupaten. Praktik

empiriknya proses itu tidak menjadikan perencanaan yang

partisipatif, dimana perencanaan Desa yang tertuang dalam Musrenbang, hanya


menjadi dokumen kelengkapan pada proses Musrebang ti tingkat Kabupaten/Kota.
Ketiga, Desain UU 32 Tahun 2004 tentang Desa terlalu umum sehingga
dalam

banyak hal pasal-pasal tentang Desa baru bisa dijalankan setelah lahir

Peraturan Pemerintah dan Peraturan Daerah. Kecenderungan ini membuat


implementasi kewenangan ke Desa sangat tergantung pada kecepatan dan kapasitas
Pemerintah dan pemerintah daerah dalam membuat pengaturan lebih lanjut tentang
Desa. Berdasarkan UU 32/2004 dan Peraturan Pemerintah Nomor 72 Tahun 2005
mengamanatkan ada sebanyak 18 buah Peraturan Daerah dan dua Peraturan
Bupati/Walikota yang harus dibentuk oleh kabupaten/kota.menyetujui RUU Desa
menjadiUndangUndangdalamrapatparipurnaDPRpadatanggal18Desember

2013.Selanjutnya,PresidenSusiloBambangYudhoyonopadatanggal15Januari
2014 telah menandatangani pengesahan Undang Undang Nomor 6 Tahun 2014
tentangDesatersebut(UUDesa).DalamprosespembahasandiDPRRI,perdebatan
terhadapmateriUndangUndangDesaitumemakanwaktubertahuntahun.Undang
UndangDesadibentukberdasarkanbeberapapertimbangan.Pertama,Desamemiliki
hak asal usul dan hak tradisional dalam mengatur dan mengurus kepentingan
masyarakatsetempatdanberperanmewujudkancitacitakemerdekaanberdasarkan
UndangUndangDasarNegaraRepublikIndonesiaTahun1945(UUDNRI1945).
Kedua, dalam perjalanan ketatanegaraan Republik Indonesia, Desa telah
berkembang dalam berbagai bentuk sehingga perlu dilindungi dan diberdayakan
agar menjadi kuat, maju, mandiri, dan demokratis sehingga dapat menciptakan
landasanyangkuatdalammelaksanakanpemerintahandanpembangunanmenuju
masyarakatyangadil,makmur,dansejahtera.Ketiga,Desadalamsusunandantata
carapenyelenggaraanpemerintahandanpembangunanperludiaturdenganundang
undangtersendiri.SebelumlahirnyaUndangUndangDesa,pengaturanmengenai
desadiaturdalamUndangUndangNo32Tahun2004tentangPemerintahanDaerah
(UndangUndangPemda).SejalandenganberlakunyaUndangUndangDesatersebut
maka ketentuan mengenai desa dalam UndangUndang Pemda dicabut dan
dinyatakantidakberlaku.
UndangUndang Desa disusun dengan semangat penerapan amanat
konstitusi,yaitupengaturanmasyarakathukumadatsesuaidenganketentuanPasal

18B ayat (2) dan Pasal 18 ayat (7) UUD NRI 1945, dengan konstruksi
menggabungkan fungsi self governingcommunity dengan localselfgovernment,
sehingga landasan konstitusional ini akan menjadi dasar yang kokoh bagi masa
depandesadiIndonesia.Namun,apakahpengaturandesadalamUndangUndang
Desa sudah cukup komprehensif sebagai pondasi bagi pembangunan dan
pemberdayaan desa? UndangUndang Desa terdiri dari 16 Bab dan 122 Pasal,
antaralainmengaturkedudukandanjenisdesa,penataandesa,kewenangandesa,
penyelenggaraan pemerintahan desa, hak dan kewajiban desa dan masyarakat,
keuangandanasetdesa,pembangunandesadanpembangunankawasanperdesaan,
Badan Usaha Milik Desa, kerjasama desa, serta pembinaan dan pengawasan.
DefinisidesaataudisebutdengannamalaindalamUndangUndangDesaadalah
kesatuanmasyarakathukumyangmemilikibataswilayahyangberwenanguntuk
mengatur dan mengurus urusan pemerintahan, kepentingan masyarakat setempat
berdasarkanprakarsamasyarakat,hakasalusul,dan/atauhaktradisionalyangdiakui
dan dihormati dalam sistem pemerintahan Negara Kesatuan Republik Indonesia.
Desaberkedudukandiwilayahkabupaten/kota.Substansiyangcukuppentingdalam
UndangUndangDesaadalahmengenaiasasdalamkontekspengaturandesa,antara
lainasasrekognisi,yaitupengakuanterhadaphakasalusul.
B. Arah Kebijakan baru Desa Berdasarkan Undang-Undang 6 Tahun 2014 dan
Peraturan Pemerintah No.43 Tahun 2014 tentang Desa

Asas subsidiaritas, yaitu penetapan kewenangan berskala lokal dan


pengambilan keputusan secara lokal untuk kepentingan masyarakat desa.Asas
keberagaman, yaitu pengakuan dan penghormatan terhadap sistem nilai yang
berlakudimasyarakatdesa,tetapidengantetapmengindahkansistemnilaibersama
dalamkehidupanberbangsadanbernegara.Asaskemandirian,yaitusuatuproses
yangdilakukanolehpemerintahdesadanmasyarakatdesauntukmelakukansuatu
kegiatandalamrangkamemenuhikebutuhannyadengankemampuansendiri.Asas
pemberdayaan,yaituupayameningkatkantarafhidupdankesejahteraanmasyarakat
desamelaluipenetapankebijakan,program,dankegiatanyangsesuaidenganesensi
masalahdanprioritaskebutuhanmasyarakatkewenangandesameliputikewenangan
di bidang penyelenggaraan pemerintahan desa, pelaksanaan pembangunan desa,
pembinaankemasyarakatandesa,danpemberdayaanmasyarakatdesaberdasarkan
prakarsa masyarakat, hak asal usul, dan adat istiadat desa. Kewenangan Desa
tersebutmeliputi:
a.kewenanganberdasarkanhakasalusul
b.kewenanganlokalberskaladesa;
c.kewenanganyangditugaskanolehPemerintah,PemerintahDaerahProvinsi,atau
PemerintahDaerahKabupaten/Kota;dan
d.kewenanganlainyangditugaskanolehPemerintah,PemerintahDaerahProvinsi,atau
Pemerintah Daerah Kabupaten/Kota sesuai dengan ketentuan peraturan
perundangundangan.

UndangUndang Desa mengatur mengenai penyelenggara pemerintahan desa yang


terdiridarikepaladesadanperangkatdesa.
Kepala desa memegang jabatan selama 6 (enam) tahun terhitung sejak tanggal
pelantikan.Kepaladesadapatmenjabat3(tiga)kalimasajabatansecaraberturut
turut atau tidak secara berturutturut. Masa jabatan ini berbeda dengan Undang
UndangPemerintahdaearahyangmembatasihanyadapatdipilihkembaliuntuk
(1) satu kali masa jabatan berikutnya. Perangkat desa terdiri dari sekretaris desa,
pelaksanakewilayahan,danpelaksanateknis.Perangkatdesadiangkatolehkepala
desasetelahdikonsultasikandengancamatatasnamaBupati/WalikotaKepaladesa
danperangkatdesamemperolehpenghasilantetapsetiapbulanyangbersumberdari
danaperimbangandalamAPBNyangditerimaolehkabupaten/kotadanditetapkan
dalamAPBDKabupaten/Kota.
Selainmemperolehpenghasilantetaptersebut,Kepaladesadanperangkatdesajuga
memperolehjaminankesehatandandapatmemperolehpenerimaanlainnyayangsah.
Ketentuanmengenaipendapatandantunjangankepaladesadanperangkatdesaakan
diatur lebih lanjut dalam Peraturan Pemerintah. UndangUndang Desa mengatur
mengenaikeberadaanBadanPermusyawaratanDesa(BPD)sebagailembagayang
melakukanfungsipemerintahanyanganggotanyamerupakanwakildaripenduduk
desa berdasarkan keterwakilan wilayah dan ditetapkan secara demokratis.BPD
merupakan badan permusyawaratan di tingkat desa yang turut membahas dan
menyepakatiberbagaikebijakandalampenyelenggaraanpemerintahandesa.Dalam

10

upayameningkatkankinerjakelembagaanditingkatdesa,memperkuatkebersamaan,
serta meningkatkan partisipasi dan pemberdayaan masyarakat.Pemerintah desa
dan/atauBPDmemfasilitasipenyelenggaraanmusyawarahdesaMusyawarahdesa
atau yang disebut dengan nama lain adalah forum musyawarah antara BPD,
pemerintah desa dan unsur masyarakat yang diselenggarakan oleh BPD untuk
memusyawarahkan dan menyepakati hal yang bersifat strategis dalam
penyelenggaraan pemerintahan desa. Salah satu substansi penting yang tertuang
dalamUUDesaadalahpengaturantentangkeuangandesa.UndangUndangDesa
menyatakanbahwadesamempunyaisumberpendapatanyangterdiridari:
a.pendapatanaslidesa
b.alokasianggaranAPBN
c.bagihasilpajakdaerahdanretribusidaerahKabupaten/Kota
d.alokasidanadesayangmerupakanbagiandaridanaperimbangankeuanganpusat
dandaerahyangditerimaolehKabupaten/Kota
e.bantuankeuangandariAPBDProvinsidanAPBDKabupaten/Kota
f.hibahdansumbanganyangtidakmengikatdaripihakketiga,serta
g.lainlainpendapatandesayangsah.Khususpointb,alokasianggaran
yangberasaldariAPBN,bersumberdariBelanjaPusatdenganmengefektifkan
programyangberbasisdesasecarameratadanberkeadilan.DalampenjelasanPasal
dijelaskanbahwabesaranalokasianggaranyangperuntukannyalangsungkedesa
ditentukan10%(sepuluhperseratus)daridandiluardanaTransferDaerah(ontop)

11

secara bertahap. Anggaran tersebut dihitung berdasarkan jumlah desa dan


dialokasikan dengan memperhatikan jumlah penduduk, angka kemiskinan, luas
wilayah,dantingkatkesulitangeografisdalamrangkameningkatkankesejahteraan
dan pemerataan pembangunan desa bagi kabupaten/kota yang tidak memberikan
alokasi dana desa tersebut, pemerintah dapat melakukan penundaan dan/atau
pemotongan sebesar alokasi dana perimbangan setelah dikurangi Dana Alokasi
Khusus yang seharusnya disalurkanke desa. Selanjutnya, UU Desa mengatur
mengenaiBadanUsahaMilikDesayaitubadanusahayangseluruhatausebagian
besarmodalnyadimilikiolehdesamelaluipenyertaansecaralangsungyangberasal
darikekayaandesayangdipisahkangunamengelolaaset,jasapelayanan,danusaha
lainnyauntuksebesarbesarnyakesejahteraanmasyarakatdesa.
Disamping ketentuan yang mengatur mengenai kelembagaan ekonomi desa,
terdapatlembagakemasyarakatandanlembagaadat,yangberfungsisebagaiwadah
partisipasi masyarakat desa dalam pembangunan, pemerintahan, kemasyarakatan,
danpemberdayaanyangmengarahbagiterwujudnyademokratisasidantransparansi
di tingkat masyarakat dalam pembangunan masyarakat dan desanya, serta
menciptakan akses agar masyarakat lebih berperan aktif dalam kegiatan
pembangunan.Sesuai dengan prinsip desa membangun, desa sebagai subjek
pembangunan, maka model pembangunan yang digerakkan masyarakat
(communitydrivendevelopment) berubah menjadi pembangunan yang digerakkan
olehdesaataudesamenggerakkanpembangunan(villagedrivendevelopmentVDD)

12

VDD mempunyai beberapa karakteristik (Sutoro Eko, DesaMembangun Negara


2014) Desa hadir sebagai sebuah kesatuan kolektif antara pemerintah desa dan
masyarakatdesa.

Kepentingan dan kegiatan dalam pemerintahan dan pembangunan diikat dan


dilembagakansecarautuhdankolektifdalamsistemdesa.Kemandiriandesayang
ditopang dengan kewenangan, diskresi dan kapasitas lokal.Kepala desa tidak
bertindaksebagaikepanjangantanganpemerintah,melainkanberdiridanbertindak
sebagai pemimpin masyarakat.Otoritas dan akuntabilitas pemerintah desa yang
memperolehlegitimasidarimasyarakat.Desaharusmempunyaipemerintahyangkuat
danmampumenjadipenggerakpotensilokaldanmemberikanperlindungansecara
langsung terhadap warga, termasuk kaum marginal dan perempuan yang lemah.
Demokratisasidesayangmencakup:
(a)institusionalisasinilainilaitransparansi,akuntabilitas,partisipasi,
inklusivitasdankeseteraangender
(b)institusirepresentasidandeliberalisasidan
(c) pertautan (engagement) antarpelaku di desa. Karakteristik VDD lainya yaitu
Pelembagaanperencanaandanpenganggaransecarainklusifdanpartisipatorisserta
berbasispadaasetlokal.Pembangunanberbasispadaasetpenghidupanlokal.Dana
AlokasiDesadaripemerintahsebagaibentukredistribusiekonomidarinegaradan

13

menjamin keadilan ekonomi bagi desa.Desa bermartabat secara budaya, yang


memilikiidentitasatausistemsosialbudayayangkuat,ataumemilikikearifanlokal
yang kuat untuk mengelola masyarakat dan sumberdaya lokal.Satu desa, satu
rencana,satuanggaran.Wargayangkritis,aktifdanterorganisir.Ikatanwargadalam
komunitassangatpentingtetapitidakcukup,namunbutuhwargayangaktif,melek
dansadarpolitikterhadaphakdankepentinganmereka,sertaberpartisipasidalam
penyelenggaraan pemerintahan dan pembangunan desa.Pengaturan desa dalam
UndangUndangDesasudahcukupmemadaisebagailandasanbagipembangunan
dan pemberdayaan desa, meskipun perlu peraturan pelaksanaan lebih lanjut yang
diperintahkanolehUndangUndangDesa.Denganpengaturanyangada,tujuanyang
adadiUndangUndangtersebutdapattercapaiyaitu:memberikanpengakuandan
penghormatan atas desa yang sudah ada dengan keberagamannya sebelum dan
sesudahterbentuknyaNegaraKesatuanRepublikIndonesia.
Memberikan kejelasan status dan kepastian hukum atas desa dalam sistem
ketatanegaraanRepublikIndonesia.
Melestarikan dan memajukan adat, tradisi, dan budaya masyarakat desa.Mendorong
prakarsa,gerakan,danpartisipasimasyarakatdesauntukpengembanganpotensidan
aset desa guna kesejahteraan bersama.Membentuk pemerintahan desa yang
profesional, efisien dan efektif, terbuka, serta bertanggung jawab.Meningkatkan
pelayanan publik bagi warga masyarakat desa guna mempercepat perwujudan
kesejahteraanumum.Meningkatkanketahanansosialbudayamasyarakatdesaguna

14

mewujudkan masyarakat desa yang mampu memelihara kesatuan sosial sebagai


bagian dari ketahanan nasional.Memajukan perekonomian masyarakat desa serta
mengatasi kesenjangan pembangunan nasional.Memperkuat masyarakat desa
sebagaisubjekpembangunanUndangUndangDesamemberikanharapanyangbesar
bagi kemajuan dan kesejahteraan masyarakat dan pemerintahan desa. Undang
Undang Desa diharapkan dapat menjawab berbagai permasalahan di desa yang
meliputi aspek sosial, budaya, ekonomi, serta memulihkan basis penghidupan
masyarakat desadanmemperkuat desasebagai entitas masyarakat yangkuatdan
mandiri.Desajugamenjadiujungtombakdalamsetiappelaksananpembangunandan
kemasyarakatan. Sehingga, UndangUndang Desa juga dimaksudkan untuk
mempersiapkan desa dalam merespon proses demoktratisasi, modernisasi, dan
globalisasiyangterusberkembangtanpakehilanganjatidirinya. DenganUndang
Undang,desainiakanlayaksebagaitempatkehidupandanpenghidupan.(Mendagri
GamawanFauzi,2014)Bahkanlebihdariitu,desaakanmenjadifondasipenting
bagikemajuanbangsadannegaradimasayangakandatang.LebihlanjutUndang
UndangDesamengangkatdesapadaposisisubjekyangterhormatdalamkehidupan
berbangsadanbernegara,karenaakanmenentukanformatdesayangtepat sesuai
dengankontekskeragamanlokal,sertamerupakaninstrumenuntukmembangunvisi
menujukehidupanbarudesayangmandiri,demokratisdansejahtera.Membangun
danmemberdayakandesaartinyamembangunNegara.
1.2 Maksud dan Tujuan

15

Pengkajian ini bermaksud melakukan analisis terhadap kondisi eksisting


pemerintahan Desa yang berada Kabupaten Pandeglang dan menyusun desain
Naskah akadamik bagi Pemerintah Kabupaten Pandeglang sebagai dasar akan di
kelurakanya Rancangan peraturan Daerah tentang Pemilihan Kepala Desa, Peraturan
Desa, Keuangan Desa,dan Pemerintahan Desa.
Tujuan pengkajian ini adalah :
1. Untuk menyusun Naskah kajian yang di sesuaikan dengan kebutuhan Rancangan
Peraturan Daerah khususnya Raperda Tentang Peraturang Desa, Pemilhan
Kepala Desa, Keuangan Desa dan Pemerintahan Desa
2. Menganalisis Perbandingan Undang-Undang32 Tahun 2004 dan UndangUndang Desa Nomor 6 Tahun 2014 dan Menganalisi Perbandingan antara
Peraturan Pemerintah nomor 72 tahun 2005 dan Peraturan Pemerintah Nomor
43 tahun 2014 mengenai tentang Progarm Peraturan Desa, Pemilihan Kepala
Desa, Keuangan Desa, Pemerintahan Desa.
3

Menghasilkan out put dari Perbandingan dan Kedua Undang-Undang dan

Peraturan pemerintah Tersebut


1.3 Luaran (output) Kegiatan
Evaluasi sistem pemerintahan desa birokrasi Pemerihan desa dimaksudkan
untuk

mengidentifikasi

permasalah

dan

hambatan

kinerja

dalam

usaha

meningkatkan mutu pelayanan publik di desa dan menggembalikan desa sebagai


pemegang otonomi penuh dalam setiap pengambilan kebijakan berdasarkan
undang-Undang Nomor 6 Tahun 2014 dan Peraturan Pemerintah No.43 tahun 2014

16

1.4 Metode Kegiatan


Kegiatan ini dilakukan dengan menggunakan pendekatan tailor made,
yakni berupaya menyusun desain kelembagaan perangkat daerah dengan
melakukan analisis terhadap kondisi eksisting yang ada sekarang serta kebutuhan di
masa mendatang pengumpulan data yang digunakan meliputi:
1. Studi literatur dan dokumentasi untuk mengumpulkan data dan bahan berupa
peraturan perundang-undangan yang terkait dengan pengaturan kelembagaan
perangkat daerah. Selain itu, juga dilakukan pengumpulan data dan bahan
berupa
2. hasil kajian yang sudah dilakukan sebelumnya sebagai bahan perbandingan dan
pengayaan analisis.
3. Focus group discussion (FGD) dengan para pengambil kebijakan, antara lain
Asisten Daerah Bidang Administrasi, Kepala Badan Pemberdayaan Pemerinthan
Masyarakat Desa Kabupaten Pandeglang Data dan bahan yang telah dikumpulkan
selanjutnya diolah dengan menggunakan teknik analisis sebagai berikut:
1. Perbandiangan Undang-Undang 32 Tahun 2014 dan Peraturan Pemerintah 72
Tahun 2005 dan Undang-Undang Nomor 6 Tahun 2014

dan peraturan

pemerintah Nomor 43 tahun 2014 yang mencakup indikator-indikator sebagai


a. Peraturan Desa
b. Pemilihan Kepala Desa
c. Keuangan Desa
d. Pemerinatahan Desa

17

2. Analisis kebutuhan Kabupaten Pandeglang dengan mengacu pada aspek-aspek


sebagai berikut:
a. Visi dan Misi
b. Peningkatan pelayanan
c. Reformasi birokrasi
BAB II
KAJIAN TOERISTIS DAN PRAKTEK EMPIRIS
A. Konsep AsasRekognisi Desa

Semangat dibentuknya undang-undang desa ini adalah Negara melindungi dan


memberdayakan desa agar menjadi kuat, maju, mandiri, dan demokratis sehingga
dapat menciptakan landasan yang kuat dalam melaksanakan pemerintahan dan
pembangunan menuju masyarakat yang adil, makmur dan sejahtera.Memperkuat
Catur Sakti atau desa bertenaga secara sosial, berdaulat secara politik, berdaya
secara ekonomi dan bermartabat secara budaya.Membangun tradisi berdesa, dalam
arti desa bukan hanya kampung halaman atau tempat bermukim, tetapi juga menjadi
basis sosial serta basis politik pemerintahan, atau menjadi arena bermasyarakat dan
bernegara.tujuan pengaturan desa melalui undang-undang ini. Pertama memberikan
pengakuan dan penghormatan atas Desa yang sudah ada dengan keberagamannya
sebelum dan sesudah terbentuknya Negara Kesatuan Republik Indonesia,
memberikan kejelasan status dan kepastian hukum atas Desa dalam sistem
ketatanegaraan Republik Indonesia demi mewujudkan keadilan bagi seluruh rakyat
Indonesia.Berikutnya

melestarikan dan memajukan adat, tradisi, dan budaya

18

masyarakat Desa, mendorong prakarsa, gerakan, dan partisipasi masyarakat Desa


untuk pengembangan potensi dan Aset Desa guna kesejahteraan bersama.
Membentuk Pemerintahan Desa yang profesional, efisien dan efektif, terbuka, serta
bertanggung jawab, meningkatkan pelayanan publik bagi warga masyarakat Desa
guna mempercepat perwujudan kesejahteraan umum, meningkatkan ketahanan sosial
budaya masyarakat Desa guna mewujudkan masyarakat Desa yang mampu
memelihara kesatuan sosial sebagai bagian dari ketahanan nasional, serta memajukan
perekonomian masyarakat Desa serta mengatasi kesenjangan pembangunan nasional
dan memperkuat Desa sebagai subjek pembangunan. Olehnya dijelaskan pula
perspektif baru, asas baru dan posisi baru antara desa dahulu dan saat ini.Dalam
undang-undang ini terbentuk relasi baru antara negara, desa dan warga.Negara
berperan melakukan rekognisi (pengakuan dan penghormatan) terhadap eksistensi
desa, memberikan atau menetapkan mandat urusan pemerintahan dan kepentingan
masyarakat setempat kepada desa. Selanjutnya Negara melakukan redistribusi
seperti uang dan sebagian aset negara serta melakukan pembinaan, pemberdayaan
dan pengawasan terhadap desa. Sementara itu warga Desa menjadi basis sosial bagi
warga masyarakat, menjadi arena untuk merajut modal social.Desa menjadi arena
politik dan pemerintahan bagi warga, Desa menjadi arena perencanaan dan
penganggaran secara kolektif dan partisipatif.Desa memberikan pelayanan dasar
kepada warga dan melakukan konsolidasi aset ekonomi local. Arah dari undangundang (desa) ini yakni rekognisi, penataan desa, mandat kewenangan, redistribusi,
institusionalisasi sistem desa, pembangunan desa, pembinaan dan pemberdayaan

19

serta pengawasan.Desa yang maju, kokoh, mandiri dan demokratis yang pada
akhirnya menuju kesejahteraan rakyat, azaz rekognisi Desa tidak bisa dipandang
dan ditempatkan dengan asas desentralisasi dan residualitas.Artinya desa bukan
sekadar organisasi pemerintahan yang berada dalam sistem pemerintahan
kabupaten/kota, atau desa bukan residu (sisanya sisa) kabupaten/kota.
Desa lebih tepat dipandang dengan rekognisi (pengakuan dan penghormatan) dan
subsidiaritas. Artinya negara mengakaui dan menghormati desa sebagai kesatuan
masyarakat hukum (adat).Rekognisi terhadap eksistensi desa, hak-hak tradisional dan
prakarsa desa definisi dan makna dari implikasi rekognisi Desa adalah desa dan desa
adat atau yang disebut dengan nama lain, selanjutnya disebut Desa, adalah kesatuan
masyarakat hukum yang memiliki batas wilayah yang berwenang untuk mengatur
dan mengurus urusan pemerintahan, kepentingan masyarakat setempat berdasarkan
prakarsa masyarakat, hak asal usul, dan/atau hak tradisional yang diakui dan
dihormati dalam sistem pemerintahan Negara Kesatuan Republik Indonesia. Desa
(baik yang adat maupun desa) merupakan kesatuan dan subyek hukum, sehingga
merupakan organisasi pemerintahan berbasis masyarakat, pemerintahan yang
menyatu dengan masyarakat atau pemerintahan milik masyarakat. Atau pemerintahan
paling depan, paling bawah dan paling dekat dengan masyarakat.Mengatur berarti
membuat keputusan untuk mengalokasikan sumberdaya dan menyelesaikan masalah
yang mengikat banyak orang.Mengurus berarti mengelola atau melaksanakan.Urusan
pemerintahan merupakan bidang kegiatan atau hajat hidup orang banyak atau
kepentingan warga yang telah menjadi domain kewenangan pemerintah supradesa,

20

namun karena berskala lokal dimandatkan menjadi kewenangan desa.Kepentingan


masyarakat setempat adalah kebutuhan hidup bersama yang muncul karena prakarsa
masyarakat setempat.

Mekanisme penataan desa antara lain penetapan desa dan desa adat melalui Perda
Kabupaten/kota. Penyesuaian kelurahan, yaitu kelurahan yang sebenarnya berwajah
desa dikembalikan menjadi desa, contohnya kelurahan di ibukota kecamatan.Desa
ada sesuai ketentuan umum ialah kesatuan masyarakat hukum adat beserta hak
tradisionalnya secara nyata masih hidup, baik yang bersifat teritorial, genealogis,
maupun yang bersifat fungsional.Merupakan kesatuan masyarakat hukum adat
beserta hak tradisionalnya dipandang sesuai dengan perkembangan masyarakat dan
kesatuan masyarakat hukum adat beserta hak tradisionalnya sesuai dengan prinsip
Negara Kesatuan Republik Indonesia.

Bentuk

Status

Azas
Contoh

Desa adat (Self


governing
community)
Desa adat atau
sekadar organisasi
komunitas yang
mempunyai
pemerintahan sendiri.
Punya otonomi asli
Sebagai organisasi
komunitas yang lepas
(di luar) struktur
birokrasi Negara
Rekognisi (pengakuan
dan penghormatan)
Desa adat di Bali

Desa otonom (Local


self
government)
Desa otonom, atau
sering
disebut dengan
daerah
otonom tingkat III.
Sebagai unit
pemerintahan
lokal otonom yang
berada
dalam subsistem
pemerintahan NKRI.
Desentralisasi
(penyerahan)
Desa swapraja atau

Desa administratif
(Local state
government)
Desa administratif,
atau semacam unit
birokrasi sebagai
kepanjangan tangan
negara di tingkat
lokal.
Sebagai satuan
kerja
perangkat
pemerintah daerah.
Delegasi atau tugas
Pembantuan
Kelurahan

21

Desain
institusional

Desa mempunyai
kewenangan asal- usul
Desa mengelola
urusanurusan
masyarakat yang
berskala lokal.
Mempunyai susunan
asli.
Mempunyai institusi
demokrasi
komunitarian
(musyawarah).
Pemerintah
memberikan
bantuan keuangan

Desapraja
Status desa seperti
daerah otonom.
Pemerintah
memberikan
desentralisasi
(penyerahan)
urusanurusan
menjadi
kewenangan desa.
Mempunyai
institusi
politik demokrasi
modern (elektoral
dan
perwakilan)
Pemerintah wajib
mengalokasikan
(alokasi)
anggaran untuk
membiayai
pelaksanaan
kewenangan/urusan.

Desa menjalankan
tugastugas
administratif dan
pelayanan yang
ditugaskan
pemerintah.
Tidak mempunyai
institusi demokrasi
dan tidak ada
otonomi.
Menerima dana
belanja aparatur
dari pemerintah

Tabel 2
Kelebihan dan Kekurangan

Keunggulan

Otonomi Asli Desa


Sesuai dengan konteks
sejarah desa yang
mempunyai asalusuljauh
sebelum lahir NKRI.
Relevan dengan konsep
pengakuan dan
penghormatanyang tertuang
dalam konstitusi
Relevan dengan keragaman
desa desadi Indonesia

Desa Otonom
Kedudukan dan formatnya
lebih mudah, simpel dan
konkruen dengan
pemerintahan daerah.
Memperjelas pembagian
urusan dari pemerintah
kepada desa.
Memungkinkan terjadinya
penyebaran sumberdaya
pada rakyat di level grass
roots(desa).
Mengakhiri dualisme dan
benturan antaramodernisme
vs tradisionalisme atau

22

antara
desa dinas/administratif dan
desa adat.
Desa menjadi lebih
modern
dan dinamis.
Kelemahan
(termasuk
tantangan, risiko
dan keterbatasan)

Mengalami
kerumitan/kesulitan
dalam merumuskan disain
kelembagaan pengakuan (apa
yang diakui, siapa yang
mengakui,
dan bagaimana mengakui).
Rumit/sulit dalam
merumuskan
format keragaman lokal.
Lokal cenderung
prasmanandalam mengatur
dan mengurusdesa.
Pemerintah sulitmenentukan
standar nasional dalam
pengaturan dan pelayanan
publik
pada masyarakat desa.
Bahkan sulit membangun
kesatuan dalam keragaman.
Yangmenonjol adalah
keragamandalam kesatuan.
Desa terus terjebak dalam
tradisionalismeromantisme
dansulit berkembang secara
dinamis

Konstitusi tidak secara


eksplisit memberi
desentralisasi kepada desa.
Menambah beban dan
cakupan
desentralisasiotonomi
daerah.
Cenderung tunggal (jika
tidak
bisa dikatakan seragam).
Membutuhkan proses
transisidan adaptasi yang
lebih
panjang (10 tahun).
Membutuhkan proses
menyakinkan yang lebih
panjang kepada masyarakat
adat.
Risikonya, pemerintah
harus
mengalokasikan dana yang
lebih besar kepada desa.
Biasanya ini dianggap
sebagai
beban yang berat.

23

BAB III
EVALUASI DAN ANALISIS PERATURAN PERUNDANG-UNDANGAN
TERKAIT
A. Cara Pandang Kedudukan Desa
Sejauh ini ada tiga perspektif untuk menempatkan kedudukan desa di Indonesia dan
di banyak negara, sebagaimana terlihat dalam Pilihan kedudukan desa sebaiknya
konsisten pada satu kedudukan agar lebih jelas dan tidak menimbulkan tarikmenarik
kekuasaan dan tanggungjawab. Filipina misalnya, menempatkan desa (barangay)
sebagai desa otonom (local self government).Negaranegara Eropa menempatkan
commune atau Inggris Raya menempatkan parish sebagai organisasi komunitas lokal
atau self governing community. Dalam tabel itu terlihat ada tiga bentuk kedudukan
desa: desa adat atau desa sebagai kesatuan masyarakat (selfgoverning community),
desa otonom (local self government) dan desa administratif (local state government).
Dalam konteks Indonesia, perdebatan yang menonjol sebenarnya antara pandangan
desa adat atau otonomi asli dengan desa otonom atau daerah otonom tingkat III.
Bentuk desa administratif merupakan tambahan yang mulai diperkenalkan sejak
Orde Baru hingga sekarang.juga menunjukkan kelebihan dan kekurangan antara
otonomi asli desa dengan desa otonom. Kalau ditimbangtimbang kedudukan

24

desa otonom merupakan pilihan yang lebih tepat untuk memperkuat desa, tetapi
pilihan akan kedudukan ini mengandung tantangan yang besar.

Pengalaman Sebelumnya
Pembicaraan tentang kedudukan daerah dan desa selalu mengacu pada Pasal 18
UUD 1945. Pada bab IV Pasal 18 UUD 1945 yang mengatur masalah Pemerintahan
Daerah, disebutkan:
Pembagian daerah Indonesia atas daerah besar dan kecil,
dengan bentuk susunan pemerintahannya ditetapkan dengan
undangundang, dengan memandang dan
mengingati dasar permusyawaratan dalam sistem pemerintahan
negara, dan hakhak asal-usul dalam daerahdaerah yang bersifat
istimewa.
Dalam bagian penjelasan dinyatakan:
Dalam territoir Indonesia terdapat lebih kurang 250 Zelfbesturende landschappen
dan Volksgemeenschappen, seperti desa di Jawa dan Bali, negeri di Minangkabau,
dusun dan marga di Palembang dan sebagainya.Daerahdaerah itu mempunyai
susunan asli, dan oleh karenanya dapat dianggap sebagai daerah yang bersifat
istimewa.
Selanjutnya dinyatakan juga:
Negara Republik Indonesia menghormati kedudukan daerah-daerah istimewa
tersebutdan segala peraturan negara yang mengenai daerah daerah itu akan
mengingati hak-hak asalusul daerah tersebut.
Penjelasan pasal 18 UUD 1945 menyebutkan bahwa Zelfbesturende berjumlah
sekitar 250 yang tersebar di seluruh Indonesia.Zelfbesturende Landschappen adalah
daerah swapraja, yaitu wilayah yang dikuasai oleh raja yang mengakui kekuasaan
dan kedaulatan Pemerintah jajahan Belanda melalui perjanjian politik.Secara
teoretis, Zelfbesturende Landschappen itu disebut dengan daerah otonom (local self

25

government)

yang

dibentuk

dengan

azas

desentralisasi,

sedangkanVolksgemeenschappen bisa disebut dengan kesatuan masyarakat hukum


adat atau self governing community yang eksis karena azas pengakuan (rekognisi).
Penjelasan itu tampaknya mengisyaratkan bahwa desadesa (atau nama lainnya)
yang berjumlah 250 itu ada yang berstatus daerah otonom (local self government)
ada pula yang berstatus self governing community.
Tetapi identfikasi yang jelas belum pernah dilakukan sehingga mengalami kesulitan
dalam pengaturan desa.Untuk mengatur pemerintahan pasca 17 Agustus 1945,
Badan pekerja Komite Nasional Pusat mengeluarkan pengumuman No. 2.yang
kemudian ditetapkan menjadi UU No. 1/1945. UU ini mengatur kedudukan desa
dan kekuasaan komite nasional daerah, sebagai badan legislatif yang dipimpin oleh
seorang Kepala Daerah. Menurut Prof. Koentjoro Perbopranoto, undangundang ini
dapat dianggap sebagai peraturan desentralisasi yang pertama di Republik
Indonesia. Di dalamnya terlihat bahwa letak otonomi terbawah bukanlah kecamatan
melainkan desa, sebagai kesatuan masyarakat yang berhak mengatur rumah tangga
pemerintahannya sendiri.Namun desentralisasi itu hanya sempat dilakukan sampai
pada daerah tingkat II.Karena isinya terlalu sederhana, Undangundang No. 1/1945
ini dianggap kurang memuaskan.
Maka dirasa perlu membuat undangundang baru yang lebih sesuai dengan pasal 18
UUD 1945.Pada saat itu pemerintah menunjuk R.P. Suroso sebagai ketua panitia.
Setelah melalui berbagai perundingan, RUU ini akhirnya disetujui BP KNIP, yang
pada tanggal 10 Juli 1948 lahir UU No. 22/1948 Tentang Pemerintahan Daerah.

26

Bab 2 pasal 3 angka 1 UU No.22/1948 menegaskan bahwa daerah yang dapat


mengatur rumah tangganya sendiri dapat dibedakan dalam dua jenis, yaitu daerah
otonomi biasa dan daerah otonomi istimewa.
Daerahdaerah ini dibagi atas tiga tingkatan, yaitu Propinsi Kabupaten/kota besar,
desa/kota kecil.Sebuah skema tentang pembagian daerahdaerah dalam 3 tingkatan
itu menjadi lampiran undang-undang.Daerah istimewa adalah daerah yang
mempunyai hak asalusul yang di zaman sebelun RI mempunyai pemerintahan
yang bersifat istimewa. UU No. 22/1948 menegaskan pula bahwa bentuk dan
susunan serta wewenang dan tugas pemerintah desa sebagai suatu daerah otonom
yang berhak mengatur dan mengurus pemerintahannya sendiri. UU No. 22/1948
secara tegas dan jelas menempatkan desa sebagai daerah otonom tingkat III atau
daerah otonom yang terbawah. Berikut ini penjelasan III butir ke18: Menurut
Undangundang pokok ini, maka daerah otonom yang terbawah adalah desa, negeri,
marga, kota kecil dan sebagainya. Ini berarti desa ditaruh kedalam lingkungan
pemerintahan yang modern tidak ditarik diluarnya sebagai waktu yang lampau.Pada
jaman itu tentunya pemerintahan penjajah mengerti bahwa desa itu sendi negara,
mengerti bahwa desa sebagai sendi negara itu harus diperbaiki segalagalanya
diperkuat dan didinamiseer, supaya dengan begitu negara bisa mengalami
kemajuan.Tetapi untuk kepentingan penjajahan, maka desa dibiarkan saja tetap
statis (tetap keadaannya).Pemberian hak otonomi menurut ini.Gemeente
ordonanntie adalah tidak berarti apaapa, karena desa dengan hak itu tidak bisa

27

berbuat apaapa, oleh karena tidak mempunyai keuangan dan oleh ordonanntie itu
diikat pada adatadat, yang sebetulnya di desa itu sudah tidak hidup lagi.
Malah sering kejadian adat yang telah mati dihidupkan pula atau sebaliknya, adat
yang hidup dimatikan, bertentangan dengan kemauan penduduk desa, hanya karena
kepentingan penjajah menghendaki itu.Desa tetap tinggal terbekalang, negara tidak
berdaya, adalah sesuai dengan tujuan politik penjajah.Tetapi Pemerintahan
Republik kita mempunyai tujuan sebaliknya.Untuk memenuhi pasal 33 UUD,
negara dengan rakyat Indonesia harus makmur.Untuk mendapatkan kemakmuran
itu harus dimulai dari bawah, dari desa.Oleh karena itu, desa harus dibikin di dalam
keadaan senantiasa bergerak maju (dinamis). Maka untuk kepentingan itu
pemerintahan desa dimasukkan di dalam lingkungan pemerintahan yang diatur
dengan sempurna (modern), malah tidak sebegitu saja, tetapi juga akan diusulkan
supaya bimbingan terhadap daerahdaerah yang mendapat pemerintahan menurut
Undangundang pokok ini lebih diutamakan diadakan di desa. Tetapi UU No.
22/1948, terutama dalam hal desa, tidak berjalan karena munculnya Konstitusi RIS
dan Undangundang Dasar Sementara 1950.Di bawah UUDS 1950 itu lahirlah UU
No. 1/1957.UU yang lahir di era demokrasi parlementerliberal inimemandang desa
secara berbeda dengan pandangan UU No. 22/1948.Meskipun UU No. 1/1957
membagi daerah menjadi tiga tingkatan, tetapi tidak cukup jelasmenyebut desa
sebagai daerah otonom tingkat III.
Bahkan penjelasan politik UU ini tentang desa berbeda secara kontras dengan
pandangan UU No. 22/1948: Dengan demikian nyatalah bahwa bagi tempattempat

28

yang serupa ini sulit kita untuk menciptakan satu kesatuan otonomi dalam
pengertian tingkat yang ketiga (III), sehingga kemungkinannya atau hanya
memberikan otonomi itu secara tindakan baru kepada kabupaten di bawah Propinsi,
atau menciptakan dengan cara bikinbikinan wilayah administratief dalam
kabupaten itu untuk kemudian dijadikan kesatuan yang berotonomi.
Dalam prinsipnya sangatlah tidak bijaksana mengadakan kesatuan otonomi secara
bikinbikinan saja dengan tidak berdasarkan kesatuankesatuan masyarakat hukum
yang ada. Prinsip yang kedua ialah bahwa sesuatu daerah yang akan kita berikan
otonomi itu hendaklah sebanyak mungkin merupakan suatu masyarakat yang
sungguh mempunyai faktorfaktor pengikut kesatuannya. Sebab itulah maka
hendaknya di mana menurut keadaan masyarakat belum dapat diadakan tiga (3)
tingkat, untuk sementara waktu dibentuk 2 tingkat dahulu. Berhubung dengan hal
hal adanya atau tidak adanya kesatuankesatuan masyarakat hukumadat sebagai
dasar bekerja untuk menyusun tingkat otonomi itu, hendaklah pula kita insyafi
bahwa urusan otonomi tidak "congruent" dengan urusan hukumadat, sehingga
manakala sesuatu kesatuanmasyarakat hukumadat dijadikan menjadi satu daerah
otonomi atau dimasukkan ke dalam suatu daerah otonomi, maka hal itu tidaklah
berarti, bahwa tugastugas kepalakepala adat dengan sendirinya telah terhapus.
Yang mungkin terhapus hanya segisegi hukumadat yang bercorak ketatanegaraan,
manakala hanya satu kesatuan masyarakat hukumadat itu dijadikan daerah
otonomi, sekedar corak yang dimaksud bersepadanan dengan kekuasaan ketata
negaraan yang tersimpul dalam pengertian otonomi itu.

29

Undang-Undang ini penuh keraguan memandang dan menempatkan posisi desa.


Toh Undang-Undang itu tidak berjalan juga karena dua tahun berikutnya, 1959, ada
Dekrit Presiden untuk kembali pada UUD 1945.Produk Undangundang dibawah
UUDS dibubarkan.
Untuk menyesuaikannya dengan prinsipprinsip demokrasi terpimpin dan
kegotongroyongan, maka pada tanggal 9 September 1959 Presiden mengeluarkan
Penpres No. 6 Tahun 1959 tentang Pemerintah Daerah. Dari Pidato Menteri Dalam
Negeri dan Otonomi Daerah ketika menjelaskan isi Penpres No. 6/1959, dapat
ditarik kesimpulan pokok bahwa, dengan pemberlakuan Penpres No. 6/1959 terjadi
pemusatan kekuasaan ke dalam satu garis birokrasi yang bersifat sentralistis.
Majelis Permusyawaratan Rakyat Sementara juga terbentuk atas Penpres No.
12/1959, yang antara lain menetapkan Ketetapan MPRS No.III/MPRS/1960 tentang
GarisGaris Besar Pola Pembangunan Semesta Berencana Tahapan Pertama 1961
1969, yang dalam beberapa bagiannya memuat ketentuanketentuan tentang
Pemerintah Daerah. Masingmasing adalah:
(a) Paragraf 392 mengenai pembagian Daerah dan jumlah tingkatan;
(b) Paragraf 393 mengenai desentralisasi;
(c) Paragraf 395 mengenai pemerintahan daerah
(d) Paragraf 396 mengenai pemerintahan desa.
Dalam setiap paragraf antara lain termuat amanat agar dilakukan pembentukan
daerah Tingkat II sebagaimana dalam UU No. 1/1957; dan menyusun Rancangan
UndangUndang PokokPokok Pemerintahan Desa, yang dinyatakan berhak

30

mengatur dan mengurus rumah tangganya sendiri, sebagai pengganti segala


peraturan dari masa kolonial dan nasional yang dianggap belum sempurna, yang
mengatur tentang kedudukan desa dalam rangka ketatanegaraan: bentuk dan susunan
pemerintahan desa; tugas dan kewajiban, hak dan kewenangan pemerintah desa;
keuangan pemerintah desa: serta kemungkinankemungkinan badanbadan kesatuan
pemerintahan desa yang sekarang ini menjadi satu pemerintahan yang otonom
(Yando Zakaria, 2000).Karena tuntutan itu pemerintah membentuk Panitia Negara
Urusan Desentralisasi dan Otonomi Daerah yang diketuai oleh R.P. Soeroso, atas
dasar keputusan presiden No.514 tahun 1960. Tugastugas yang harus diselesaikan
oleh panitia adalah:
1. Menyusun Rencana Undangundang Organik tentang Pemerintahan Daerah
Otonom sesuai dengan citacita Demokrasi Terpimpin dalam rangka Negara
Kesatuan

Republik

Indonesia

yang

mencakup

segala

pokokpokok

(unsurunsur)Progresif dari UU No. 22/1948,UU No.1/1957, Perpres No.6/1959


(disempurnakan), Perpres No.5/1960 (disempurnakan),dan Perpres No.2/1961.
2. Menyusun Rencana Undangundang tentang pokokpokok Pemerintahan desa, ang
berhak mengatur dan mengurus rumah tangganya sendiri, sebagai pengganti
segala peraturan perundangan dari masa kolonial mengenai pemerintahan desa
sehingga dewasa ini masih berlaku; rencana akan mengatur halhal pokok tentang:
a. Kedudukan desa dalam rangka ketatanegaraan
b. Bentuk dan susunan pemerintahan desa
c. Tugas kewajiban,hak dan kewenangan pemerintahan desa

31

d. Keuangan pemerintahan desa


e. Pengawasan pemerintahan desa
f. Kemungkinan pembangunan badanbadan kesatuan ppemerintah desa yang ada
sekarang ini menjadi satu pemerintahan desa yang otonom
g.Dan lainlain.
3. Mengajukan usul usul penjelasan mengenai:
a. Penyerahan urusanurusan pemerintahan pusat yang menurut sifatnya dan
sesuai dengan kemampuan dan kesanggupan daerah dapat diserahkan kepada
daerah, yang dahulu menurut penjelasan UU No. 1/1957 diharapkan akan
dijadikan tugas suatu Dewan Otonomi dan Desentralisasi.
b. Tuntutantuntutan tentang pembagian daerah (pemecahan, pemisahan,
penghapusan dan pembentukan baru), perluasan batasbatas wilayah kotapraja,
pemindahan ibu kota daerah.
c.Penertiban organisasiorganisasi masyarakat rukun kampung dan rukun tetangga
setelah bekerja selama dua tahun Panitia Suroso berhasil menyelesaikan 2
rancanganundangundang: RUU tentang Pokokpokok pemerintahan daerah
dan rancanganundangundang tentang desa praja. Menteri dalam negeri dan
otonomi daerah, IpikGandamana, pada tahun 1963, menyampaikan kedua RUU
itu kepada DewanPerwakilan Rakyat Gotong Royong.
Sebelumnya pada bulan Januari 1963 keduarancangan itu dibuat dalam sebuah
konferensi yang diikuti oleh seluruh gubernur.Pembahasan kedua RUU di DPRGR
cukup lama dan alot.Setelah mengalami berbagaipenyesuaian sesuai aspirasi dari

32

banyak pihak, pada tanggal 1 September 1965,DPRGR menetapkannya sebagai


undangundang.Masingmasing menjadi UU No.18/1965 Tentang Pokokpokok
Pemerintahan Daerah dan UU No. 19 Tahun 1965Tentang Desa Praja.
Menurut pasal 1 UU No. 19/1965, yang dimaksud dengan desapraja adalah
kesatuanmasyarakat hukum yang tertentu batasbatas daerahnya, berhak mengurus
rumahtangganya sendiri, memilih penguasanya, dan mempunyai harta bendanya
sendiri.Dalam penjelasan dinyatakan bahwa kesatuankesatuan yang tercakup
dalampenjelasan UUD 1945 pasal 18, Volksgemeenschappen seperti desa di Jawa
dan Bali,Nagari di Minangkabau, Dusun dan marga di Palembang dan sebagainya,
yang bukanbekas swapraja adalah desapraja menurut undangundang ini. Dengan
demikian,persekutuanpersekutuan masyarakat hukum yang berada dalam (bekas)
daerahswapraja tidak berhak atas status sebagai desa praja.Dengan memggunakan
nama desapraja, UU No.19 /1965 memberikan istilah barudengan satu nama
seragam untuk menyebut keseluruhan kesatuan masyarakathukum yang termasuk
dalam penjelasan UUD 1945 pasal 18, padahal kesatuanmasyarakat hukum di
berbagai wilayah Indonesia mempunyai nama asli yangberagam. UU No.19/1965
juga memberikan dasar dan isi desapraja secara hukumyang berarti kesatuan
masyarakat hukum yang tertentu batasbatas daerahnya danberhak mengurus
rumahtangganya sendiri, memilih penguasanya, dan memiliki hartabenda
sendiri.Dalam penjelasan umum tentang desapraja itu terdapat keterangan yang
menyatakanbahwa UU No. 19/1965 tidak membentuk baru desapraja, melainkan

33

mengakuikesatuankesatuan masyarakat hukum yang telah ada di seluruh Indonesia


denganberbagai macam nama menjadi desapraja.
Kesatuankesatuan masyarakat hukum lainyang tidak bersifat teritorial dan belum
mengenal otonomi seperti yang terdapat diberbagai wilayah daerah administratif
tidak dijadikan desa praja, melainkan dapatlangsung dijadikan sebagai unit
administratif dari daerah tingkat III. Penjelasan jugamenyatakan bahwa desapraja
bukan merupakan satu tujuan tersendiri, melainkanhanya sebagai bentuk peralihan
untuk mempercepat terwujudnya daerah tingkat IIIdalam rangka Undang-Undang
No.18/1965 tentang Pokokpokok Pemerintahan daerah.Suatu saatbila tiba waktunya
semua desa praja harus ditingkatkan menjadi Daerah Tingkat IIIdengan atau tanpa
penggabungan

lebih

dahulu

mengingat

besar

kecilnya

desaprajayang

bersangkutan.Dengan keluarnya UU No.19/1965 warisan kolonial yang sekian lama


berlaku dinegara RI, seperti IGO dan IGOB serta semua peraturanperaturan
pelaksanaannyatidak berlaku lagi.Tetapi, UU No.19/1965 tidak sempat pula
dilaksanakan dibanyakdaerah.Pelaksanaannya ditunda, tepatnya dibekukan, atas
dasar pemberlakuan UU No.6 /1969, yaitu undangundang dan peraturan pemerintah
Pengganti Undang- undang1965, meski dinyatakan juga bahwa pelaksanaanya efektif
setelah adanyaundangundang baru yang menggantikannya.Namun, anehnya,
Undang-Undang No.19/1965sendiri sebenarnya sudah terlebih dahulu ditangguhkan
melalui intruksi MenteriDalam Negeri No.29/1966.

34

Karena itu, sejak Undang-Undang No.18/1965 dan UU No.19/1965 berlaku,praktis apa


yang dimaksudkan dengan daerah tingkat III dan desapraja itutidak terwujud. Secara
informal pemerintahan desa kembali diatur berdasarkan IGOdan IGOB.Di masa
Orde Baru, UU No. 5/1979 merupakan instrumen kontrol negara kepadamasyarakat
lokal, dengan cara menciptakan keseragaman desa di seluruh Indonesia,sekaligus
hendak menciptakan modernisasi desa. Perspektif desa administratif (thelocal state
government) sangat menonjol dalam UU No. 1979, sebagaimana terlihatdalam
definisinya:Desa adalah suatu wilayah yang ditempati oleh sejumlah penduduk
sebagaikesatuan masyarakat termasuk di dalamnya kesatuan masyarakat hukumyang
mempunyai organisasi pemerintahan terendah langsung dibawah Camatdan berhak
menyelenggarakan rumah tangganya sendiri dalam ikatan NegaraKesatuan Republik
IndonesiaSudah banyak pengalaman pahit dan kritik yang ditujukan kepada UU No.
5/1979.Orang Jawa merasakn bahwa UU No. 5/1979 menempatkan desa sebagai
obyekpemerintah, bahkan sebagai gedidal (pekerja kasar yang tidak dihargai
secaramanusiawi) yang dikendalikan oleh Camat.Orang Luar Jawa merasakan UU
No.5/1979 sebagai bentuk Jawanisasi, yang menyeragamkan satuansatuan
masyarkatadat seperti model desa di Jawa, sekaligus menghancurkan nilai dan adat
istiadatlokal.UU No. 22/1999 dan UU No. 32/2004 sangat peka terhadap persoalan
penyeragamanitu, dan karenanya memasukkan dimensi keragaman dalam pengaturan
desa,termasuk memberikan keragaman dalam penggunaan nomenklatur dan
kewenangan asalusul.

35

Tetapi

sayangnya

posisi

desa

ditempatkan

dalam

subsistem

pemerintahankabupaten/kota. Dalam pasal 200 ayat (1), misalnya, disebutkan sama


dengan UU No.32/2004:
Dalam pemerintahan daerah kabupaten/kota dibentuk pemerintahan desayang
melaksanakan kewenangan berdasarkan otonomi asli yang tumbuh danberkembang
di dalam masyarakat desa yang bersangkutan.
Klausul ini menegaskanpemberian cek kosong kepada bupati/walikota untuk
mengatur atau membuatkeputusan politik tentang desa, termasuk menyerahkan
kewenangan/urusan kepadadesa.Skema desa dalam daerah atau otonomi dalam
otonomi itu mengandung beberapamasalah yang berlapis:
1. Skema itu tidak mengikuti azas yang jelas, kecuali hanya menggunakan
alasanpraktismudah.

Hukum

tatanegara

dan

teori

desentralisasi

tidakmembenarkan adanya penyerahan kewenangan dari daerah otonom ke


unityang lebih rendah seperti desa.
2. Meski UUD hanya melakukan desentralisasi teritorial ke provinsi dankabupaten/kota,
atau tidak sampai ke desa, tetapi pada saat yang sama,konstitusi tidak memberi
amanat kepada UU untuk menempatkan desa dalamdaerah. Yang ditegaskan
dalam konstitusi adalah pengakuan negara terhadap kesatuan masyarakat hukum
adat (desa atau nama lain) yang masih ada.
3. Skema desa dalam daerah menganggap bahwa desa hanya menjadi masalahkecil
dan karena itu diserahkan kepada daerah. Desa hanya menjadi sisanyasisa
penyelenggaraan pemerintahan daerah.

36

4. Secara empirik otonomi desa dalam otonomi daerah itu tidak berjalan.Secara
hukum desa menjadi insider kabupaten/kota, tetapi secara politikempirikdesa
sebenarnya dianggap outsider oleh pejabat daerah.UU No.32/2004 dan PP No.
72/2005 beserta aturan pelaksanaannya tidak berjalansecara optimal karena
sebagian besar pemerintah kabupaten/kota engganberbagi sumberdaya kepada
kepada desa.Bahkan kebanyakan bupatimelakukan politisi terhadap desa untuk
kepentingan jangka pendek. Masalah-masalahyang terkait desa tidak bisa selesai
di level kabupaten tetapi selaludibawa naik ke pusat, termasuk melempar aksi
kolektif orang desa darikabupaten ke provinsi dan dari provinsi ke pusat.
Kesulitan Pilihan
Selama ini pemilihan secara tegas dan konsisten pada salah satu kedudukan
desamengalami

kesulitan

yang

serius.Mengapa?Pertama,

ada

kesulitan

menafsirkanmakna Pasal 18 UUD 1945.Apalagi substansi Pasal 18 versi asli


mengalamiperubahan dalam UUD 1945 Amandemen Kedua.UUD amandemen
menghilangkanistilah desa. Pasal 18 ayat 1 menegasakan: Negara Kesatuan
Republik Indonesiadibagi atas daerahdaerah provinsi dan daerah provinsi itu
dibagi atas kabupaten dankota, yang tiaptiap provinsi, kabupaten dan kota
mempunyai pemerintahan daerahyang diatur dengan undangundang. Juga pasal
18B ayat 2 menegaskan: Negaramengakui dan menghormati kesatuankesatuan
masyarakat hukum adat besertahakhak tradisionalnya sepanjang masih hidup dan
sesuai dengan perkembanganmasyarakat dan prinsip Negara Kesatuan Republik

37

Indonesia, yang diatur dalamundangundang. Dalam konteks ini sering muncul


pertanyaan apakah desa satusatunyakesatuan masyarakat hukum adat?
Sejauh ini ada beberapa tafsir yang muncul:
1. Tafsir desa otonom atau daerah otonom tingkat III: Desa merupakan
bentukdaerah kecil yang mempunyai susunan asli dan bersifat istimewa. Karena
itunegara

sebaiknya

melakukan

desentralisasi

teritorial,

yang

membagi

wilayahNKRI menjadi provinsi, kabupaten/kota dan desa.Desa sebagai daerah


kecilmenjadi desa otonom (local self government) atau daerah otonom tingkat
III,

yangmengharuskan

negara

memberikan

desentralisasi

kepada

desa.Penganutperspektif desa otonom (local self government), UU No. 22/1948


dan UU No.19/1965 termasuk yang mengikuti tafsir ini.
2. Tafsir otonomi asli: Batang tubuh Pasal 18 UUD 1945 sama sekali tidak,
mengenaldesa, juga tidak secara eksplisit membagi wilayah NKRI menjadi
provinsi,kabupaten/kota dan desa. Konstitusi hanya membagi NKRI menjadi
daerah besar(provinsi) dan daerah kecil (kabupaten/kota). Menurut tafsir ini, desa
(atau namalainnya yang berjumlah 250) merupakan kesatuan masyarakat hukum
adat, yangharus diakui (rekognisi) oleh negara. Dengan demikian, negara tidak
memberikandesentralisasi pada desa untuk membentuk desa sebagai unit
pemerintahan lokalyang otonom.Posisi desa yang tepat menurut tafsir ini sebagai
organisasimasyarakat adat atau desa adat (self governing community) yang
mempunyai danmengelola hak asalusul.Konsep otonomi asli berpijak pada
tafsir ini.

38

3. Tafsir pragmatis: Tafsir yang berdasar pada Pasal 18 UUD 1945 amanden kedua.
Hampir sama dengan tafsir kedua, tafsir ini mengatakan bahwa NKRI hanya
dibagimenjadi wilayah provinsi dan kabupaten/kota.
Desentralisasi hanya berhentipada kabupaten/kota, tidak sampai ke desa.Tetapi tafsir ini
berbeda dengan tafsirkedua karena tidak menempatkan kedudukan desa sebagai desa
adat (selfgoverning community), melainkan menempatkan desa sebagai unit
pemerintahandi bawah dan di dalam subsistem pemerintah kabupaten.UU No.
22/1999 dan UUNo. 32/2004, dengan alasan praktis (meninjam istilah Prof. Sadu
Wasistiono),mengikuti tafsir ini.Padahal UUD 1945 tidak secara eksplisit
mengamanatkanpenempatan

kedudukan

desa

dalam

subsistem

pemerintah

kabupaten/kota.Kedua, masingmasing tipe kedudukan mempunyai kelebihan dan


kelemahan, sepertiterlihat dalam tabel 2.Keduanya tampak menempati posisi yang
biner dan berbedasecara kontras.Kelemahan dalam desa rekognisi (adat) justru bisa
menjadi kelebihandalam desa otonom, sebaliknya kelemahan desa otonom menjadi
kelebihan desa adat.
Tetapi kalau ditimbangtimbang posisi desa otonom jelas lebih unggul daripada
desarekognisi (adat), yakni akan membuat desa lebih kuat, maju, modern dan
dinamis.Pertanyaannya, apakah kita mempunyai visi politik untuk membawa desa
desa lebihkuat, maju, modern dan dinamis, atau sebaliknya akan menempatkan desa
padaposisi yang status quo?Ketiga, secara historis, semua desa di Indonesia
berbentuk self governing community.Konstitusi UUD 1945 secara implisit juga
menempatkan desa sebagai kesatuanmasyarakat hukum adat atau disebut dengan self

39

governing community tersebut.Tetapi secara lambat laun sejak kolonial dan


puncaknya pada masa Orde Baru, negaramemaksakan bentuk the local state
government pada desa, yang menempatkan desasebagai kepanjangan tangan
negara.Di masa Orde Baru, desa dibuat secara seragamsebagai desa administratif,
sehingga spirit dan bentuk self governing communitymengalami kerusakan.UU No.
22/1999 dan UU No. 32/2004 mulai memasukkandimensi local self government
secara inkremental, tetapi belum sempurna.
Saat iniposisi desa dibuat default, yang mengandung campuran antara self
governingcommunity (sebagaimana ditegaskan dalam kewenangan asalusul,
mempunyai tanahbengkok atau ulayat, dan perangkat desa yang dikelola secara
tradisional), local selfgovernment (desa berwenang menyusun organisasi desa dan
perencanaan desa,mengelola kewenangan berskala lokal, memperoleh ADD, ada
pilkades langsung, adaBPD, dll) yang belum sempurna, dan juga ada local state
government (ada begitubanyak tugas pembantuan atau permintaan tolong kepada
desa). Tetapi posisi daninstitusi yang inti tidak ditonjolkan.Keempat, karena
pengaruh adat, kondisi geografis dan kemajuan pembangunan yangberbeda, kondisi
desadesa di Indonesia sangat beragam.Bentuk desa otonom tentusangat cocok
diterapkan

di

Jawa,

sebagian

Sumatera,

sebagian

Kalimantan,

sebagianSulawesi.Sebaliknya format desa adat (rekognisi) tidak tepat diterapkan di


Jawakarena di Jawa pengaruh adat semakin hilang.

40

BAB IV
LANDASAN HISTORIS FILOSOFIS,SOSIOLOGIS,YURIDIS, PSIKOPOLITIK

1. Argumen historis
Pertama, Desa-Desa yang beragam di seluruh Indonesia sejak dulu
merupakan basis penghidupan masyarakat setempat, yang notabene mempunyai
otonomi dalam mengelola tatakuasa dan tatakelola atas penduduk, pranata lokal
dan sumberdaya ekonomi pada awalnya Desa merupakan organisasi komunitas
lokal yang mempunyai batas-batas wilayah, dihuni oleh sejumlah penduduk, dan
mempunyai adat-istiadat untuk mengelola dirinya sendiri. Inilah yang disebut
dengan self-governing community. Sebutan Desa sebagai kesatuan masyarakat
hukum baru dikenal pada masa kolonial Belanda. Desa pada umumnya
mempunyai pemerintahan sendiri yang dikelola secara otonom tanpa ikatan
hirarkhis-struktural dengan struktur yang lebih tinggi.

Di Sumatera Barat,

misalnya, nagari adalah sebuah republik kecil yang mempunyai pemerintahan


sendiri secara otonom dan berbasis pada masyarakat (self-governing
community).
Desa-Desa di Jawa sebenarnya juga menyerupai republik kecil, dimana
pemerintahan Desa dibangun atas dasar prinsip kedaulatan rakyat. Trias politica
yang diterapkan dalam negara-bangsa modern juga diterapkan secara tradisional
dalam pemerintahan Desa. Desa-Desa di Jawa, mengenal Lurah (kepala Desa)
beserta perangkatnya sebagai badan eksekutif, Rapat Desa (rembug Desa)
sebagai badan legislatif yang memegang kekuasaan tertinggi, serta Dewan

41

Morokaki sebagai badan yudikatif yang bertugas dalam bidang peradilan dan
terkadang memainkan peran sebagai badan pertimbangan bagi eksekutif
(Soetardjo Kartohadikoesoemo, 1984).
Kedua, secara historis, semua masyarakat lokal di Indonesia mempunyai
kearifan lokal secara kuat yang mengandung roh kecukupan, keseimbangan dan
keberlanjutan, terutama dalam mengelola sumberdaya alam dan penduduk.
Diantara kearifan-kearifan lokal tersebut, ada beberapa aturan hukum adat yang
mengatur masalah pemerintahan, pengelolaan sumberdaya, hubungan sosial, dan
seterusnya. Pada prinsipnya aturan lokal itu dimaksudkan untuk menjaga
keseimbangandan keberlanjutanhubungan antar manusia dan hubungan antara
manusia dengan alam dan Tuhan.
2. Argumen filosofis-konseptual
Pertama, Secara filosofis jelas bahwa sebelum tata pemerintahan di
atasnya ada, Desa itu lebih dulu ada. Oleh karena itu sebaiknya Desa harus
menjadi landasan dan bagian dari tata pengaturan pemerintahan sesudahnya.
Desa yang memiliki tata pemerintahan yang lebih tua, seharusnya juga menjadi
ujung

tombak

dalam

setiap

penyelenggaraan

urusan

pemerintahan,

pembangunan dan kemasyarakatan.


Kedua, mengikuti pendapatProf. Mr J de Louter, seorang ahli tata negara
Belanda dan F. Laceulle dalam suatu laporannya yang menyatakan bahwa
bangunan hukum Desa merupakan fundamen bagi tatanegara Indonesia

42

(Sutardjo, 1984: 39). Artinya bahwa bangsa dan negara sebenarnya terletak di
Desa, maka pengaturan Desa dalam Undang-Undang adalah sangat mendesak
karena jenis dan hierarki peraturan perundang-undangan ini akan menentukan
luasnya jangkauan pengaturan mengenai Desa. Artinya pengaturan dalam
Undang-Undang ini akan menentukan pula maju mundurnya Desa yang
berimplikasi pada pemerintahan yang ada di atasnya.
Otonomi dan demokrasi Desa yang akan dibingkai dengan undangundang tentang Desa bukan sekadar perkara kelembagaan semata, melainkan
mempunyai dasar filosofis yang dalam. Kita membutuhkan bangsa yang
mandiri-bermartabat, butuh negara (pemerintah) yang kuat (berkapasitas dan
bertenaga) dan demokratis. Upaya penguatan otonomi daerah dan otonomi
Desa menjadi bagian dari cita-cita itu, sekaligus hendak membangun imajinasi
Indonesia yang kuat dan sempurna, yang melampui (beyond) sentralisme dan
lokalisme. NKRI akan menjadi lebih kuat bila ditopang oleh kedaulatan rakyat
serta kemandirian lokal (daerah dan Desa), yakni pusat yang menghargai lokal
dan lokal yang menghormati pusat. Kemandirian Desa akan menjadi fondasi
dan kekuatan NKRI dan imajinasi Indonesia itu. Jika Desa selamanya marginal
dan tergantung, maka justru akan menjadi beban berat pemerintah dan
melumpuhkan fondasi NKRI. Kedepan kita membutuhkan Desa sebagai entitas
lokal yang bertenaga secara sosial, berdaulat secara politik, berdaya secara
ekonomi dan bermartabat secara budaya.

43

Ketiga,

Undang-Undang

tentang

pemerintahan

Desa merupakan

instrumen untuk membangun visi menuju kehidupan baru Desa yang mandiri,
demokratis dan sejahtera apa maknanya? Pertama, kemandirian Desa bukanlah
kesendirian Desa dalam menghidupi dirinya sendiri. Kemandirian Desa tentu
tidak berdiri di ruang yang hampa politik, tetapi juga terkait dengan dimensi
keadilan yang berada dalam konteks relasi antara Desa (sebagai entitas lokal)
dengan kekuatan supraDesa (pusat dan daerah) yang lebih besar. Secara lokalinternal, kemandirian Desa berarti kapasitas dan inisiatif lokal yang kuat.
Inisiatif lokal adalah gagasan, kehendak dan kemauan entitas Desa yang berbasis
pada kearifan lokal, komunalisme dan modal sosial (kepemimpinan, jaringan
dan solidaritas sosial). Dengan demikian, inisiatif lokal yang kuat merupakan
fondasi lokal bagi kemandirian Desa.Tetapi inisiatif lokal ini tidak bakal tumbuh
dengan baik jika tidak ada ruang yang memungkinkan (enabling) untuk tumbuh.
Regulasi yang mengandung banyak instruksi dan intervensi tentu akan
menumpulkan inisiatif lokal. Karena itu kemandirian Desa membutuhkan
kombinasi dua hal:
Pertama inisiatif lokal dari bawah dan respons kebijakan dari atas
dibutuhkan pengakuan (rekognisi) negara terhadap keberadaan entitas Desa dan
termasuk organisasi masyarakat adat, yang kemudian dilanjutkan dengan
penetapan hak, kekuasaan, kewenangan, sumberdaya dan tanggungjawab kepada
Desa. Kewenangan memungkinkan Desa mempunyai kesempatan dan
tanggungjawab mengatur rumah tangganya sendiri dan kepentingan masyarakat

44

setempat, yang sekaligus akan menjadi bingkai bagi Desa untuk membuat
perencanaan lokal. Perencanaan Desa akan memberikan keleluasaan dan
kesempatan bagi Desa untuk menggali inisiatif lokal (gagasan, kehendak dan
kemauan lokal), yang kemudian dilembagakan menjadi kebijakan, program dan
kegiatan dalam bidang pemerintahan dan pembangunan Desa.
Kemandirian itu sama dengan otonomi Desa. Gagasan otonomi Desa
sebenarnya mempunyai relevansi (tujuan dan manfaat) sebagai berikut:

Memperkuat kemandirian Desa sebagai basis kemandirian NKRI.

Memperkuat posisi Desa sebagai subyek pembangunan;

Mendekatkan perencanaan pembangunan ke masyarakat;

Memperbaiki pelayanan publik dan pemerataan pembangunan;

Menciptakan efisiensi pembiayaan pembangunan yang sesuai dengan


kebutuhan lokal;

Menggairahkan ekonomi lokal dan penghidupan masyarakat Desa;

Memberikan kepercayaan, tanggungjawab dan tantangan bagi Desa untuk


membangkitkan prakarsa dan potensi Desa;

Menempa kapasitas Desa dalam mengelola pemerintahan dan pembangunan;

Membuka arena pembelajaran yang sangat berharga bagi pemerintah Desa,


lembaga-lembaga Desa dan masyarakat.

Merangsang tumbuhnya partisipasi masyarakat lokal.

45

Kedua, demokrasi adalah nilai dan sistem yang memberi bingkai tata
pemerintahan Desa. Secara konseptual demokrasi mengandung sejumlah prinsip
dasar: representasi, transparansi, akuntabilitas, responsivitas dan partisipasi,
yang semua prinsip ini menjadi fondasi dasar bagi pengelolaan kebijakan,
perencanaan Desa, pengelolaan keuangan Desa dan pelayanan publik. Kalau
prinsip-prinsip dasar ini tidak ada di Desa, maka akan muncul penguasa
tunggal yang otokratis, serta kebijakan dan keuangan Desa akan berjalan apa
adanya secara rutin, atau bisa terjadi kasus-kasus bermasalah yang merugikan
rakyat Desa. Demokrasi Desa akan membuka ruang bagi rakyat untuk
menyampaikan aspirasinya kepada pemerintah Desa. Aspirasi adalah fondasi
kedaulatan rakyat yang sudah lama diamanatkan dalam konstitusi,
Demokrasi juga menjadi arena untuk mendidik mental dan kepribadian
rakyat agar mereka lebih mampu, mandiri, militan dan mempunyai kesadaran
tentang pengelolaan barang-barang publik yang mempengaruhi hidup mereka.
Pendidikan dan pembelajaran ini penting, mengingat masyarakat cenderung
pragmatis secara ekonomi dan konservatif secara politik, akibat dari
perkembangan zaman yang mengutamakan orientasi material.
Ketiga, isu kesejahteraan mencakup dua komponen besar, yakni
penyediaan layanan dasar (pangan, papan, pendidikan dan kesehatan) dan
pengembangan ekonomi Desa yang berbasis pada potensi lokal. Kemandirian

46

dan demokrasi Desa merupakan alat dan peta jalan untuk mencapai
kesejahteraan rakyat Desa. Desentralisasi memungkinkan alokasi sumberdaya
kepada Desa, dan demokrasi memungkinkan pengelolaan sumberdaya Desa
berpihak pada rakyat Desa. Hak Desa untuk mengelola sumberdaya alam,
misalnya, merupakan modal yang sangat berharga bagi ekonomi rakyat Desa.
Demikian juga dengan alokasi dana Desa yang lebih besar akan sangat
bermanfaat untuk menopang fungsi Desa dalam penyediaan layanan dasar warga
Desa. Namun, kesejahteraan rakyat Desa yang lebih optimal tentu tidak mungkin
mampu dicakup oleh pemerintah Desa semata, karena itu dibutuhkan juga
kebijakan pemerintah yang responsif dan partisipatif, yang berorientasi pada
perbaikan pelayanan dasar dan pengembangan ekonomi lokal.
3. Argumen yuridis
Pertama, Undang-undang Dasar 1945 mengamanatkan dalam Pasal 18b
adanya kesatuan masyarakat hukum adat. Kemudian dalam penjelasan umum
Undang-Undang No. 32 Tahun 2004 dan Undang-Undang Nomor 6 tahun 2014
tentang Pemerintahan Daerah dijelaskan ...., maka otonomi Desa akan
diberikan kesempatan untuk tumbuh dan berkembang mengikuti perkembangan
dari Desa itu sendiri... Hal ini berarti bahwa Desa sebagai susunan
pemerintahan terendah di Indonesia mempunyai identitas dan entitas yang
berbeda dan perlu di atur tersendiri dalam bentuk Undang-Undang. Selain itu,
usulan mengenai pentingnya Undang-undang mengenai Desa ini dikemukakan
oleh Dewan Perwakilan Rakyat sebagai pemegang kekuasaan legislatif.

47

Sejumlah isu yang terkandung UUD 1945 tentu membutuhkan


penjabaran lebih lanjut dalam bentuk undang-undang. Termasuk pasal 18 yang
mengatur keberadaan daerah besar dan kecil. Pasal 18 itu berbunyi: Pembagian
daerah Indonesia atas daerah besar dan kecil, dengan bentuk susunan
pemerintahannya ditetapkan dengan undang-undang, dengan memandang dan
mengingati dasar permusyawaratan dalam sistem pemerintahan negara, dan hakhak asal-usul dalam daerah-daerah yang bersifat istimewa. Desa sebenarnya
termasuk daerah-daerah kecil yang mempunyai hak-hak asal-usul dan bersifat
istimewa. Dalam penjelasan juga ditegaskan: Daerah Indonesia akan dibagi
dalam daerah propinsi dan daerah propinsi akan dibagi pula dalam daerah yang
lebih kecil. Ini berarti bahwa daerah yang lebih kecil mencakup kabupaten/kota
dan Desa, atau setidaknya undang-undang juga harus memberi kedudukan yang
tepat keberadaan Desa yang telah ada jauh sebelum NKRI lahir, dan Desa pada
masa kolonial juga telah diatur tersendiri (Yando Zakaria, 2002).
Kedua, pengakuan dan penghormatan negara terhadap

Desa dalam

konstitusi sebenarnya nampak jelas (Yando Zakaria, 2002). Dalam penjelasan


Pasal 18 disebutkan bahwa: Dalam territoir Negara Indonesia terdapat lebih
kurang 250 zelfbesturende landchappen dan volksgetneenschappen, seperti Desa
di Jawa dan Bali, negeri di Minangkabau, dusun dan marga di Palembang dan
sebagainya. Daerah-daerah itu mempunyai susunan asli, dan oleh karenanya
dapat dianggap sebagai daerah yang bersifat istimewa. Kalimat ini menegaskan
bahwa NKRI harus mengakui keberadaan Desa-Desa di Indonesia yang bersifat

48

beragam. Konsep zelfbesturende landchappen identik dengan Desa otonom


(local self government) atau disebut Desa Praja yang kemudian dikenal dalam
UU Nomor 19 Tahun 1965, yakni Desa sebagai kesatuan masyarakat hukum
yang berhak dan berwenang mengatur dan mengurus rumah tangganya sendiri.
Sedangkan konsep volksgetneenschappen identik dengan kesatuan masyarakat
hukum adat atau menurut orang Bali disebut dengan Desa adat atau self
governing community. Zelfbesturende landchappen akan mengikuti azas
desentralisasi (pemberian) dan volksgetneenschappen akan mengikutiazas
rekognisi/pengakuan (meski azas ini tidak dikenal dalam semesta teori
desentralisasi).
Namun keragaman dan pembedaan zelfbesturende landchappen (Desa
otonom) dan volksgetneenschappen (Desa adat) itu lama kelamaan menghilang,
apalagi di zaman Orde Baru UU 5/1979 melakukan penyeragaman dengan
model Desa administratif, yang bukan Desa otonom dan bukan Desa adat. Lebih
memprihatinkan lagi, UUD 1945 Amandemen Kedua malah menghilangkan
istilah Desa.

Pasal 18 ayat 1 menegasakan: Negara Kesatuan Republik

Indonesia dibagi atas daerah-daerah provinsi dan daerah provinsi itu dibagi atas
kabupaten dan kota, yang tiap-tiap provinsi, kabupaten dan kota mempunyai
pemerintahan daerah yang diatur dengan undang-undang. Juga pasal 18B ayat 2
menegaskan: Negara mengakui dan menghormati kesatuan-kesatuan masyarakat
hukum adat beserta hak-hak tradisionalnya sepanjang masih hidup dan sesuai

49

dengan perkembangan masyarakat dan prinsip Negara Kesatuan Republik


Indonesia, yang diatur dalam undang-undang.
Meskipun istilah Desa hilang dalam UUD 1945 amandemen ke-2, tetapi
klausul Negara mengakui dan menghormati kesatuan-kesatuan masyarakat
hukum adat beserta hak-hak tradisionalnya berarti mengharuskan negara
melakukan rekognisi terhadap kesatuan-kesatuan masyarakat hukum adat, yang
di dalamnya mencakup Desa, nagari, mukim, huta, sosor, kampung, marga,
negeri, parangiu, pakraman, lembang dan seterusnya. UU 22/1999 dan UU
32/2004 telah memberikan pengakuan itu dan secara nasional melakukan
penyebutan Desa (atau dengan nama lainnya). Pengakuan diberikan kepada
eksistensi Desa (atau nama lain) beserta hak-hak tradisionalnya hak asal-usul.
Kebijakan yang sama juga terlihat misalnya dalam UU Nomor 11 Tahun 2006
tentang Pemerintahan Aceh yang mengakui kembali keberadaan mukim (berada
di tengah kecamatan dan Desa/Gampong), yang selama Orde Baru mukim
dihilangkan dari struktur hirarkhis dan hanya menempatkan gampong sebagai
Desa.
Ketiga, penyerahan urusan/kewenangan dari kabupaten/kota kepada
Desa sebenarnya tidak dikenal dalam teori desentralisasi. Karena itu dengan di
lahirnya Undang-Undang Nomor 6 Tahun 2014 Desa dan peraturan pemerintah
Nomor 43 tahun 2014di susun terpisah dari Undang-Undang Pemda, hal ini akan
semakin mempertegas amanat dan makna Pasal 18 UUD 1945, sekaligus akan

50

semakin memperjelas posisi (kedudukan) dan kewenangan Desa atau


memperjelas makna otonomi Des
4. Argumen Sosiologis
Pertama, secara sosiologis, jelas bahwa untuk menciptakan masyarakat
adil dan makmur seperti yang diamanatkan dalam Pembukaan Undang-Undang
Dasar 1945, bangsa Indonesia harus memulai paradigma pembangunan dari
bawah (Desa) karena sebagian besar penduduk Indonesia beserta segala
permasalahannya tinggal di Desa. Tetapi selama ini, pembangunan cenderung
berorientasi pada pertumbuhan dan bias kota. Sumberdaya ekonomi yang
tumbuh di kawasan Desa diambil oleh kekuatan yang lebih besar, sehingga Desa
kehabisan sumberdaya dan menimbulkan arus urbanisasi penduduk Desa ke
kota. Kondisi ini yang menciptakan ketidakadilan, kemiskinan maupun
keterbelakangan senantiasa melekat pada Desa.
Kedua, ide dan pengaturan otonomi Desa kedepan dimaksudkan untuk
memperbaiki kerusakan-kerusakan sosial, budaya ekonomi dan politik Desa.
Otonomi Desa hendak memulihkan basis penghidupan masyarakat Desa, dan
secara sosiologis hendak memperkuat Desa sebagai entitas masyarakat
paguyuban yang kuat dan mandiri, mengingat transformasi Desa dari
patembayan menjadi paguyuban tidak berjalan secara alamiah sering dengan
perubahan zaman, akibat dari interupsi negara (struktur kekuasaan yang lebih
besar).

51

Ketiga, pengaturan tentang otonomi Desa dimaksudkan untuk merespon


proses globalisasi, yang ditandai oleh proses liberalisasi (informasi, ekonomi,
teknologi, budaya, dan lain-lain) dan

munculnya pemain-pemain ekonomi

dalam skala global. Dampak globalisasi dan ekploitasi oleh kapitalis global tidak
mungkin dihadapi oleh lokalitas, meskipun dengan otonomi yang memadai.
Tantangan ini memerlukan institusi yang lebih kuat (dalam hal ini negara) untuk
menghadapinya. Oleh karena diperlukan pembagian tugas dan kewenangan
secara rasional di negara dan masyarakat agar dapat masing-masing bisa
menjalankan fungsinya.

Prinsip dasar yang harus dipegang erat dalam

pembagian tugas dan kewenangan tersebut adalah Daerah dan Desa dapat
dibayangkan sebagai kompartemen-kompartemen fleksibel dalam entitas negara.
Berikutnya,

ketiganya

memiliki

misi

yang

sama

yaitu

mewujudkan

kesejahteraan masyarakat, bahkan yang lebih mendasar adalah survival ability


bangsa. Otonomi Desa adalah instrumen untuk menjalankan misi tersebut. Oleh
karena itu, tidak tepat kalau dalam otonomi daerah atau Desa justru melemahkan
bangunan NKRI atau survival ability bangsa. Ini mungkin terjadi kalau tidak
ada pengaturan tepat antara peran negara, daerah dan Desa. Perlu diingat bahwa
negara tidaklah sekedar agregasi daerah-daerah atau Desa-Desa yang otonom.
(Hastu, 2007). Spirit Desa bertenaga sosial, berdaulat secara politik, berdaya
secara ekonomi dan bermartabat secara budaya sebenarnya menjadi cita-cita dan
fondasi lokal-bawah yang memperkauat negara-bangsa (Sutoro Eko, 2007;
AMAN, 2006).

52

5. Argumen Psikopolitik
Pertama, sejak kemerdekaan sebenarnya Indonesia telah berupaya untuk
menentukan posisi dan format Desa yang tepat sesuai dengan konteks
keragaman lokalPerdebatan terus berlangsung mengawali penyusunan UndangUndang, tetapi sulit membangun kesepakatan politik. Undang-Undang 19/1965
tentang Desa Praja sebenarnya merupakan puncak komitmen dan kesepakatan
politik yang mendudukkan Desa sebagai daerah otonom tingkat III. Tetapi
karena perubahan paradigma politik dari Orde Lama ke Orde Baru, UU tersebut
tidak berlaku. Selama puluhan tahun pencarian tentang posisi dan format Desa
betul-betul mengalami kesulitan yang serius. Mendiang Prof. Selo Soemardjan
(1992) selalu menyoroti betapa sulitnya menempatkan posisi dan format Desa.
Demikian tuturnya:
Mengenai pembentukan daerah-daerah administratif pada umumnya
tidak dijumpai masalah-masalah yang berarti, baik secara hukum
maupun politis. Sebaliknya menghadapi Desa, negeri, marga dan
sebagainya yang diakui sebagai daerah istimewa tampaknya ada
berbagai pendapat yang berbeda-beda yang sampai sekarang belum
dapat disatukan dengan tuntas. Perbedan pendapat itu mengakibatkan
keragu-raguan pemerintah untuk memilih antara sistem desentralisasi
dua tingkat, yaitu dengan daerah otonomi tingkat I dan tingkat II saja
dan sistem tiga tingkat dimana di bawah tingkat II ditambah tingkat III.
Kedua, secara psikopolitik, Desa tetap akan marginal dan menjadi isu
yang diremehkan ketika pengaturannya ditempatkan pada posisi subordinat dan
subsistem pengaturan pemerintahan daerah. Desa mempunyai konteks sejarah,
sosiologis, politik dan hukum yang berbeda dengan daerah. Karena itu
penyusunan UU Desa tersendiri sebenarnya hendak mengeluarkan Desa dari

53

posisi subordinat, subsistem dan marginal dalam pemerintahan daerah, sekaligus


hendak mengangkat Desa pada posisi subyek yang terhormat dalam
ketatanegaraan Republik Indonesia.
Ketiga, secara politik penguatan otonomi Desa melalui Undang-Undang
Desa tersendiri sebenarnya juga menjadi aspirasi Desa yang disuarakan oleh
asosiasi pemerintah Desa dan Badan Perwakilan Desa. Mereka senantiasa
menuntut perhatian pemerintah pada Desa, kesejahteraan yang lebih baik,
kedudukan dan kewenangan Desa yang lebih besar, penempatan Desa sebagai
subyek pemerintahan dan pembangunan, alokasi dana Desa yang lebih memadai,
serta pembangunan yang betul-betul berangkat dari bawah (bottom up).
Sementara Aliansi Masyarakat Adat Nusantara (AMAN) senantiasa menuntut
pengakuan negara terhadap adat. Aspirasi dari bawah tersebut tentu memperoleh
dukungan dari berbagai organisasi masyarakat sipil, termasuk Forum
Pengembangan Pembaharuan Desa (FPPD).

BAB V

54

JANGKAUAN, ARAH PENGATURAN DAN RUANG LINGKUP MATERI


MUATAN PERATURAN DAERAHTENTANG PEMERINTAHAN DESA
A. Sasaran Yang Akan Diwujudkan Keuangan Desa
Selama ini keuangan Desa ditopang dengan dua sumber utama, yakni
pendapatan asli Desa (pungutan, hasil kekayaan Desa, gotong-royong dan swadaya
masyarakat) serta bantuan dari pemerintah. Namun, secara empirik, ada beberapa
masalah yang berkaitan dengan keuangan Desa. Pertama, besaran anggaran Desa
sangat terbatas. PADes sangat minim, antara lain karena Desa tidak mempunyai
kewenangan dan kapasitas untuk menggali potensi sumber-sumber keuangan Desa.
Karena terbatas, anggaran Desa tidak mampu memenuhi kebutuhan kesejahteraan
perangkat Desa, pelayanan publik, pembangunan Desa apalagi kesejahteraan
masyarakat Desa. Anggaran Desa sangat tidak mencukupi untuk mendukung
pelayanan dasar seperti pendidikan, kesehatan dan perumahan. Dengan kalimat lain
ada kesenjangan fiskal antara keuangan pemerintah supraDesa dengan pemerintah
Desa.
Kedua, ada kesenjangan antara tanggung-jawab dan responsivitas dengan
partisipasi masyarakat dalam anggaran Desa partisipasi masyarakat dalam anggaran
pembangunan Desa sangat besar, sementara tanggungjawab dan responsivitas sangat
kecil. Sebagian besar anggaran pembangunan Desa, terutama pembangunan fisik
(infrastruktur), ditopang oleh gotong-royong atau swadaya masyarakat. Sementara
besaran dana dari pemerintah sangat kecil, yang difungsikan sebagai stimulan untuk
mengerahkan (mobilisasi) dana swadaya masyarakat. Padahal kekuatan dana dari

55

warga masyarakat sangat terbatas, mengingat sebagian besar warga Desa mengalami
kesulitan untuk membiayai kebutuhan dasar (papan, sandang, pangan, pendidikan
dan kesehatan) bagi keluarganya masing-masing.
Ketiga, skema pemberian dana pemerintah kepada Desa kurang mendorong
pemberdayaan. Dulu ada dana pembangunan Desa (Inpres Bandes) selama 30 tahun
yang dibagi secara merata ke seluruh Desa sebesar Rp 10 juta (terakhir tahun 1999),
yang sudah ditentukan dan dikontrol dari atas, sehingga Desa tidak bisa secara
leluasa dan berdaya menggunakan anggaran. Lagipula alokasi dana yang samamerata kepada seluruh Desa hanya berfungsi sebagai stimulan, yang tidak
mencerminkan aspek keragaman (kondisi geografis dan sosial ekonomi Desa) dan
keadilan. Baik Desa miskin maupun Desa kaya akan memperoleh alokasi yang
sama. Saking lamanya (30 tahun) pengalaman bandes, skema seperti itu sudah
mendarah daging dalam paradigma dan kebijakan pemerintah atas Desa, yang justru
tidak mengangkat kesejahteraan dan kemandirian Desa.
Selain Bandes yang sudah melegenda, masih ada banyak skema bantuan
proyek masuk Desa, mulai dari IDT, P3DT, KUT, PDMDKE, PPK, P2KP, BLT dan
lain-lain. Proyek-proyek (yang silih berganti) yang bersifat bagi-bagi uang selalu
menimbulkan masalah, sehingga dana menjadi sia-sia. Selain itu, skema bantuan
proyek selalu mempunyai birokrasi dan mekanisme tersendiri, yang lepas dari
konteks perencanaan lokal (Desa dan daerah) dan kebutuhan lokal.

56

Pemerintah daerah (kabupaten/kota) juga mempunyai anggaran (ABPD)


yang disusun berdasarkan perencanaan dari bawah (Desa). Baik APBN maupun
APBD umumnya kurang perhatian pada Desa. Sebesar 60% - 70% anggaran negara
dan daerah dikonsumsi untuk belanja aparatur (belanja rutin). Sisanya, sebesar 30%
hingga 40% anggaran daerah digunakan untuk belanja publik untuk masyarakat,
yang komposisi kasarnya sekitar 30% untuk biaya tidak langsung (administrasi) dan
70% untuk belanja langsung ke masyarakat. Dari 70% belanja langsung untuk
pembangunan tersebut, jika dihitung secara kasar, terdiri dari beberapa pfalon: 20%
plafon politik (untuk DPRD dan Kepala Daerah); 70% untuk plafon sektoral
(pendidikan, kesehatan, ekonomi rakyat, industri kecil, prasarana daerah, dan
seterusnya); dan 10% untuk plafon spasial Desa melalui ADD.

Sedangkan

mayoritas (70%) plafon sektoral digunakan untuk prasarana fisik, yang tidak
berkaitan langsung dengan penanggulangan kemiskinan. Dari komposisi kasar
APBD itu memperlihatkan bahwa keberpihakan pemerintah terhadap Desa dan
orang miskin di Desa sangat lemah
Keterbatasan keuangan Desa tersebut menjadi sebuah masalah serius, yang
menjadi perhatian yang seksama baik dari kalangan pemerintah Desa, pemerintah
pusat dan kabupaten maupun kalangan sektor ketiga (akademisi dan NGOs) yang
menaruh perhatian tentang Desa. Pemerintah ternyata memberikan respons yang
positif. Pada masa Undang-undang lama maupun UU No. 22/1999, kita hanya
mengenal konsep dan skema bantuan pemerintah untuk mendukung keuangan Desa,
meski dalam hal keuangan daerah sudah dikenal dengan perimbangan keuangan

57

pusat dan daerah. Konsep bantuan ini tentu tidak jelas, sangat tergantung pada
kebaikan hati pemerintah, sekaligus menunjukkan bahwa Desa tidak mempunyai
hak atas uang negara.
Meski UU 22/1999 belum memberikan amanat tentang perimbangan atau
alokasi dana kepada Desa secara jelas, tetapi sejak 2001 sejumlah pemerintah
kabupaten/kota melakukan inovasi melahirkan kebijakan alokasi dana Desa (ADD)
secara proporsional dengan jumlah yang lebih besar daripada bantuan keuangan
sebelumnya. Pengalaman-pengalaman yang baik dari banyak daerah ini diadopsi
dengan baik oleh UU 32/2004. UU No. 32/2004 memperbaiki kelemahan yang
terkandung dalam UU 22/1999 tersebut, yakni mengubah konsep bantuan menjadi
bagian, yang berarti bahwa Desa mempunyai hak untuk memperoleh alokasi
sebagian dana perimbangan yang diterima oleh pemerintah kabupaten/kota.
Kebijakan Alokasi Dana Desa (ADD) tersebut semakin dipertegas dalam PP No.
72/2005, yang menyatakan bahwa salah satu sumber keuangan Desa adalah bagian
dari dana perimbangan keuangan pusat dan daerah yang diterima oleh
Kabupaten/Kota untuk Desa sekurang-kurangnya 10% (sepuluh per seratus), setelah
dikurangi belanja pegawai, yang pembagiannya untuk setiap Desa secara
proporsional yang merupakan alokasi dana Desa. Klausul regulasi inilah yang
dijadikan sebagai dasar hukum atas Alokasi Dana Desa (ADD).

58

ADD tersebut tentu merupakan amanat peraturan untuk dilaksanakan oleh


pemerintah kabupaten/kota. Meski belum semua kabupaten/kota melaksanakannya,
tetapi setelah PP No. 72/2005 lahir semakin banyak kabupaten/kota yang menyusul
melaksanakan kebijakan ADD. ADD tentu memberikan suntikan darah segar dan
memompa semangat baru bagi pemerintah dan masyarakat Desa. ADD jelas lebih
maju dari PPK karena ADD menyatu (integrasi) dengan sistem perencanaan dan
penganggaran daerah, dan dananya bukan berasal dari utang seperti PPK.
Pengalaman, tujuan dan manfaat ADD di berbagai daerah sejak 2001 memang
sangat beragam. Lebih banyak banyak kabupaten yang enggan membuat
kebijakan alokasi dana yang menggunakan istilah perimbangan keuangan atau
alokasi dana Desa (ADD), dengan cara mereplikasi formula perimbangan keuangan.
Sampai tahun 2004, akhir baru sekitar 40 kabupaten yang melakukan inovasi dalam
hal alokasi dana Desa dengan merujuk pada UU No. 25/1999, yang kemudian
disusul oleh kabupaten-kabupaten lain sejak keluar PP No. 72/2005. Inovasi baru
ini memang tidak lepas dari berbagai dorongan yang beragam: inisiatif populis
seorang bupati, dorongan dari pemerintah pusat, asistensi teknis dari sejumlah
lembaga donor, serta tekanan dari oganisasi masyarakat sipil maupun asosiasi Desa.
Sejak 2005/2006, tidak ada alasan bagi pemerintah daerah untuk membuat kebijakan
ADD karena sudah memperoleh amanat, namun masih banyak kebupatan yang
belum menjalankan ADD, dan komponen masyarakat bawah juga belum mengetahui
apa itu kebijakan ADD.

59

Tentu pelaksanaan ADD tidak luput dari banyak masalah salah satu masalah
yang muncul adalah keterpisahan antara perencanaan daerah dengan kebutuhan
lokal dan perencanaan Desa. Ketika ide ADD mulai digulirkan umumnya birokrasi
kabupaten/Kota terutama dinas-dinas teknis yang mengendalikan kebijakan dan
anggaran pembangunan sektoral, melakukan resistensi yang keras, bukan karena visi
jangka panjang, tetapi karena mereka merasakan bakal kehilangan sebagian kapling.
Keenganan secara psikologis dinas-dinas teknis ini tampaknya masih berlanjut
ketika ADD dilancarkan. Dengan berlindung pada ADD, atau karena Desa telah
memiliki dana tersendiri, dinas-dinas teknis justru menjauh dan kurang responsif
pada kebutuhan Desa. Di sisi lain, masalah juga muncul di Desa, terutama masalah
lemahnya akuntabilitas pemerintah Desa dalam mengelola ADD.

Karena itu

beberapa kabupaten yang sudah berpengalaman menjalankan ADD atau yang baru
saja mengeluarkan kebijakan ADD sangat peka (baca: khawatir) terhadap
akuntabilitas keuangan Desa, sehingga memaksa mereka membuat rambu-rambu
yang lebih ketat dalam pengelolaan ADD, meski langkah ini tidak sesuai dengan
prinsip keleluasaan Desa dalam mengelola block grant.
Meskipun banyak masalah dan distorsi yang muncul, ADD di banyak
kabupaten tetap memberikan banyak pelajaran berharga yang kedepan mengarah
pada penguatan kemandirian Desa. Pertama, pengalaman ADD telah mendorong
rekonstruksi terhadap makna dan format transfer dana dari pemerintah supraDesa ke
Desa. Kedua, ADD telah mendorong efisiensi penyelenggaraan layanan publik,
kesesuaian program dengan kebutuhan lokal, sekaligus juga meningkatkan

60

kepemilikan lokal.

Ketiga, ADD sangat relevan dengan salah satu tujuan besar

desentralisasi, yakni membawa perencanaan daerah lebih dekat kepada masyarakat


lokal. Belajar dari pengalaman di beberapa kabupaten menunjukkan bahwa ADD
semakin membuat perencanaan Desa lebih bermakna dan dinamis.
Secara kelembagaan ADD telah membawa perubahan pada aspek
perencanaan daerah, yakni munculnya pola perencanaan Desa. Dampaknya, pola ini
semakin mendekatkan perencanaan pembangunan kepada masyarakat Desa, dan
sebaliknya, masyarakat Desa mempunyai akses yang lebih dekat pada pusat
perencanaan. Keempat, ADD menjadi arena baru bagi pembelajaran lokal dalam
mengelola desentralisasi. Namun dana ADD tentu tidak sebanding dengan problem
keterbelakangan

dan

kemiskinan

masyarakat

Desa,

sehingga

berdasarkan

perhitungan nominal ADD ibarat hanya menggarami air laut. Dana sebesar 100
juta hingga 200 juta jelas dangat tidak cukup untuk mengatasi masalah kemiskinan
dan kekurangan pelayanan dasar. ADD tentu tidak serta-merta menciptakan
kesejahteraan yang merata bagi seluruh rakyat.
B. Arah Jangkauan PengaturanKeuangan dan Aset Desa Menurut Undang-Undang

Nomor 6 tahun 2014


Bagian KesatuKeuangan DesaPasal 71 Keuangan Desa adalah semua hak dan
kewajiban Desa yang dapat dinilai dengan uang serta segala sesuatu berupa uang dan
barang yang berhubungan dengan pelaksanaan hak dan kewajiban Desa Hak dan
kewajiban sebagaimana dimaksud pada ayat (1)menimbulkan pendapatan, belanja,

61

pembiayaan, dan pengelolaanKeuangan DesaPasal 72Pendapatan Desa sebagaimana


dimaksud dalam Pasal 71 ayat (2)bersumber dari:
a. Pendapatan asli Desa terdiri atas hasil usaha, hasil aset, swadaya dan partisipasi,
gotong royong, dan lain-lain pendapatan asli Desa;
b. Alokasi Anggaran Pendapatan dan Belanja Negara;
c. Bagian dari hasil pajak daerah dan retribusi daerah Kabupaten/KotaAH PIMPINAN
d . Alokasi dana Desa yang merupakan bagian dari dana perimbangan yang diterima
Kabupaten/Kota;
e. Bantuan keuangan dari Anggaran Pendapatan dan Belanja Daerah Provinsi dan
Anggaran Pendapatan dan Belanja Daerah Kabupaten/Kota;
f. Hibah dan sumbangan yang tidak mengikat dari pihak ketiga;dan g. lain-lain
pendapatan Desa yang sah.
Alokasi anggaran sebagaimana dimaksud pada ayat (1) huruf b bersumber dari Belanja
Pusat dengan mengefektifkan program yang berbasis Desa secara merata dan
berkeadilan.Bagian hasil pajak daerah dan retribusi daerah Kabupaten/Kota
sebagaimana dimaksud pada ayat (1) huruf c paling sedikit 10% (sepuluh perseratus)
dari pajak dan retribusi daerah.Alokasi dana Desa sebagaimana dimaksud pada ayat
(1) huruf d paling sedikit 10% (sepuluh perseratus) dari dana perimbangan yang
diterima Kabupaten/Kota dalam Anggaran Pendapatan dan Belanja Daerah setelah
dikurangi Dana Alokasi Khusus. Dalam rangka pengelolaan Keuangan Desa, Kepala

62

Desa melimpahkan sebagian kewenangan kepada perangkat Desa yang ditunjukBagi


Kabupaten/Kota yang tidak memberikan alokasi dana Desa sebagaimana dimaksud
pada ayat Pemerintah dapat melakukan penundaan dan/atau pemotongan sebesar
alokasi dan perimbangan setelah dikurangi Dana Alokasi Khusus yang seharusnya
disalurkan ke Desa. Pasal 73 Anggaran Pendapatan dan Belanja Desa terdiri atas
bagian pendapatan, belanja, dan pembiayaan Desa.
Rancangan Anggaran Pendapatan dan Belanja Desa diajukan oleh Kepala Desa dan
dimusyawarahkan bersama Badan Permusyawaratan Desa. Sesuai dengan hasil
musyawarah sebagaimana dimaksud pada ayat (2), Kepala Desa menetapkan
Anggaran Pendapatan dan Belanja Desa setiap tahun dengan Peraturan Desa.Pasal 74
Belanja Desa diprioritaskan untuk memenuhi kebutuhan pembangunan yang
disepakati dalam Musyawarah Desa dan sesuai dengan prioritas Pemerintah Daerah
Kabupaten/Kota, Pemerintah Daerah Provinsi, dan Pemerintah. Kebutuhan
pembangunan sebagaimana dimaksud pada ayat (1) meliputi, tetapi tidak terbatas
pada kebutuhan primer, pelayanan dasar, lingkungan, dan kegiatan pemberdayaan
masyarakat Desa. Pasal 75
(1) Kepala Desa adalah pemegang kekuasaan pengelolaan Keuangan Desa.
(2) Dalam melaksanakan kekuasaan sebagaimana dimaksud pada ayat (1), Kepala
Desa menguasakan sebagian kekuasaannya kepada perangkat Desa.
(3) Ketentuan lebih lanjut mengenai keuangan Desa diatur dalam Peraturan
Pemerintah Bagian Kedua Aset Desa Pasal 76

63

(1) Aset Desa dapat berupa tanah kas Desa, tanah ulayat, pasar Desa, pasar hewan,
tambatan perahu, bangunan Desa, pelelangan ikan, pelelangan hasil pertanian, hutan
milik Desa, mata air milik Desa, pemandian umum, dan aset lainnya milik Desa.
(2) Aset lainnya milik Desa sebagaimana dimaksud pada ayat (1) antara lain:
a. Kekayaan Desa yang dibeli atau diperoleh atas beban Anggaran
Pendapatan dan Belanja Negara, Anggaran Pendapatan dan Belanja Daerah, serta
Anggaran Pendapatan dan Belanja Desa;
b. kekayaan Desa yang diperoleh dari hibah dan sumbangan atau yang sejenis;
c. kekayaan Desa yang diperoleh sebagai pelaksanaan dari perjanjian/kontrak dan
lain-lain sesuai dengan ketentuan peraturan perundang-undangan;
d. hasil kerja sama Desa; dan
e. kekayaan Desa yang berasal dari perolehan lainnya yang sah.
(3) Kekayaan milik Pemerintah dan Pemerintah Daerah berskala lokal Desa yang ada di
Desa dapat dihibahkan kepemilikannya kepada Desa.
(4) Kekayaan milik Desa yang berupa tanah disertifikatkan atas nama Pemerintah Desa.
(5) Kekayaan milik Desa yang telah diambil alih oleh Pemerintah Daerah
Kabupaten/Kota dikembalikan kepada Desa, kecuali yang sudah digunakan untuk
fasilitas umum.

64

(6) Bangunan milik Desa harus dilengkapi dengan bukti status kepemilikan dan
ditatausahakan secara tertib. Pasal 77
(1) Pengelolaan kekayaan milik Desa dilaksanakan berdasarkan asas kepentingan
umum,

fungsional,

kepastian

hukum,

keterbukaan,

efisiensi,

efektivitas,

akuntabilitas, dan kepastian nilai ekonomi.


(2) Pengelolaan kekayaan milik Desa dilakukan untuk meningkatkankesejahteraan dan taraf
hidup masyarakat Desa sertameningkatkan pendapatan Desa. GGAL 17 DESEMBER 2013, O
(3) Pengelolaan kekayaan milik Desa sebagaimana dimaksud padaayat (2) dibahas oleh Kepala
Desa bersama Badan Permusyawaratan Desa berdasarkan tata cara pengelolaan Penghasilan

Pemerintah Desa Pasal 81


(1) Penghasilan tetap kepala Desa dan perangkat Desa dianggarkan dalam APB Des
yang bersumber dari ADD Pengalokasian 40 Pengalokasian ADD untuk penghasilan
tetap kepala Desa dan perangkat Desa menggunakan penghitungan sebagai berikut:
a. ADD yang berjumlah kurang dari Rp500.000.000,00 (lima ratus juta rupiah)
digunakan maksimal 60% (enam puluh perseratus);
b. ADD yang berjumlah Rp500.000.000,00 (lima ratus juta rupiah) sampai dengan
Rp700.000.000,00 (tujuh ratus juta rupiah) digunakan maksimal 50% (lima puluh
perseratus);
c. ADD yang berjumlah lebih dari Rp700.000.000,00 (tujuh ratus juta rupiah) sampai
dengan Rp900.000.000,00 (sembilan ratus juta rupiah) digunakan maksimal 40%
(empat puluh perseratus); dan

65

d. ADD yang berjumlah lebih dari Rp900.000.000,00 (sembilan ratus juta rupiah)
digunakan maksimal 30% (tiga puluh perseratus).
Pengalokasian batas maksimal sebagaimana dimaksud pada ayat (2) ditetapkan dengan
mempertimbangkan efisiensi, jumlah perangkat, kompleksitas tugas pemerintahan,
dan letak geografis.
(4) Bupati/walikota menetapkan besaran penghasilan tetap:
a. kepala Desa;
b. sekretaris Desa paling sedikit 70% (tujuh puluh perseratus) dari penghasilan tetap
kepala Desa per bulan; dan
c. perangkat Desa selain sekretaris Desa paling sedikit 50% (lima puluh perseratus) dari
penghasilan tetap kepala Desa per bulan.
(5)Besaran penghasilan tetap kepala Desa dan perangkat desa sebagaimana dimaksud
pada ayat (4) ditetapkan dengan peraturan bupati/walikota. Pasal 82 Selain menerima
penghasilan tetap sebagaimana dimaksud dalam Pasal 81, kepala Desa dan perangkat
Desa menerima tunjangan dan penerimaan lain yang sah Tunjangan . . . Tunjangan
dan penerimaan lain yang sah sebagaimana dimaksud pada ayat (1) dapat bersumber
dari APB Desa dan berdasarkan ketentuan peraturan perundang-undangan. Besaran
tunjangan dan penerimaan lain yang sah sebagaimana dimaksud pada ayat (1)
ditetapkan dengan peraturan bupati/walikota.

66

Badan Usaha Milik Desa Sebagai Modal Dasar Keuangan Desa


Pendirian

BUMDes

dilandasi

oleh

Undang-Undang

Nomor

tahun

2014

tentangPemerintahan Daerah dan PP No. 43 Tahun 2014 tentang Desa. Secararinci


tentang kedua landasan hukum BUMDes adalah:Pasal 89- 79 Desa dapat mendirikan
Badan Usaha Milik Desa yang disebut BUM Desa.BUM Desa dapat menjalankan
usaha di bidang ekonomi dan/atau pelayananumum sesuai dengan ketentuan
peraturan

perundang-undangan.Pendirian

BUM

Desa

disepakati

melalui

Musyawarah Desadan ditetapkan denganPeraturan Desa Hasil usaha BUM Desa


dimanfaatkan untuk:
Pengembangan usaha; dan
Pembangunan Desa, pemberdayaan masyarakat Desa, dan pemberian bantuan
untukmasyarakat miskin melalui hibah, bantuan sosial, dan kegiatan dana bergulir
yangditetapkan dalam Anggaran Pendapatan dan Belanja Desa.
Pemerintah, Pemerintah Daerah provinsi, Pemerintah Daerah kabupaten/kota,
danPemerintah Desa mendorong perkembangan BUM Desa dengan:
memberikan hibah dan/atau akses permodalan melakukan pendampingan teknis
dan akses ke pasar; dan memprioritaskan BUM Desa dalam pengelolaan sumber
daya alam di Desa.
1) Dalam meningkatkan pendapatan masyarakat dan Desa,Pemerintah Desa dapat
mendirikan Badan Usaha Milik Desasesuai dengan kebutuhan dan potensi Desa.

67

2) Pembentukan Badan Usaha Milik Desa sebagaimanadimaksud pada ayat (1)


ditetapkan dengan Peraturan Desaberpedoman pada peraturan perundangundangan.
3) Bentuk Badan Usaha Milik Desa sebagaimana dimaksud pada ayat (1) harus
berbadan hukumPasal 791 Badan Usaha Milik Desa sebagaimana dimaksud
dalam Pasal78 ayat (1) adalah usaha desa yang dikelola oleh PemerintahDesa.
2) Permodalan Badan Usaha Milik Desa dapat berasal dari:
a) Pemerintah Desa;
b) Tabungan masyarakat;
c) Bantuan Pemerintah, Pemerintah Provinsi danPemerintah Kabupaten/ Kota;
d) Pinjaman; dan/atau
e) Penyertaan modal pihak lain atau kerja sama bagi hasilatas dasar saling
menguntungkan.
Kepengurusan Badan Usaha Milik Desa terdiri dari PemerintahDesa dan masyarakat.
Pasal 80
1) Badan Usaha Milik Desa dapat melakukan pinjaman sesuaidengan peraturan
perundang-undangan.
2) Pinjaman sebagaimana dimaksud pada ayat (1) dilakukan setelahmendapat
persetujuan BPD
Pasal 81
1) Ketentuan lebih lanjut mengenai Tata Cara Pembentukan danPengelolaan Badan
Usaha Milik Desa diatur dengan PeraturanDaerah Kabupaten/Kota

68

2) Peraturan Daerah Kabupaten/Kota sebagaimana dimaksud pada ayat (1) sekurang


kurangnya memuat:
a. Bentuk badan hukum;
b. Kepengurusan;
c. Hak dan kewajiban;
d. Permodalan;
e. Bagi hasil usaha atau keuntungan;
f. Kerjasama dengan pihak ketiga;
g. Mekanisme pengelolaan dan pertanggungjawaban.
1. Prinsip Umum Pengelolaan Badan Usaha Milik Desa (BUMDes):
Pengelolaan BUMDes harus diljalankan dengan menggunakanprinsip kooperatif,
partisipatif,

emansipatif,

transparansi,

akuntable,dan

sustainable,

dengan

mekanisme member-base dan self helpyang dijalankan secara profesional, dan


mandiri. Berkenaandengan hal itu, untuk membangun BUMDes diperlukan
informasiyang akurat dan tepat tentang karakteristik ke-lokal-an, termasukciri sosialbudaya masyarakatnya dan peluang pasar dari produk(barang dan jasa) yang
dihasilkan.
BUMDes sebagai badan usaha yang dibangun atas inisiatifmasyarakat dan menganut
asas mandiri, harus mengutamakanperolehan modalnya berasal dari masyarakat dan
Pemdes.Meskipun

demikian,

tidak

menutup

kemungkinan

BUMDes

dapatmemperoleh modal dari pihak luar, seperti dari PemerintahKabupaten atau


pihak lain, bahkan dapat pula melakukan pinjamankepada pihak ke tiga, sesuai

69

peraturan perundang-undangan.Pengaturan lebih lanjut mengenai BUMDes tentunya


akan diaturmelalui Peraturan Daerah (Perda).
BUMDes didirikan dengan tujuan yang jelas. Tujuan tersebut, akandirealisir
diantaranya dengan cara memberikan pelayanankebutuhan untuk usaha produktif
terutama bagi kelompok miskin dipedesaan, mengurangi praktek ijon (rente) dan
pelepasan uang,menciptakan pemerataan kesempatan berusaha, danmeningkatkan
pendapatan masyarakat desa. Hal penting lainnyaadalah BUMDes harus mampu
mendidik masyarakat membiasakanmenabung, dengan cara demikian akan dapat
mendorongpembangunan ekonomi masyarakat desa secara mandiri.
Pengelolaan BUMDes, diprediksi akan tetap melibatkan pihak ketiga yang tidak saja
berdampak pada masyarakat desa ituDisebarluaskan tetapi juga masyarakat dalam
cakupan yang lebih luas(kabupaten). Oleh sebab itu, pendirian BUMDes yang
diinisiasioleh masyarakat harus tetap mempertimbangkan keberadaanpotensi
ekonomi desa yang mendukung, pembayaran pajak didesa, dan kepatuhan
masyarakat desa terhadap kewajibannya.Kesemua ini menuntut keterlibatan
pemerintah kabupaten.
Diprediksi bahwa karakteristik masyarakat desa yang perlumendapat pelayanan utama
BUMDes adalah:
(a)

masyarakat

desayang

dalam

mencukupi

kebutuhan

hidupnya

berupa

pangan,sandang dan papan, sebagian besar memiliki matapencaharian disektor


pertanian dan melakukan kegiatan usaha ekonomi yangbersifat usaha informal;

70

(b) masyarakat desa yang penghasilannyatergolong sangat rendah, dan sulit


menyisihkan

sebagianpenghasilannya

untuk

modal

pengembangan

usaha

selanjutnya;
(c)masyarakat desa yang dalam hal tidak dapat mencukupikebutuhan hidupnya sendiri,
sehingga banyak jatuh ke tanganpengusaha yang memiliki modal lebih kuat; dan
yang terpenting
(d) masyarakat desa yang dalam kegiatan usahanyacenderung diperburuk oleh sistem
pemasaran yang memberikankesempatan kepada pemilik modal untuk dapat
menekan harga,sehingga mereka cenderung memeras dan menikmati sebagianbesar
dari hasil kerja masyarakat desa. Atas dasar prediksitersebut, maka karakter
BUMDes sesuai dengan ciri-ciri utamanya,prinsip yang mendasari, mekanisme dan
sistem pengelolaanya.
Secara umum pendirian BUMDes dimaksudkan untuk:
a Meningkatkan pelayanan kepada masyarakat (standarpelayanan minimal), agar
berkembang usaha masyarakatdi desa.
bMemberdayakan desa sebagai wilayah yang otonomberkenaan dengan usaha-usaha
produktif

bagi

upayapengentasan

kemiskinan,

pengangguran

dan

peningkatanPADesa.
c Meningkatkan kemandirian dan kapasitas desa sertamasyarakat dalam melakukan
penguatan ekonomi di desa.

71

2. Prinsip Pengelolaan Badan Usaha Milik Desa (BUMDes)


Prinsip-prinsip

pengelolaan

BUMDes

penting

untuk

dielaborasi

atauDisebarluaskandiuraikan agar difahami dan dipersepsikan dengan cara yang


sama olehpemerintah desa, anggota (penyerta modal), BPD, Pemkab, danmasyarakat.
Terdapat 6 (enam) prinsip dalam mengelola BUMDes yaitu:
1. Kooperatif, Semua komponen yang terlibat di dalam BUMDes harus mampu
melakukan kerjasama yang baik demipengembangan dan kelangsungan hidup
usahanya.
2. Partisipatif. Semua komponen yang terlibat di dalam BUMDesharus bersedia
secara sukarela atau diminta memberikandukungan dan kontribusi yang dapat
mendorong kemajuan usahaBUMDes.
3. Emansipatif. Semua komponen yang terlibat di dalam BUMDesharus diperlakukan
sama tanpa memandang golongan, suku, danagama.
4. Transparan. Aktivitas yang berpengaruh terhadap kepentinganmasyarakat umum
harus dapat diketahui oleh segenap lapisanmasyarakat dengan mudah dan terbuka.
5. Akuntabel. Seluruh kegiatan usaha harus dapat dipertanggungjawabkan secara
teknis maupun administratif.
6.Sustainabel. Kegiatan usaha harus dapat dikembangkan dandilestarikan oleh
masyarakat dalam wadah BUMDes.
Terkait dengan implementasi Alokasi Dana Desa (ADD), maka proses penguatan
ekonomi desa melalui BUMDes diharapkan akan lebih berdaya.

72

Hal ini disebabkan adanya penopang yakni dana anggaran desa yang semakin besar.
Sehingga memungkinkan ketersediaan permodalanyang cukup untuk pendirian
BUMDes. Jika ini berlaku sejalan, maka akanterjadi peningkatan PADesa yang
selanjutnya dapat digunakan untukkegiatan pembangunan desa.Hal utama yang
penting dalam upaya penguatan ekonomi desaadalah memperkuat kerjasama
(cooperatif),

membangun

kebersamaan/menjalin

kerekatan

disemua

lapisan

masyarakat desa.Sehingga itumenjadi daya dorong (steam engine) dalam upaya


pengentasankemiskinan, pengangguran, dan membuk akses pasar.
C. Pemilihan Kepala Desa
1. Sasaran Yang di Wujudkan Pemilihan Kepala Desa
Pemilihan kepala desa (Pilkades) konon dianggap sebagai arena demokrasi
yang dianggap paling nyata di desa dalam pilkades terjadi kompetisi yang bebas,
partisipatif langsung dengan prinsip One man one vote, tetapi dalam banyak hal
masih banayak desa pilkades yang berlansung secara tidak demokratis dan sering di
bayar mahal, kekerasan meledak ketika kubu calon kepala desa yang kalah
melampiaskan kekecewaanya buntutnya adalah dendam pribadi yang terus dibawa,
serta permusuhan antar pendukung yang sebenarnya mereka adalah tetangga
apakah Demokrasi cenderung mengakibatkan permusuhan? Atau memang karena
model dan praktek demokrasi desa selama ini tidak sesuai dengan kultur lokal ?ada
beberapa pakar yang mempunyai jawaban sementara bahwa kekerasan pasca
pilkades bukan resiko demokrasi, melainkan karena warga kurang memahami
demokrasi.

73

Demokrasi Justru merupakan cara untuk mengatasi kekerasan, tetapi saya ingin
menegaskan bahwa wacana demokrasi selama ini tidak sesuai dengan kultur lokal
desa. Demokrasi adalah cara atau seni pergaulan hidup untuk mencapai kebaikan
bersama, banyak orang memahami bahwa prinsip dasar demokrasi adalah
kebebasan individu justru saya memahami demokarasi adalah mendegarkan dan
mengharagai orang lain, jika demokrasi dimaknai sebagai pemerintahan rakyat
maka pemerintah harus banyak mendegarkan

suara rakyat dalam mengambil

keputusan dan bertindak. Sebagai seni pergaulan hidup, Demokrasi prosedural


antara lain terkait dengan mekanisme pembuatan keputusan,penentuan pemimpin
dan artikulasi kepentingan masyarakatdemokrasi pada level kultural terkait dengan
budaya tatakrama (fatsoen) atau pergaulan sehari-hari masyarkat sipil, ini tercermin
dalam kultur toleran, terbuka, egaliterian bertanggung jawab kompetisi politik dan
seterusnya gagasan demokrasi seperti sekarang ini beragam karena di pengaruhi
oleh tradisi komunitarian, menurut tradisi liberal, demokrasi prosedural diukur
dengan bekerjanya tiga nilai penting: kompetisi,liberalisasi dan partisipasi ketiga
elemen ini berbasis pada individualisme dan semangat kebebesan individu. Secara
prosedural liberalisasi dan paritisipasi dikembangkan dalam pemelihan lembaga
perwakilan, demokrasi komunitarian lahir sebagai kritik atas demokrasi liberal,
karena demokrasi liberal ini dinilai menjadi hegemoni universal yang melakukan
penyeragaman praktek demokrasi prosedural di seluruh dunia, tradisi komunitarian
memaknai demokrasi secara partikularistik dengan memperhatikan keragaman
budaya,struktur sosial,sistem ekonomi dan sejarah setiap negara penganut

74

demokrasi seperti Barber (1983) menyatakan bahwa individulime liberal cenderung


merusak kewarganegaraan dan menafikan civic virtue artinya semangat
individualisme liberal tidak mampu memberikan landasan yang kokoh bagi
kebebesan dan kesetaraan warga dalam kerangakan demokrasi komunitarian.
Gagasan demokrasi komunitarian sangat relevan diterapkan pada level komonitas
yang kecil (semisal desa) karena kegagalan demokrasi prosedural-liberal mewadahi
partisipasi publik.
Demokrasi secara liberal secara konvensional merduksi peraktek demokrasi hanya
dalam kerangka pemilihan pemimpin dan perwakilan, yang di yakini sebagai wadah
partisipasi publik. format demokrasi perwakilan yang didesain itu di lembagkan
secara formal melalui peraturan yang mau tidak mau menimbulkan apa yang
dinamakan oleh Robert Michael sebagai oligarki elite, segelintir elite yang
mengendalikan pemerintahan dan pembuatan keputusan dan kepeutusan itu
umumunya bersekip konserfatif dan punya kepentingan sendiri yang tercarabut dari
konstituenya tetapi mereka selalu mewakili rakyat banyak Jaman terus bergerak dan
berubah kehidupan desa semakin kompelek, rumit dan hetrogen moderenisasi dan
birokratisasi negara yang tidak manusiawi merusak desa yang kemudain merusak
kearifan demokrasitisasi komunitarian desa, di tempat lain model demokrasi liberal
di terapkan secara seragam oleh negara di formalakan dengan melalui peraturan
baik undang-undang maupun peraturan dearah.
Bentuk kongkiritnya adalah pemilhan kepala desa langsung dan pelembagaan
lembaga perwakilan desa (LMD) dan yang sekrang adalah Badan Perwakilan Desa
(BPD) sampai saat ini pemilhan secara langasung masih dianggap sebagai indikator

75

demokrasi yang paling gampang dan sahih, orang tidak pernah berpikir secara
jernih mendalam dan penuh kebijakan bahwa demokrasi bukan sekdar pemilihan,
orang desa hampir tidak pernah berkaca dan menyelesaikan persoalan, mengapa
setiap pemilihan langsung menimbulkan teror, perpecahan, konflik,KKN dan
sebaginya orang mestinya berpikir bahwa demokrasi secara subtantif adalah metode
politik yang dialogis dan partisipatif untuk mengatasi persoalaan bersama dan
mencapai tujuan bersama Pemilihan kepala desa sangat menarik untuk di
cermati,apalagi di pandeglang Pilkades dianggap sebagai arene demokrasi dan
sekaligus arena pergolakan politik paling seru di desa karena melibatkan kompetisi
aktor-aktor politik dan mobilisasi besar-besaran, kemenangan seorang kandidat
kepala Desa atau kompetitor sangat di tentukan oleh dukungan suara individu
dalam proses pemilihan, tetapi dukungan ini tidak lepas dari basis komunal, baik
yang terikait dengan kekerabatan teman dan tetangga,kekerabatan akan tampak
solid anggotanya tampil menjadi calon kepala desa energi dan loyalitas akan
mereka berikan untuk dukungan tersebut. Probelem pilkades yang rumit diatas
semakin di perumit dengan problem partisipasi masyarakat sebagia elemen penting
demokratisasi desa selama ini ada tiga kecenderungan umum

partisapasi

masyarakat
Pertama: para elite desa terutama kepala desa memahami partisipasi sebagai bentuk
dukungan masyarakat terhadap kebijakan ini artinya partisipasi sebagai bentuk
dukungan masyarakat terhadap kebijakan, dan artinya partisipasi bukan pengertian
keterlibatan warga secara otonom, melainkan mobilisasi peran serta masyarakat
dalam implementasi kebijakan

76

kedua : partisipasi dalam proses pembuatan keputusan merupakan domain elite desa
yang duduk dalam perwakilan secara empirik ini merumuskan kebijakan desa
sendiri, kurang berbasis pada kebutuhan komonitas dan dari segi proses di dukung
oleh dialog atau konsultasi publik
ketiga : awarnes warga desa terhadap persoalaan partisipasi sangat lemah,umumnya
mereka menyerahkan dan mempercayakan urusan partisipasi kepada pemuka
masyarakat. Penelitian ini adalah hasil dari pantuan hasil pemilihan kepala desa di
beberapa desa di kabupaten pandeglang yang kemudian di rekomendasikan untuk
bahan penelitian selanjutnya

semoga ini jadi sumbangsih untuk rujukan

perkembangan penelitian kampus ke depan


Konsep demokrasi secara umum mengandaikan pemerintahan dari, oleh dan untuk
rakyat. Ide dasar demokrasi mensyaratkan keikutsertaan rakyat, serta kesepakatan
bersama

atau

konsensus

untuk

mencapai

tujuan

yang

dirumuskan

bersama.Demokrasi di Indonesia pasca Orde Baru hampir selalu dibicarakan secara


berkaitan dengan pembentukan sistem politik yang mencerminkan prinsip
keterwakilan, partisipasi, dan kontrol. Oleh karenanya, pemerintahan yang
demokratis mengandaikan pemisahan kekuasaan dalam tiga wilayah institusi yaitu
eksekutif, legislatif dan yudikatif.Suatu pemerintahan dikatakan demokratis jika
terdapat indikator utama yaitu keterwakilan, partisipasi dan kontrol terhadap
penyelenggaraan pemerintahan oleh ketiga institusi tersebut. Prinsip partisipasi
menjamin aspek keikutsertaan rakyat dalam proses perencanaan pembangunan
daerah; atau keikutsertaan rakyat dalam proses pemilihan wakil dalam lembaga

77

politik; sedangkan prinsip kontrol menekankan pada aspek akuntabilitas


pemerintahan.Dalam demokrasi, aspek kelembagaan merupakan keutamaan dari
berlangsungnya praktik politik yang demokratis, sehingga, terdapat partai politik,
pemilihan umum dan pers bebas.
Sedangkan, istilah lokal mengacu kepada arena tempat praktek demokrasi itu
berlangsung, yaitu pada entitas politik yang terkecil, desa.Desa secara etimologi
berasal dari bahasa Sansekerta, deca yang berarti tanah air, tanah asal atau tanah
kelahiran. Dari perspektif geografis, desa atau village diartikan sebagai a group of
houses and shops in a country area, smaller than a town. Istilah desa hanya
dikenal di Jawa, sedangkan di luar Jawa misalnya di Sumatra, Kalimantan dan
Sulawesi, sebutan untuk wilayah dengan pengertian serupa desa sangat
beranekaragam,sesuai dengan asal mula terbentuknya area desa tersebut, baik
berdasarkan pada prinsip-prinsip ikatan genealogis, atau ikatan teritorial, dan
bahkan berdasarkan tujuan fungsional tertentu (semisal desa petani atau desa
nelayan, atau desa penambang emas) dan sebagainya.Desa atau nama lainnya,
sebagai sebuah entitas budaya, ekonomi dan politik yang telah ada sebelum produkproduk hukum masa kolonial dan sesudahnya, diberlakukan, telah memiliki asasasas pemerintahan sendiri yang asli, sesuai dengan karakteristik sosial dan
ekonomi, serta kebutuhan dari rakyatnya. Konsep desa tidak hanya sebatas unit
geografis dengan jumlah penduduk tertentu melainkan sebagai sebuah unit teritorial
yang dihuni oleh sekumpulan orang dengan kelengkapan budaya termasuk sistem
politik dan ekonomi yang otonom.

78

Bagaimanakah konsep demokrasi tersebut diimplementasikan di tingkat desa?


Demokrasi desa merupakan demokrasi asli yang lebih dahulu terbentuk sebelum
negara Indonesia berdiri, bahkan pada masa kerajaan sebelum era kolonial.Ciri-ciri
dari demokrasi desa antara lain adanya mekanisme pertemuan antar warga desa
dalam bentuk-bentuk pertemuan publik seperti musyawarah/ rapat, dan ada kalanya
mengadakan protes terhadap penguasa (raja) secara bersama-sama.Dengan
pengertian demokrasi desa seperti di atas, pada tataran realitas terdapat keterkaitan
antara aspek ekonomi dan politik dalam konteks rakyat pedesaan. Misalnya di Jawa
pada kurun waktu pasca revolusi kemerdekaan hingga 1960an, Moh. Hatta
berpendapat, di desa-desa yang sistem demokrasinya masih kuat dan hidup sehat
sebagai bagian (dari) adat istiadat yang hakiki, dasarnya adalah pemilikan tanah
yang komunal yaitu setiap orang merasa bahwa ia harus bertindak berdasarkan
persetujuan

bersama,

sewaktu

mengadakan

kegiatan

ekonomi.Ia

juga

menambahkan, struktur demokrasi yang hidup dalam diri bangsa Indonesia harus
berdasarkan pada demokrasi asli yang berlaku di desa.
Perkembangan jaman menunjukkan desa-desa di Jawa mengalami perubahan yang
diakibatkan oleh kemampuan adaptasi desa terhadap tekanan eksternal, misalnya
migrasi penduduk, atau terhadap bentuk proyek kebijakan ekonomi dan politik
lainnya
Saat ini, demokrasi (lokal) dan desentralisasi, merupakan dua isu utama dalam
statecraft Indonesia pasca Orde Baru. Desentralisasi secara umum dikategorikan ke

79

dalam dua perspektif utama, yakni perspektif desentralisasi politik dan


desentralisasi

administrasi.Perspektif

desentralisasi

politik

menerjemahkan

desentralisasi sebagai devolusi kekuasaan dari pemerintah pusat kepada pemerintah


daerahsedangkan

perspektif

desentralisasi

administrasi

diartikan

sebagai

pendelegasian wewenang administratif dari pemerintah pusat kepada pemerintah


daerah.Jika desentralisasi merupakan arena hubungan antara desa dengan
pemerintah supra desa (Negara) yang bertujuan untuk memberikan pengakuan
terhadap eksistensi desa, memperkuat identitas lokal, membangkitkan prakarsa dan
inisiatif lokal, serta membagi kekuasaan dan kekayaan kepada desa, dan
mewujudkan otonomi desa, maka demokratisasi merupakan upaya untuk
menjadikan penyelenggaraan pemerintah (desa) menjadi lebih akuntabel, responsif,
diakui oleh rakyatmendorong parlemen desa berfungsi sebagai badan perwakilan
dan intermediary agent (dalam aspek artikulasi dan agregasi kepentingan, formulasi
kebijakan serta kontrol terhadap eksekutif desa); serta memperkuat partisipasi
masyarakat desa dalam proses pemerintahan dan pembangunan desa.
Partisipasi juga menandai keikutsertaan kalangan marjinal yang selama ini
disingkirkan dari proses politik dan ekonomi.Perspektif desentralisasi politik
menekankan bahwa tujuan utama dari desentralisasi adalah untuk mewujudkan
demokratisasi di tingkat lokal sebagai persamaan politik, akuntabilitas lokal, dan
kepekaan lokal. Perspektif desentralisasi administrasi lebih menekankan pada aspek
efisiensi penyelenggaraan pemerintah daerah dan pembangunan ekonomi di daerah,
sebagai tujuan utama dari desentralisiSedangkan desentralisasi politik ini pada

80

tingkat desa menekankan pada aspek kelembagaan desa, pembagian peran serta
berfungsi atau tidaknya kelembagaan desa.
Kelembagaan Politik Desa
Desa merupakan entitas pemerintahan yang langsung berhubungan dengan rakyat,
namun secara geografis berjarak cukup jauh dari pusat kekuasaan di tingkat
atasnya,hal itu menyebabkan desa memiliki arti penting sebagai basis
penyelenggaraan pelayanan publik dan memfasilitasi pemenuhan hak-hak publik
rakyat lokal. Peran penting desa ini disadari oleh pemerintah Hindia Belanda pada
masa politik kolonial, melalui penerbitan Indlandsche Gemeente Ordonanntie
(IGO) Stbl. 1906 No. 83, yaitu aturan hukum yang memberikan ruang bagi desa
untuk menjalankan pemerintahan sendiri (self governing community) dalam bentuk
pengakuan hak-hak budaya desa, sistem pemilihan kepala desa, desentralisasi
pemerintahan pada tingkat desa, parlemen desa dan sebagainyaPada masa ini
penduduk pribumi diperintah secara langsung oleh penguasa pribumi, dan secara
tidak langsung oleh penguasa Belanda.
Sistem pemerintahan berdasarkan ras ini berlangsung hingga 1942, dengan penguasa
pribumi memegang jabatan mulai dari karesidenan, kawedanan hingga tingkat
kecamatan, dan membawahi kepala desa. Hal ini sesuai dengan skema dimana
pemerintah kolonial melakukan penguasaan sumberdaya dengan memegang elite
politik lokal, meskipun demikian secara tradisional struktur pemerintahan ini bersifat
otonom. Strategi indirect rule melalui elite lokal ini juga berlangsung di luar Jawa,

81

semisal di Sumatra (Aceh, Medan, Palembang) yang memudahkan pemerintah


kolonial mengekspoitasi sumberdaya alam dan manusia untuk kepentingan
perdagangan internasionalnya.Sedangkan, proyek politik untuk menata pemerintahan
negara Indonesia pada kurun waktu paska kemerdekaan, dilakukan dalam konteks
penataan institusi pemerintahan di daerah, tetapi masih dalam bingkai negaraisasi,
memperlakukan

desa

dalam

wawasan

pemerintah

pusat.

Bagaimana

hal

inidirefleksikan dalam praktek berlakunya UU tersebut, dan bagaimana pengaruhnya


pada pemerintahan asli desa?Pada masa rejim Orde Baru yang berkarakter represif
secara politik untuk mendukung pembangunan ekonomi, aktivitas ekonomi desa
terseret dalam pusaran modernisasi sektoral, yang menyebabkan penciutan lahan
pertanian untuk pembangunan pabrik, ekploitasi hutan untuk kepentingan ekspor
kayu, dan alih profesi para petani tradisional menjadi buruh pabrik atau pekerja
tambang.
Penekanan terhadap stabilitas politik untuk mendorong laju ekonomi ini dalam
penataan pemerintahan diwujudkan dalam UU No. 5/1979 yang berwawasan
kontrolDengan mengartikan desa sebagai konsep administratif, maka desa terletak
di bawah struktur pemerintahan kecamatan. Kepala desa dan dewan desa
bertanggungjawab kepada pemerintah supra desa, bukan kepada warga, sehingga
desa lebih merupakan kepanjangan tangan dari birokrasi pemerintah pusat.
Akibatnya terjadi kecenderungan pemusatan kekuasaan di tangan kepala desa. Desa
tidak ubahnya sebagai mesin birokrasi kepanjangan dari birokrasi negara.Pasal 3 UU
No. 5/1979 menyebutkan bahwa pemerintahan desa terdiri dari kepala desa dan

82

Lembaga Musyawarah Desa (LMD), yang merupakan lembaga musyawarah atau


permufakatan antar elite pemerintahan desa dengan tokoh masyarakat desa. Secara
praktis, UU tersebut mengesahkan posisi dan fungsi kepala desa sebagai kepala
pemerintahan sekaligus sebagai ketua LMD. Selain LMD, terdapat juga LKMD
(lembaga Ketahanan Masyarakat Desa) yang No. 28/ 1980 dan dikukuhkan oleh
Instruksi Mendagri No. 4/ 1981 yang berfungsi sebagai koordinator pelaksanaan
proyek pembangunan desa. Keanggotaan LKMD seperti halnya LMD terdiri dari
para elite desa yang cenderung dekat dengan kepala desa, sementara pembentukan
pengurus LKMD harus disetujui oleh kepala desa, camat, dan bupati atau walikota
untuk disahkan.Oleh karenanya baik LKMD maupun LMD tidak bisa menyuarakan
pandangan kritis terhadap kepala desa.

Untuk menjaga loyalitas dari kalangan masyarakat desa, pesta demokrasi, yang
dikomandoi oleh para klien negara di desa, diselenggarakan secara periodik
diadakan lima tahun sekali. Desa menjadi sumber untuk mobilisasi dukungan
terhadap partai-partai politik. Secara perlahan, dengan praktek ekonomi dan politik
seperti di atas, otonomi asli dan masyarakat hukum yang otonom semakin
menghilang.Pada masa reformasi, dalam kerangka desentralisasi politik dan
demokratisasi maka ketentuan tentang pemerintahan desa disesuaikan dengan
keanekaan kekhasan sosial, budaya dan ekonomi desa. Ruang politik yang semakin
terbuka juga ditandai oleh munculnya asosiasi-asosiasi kemasyarakatan desa serta

83

seruan dari berbagai pihak untuk menghidupan kembali struktur pemerintahan


adat.Di Aceh, misalnya, terdapat pola struktur pemerintahan nanggroe yang federatif
menggambarkan tingkatan-tingkatan mulai dari unit terendah setingkat desa yaitu
gampong, kemudian struktur di atasnya yaitu mukim (federasi gampong), federasi
mukim yaitu sagoe dan strata pemerintahan teratas yaitu nanggroe. Setiap elemen ini
memiliki perangkat pemerintahan sendiri yang dapat dipersamakan dengan fungsi
legislatif, eksekutif dan yudikatif.Pada masa kini, (dalam konteks desentralisasi, dan
khususnya sebagai bagian dari proses resolusi konflik antara pihak RI dan GAM),
UUPA No. 11/ 2006 mengakomodasi kembalinya format otonomi asli pemerintahan
Aceh tersebut. Pada tataran implementasinya, kabupaten-kabupaten di Aceh
mengeluarkan qanun atau peraturan daerah untuk menjadi dasar pembentukan
lembaga daerah sampai tingkat gampongDi Kalimantan Tengah, pemerintah daerah
mengakomodasi struktur pemerintah adat kedemangan dalam struktur pemerintahan
modern berdasarkan UU No. 22/1999. Di Sumatra Barat, dikenal sebutan nagari
yang tingkatan sistem pemerintahannya hampir serupa dengan Nanggroe, demikian
juga dengan fungsi perangkat pemerintahannya.
Harus diakui bahwa satu keutamaan reformasi adalah keberhasilan mengakomodasi
dan menyesuaikanformat pemerintahan asli ini ke dalam penyelenggaraan negara,
meskipun masih banyak kekurangannya di sana-sini.UU No. 22/1999 pada intinya
menerapkan kerangka desentralisasi politik, yang ditandai oleh pembatasan
kekuasaan pusat dan pemberian otoritas yang lebih luas kepada pemerintah daerah
UU No. 22/1999 menjadi prinsip utama untuk menghidupkan kembali parlemen desa

84

dengan keberadaan BPD, serta adanya pemberdayaan peran dan fungsi parlemen
daerah,untuk tujuan meningkatkan demokratisasi lokal melalui perluasan ruang
partisipasi politik rakyatPemerintahan desa dalam UU No. 22/1979 diatur dalam
pasal-pasal 93 hingga 111. Dalam pasal 95, pemerintah desa- atau disebut dengan
nama lain- terdiri atas kepala desa dan perangkat desa. Pasal 104 mencantumkan
keberadaan BPD (Badan Perwakilan Desa) yang befungsi sebagai pengayom adat
istiadat, pembuat peraturan desa (perdes), penampung dan penyalur aspirasi
masyarakat, serta pengawas penyelenggaraan pemerintahan desa. Hal ini
menandakan perubahan signifikan dalam struktur dan fungsi kelembagaan desa,
dimana kepala desa harus bersama-sama BPD menjalankan fungsi administrasi,
anggaran dan pembuatan keputusan desa. Dari aspek keanggotaan, Pasal 105
mengatur bahwa anggota BPD sebagai wakil rakyat desa dipilih dari dan oleh
masyarakat desa. Kepala desa bertanggungjawab kepada rakyat melalui BPD, dan
dalam Pasal 102 diatur bahwa kepala desa melaporkan pelaksanaan tugasnya kepada
bupati.
Namun demikian, tidak semudah itu menerapkan konsep-konsep ideal demokrasi
sesuai dengan UU No. 22/1979. Seperti disampaikan di muka, keberagaman latar
belakang sosial, budaya dan ekonomi di daerah-daerah di Indonesia menjadikan
corak kelembagaan pemerintah desa pun menjadi beragam. UU No. 22/1999, yang
substansinya mendukung keanekaragaman dalam masyarakat desa, ironisnya, tetap
menyeragamkan

struktur

pemerintahan

desaDalam

prakteknya,

konsep

pemerintahan desa yang diperbarui oleh UU ini dipertemukan dengan sisa-sisa pola

85

patron-klien di kalangan masyarakat desa, yang terbentuk pada masa Orde Baru.
Belum lagi faktor-faktor keanekaragaman pola budaya yang terus berubah. Secara
khusus, idealnya para pembuat keputusan mengenai pemerintahan desa harus
mempertimbangkan pengaruh dari apa yang oleh kalangan pengamat politik
pedesaan disebut sebagai fenomena khas, yaitu bahwa masyarakat Indonesia adalah
masyarakat transisi yang permanen karena tidak lagi tradisional sepenuhnya, namun
juga belum bergerak ke arah masyarakat modern (dalam pengertian modernisme
Barat yang menekankan pada asas rasionalitas dan individualisme).Sehingga, jika
alasan tersebut di atas dapat dipahami oleh para pembuat keputusan, maka solusi
terhadap praktek demokrasi yang hanya terjadi di tingkat prosedural artinya
demokrasi hanya sebatas aspek prosedur, namun tidak diikuti oleh proses politik
yang mencerminkan perilaku atau budaya demokratis tidak hanya sebatas dengan
keluarnya peraturan baru yang dampaknya tambal sulam.
Para pengambil keputusan seharusnya memahami latar belakang sosial, budaya dan
ekonomi di pedesaan, dan kemudian menjadikan faktor-faktor tersebut sebagai
variabel penentu dalam penataan pemerintah desa, baik dari aspek kelembagaan
maupun pranata desa, yang sesuai dengan asas demokrasi.Sebagai contoh, terdapat
kasus di beberapa daerah dimana anggota BPD, yang terpilih secara demokratis,
menggunakan akses komunikasi politik langsung ke Bupati untuk menjatuhkan
kepala desa, yang tidak lagi memainkan peran sentral dalam perpolitikan desa. Ada
kalanya, untuk memuluskan pencapaian tujuan kepentingan politik atau ekonomi,
kades juga dapat berkolaborasi dengan BPD (kolusi) sehingga tidak lagi

86

mengawasinya.Pemilihan kepala desa dan BPD juga seringkali diwarnai oleh isu
politik uang atau intrik politik lainnya, yang diikuti pula dengan kecenderungan
anarkisme dari massa pendukung yang tidak puas. Hal ini berarti bahwa suatu sistem
demokrasi tidak bisa berlangsung tanpa adanya jaminan penegakan hukum oleh
Negara di satu pihak, dan kultur demokratis (dari masyarakat dan elite politik ) di
pihak lain Perbedaan budaya di antara warga juga seringkali disikapi dengan
kekerasan sebagaimana jaman penjajahan atas dalih rust en orde, dan malangnya,
ini dilakukan oleh sesama warga Negara.Meskipun terdapat fenomena negatif dalam
praktek politik seperti di atas, upaya demokratisasi di desa-desa memang
memerlukan proses yang panjang, sebab terjadi transformasi besar-besaran pada dua
aras yaitu pertama, pola berpikir dan praktek politik para elite desa, dan kedua, pada
internal masyarakat desa sendiri, dalam konteks transisi politik sejak 1998.BPD saja
baru terbentuk kurang dari 5 tahun (terhitung sejak 2004), sudah tentu memerlukan
waktu untuk sepenuhnya menjalankan fungsi sebagai Badan Perwakilan Desa.
Masyarakat desa memerlukan perenungan atau penyesuaian terhadap mekanisme
pemilihan langsung wakil-wakilnya, setelah sekian lama terbiasa dalam proses
politik yang serba ditentukan dari atas. Sesungguhnya kurun waktu antara 1999
hingga 2004 inilah periode penting untuk memperkuat nilai-nilai demokrasi (baik
asli maupun demokrasi Barat) dalam praktek politik desa yang peluangnya ada di
tangan organisasi non pemerintah, masyarakat desa, serta berbagai pemangku
kepentingan di desa.Maka, upaya untuk mengintrodusir demokrasi di tingkat desa,
dengan memperkuat kapasitas masyarakat akar rumput di desa menjadi percuma

87

ketika pemerintah pusat mengeluarkan UU No. 32/2004 yang cenderung


mengembalikan kekuasaan di tangan kepala desa dan mencabut peran badan
perwakilan desa, dan sekali lagi, menyeragamkan struktur kelembagaan pemerintah
desa. UU No.32/2004 tersebut keluar dengan latar belakang dominannya perspektif
resentralisasi pemerintah pusat (Depdagri), selain adanya anggapan bahwa
kecenderungan konfliktual antara BPD dan kepala desa sudah tidak dapat dikontrol
lagi.Tampaknya pemikiran bahwa desentralisasi politik hanya melahirkan konflik
politik dan akibat negatif lainnya masih mendominasi pemerintah pusat, padahal
yang perlu dipertimbangkan oleh mereka adalah bahwa reformasi politik
mengandung konsekuensi tampilnya diskursus-diskursus baru (pembaruan diskursus)
dalam politik desa, termasuk konsep demokrasi, yang memerlukan proses
penyesuaian dalam prakteknya oleh masyarakat desa dan elite politik desa.
Tak pelak lagi, gerakan resentralisasi oleh pemerintah pusat menyebabkan desa
kembali dimaknai sekedar sebagai saluran administratif kewenangan negara lewat
kabupaten/kota,

tanpa

memiliki

daya

tawar

terhadap

berbagai

kebijakan

negara.Sebagai peraturan pelaksanaan UU No.32/2004 diterbitkanlah PP No.72/2005


yang memuat beberapa perubahan penting berkaitan dengan peran Badan
Permusyawaratan Desa sebagai parlemen desa untuk melakukan pengawasan
terhadap kebijakan desa; serta tentang peran dan kedudukan kepala desa. Pasal 29 PP
No.72/2005 menegaskan bahwa kedudukan BPD sebagai unsur penyelenggaraan
pemerintahan desa, artinya posisi BPD berada di bawah eksekutif.Sementara pasal
202 ayat (1) UU No. 32/2004 memberikan pengertian pemerintah desa terdiri atas

88

kepala desa dan perangkat desa. BPD dikurangi kedudukan dan perannya dari fungsi
badan legislatif menjadi badan permusyawaratan; di samping itu keanggotaan BPD
yang awalnya dalam UU No. 22/1999 dipilih secara demokratis, kini dalam UU No.
32/2004 ditetapkan secara musyawarah dan mufakat dengan basis perwakilan
wilayah Kecenderungan pemusatan kembali ke atas dalam pertanggungjawaban
kepala desa sangat tampak dalam pasal 15 ayat (2) PP No. 72/2005 yang
menyebutkan bahwa kepala desa berkewajiban untuk memberikan laporan
penyelenggaraan pemerintahan desa kepada bupati atau walikota; sedangkan
tanggung jawab kepala desa kepada BPD hanya dalam bentuk penyampaian laporan
keterangan pertanggungjawaban, dan mereka hanya menginformasikan laporan
penyelenggaraan pemerintahan desa kepada rakyat.
A. Tentu saja ini berarti tidak ada lagi fungsi check and balances sebagai prinsip
demokrasi dalam pola hubungan antara BPD dan kepala desa; serta hubungan
BPD dengan lembaga supra desa. Bahkan, terdapat kontradiksi antara pasal 15
ayat (2) PP yang mengatur bahwa BPD memiliki salah satu wewenang untuk
melaksanakan pengawasan terhadap pelaksanaan peraturan desa dan peraturan
kepala desa, dengan pasal 35 (b) PP tentang desa. Meskipun pada pasal 35(c)
PP tentang desa disebutkan bahwa BPD diberikan kewenangan untuk
mengusulkan

pengangkatan

dan

pemberhentian

kepala

desa

kepada

bupati/walikota, namun jika mengacu pada pasal 15 (2) PP Desa di atas, terlihat
ambivalensi pengaturan kewenangan pengawasan BPD. Selain sentralisasi
politik dalam penyelenggaraan pemerintahan desa, perencanaan pembangunan

89

desa pun disesuaikan dengan perencanaan pembangunan nasional. Artinya, desa


tidak lagi memiliki otonomi untuk mengatur pembangunan ekonominya sendiri.
Pasal 63 PP Desa menempatkan perencanaan desa sebagai satu kesatuan dengan
sistem perencanaan pembangunan daerah kabupaten/kota; sedangkan pasal 150
UU No. 32/2004 menegaskan bahwa sistem perencanaan daerah merupakan satu
kesatuan dengan perencanaan pembangunan nasional. Singkatnya, PP itu tidak
menawarkan rumusan untuk memperkuat demokrasi di desa, malahan
melemahkannya dengan mengembalikan pemusatan kekuasaan di tangan kepala
desa, dan mempreteli fungsi dan wewenang BPD, selain melemahkan otonomi
pembangunan desa.

Kerja ke Depan
Untuk konteks negara Indonesia yang tengah melakukan eksperimen politik sejak
kemerdekaannya tahun 1945, desa masih dipandang setengah mata sebagai wilayah
yang memiliki demokrasi asli dan otonomi sendiri, meskipun beberapa di antaranya
sebelum masa kolonial sudah memiliki otonomi asli. Penerapan otonomi daerah
ala UU No. 32/2004) yang menekankan pada tingkat provinsi, kabupaten/kota dan
kecamatan, dengan demikian mengesampingkan posisi desa sebagai unit terkecil
dalam struktur pemerintahan negara. Padahal dalam kerangka UU No. 22/1999,
demokrasi pada tingkat desa sedang mulai tumbuh, dan dapat memperkuat kehidupan
demokrasi di kabupaten/kota, provinsi dan akhirnya negara. Keluarnya UU ini

90

cenderung menghasilkan democratic defisit atau kegagalan sistem demokrasi (yang


telngah

dirancang)

demokrasi.Mencermati

untuk
narasi

berjalan
di

atas

sesuai
tampaklah

dengan
bahwa

prinsip-prinsip
kecenderungan

penyeragaman, resentralisasi, dan pembentukan lembaga baru oleh pemerintah pusat


terhadap pemerintahan desa masih tetap dominan, sebagaimana ditampilkan oleh UU
No. 22/1999 maupun UU No. 32/2004. Beberapa persoalan pokok yang ditampilkan
oleh UU no 32/2004 adalah masalah keterwakilan masyarakat desa dalam lembaga
BPD dan fungsi kontrol dan pengawasan terhadap jalannya pemerintahan desa.
Dengan kondisi sedemikian, bagaimana nasib demokrasi desa? Mesti ada mekanisme
yang diciptakan, berbasis jaringan antar komunits, untuk memberikan perlindungan
dan penguatan lembaga-lembaga asli desa, penguatan kapasitas politik kelembagaan
desa yang mencerminkan asas keterwakilan rakyat desa yang hakiki, serta upaya
untuk memperkuat ekonomi desa adalah kesatuan masyarakat yang memiliki batasbatas wilayah yang berwenang untuk mengatur dan mengurus kepentingan
masyarakat setempat, berdasarkan asal usul dan adat istiadat setempat yang diakui
dan dihormati dalam sistem Pemerintahan Negara Kesatuan Repulik Indonesia
UUD 1945 menegaskan bahwa negara mengakui dan menghormati kesatuan
masyarakat hukum adat beserta hak tradisionalnya sepanjang masih hidup dan sesuai
dengan perkembangan masyarakat dan prinsip negara RI. Dalam penyelenggaraan
pemerintahan dan pembangunan desa harus mampu mewujudkan partisipasi dan
peran aktif masyarakat agar masyarakat senantiasa bertanggungjawab terhadap
perkembangan kehidupan bersama sebagai warga desa. Pelaksanaan pembangunan

91

desa ditujukan untuk meningkatkan taraf hidup dan kesejahteran masyarakat dengan
kegiatan dan program sesuai dengan kebutuhan masyarakat.
Sasaran yang akan diwujudkan dalam Pemerintahan Desa
Undang-Undang No. 6 Tahun 2014 tentang Desa. Dalam konsideran UU tersebut
diisampaikan bahwa Desa memiliki hak asal usul dan hak tradisional dalam
mengatur

dan

mengurus

kepentingan

masyarakat

setempat

dan

berperan

mewujudkan cita-cita kemerdekaan berdasarkan Undang-Undang Dasar Negara


Republik Indonesia Tahun 1945 Kemudian bahwa dalam perjalanan ketatanegaraan
Republik Indonesia, Desa telah berkembang dalam berbagai bentuk sehingga perlu
dilindungi dan diberdayakan agar menjadi kuat, maju, mandiri, dan demokratis
sehingga dapat menciptakan landasan yang kuat dalam melaksanakan pemerintahan
dan pembangunan menuju masyarakat yang adil, makmur, dan sejahtera Jika kita
pahami dari konstruksi hukum terhadap struktur pemerintahan desa, sebenarnya
masih menggunakan konstruksi hukum yang diterapkan selama ini. Hal ini dapat kita
telusuri dari teks hukum pada pasal 1 angka UU No 6 Tahun 2014 yang menyatakan,
bahwa Pemerintahan Desa adalah penyelenggaraan urusan pemerintahan dan
kepentingan masyarakat setempat dalam sistem pemerintahan Negara Kesatuan
Republik Indonesia.Pertanyaan yang perlu diajukan adalah apa yang dimaksudkan
dengan penyelenggaraan urusan pemerintahan dan kepentingan masyarakat setempat,
karena disini ada dua konsep, yakni pertama, penyelenggaraan urusan pemerintahan,
kedua, kepentingan masyarakat setempat Untuk memahami ini, harus dipahami lebih

92

dahulu apa yang dimaksud dengan desa, apabila memperhatikan secara cermat teks
hukum UU No 6 Tahun 2014 tentang Desa pada pasal 1 angka 1 memberikan batasan
tentang desa berikut ini Desa adalah desa dan desa adat atau yang disebut dengan
nama lain, selanjutnya disebut Desa, adalah kesatuan masyarakat hukum yang
memiliki batas wilayah yang berwenang untuk mengatur dan mengurus urusan
pemerintahan, kepentingan masyarakat setempat berdasarkan prakarsa masyarakat,
hak asal usul, dan/atau hak tradisional yang diakui dan dihormati dalam sistem
pemerintahan Negara Kesatuan Republik Indonesia.
Berdasarkan rumusan pasal 1 angka 1, terjawablah, bahwa desa memiliki
kewenangan untuk mengatur dan mengurus urusan pemerintahan, kepentingan
masyarakat setempat berdasarkan prakarsa masyarakat, hak asal usul, dan/atau
hak tradisional yang diakui dan dihormati.Jadi yang dimaksud penyelenggaraan
urusan pemerintahan adalah untuk mengatur, untuk mengurus urusan
pemerintahan, kepentingan masyarakat setempat.Dasar yang digunakan adalah
berdasarkan
(1) prakarsa masyarakat,
(2) berdasarkan hak asal usul atau hak tradisional. Pertanyaan siapa yang berwenang
untuk mengatur dan mengurus urusan pemerintahan, kepentingan masyarakat
setempat ? Pertanyaan ini dijawab dalam rumusan pada Pasal 1 angka 3 yang
menyatakan, bahwa Pemerintah Desa adalah Kepala Desa atau yang disebut
dengan nama lain dibantu perangkat Desa sebagai unsur penyelenggara
Pemerintahan Desa Jadi yang berwenang adalah pemerintah desa, yakni

93

Kepala Desa dibantu perangkat desa, sebagai unsur penyelenggaran


pemerintahan desa. Ini artinya disamping Kepala desa dan perangkat desa ada
unsur lain penyelenggara pemerintahan desa. Siapakah unsur lain dimaksud
dalam UU No 6 Tahun 2014 ?Pasal 1 angka 4 UU No 6 Tahun 2014
menjawab yang dimaksudkan unsur lain, yakni Badan Permusyawaratan
Desa atau yang disebut dengan nama lain adalah lembaga yang melaksanakan
fungsi pemerintahan yang anggotanya merupakan wakil dari penduduk Desa
berdasarkan keterwakilan wilayah dan ditetapkan secara demokratis.

D. Pemerintahan Desa
Arah dan Jangkaun Pengaturan Pemerintahan Desa Berdasarkan UndangUndang Nomor 6 Tahun 2014
Kata kuncinya adalah lembaga yang melaksanakan fungsi pemerintahan. Pertanyaannya
adalah karena kedua lembaga Kepala desa dan BPD sama-sama melaksanakan
fungsi pemerintahan, yakni pemerintahan desa, maka perlu diajukan siapakah yang
dimaksud Penyelenggaran Pemerintahan Desa berdasarkan UU No 6 Tahun
2014,Pasal 23 UU No 6 Tahun 2014 memberikan penegasan, yakni Pemerintahan
Desa diselenggarakan oleh Pemerintah Desa.

94

Jelas terjawab siapakah yang dimaksud pemerintah desa, maka dikembalikan pada
pasal 1 angka 3 UU No 6 Tahun 2014, yakni Pemerintah Desa adalah Kepala Desa
atau yang disebut dengan nama lain dibantu perangkat Desa sebagai unsur
penyelenggara Pemerintahan Desa. Jika demikian BPD kedudukannya adalah
hanya lembaga yang melaksanakan fungsi pemerintahan yang anggotanya
merupakan wakil dari penduduk Desa berdasarkan keterwakilan wilayah dan
ditetapkan secara demokratis . Hal ini ditegaskan juga pada Pemerintah DesaPasal
25 bahwa Pemerintah Desa sebagaimana dimaksud dalam Pasal 23 adalah Kepala
Desa atau yang disebut dengan nama lain dan yang dibantu oleh perangkat Desa
atau yang disebut dengan nama lainBerdasarkan konstruksi hukum yang demikian,
jelas Kepala Desa memiliki kedudukan yang strategis sebagai Penyelenggaran
Pemerintahan Desa Namun ketika melaksanakan kewenangan desa dua lembaga
tersebut mempunyai kedudukan yang sama, yakni Kepala Desa dan BPD.Untuk
memahami, perlu dipahami konstruksi hukum terhadap Kewenanagan Desa
sebagaimana dimaksud Pasal 18 UU no 6 Tahun 2014, Kewenangan Desa meliputi
kewenangan

di

bidang penyelenggaraan

Pemerintahan

Desa,

pelaksanaan

Pembangunan Desa, pembinaan kemasyarakatan Desa, dan pemberdayaan


masyarakat Desa berdasarkan prakarsa masyarakat, hak asal usul, dan adat istiadat
Desa.
Pasal 19 Kewenangan Desa meliputi:
a. kewenangan berdasarkan hak asal usul;
b. kewenangan lokal berskala Desa;

95

c. kewenangan yang ditugaskan oleh Pemerintah, Pemerintah Daerah Provinsi, atau


Pemerintah Daerah Kabupaten/Kota; dan
d. kewenangan lain yang ditugaskan oleh Pemerintah, Pemerintah Daerah Provinsi,
atau Pemerintah Daerah Kabupaten/Kota sesuai dengan ketentuan peraturan
perundang-undangan.Pasal 20 Pelaksanaan kewenangan berdasarkan hak asal
usul dan kewenangan lokal berskala Desa sebagaimana dimaksud dalam Pasal
19 huruf a dan huruf b diatur dan diurus oleh Desa. Pasal 21 :Pelaksanaan
kewenangan yang ditugaskan dan pelaksanaan kewenangan tugas lain dari
Pemerintah,

Pemerintah

Daerah

Provinsi,

atau

Pemerintah

Daerah

Kabupaten/Kota sebagaimana dimaksud dalam Pasal 19 huruf c dan huruf


d diurus

oleh

Desa.Pada

teks

hukum

Pasal

19

perlu

dipahami

konstruksi hukumnya, bahwa ada kewenangan yang diurus oleh desa dan ada
kewenangan yang berasal dari penugasan dari pemerintah, pemerintah daerah
provinsi, dan pemerintahan kabupaten/ kota.Pertanyaannya kewenangan yang
berasal dari penugasan dari pemerintah, pemerintah daerah provinsi, dan
pemerintahan kabupaten/ kota meliputi apa saja ? Jika kita mengacu pada UU
No 6 Tahun 2014, hal tersebut ditegaskan pada pasal Pasal 22 yang
menyatakan:
(1) Penugasan dari Pemerintah dan/atau Pemerintah Daerah kepada Desa meliputi
penyelenggaraan Pemerintahan Desa, pelaksanaan Pembangunan Desa,
pembinaan kemasyarakatan Desa, dan pemberdayaan masyarakat Desa.

96

(2) Penugasan sebagaimana dimaksud pada ayat (1) disertai biayaBerdasarkan


Pasal 22 ada empat penugasan yang bisa datang dari pemerintah, dan atau
pemerintah daerah (bisa Pemerintaha Daerah Provinsi, bisa Pemerintah daerah
Kabupaten Kota) yakni;
Pertama, penyelenggaraan Pemerintahan Desa
Kedua , pelaksanaan Pembangunan Desa
Ketiga, pembinaan kemasyarakatan Desa
Keempat, pemberdayaan masyarakat Desa.
Keempat hal tersebut penugasaan disertai biaya, pertanyaannya dari mana biayanya ?
Untuk memahami perlu dipahami oleh Kepala desa dan pembantu serta BPD apa
yang dimaksud keempat penugasan tersebut diatas konsepnya? Berdasarkan UU No
6 Tahun 2014 hanya ada dua konsep yang diberikan batasan dalan Ketentuan Umum
Pasal 1, yakni: Pembangunan Desa dan Pemberdayaan desa sebagaimana pernyataan
berikut ini: Pembangunan Desa adalah upaya peningkatan kualitas hidup dan
kehidupan untuk sebesar-besarnya kesejahteraan masyarakat Desa. (pasal 1 angka 8)
dan Pemberdayaan Masyarakat Desa adalah upaya mengembangkan kemandirian
dan

kesejahteraan

masyarakat

dengan

meningkatkan

pengetahuan,

sikap,

keterampilan, perilaku, kemampuan, kesadaran, serta memanfaatkan sumber daya


melalui penetapan kebijakan, program, kegiatan, dan pendampingan yang sesuai
dengan esensi masalah dan prioritas kebutuhan masyarakat Desa. (pasal 1 angka
12)Siapa yang melaksanakan keempat hal tersebut di atas, berdasarkan UU No 6
Tahun 2014 pada Pasal 26 ayat (1) Kepala Desa bertugas menyelenggarakan

97

Pemerintahan Desa, melaksanakan Pembangunan Desa, pembinaan kemasyarakatan


Desa, dan pemberdayaan masyarakat DesaPertanyaaan selanjutnya kewenangan apa
yang dimiliki oleh Kepala Desa dalam menyelenggaraka keempat hal tersebut diatas
? Pasal 26 ayat (2) menyatakan, bahwa Dalam melaksanakan tugas sebagaimana
dimaksud pada ayat (1), Kepala Desa berwenang:
a. memimpin penyelenggaraan Pemerintahan Desa;
b. mengangkat dan memberhentikan perangkat Desa;
c. memegang kekuasaan pengelolaan Keuangan dan Aset Desa;
d. menetapkan Peraturan Desa;
e. menetapkan Anggaran Pendapatan dan Belanja Desa;
f. membina kehidupan masyarakat Desa;
g. membina ketenteraman dan ketertiban masyarakat Desa;
h. membina dan meningkatkan perekonomian Desa serta mengintegrasikannya agar
mencapai perekonomian skala produktif untuk sebesar-besarnya kemakmuran
masyarakat Desa;
i. mengembangkan sumber pendapatan Desa;
j. mengusulkan dan menerima pelimpahan sebagian kekayaan negara guna
meningkatkan kesejahteraan masyarakat Desa;
k. mengembangkan kehidupan sosial budaya masyarakat Desa;
l. memanfaatkan teknologi tepat guna;
m. mengoordinasikan Pembangunan Desa secara partisipatif;

98

n. mewakili Desa di dalam dan di luar pengadilan atau menunjuk kuasa hukum untuk
mewakilinya sesuai dengan ketentuan peraturan perundang-undangan; dan
o. melaksanakan wewenang lain yang sesuai dengan ketentuan peraturan perundangundangan.
Berdasarkan kewenangan yang dimiliki oleh kepala desa, maka secara hukum
memiliki tanggung jawab yang besar, oleh karena itu untuk efektif harus ada
pendelegasian kewenangan kepada para pembantunya atau memberikan mandat.
Oleh karena itu dalam melaksanakan kewenangan Kepala Desa diberikan
sebagaimana ditegaskan pada pasal 26 ayat (3) UU No 6 Tahun 2014, yaitu : Dalam
melaksanakan tugas sebagaimana dimaksud pada ayat (1), Kepala Desa berhak:
a. mengusulkan struktur organisasi dan tata kerja Pemerintah Desa;
b. mengajukan rancangan dan menetapkan Peraturan Desa;
c. menerima penghasilan tetap setiap bulan, tunjangan, dan penerimaan lainnya yang
sah, serta mendapat jaminan kesehatan;
d. mendapatkan pelindungan hukum atas kebijakan yang dilaksanakan; dan
e. memberikan mandat pelaksanaan tugas dan kewajiban lainnya kepada perangkat
Desa.
Patut disadari, bahwa disamping kewenangan dan hak yang dimiliki Kepala Desa
memiliki kewajiban yang ditegaskan dalam UU No 6 Tahun 2014 pada pasal 26 ayat
(4) Dalam melaksanakan tugas sebagaimana dimaksud pada ayat (1), Kepala Desa
berkewajiban:

99

a. memegang teguh dan mengamalkan Pancasila, melaksanakan Undang-Undang


Dasar Negara Republik Indonesia Tahun 1945, serta mempertahankan dan
memelihara keutuhan Negara Kesatuan Republik Indonesia, dan Bhinneka
Tunggal Ika;
b. meningkatkan kesejahteraan masyarakat Desa;
c. memelihara ketenteraman dan ketertiban masyarakat Desa;
d. menaati dan menegakkan peraturan perundang-undangan;
e. melaksanakan kehidupan demokrasi dan berkeadilan gender;
f.melaksanakan prinsip tata Pemerintahan Desa yang akuntabel, transparan,
profesional, efektif dan efisien, bersih, serta bebas dari kolusi, korupsi, dan
nepotisme;
g. menjalin kerja sama dan koordinasi dengan seluruh pemangku kepentingan di
Desa;
h. menyelenggarakan administrasi Pemerintahan Desa yang baik;
i. mengelola Keuangan dan Aset Desa;
j. melaksanakan urusan pemerintahan yang menjadi kewenangan Desa;
k. menyelesaikan perselisihan masyarakat di Desa;
l. mengembangkan perekonomian masyarakat Desa;
m. membina dan melestarikan nilai sosial budaya masyarakat Desa;
n. memberdayakan masyarakat dan lembaga kemasyarakatan di Desa;
o. mengembangkan potensi sumber daya alam dan melestarikan lingkungan hidup; dan
p. memberikan informasi kepada masyarakat Desa.

100

Kewenangan, hak, Kewajiban Kepala Desa masih dibebani sebuah kewajiban kepada
pemerintahan Kabupaten/Kota, sebagaimana ditegaskan pada Pasal 27 Dalam
melaksanakan tugas, kewenangan, hak, dan kewajiban sebagaimana dimaksud dalam
Pasal 26, Kepala Desa wajib:
a. menyampaikan laporan penyelenggaraan Pemerintahan Desa setiap akhir tahun
anggaran kepada Bupati/Walikota;
b. menyampaikan laporan penyelenggaraan Pemerintahan Desa pada akhir masa
jabatan kepada Bupati/Walikota;
c. memberikan laporan keterangan penyelenggaraan pemerintahan secara tertulis
kepada Badan Permusyawaratan Desa setiap akhir tahun anggaran; dan
d. memberikan dan/atau menyebarkan informasi penyelenggaraan pemerintahan
secara tertulis kepada masyarakat Desa setiap akhir tahun anggaran.Pasal 28
(1) Kepala Desa yang tidak melaksanakan kewajiban sebagaimana dimaksud dalam
Pasal 26 ayat (4) dan Pasal 27 dikenai sanksi administratif berupa teguran lisan
dan/atau teguran tertulis.
(2) Dalam hal sanksi administratif sebagaimana dimaksud pada ayat (1) tidak
dilaksanakan, dilakukan tindakan pemberhentian sementara dan dapat dilanjutkan
dengan pemberhentian.
Agar Kepala Desa tidak terjebak pada pelanggaran hukum maka Kepala Desa
diberikan larangan sebagaimana ditegaskan, Pasal 29 UU no 6 Tahun 2014. Kepala
Desa dilarang:
a. merugikan kepentingan umum;

101

b. membuat keputusan yang menguntungkan diri sendiri, anggota keluarga, pihak


lain, dan/atau golongan tertentu;
c. menyalahgunakan wewenang, tugas, hak, dan/atau kewajibannya;
d. melakukan tindakan diskriminatif terhadap warga dan/atau golongan masyarakat
tertentu;
e. melakukan tindakan meresahkan sekelompok masyarakat Desa;
f. melakukan kolusi, korupsi, dan nepotisme, menerima uang, barang, dan/atau jasa
dari pihak lain yang dapat memengaruhi keputusan atau tindakan yang akan
dilakukannya;
g menjadi pengurus partai politik;
h menjadi anggota dan/atau pengurus organisasi terlarang
i. merangkap jabatan sebagai ketua dan/atau anggota Badan Permusyawaratan
Desa, anggota Dewan Perwakilan Rakyat Republik Indonesia, Dewan
Perwakilan Daerah Republik Indonesia, Dewan Perwakilan Rakyat Daerah
Provinsi atau Dewan Perwakilan Rakyat Daerah Kabupaten/Kota, dan jabatan
lain yang ditentukan dalam peraturan perundangan-undangan;
j. ikut serta dan/atau terlibat dalam kampanye pemilihan umum dan/atau pemilihan
kepala daerah;
k. melanggar sumpah/janji jabatan; dan
l. meninggalkan tugas selama 30 (tiga puluh) hari kerja berturut-turut tanpa alasan
yang jelas dan tidak dapat dipertanggungjawabkan.
Pasal 30

102

(1) Kepala Desa yang melanggar larangan sebagaimana dimaksud dalam Pasal 29
dikenai sanksi administratif berupa teguran lisan dan/atau teguran tertulis.
(2) Dalam hal sanksi administratif sebagaimana dimaksud pada ayat (1) tidak
dilaksanakan, dilakukan tindakan pemberhentian sementara dan dapat dilanjutkan
dengan pemberhentian.Berdasarkan kewenangan, hak dan kewajiban serta
larangan, maka perlu dipahamidan dilaksanakan asas-asas penyelenggaraan
pemerintahan desa yang ditegaskan oleh UU No 6 Tahun 2014 pada Pasal
24 Penyelenggaraan Pemerintahan Desa berdasarkan asas:
a. kepastian hukum;
b. tertib penyelenggaraan pemerintahan;
c. tertib kepentingan umum;
d. keterbukaan;
e. proporsionalitas;
f. profesionalitas;
g. akuntabilitas;
h. efektivitas dan efisiensi;
i. kearifan lokal;
j. keberagaman; dan
k. partisipatif.
Agar penyelenggaran Pemerintahan desa terlaksana secara demokratis di desa
trerdapat forum yang kemudian dinamakan musyawarah desa. Didalam UU No 6
Tahun 2014 diberikan batasan yang tegas apa yang dimaksud musyawarah desa,

103

yakni pada Pasal 1 angka 5 yang menayatkan, bahwa Musyawarah Desa atau yang
disebut dengan nama lain adalah musyawarahantara Badan Permusyawaratan Desa,
Pemerintah Desa, dan unsur masyarakat yang diselenggarakan oleh Badan
Permusyawaratan Desa untuk menyepakati hal yang bersifat strategis Yang
berperanan strategis pada musyawarah desa adalah BPD, karena musyawarah desa
diselenggarakan oleh BPD. Oleh karena itu perlu pula dipahami apa tugas BPD
berdasarkan UU No 6 Tahun 2014 pada Pasal 55 Badan Permusyawaratan Desa
mempunyai fungsi:
a. membahas dan menyepakati Rancangan Peraturan Desa bersama Kepala Desa;
b.

menampung dan menyalurkan aspirasi masyarakat Desa; dan

c.

melakukan pengawasan kinerja Kepala Desa.

Untuk melaksanakan fungsi tersebut BPD diberikan hak pada pasal 61 Badan
Permusyawaratan Desa berhak:
a mengawasi dan meminta keterangan tentang penyelenggaraan Pemerintahan Desa
kepada Pemerintah Desa;
b. menyatakan pendapat atas penyelenggaraan Pemerintahan Desa, pelaksanaan
Pembangunan Desa, pembinaan kemasyarakatan Desa, dan pemberdayaan
masyarakat Desa; dan
c. mendapatkan biaya operasional pelaksanaan tugas dan fungsinya dari Anggaran
Pendapatan dan Belanja Desa.Sedangkan anggota diberikan hak dan kewajiban
dan larangan sebagai berikut:Pasal 62 Anggota Badan Permusyawaratan Desa
berhak:

104

a. mengajukan usul rancangan Peraturan Desa;


b. mengajukan pertanyaan;
c. menyampaikan usul dan/atau pendapat;
d. memilih dan dipilih; dan
e. mendapat tunjangan dari Anggaran Pendapatan dan Belanja Desa.Pasal 63
Anggota Badan Permusyawaratan Desa wajib:
.

a. memegang teguh dan mengamalkan Pancasila, melaksanakan Undang-Undang


Dasar Negara Republik Indonesia Tahun 1945, serta mempertahankan dan
memelihara keutuhan Negara Kesatuan Republik Indonesia dan Bhinneka
Tunggal Ika.
b penyelenggaraan Pemerintahan Desa;
c. menyerap, menampung, menghimpun, dan menindaklanjuti aspirasi masyarakat
Desa;
d. mendahulukan kepentingan umum di atas kepentingan pribadi, kelompok dan/atau
golongan;
e menghormati nilai sosial budaya dan adat istiadat masyarakat Desa; dan
f. menjaga norma dan etika dalam hubungan kerja dengan lembaga kemasyarakatan
Desa.

Pasal 64 Anggota Badan Permusyawaratan Desa dilarang:


a.merugikan kepentingan umum, meresahkan sekelompok masyarakat Desa, dan
mendiskriminasikan warga atau golongan masyarakat Desa;

105

b. melakukan korupsi, kolusi, dan nepotisme, menerima uang, barang, dan/atau jasa
dari pihak lain yang dapat memengaruhi keputusan atau tindakan yang akan
dilakukannya;
c. menyalahgunakan wewenang;
d. melanggar sumpah/janji jabatan;
e. merangkap jabatan sebagai Kepala Desa dan perangkat Desa;
f. merangkap sebagai anggota Dewan Perwakilan Rakyat Republik Indonesia,
Dewan Perwakilan Daerah Republik Indonesia, Dewan Perwakilan Rakyat Daerah
Provinsi atau Dewan Perwakilan Rakyat Daerah Kabupaten/Kota, dan jabatan lain
yang ditentukan dalam peraturan perundangan-undangan;
g. sebagai pelaksana proyek Desa;
h. menjadi pengurus partai politik; dan/atau
i. menjadi anggota dan/atau pengurus organisasi terlarang.
Hal yang penting adalah berkaitan dengan keuangan desa ada pertanyaan yang penting
adalah dari mana penghasilan desa berdasarkan UU No 6 Tahun 2014 ?
Pasal 66:
(1) Kepala Desa dan perangkat Desa memperoleh penghasilan tetap setiap bulan.
(2) Penghasilan tetap Kepala Desa dan perangkat Desa sebagaimana dimaksud pada
ayat (1) bersumber dari dana perimbangan dalam Anggaran Pendapatan dan Belanja
Negara yang diterima oleh Kabupaten/Kota dan ditetapkan dalam Anggaran
Pendapatan dan Belanja Daerah Kabupaten/Kota.

106

(3) Selain penghasilan tetap sebagaimana dimaksud pada ayat (1), Kepala Desa dan
perangkat Desa menerima tunjangan yang bersumber dari Anggaran
Pendapatan dan Belanja Desa.
(4) Selain penghasilan tetap sebagaimana dimaksud pada ayat (1), Kepala Desa dan
perangkat Desa memperoleh jaminan kesehatan dan dapat memperoleh
penerimaan lainnya yang sah.
(5) Ketentuan lebih lanjut mengenai besaran penghasilan tetap sebagaimana
dimaksud pada ayat (1) dan tunjangan sebagaimana dimaksud pada ayat (3)
serta penerimaan lainnya yang sah sebagaimana dimaksud pada ayat (4) diatur
dalam Peraturan Pemerintah.

Sasaran yang akan di Wujudkan dalam Peraturan Desa

Jenis peraturan di Desa terdiri atas Peraturan Desa, peraturan bersama Kepala Desa,
dan peraturan Kepala Desa. Peraturan sebagaimana dimaksud pada ayat (1)
dilarang bertentangan dengan kepentingan umum dan/atau ketentuan peraturan
perundang-undangan yang lebih tinggi Peraturan Desa ditetapkan oleh Kepala
Desa setelah dibahas dan disepakati bersama Badan Permusyawaratan Desa.
Rancangan Peraturan Desa tentang Anggaran Pendapatan dan Belanja Desa,
pungutan, tata ruang, dan organisasi Pemerintah Desa harus mendapatkan evaluasi

107

dari Bupati/Walikota sebelum ditetapkan menjadi Peraturan Desa.Hasil evaluasi


sebagaimana dimaksud pada ayat (4) diserahkan oleh Bupati/Walikota paling lama
20 (dua puluh) hari kerja terhitung sejak diterimanya rancangan peraturan tersebut
oleh Bupati/Walikota.) Dalam hal Bupati/Walikota telah memberikan hasil evaluasi
sebagaimana dimaksud pada ayat (5), Kepala Desa wajib memperbaikinya.Kepala
Desa diberi waktu paling lama 20 (dua puluh) hari sejak diterimanya hasil evaluasi
untuk melakukan koreksi Dalam hal Bupati/Walikota tidak memberikan hasil
evaluasi dalam batas waktu sebagaimana dimaksud pada ayat (5), Peraturan Desa
tersebut

berlaku

dengan

sendirinya

Rancangan

Peraturan

Desa

wajib

dikonsultasikan kepada masyarakat Desa Masyarakat Desa berhak memberikan


masukan terhadap Rancangan Peraturan Desa. (11) Peraturan Desa dan peraturan
Kepala Desa diundangkan dalam Berita Desa dan Lembaran Desa oleh sekretaris
Desa. (12) Dalam pelaksanaan Peraturan Desa sebagaimana dimaksud pada ayat
(1),

Kepala

Desa

menetapkan

Peraturan

Kepala

Desa

sebagai

aturan

pelaksanaannya. Pasal 70 (1) Peraturan bersama Kepala Desa merupakan peraturan


yang ditetapkan oleh Kepala Desa dari 2 (dua) Desa atau lebih yang melakukan
kerja sama antar-Desa. (2) Peraturan bersama Kepala Desa sebagaimana dimaksud
pada ayat (1) merupakan perpaduan kepentingan Desa masing-masing dalam kerja
sama antar-Desa.
PP.72 Tahun 2005
(1) Peraturan Desa ditetapkan oleh Kepala Desa bersama BPD.
(2) Peraturan Desa dibentuk dalam rangka penyelenggaraan Pemerintahan Desa.

108

(3) Peraturan Desa sebagaimana dimaksud pada ayat (1) merupakan penjabaran
lebih lanjut dari peraturan perundangundangan yang lebih tinggi dengan
memperhatikan kondisisosial budaya masyarakat desa setempat.(4) Peraturan
Desa sebagaimana dimaksud pada ayat (1) dilarang bertentangan dengan
kepentingan umum dan/atau peraturan perundang-undangan yang lebih
tinggi.Pasal

56

Peraturan

pembentukanperaturan

Desa

dibentuk

perundang-undangan.Pasal

berdasarkan
57

pada

Masyarakat

asas
berhak

memberikan masukan secara lisan atau tertulis dalam rangka penyiapan atau
pembahasan Rancangan Peraturan Desa.Pasal 58 Peraturan Desa disampaikan
oleh Kepala Desa kepada Bupati/Walikota melalui Camat sebagai bahan
pengawasan dan pembinaan paling lambat 7 (tujuh) hari setelah ditetapkan.Pasal
59 (1) Untuk melaksanakan Peraturan Desa, Kepala Desa menetapkan Peraturan
Kepala Desa dan/atau Keputusan Kepala Desa. (2) Peraturan . . . - 26 -(2)
Peraturan Kepala Desa dan/atau Keputusan Kepala Desa sebagaimana dimaksud
pada ayat (1), dilarang bertentangan dengan kepentingan umum, dan peraturan
perundangundanganyang lebih tinggi. Pasal 60
(1) Peraturan Desa dan Peraturan Kepala Desa dimuat dalam Berita Daerah.
(2) Pemuatan Peraturan Desa dan Peraturan Kepala Desa sebagaimana dimaksud
ayat (1) dilakukan oleh Sekretaris Daerah.
(3) Peraturan Desa dan Peraturan Kepala Desa sebagaimana dimaksud ayat (1)
disebarluaskan oleh Pemerintah Desa. Pasal 61 Rancangan Peraturan Desa tentang
APB Desa yang telah disetujui bersama sebelum ditetapkan oleh Kepala Desa

109

paling lama 3 (tiga) hari disampaikan oleh Kepala Desa kepadaBupati/Walikota


untuk dievaluasi. (2) Hasil evaluasi Bupati/Walikota terhadap Rancangan Peraturan
Desa sebagaimana dimaksud pada ayat (1) disampaikan palinglama 20 (dua puluh)
hari kepada Kepala Desa. (3) Apabila hasil evaluasi sebagaimana dimaksud pada
ayat (2) melampaui batas waktu dimaksud, Kepala Desa dapat menetapkan
Rancangan Peraturan Desa tentang APB Desa menjadi Peraturan Desa. Pasal 62
Ketentuan lebih lanjut mengenai pedoman Pembentukan dan mekanisme
penyusunan Peraturan Desa diatur dengan Peraturan Daerah Kabupaten/Kota
dengan berpedoman pada Peraturan Menteri.
Arah dan Jangkaun Pengaturan Pemerintahan Desa Berdasarkan Undang
Undang Nomor Berdasrkan Evaluasi Perbandingan Peraturan Pemerintah 72
Tahun 2005 Undang-Undang No 6 Tahun 2014 dan Peraturan Pemerintah
Nomor 43 tahun 2014.
1. Tidak adanya keterlibatan Badan Permuswratan Desa dalam Perencanaan
rancangan mengenai peraturan desa.
2. Peran kepala desa lebih dominan dalam perencanaan rancangan Peraturan Desa
3. Pemerintahan Desa di berikan hak Otonomi dalam Penyusunan Peraturan Desa
4 Dalam Hal Teknis Penetapan peraturan desa ada yang berbeda
5 Tidak adanya Kosultasi Kepada lembaga yang lebih tinggi.
PERATURAN DESA

Sasaran Yang di Wujudkan dalam Peraturan desa berdasarkan PP.72 Tahun 2005

110

Sebagai konsekuensi atas penetapan kewenangan yang melekat pada Desa, maka Desa
mempunyai kewenangan (mengatur, mengurus danbertanggungjawab) untuk menyusun
peraturan Desa.Peraturan Desadisusun oleh Kepala Desa dan BPD sebagai kerangka
kebijakan

dan

hukumbagi

penyelenggaraan

pemerintahan

dan

pembangunan

Desa.Penyusunanperaturan Desa merupakan penjabaran atas berbagai kewenangan


yangdimiliki Desa, tentu berdasarkan kepada kebutuhan dan kondisi Desasetempat,
serta mengacu pada peraturan perundang-undangan yang lebihtinggi.Sebagai sebuah
produk hukum, peraturan Desa tidak bolehbertentangan dengan peraturan yang lebih
tinggi dan tidak boleh merugikankepentingan umum. Sebagai sebuah produk politik,
peraturan Desa disusunsecara demokratis dan partisipatif, yakni proses penyusunannya
melibatkanpartisipasi masyarakat. Masyarakat mempunyai hak untuk mengusulkan
ataumemberi masukan kepada BPD maupun Kepala Desa dalam prosespenyusunan
peraturan Desa.Fasilitasi pemerintah kabupaten terhadap penyusunan peraturan
Desasangat diperlukan untuk mempermudah dan membangun kapasitaspemerintah Desa
untuk menyusun perdes baik.Pengawasan (supervisi)kabupaten terhadap peraturan Desa
sangat diperlukan agar perdes tetapberjalan sesuai dengan norma-norma hukum, yakni
tidak menyimpang dariperaturan di atasnya dan tidak merugikan kepentingan
umum.Pengawasanbisa berbentuk preventif (proses konsultasi sebelum raperdes
disahkanmenjadi

perdes)

dan

berbentuk

represif

(membatalkan

perdes

yangbertentangan).Setelah peraturan Desa ditetapkan secara formal oleh kepala


Desadan

BPD,

maka

tahap

berikutnya

adalah

pelaksanaan

perdes

yang

menjaditanggungjawab kepala Desa.BPD mempunyai hak melakukan pengawasandan

111

evaluasi terhadap pelaksanaan peraturan Desa.Masyarakat jugamempunyai hak untuk


melakukan monitoring dan evaluasi secara partisipatifterhadap pelaksanaan perdes.
PP.72 Tahun 2005
(1) Peraturan Desa ditetapkan oleh Kepala Desa bersama BPD.
(2) Peraturan Desa dibentuk dalam rangka penyelenggaraan Pemerintahan Desa.
(3) Peraturan Desa sebagaimana dimaksud pada ayat (1) merupakan penjabaran lebih
lanjut dari peraturan perundangundangan yang lebih tinggi dengan memperhatikan
kondisi sosial budaya masyarakat desa setempat.(4) Peraturan Desa sebagaimana
dimaksud pada ayat (1) dilarang bertentangan dengan kepentingan umum dan/atau
peraturan perundang-undangan yang lebih tinggi.Pasal 56 Peraturan Desa dibentuk
berdasarkan pada asas pembentukan peraturan perundang-undangan.Pasal 57
Masyarakat berhak memberikan masukan secara lisan atau tertulis dalam rangka
penyiapan atau pembahasan Rancangan Peraturan Desa.Pasal 58 Peraturan Desa
disampaikan oleh Kepala Desa kepada Bupati/Walikota melalui Camat sebagai
bahan pengawasan dan pembinaan paling lambat 7 (tujuh) hari setelah
ditetapkan.Pasal 59 (1) Untuk melaksanakan Peraturan Desa, Kepala Desa
menetapkan Peraturan Kepala Desa dan/atau Keputusan Kepala Desa. (2) Peraturan
. . . - 26 - (2) Peraturan Kepala Desa dan/atau Keputusan Kepala Desa sebagaimana
dimaksud pada ayat (1), dilarang bertentangan dengan kepentingan umum, dan
peraturan perundangundangan yang lebih tinggi. Pasal 60
(1) Peraturan Desa dan Peraturan Kepala Desa dimuat dalam Berita Daerah.

112

(2) Pemuatan Peraturan Desa dan Peraturan Kepala Desa sebagaimana dimaksud
ayat (1) dilakukan oleh Sekretaris Daerah.
(3) Peraturan Desa dan Peraturan Kepala Desa sebagaimana dimaksud ayat (1)
disebarluaskan oleh Pemerintah Desa. Pasal 61 Rancangan Peraturan Desa tentang
APB Desa yang telah disetujui bersama sebelum ditetapkan oleh Kepala Desa
paling lama 3 (tiga) hari disampaikan oleh Kepala Desa kepada Bupati/Walikota
untuk dievaluasi. (2) Hasil evaluasi Bupati/Walikota terhadap Rancangan Peraturan
Desa sebagaimana dimaksud pada ayat (1) disampaikan paling lama 20 (dua puluh)
hari kepada Kepala Desa. (3) Apabila hasil evaluasi sebagaimana dimaksud pada
ayat (2) melampaui batas waktu dimaksud, Kepala Desa dapat menetapkan
Rancangan Peraturan Desa tentang APB Desa menjadi Peraturan Desa. Pasal 62
Ketentuan lebih lanjut mengenai pedoman Pembentukan dan mekanisme
penyusunan Peraturan Desa diatur dengan Peraturan Daerah Kabupaten/Kota
dengan berpedoman pada Peraturan Mente
Undang-Undang 6 tahun 2014
Jenis peraturan di Desa terdiri atas Peraturan Desa, peraturan bersama Kepala Desa,
dan peraturan Kepala Desa. Peraturan sebagaimana dimaksud pada ayat (1)
dilarang bertentangan dengan kepentingan umum dan/atau ketentuan peraturan
perundang-undangan yang lebih tinggi Peraturan Desa ditetapkan oleh Kepala
Desa setelah dibahas dan disepakati bersama Badan Permusyawaratan Desa.
Rancangan Peraturan Desa tentang Anggaran Pendapatan dan Belanja Desa,

113

pungutan, tata ruang, dan organisasi Pemerintah Desa harus mendapatkan evaluasi
dari Bupati/Walikota sebelum ditetapkan menjadi Peraturan Desa.
Hasil

evaluasi

sebagaimana

dimaksud

pada

ayat

(4)

diserahkan

oleh

Bupati/Walikota paling lama 20 (dua puluh) hari kerja terhitung sejak diterimanya
rancangan peraturan tersebut oleh Bupati/Walikota.) Dalam hal Bupati/Walikota
telah memberikan hasil evaluasi sebagaimana dimaksud pada ayat (5), Kepala
Desa wajib memperbaikinya.Kepala Desa diberi waktu paling lama 20 (dua puluh)
hari sejak diterimanya hasil evaluasi untuk melakukan koreksi Dalam hal
Bupati/Walikota tidak memberikan hasil evaluasi dalam batas waktu sebagaimana
dimaksud pada ayat (5), Peraturan Desa tersebut berlaku dengan sendirinya
Rancangan Peraturan Desa wajib dikonsultasikan kepada masyarakat Desa
Masyarakat Desa berhak memberikan masukan terhadap Rancangan Peraturan
Desa. Peraturan Desa dan peraturan Kepala Desa diundangkan dalam Berita Desa
dan Lembaran Desa oleh sekretaris Desa. (12) Dalam pelaksanaan Peraturan Desa
sebagaimana dimaksud pada ayat (1), Kepala Desa menetapkan Peraturan Kepala
Desa sebagai aturan pelaksanaannya. Pasal 70 (1) Peraturan bersama Kepala Desa
merupakan peraturan yang ditetapkan oleh Kepala Desa dari 2 (dua) Desa atau
lebih yang melakukan kerja sama antar-Desa. (2) Peraturan bersama Kepala Desa
sebagaimana dimaksud pada ayat (1) merupakan perpaduan kepentingan Desa
masing-masing dalam kerja sama antar-Desa.

114

BAB V
PENUTUP
1. Keputusan Pemerintah dan Komisi II DPR untuk melakukan revisi terhadap UndangUndang Nomor 32 Tahun 2004 tentang Pemerintahan Daerah serta mendesain
kembali menjadi 3 Undang-Undang yang baru, yakni Undang Undang Pemerintahan
Daerah, Undang-Undang Pemilihan Kepala Daerah dan Undang-Undang Desa
adalah suatu gagasan yangsangat baik dan perlu didukung oleh semua pihak dalam
rangkamewujudkan tata kelola pemerintahan yang lebih baik.

115

2. Dalam hubungannya dengan keinginan yang kuat untuk mewujudkanpembentukan


Undang-Undang Desa, hal ini semakin menunjukkanadanya suatu kesadaran dan
komitmen politik yang sangat tinggi untukmenempatkan dan memfokuskan Desa
sebagai sendi-sendi negara yangsangat penting dalam rangka mempercepat dan
mendukungpemerintahan di atasnya.
3. Secara filosofis, pembentukan Undang-Undang Desa akan menempatkankembali
Desa sebagai susunan pemerintahan yang terdepan dalampenyelenggaraan urusan
pemerintahan yang langsung berhadapan dengan masyarakat.
4. Secara Yuridis, dengan pembentukan Undang-Undang Desa ini makaakan semakin
memperjelas kedudukan Desa dalam tata pemerintahan diIndonesia, hal ini
dikarenakan akan kembali sesuai dengan amanat Pasal18 Undang-Undang Dasar
1945.
5. Secara Sosiologis, berbagai aspek yang menjadi permasalahan krusialmasyarakat di
daerah Perdesaan akan segera dapat lebih difokuskanuntuk ditangani, dengan
demikian maka cita-cita luhur bangsa Indonesiayang tertuang di dalam Pembukaan
Undang-Undang Dasar 1945 akansegera dapat diwujudkan.

116

117

118