Anda di halaman 1dari 19

5/22/2015

HOME

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH
PENDIDIKANISLAM

BAHASAINDONESIA

PKN

BAHASAINGGRIS

BIOLOGI

EKONOMI

KESEHATAN

SENI

SEJARAH

PENDIDIKAN
SOSIOLOGI

HUKUM
SKRIPSI

IPS

MANAJEMEN

KARYAILMIAH

SKRIPSI

PROPOSAL

CONTOHSURAT

Home PROPOSAL CONTOH PROPOSAL PROGRAM PENGAJUAN PENDIRIAN SEKOLAH


MENENGAHKEJURUAN(SMK)

CONTOH PROPOSAL PROGRAM PENGAJUAN PENDIRIAN SEKOLAH


MENENGAHKEJURUAN(SMK)
Nomor : 01/YPPI
AM/24/III/2009
Lamp:1(satu)bundel
Perihal : Permohonan
Penyelenggaraan
SekolahMenengah
Kejuruan(SMK)
Kepada Yang
Terhormat,
Bapak Kepala
Dinas
Pendidikan
Kota
Tasikmalaya

Beli Gmail U/
Domain Anda

TerimakasihatasmasukanAnda!Urung

di

KamiakanmenggunakanmasukanAndauntuk
Tasikmalaya meninjauiklanpadasitusini.
Bantukamimenampilkaniklanyanglebihbaik
kepadaAndadenganmemperbaruisetelaniklan
Anda.

Alamat Email Bisnis Khusus.


Mulai Uji Coba Gratis 30 Hari.
BersamainikamiKetuaYayasanPembinaPendidikanIslam(YPPI)AlMisbah
mengajukan permohonan rekomendasi untuk menyelenggarakan Sekolah
MenengahKejuruan(SMK)dilingkunganYayasanyangkamikelola.Dengan
identitassebagaiberikut:
1. NamaYayasan:ALMISBAH
2. AlamatLengkap:Jl.Kel.SirnagalihRt.01/04(Komp.
PonpesAlMisbah)Kec.Indihiang
KotaTasikmalaya46151
3. NamaKetuaYayasan:K.KhairilAnbar
4. PenanggungJawabProgram:RivaFuadFauzi,S.Pd.I
5. JumlahSantri:70orang
6. SaranaPendidikanyangada:
a. Madrasah/RuangKelas8lokal
b. Pondok
c. Mesjid
Demikianpermohonaninikamisampaikan,atasperhatiandankerjasamayang
baikkamiucapkanterimakasih.

Tasikmalaya,24Maret2009

file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

1/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH
KetuaYPPIAlMisbah

K.KhairilAnbar
Mengetahui,
CamatIndihiang

LurahSirnagalih

_________________________

___________________________

Nomor:02/YPPIAM/24/III/2009
Lamp:1(satu)bundel
Perihal:KesanggupanMelaksanakanProgram

KepadaYangTerhormat,
BapakKepalaDinasPendidikanKotaTasikmalaya
di
KotaTasikmalaya

SURATPERNYATAAN
Nomor:01/YPPIAM/SMK/24/III/2009

AssalamualaikumWr.Wb
Yangbertandatangandibawahini:
Nama:RivaFuadFauziS.Pd.I
TempatTanggalLahir:Tasikmalaya,17Nopember1983
Jabatan:PenanggungJawabProgram
SekolahMenengahKejuruan(SMK)
Alamat:Jl.Kel.SirnagalihRt.01/04(Komp.
PonpesAlMisbah)Kec.Indihiang
KotaTasikmalaya46151
Dengan ini menyatakan bersedia mengelenggarakan Sekolah Menengah
Kejuruan(SMK)padaYayasanPembinaPendidikanIslam(YPPI)AlMisbahJl.
Kel. Sirnagalih Rt. 01/04 (Komp. Ponpes AlMisbah) Kec. Indihiang Kota
Tasikmalaya,dengansegalasaranadankemampuan.
Demikian surat pernyataan ini kami buat dengan sesungguhnya untuk
dijadikanbahanseperlunya.
Atasperhatiandankerjasamayangbaikkamihaturkanterimakasih.

file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

2/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH
WassalamualaikumWr.Wb

Tasikmalaya,24Maret2009
Penanggung

Jawab

Program,

RivaFuadFauzi,S.Pd.I

PEMETAANYAYASANPEMBINAPENDIDIKANISLAM(YPPI)ALMISBAH
PENYELENGGARASEKOLAHMENENGAHKEJURUAN(SMK)
A. DATAUMUM
1. NamaYayasan:ALMISBAH
2. AktaNotarisYayasan:Tanggal11Juli1970No.11
3. NomorSuratPernyataan
KesanggupanMelaksanakanProgram:
4. NamaKetuaYayasan:K.KhairilAnbar
5. AlamatYayasan:
a. Jalan:Kel.Sirnagalih
b.Kelurahan:Sirnagalih
c. Rt./Rt:RT.01RW.04(Komp.PonpesAlMisbah)
d. Kecamatan:Indihiang
e. Kota:Tasikmalaya
f. KodePos:46151
B. PenanggungJawabProgram
1. Nama:ALMISBAH
2. TempatTglLahir:Tanggal11Juli1970No.11
3. Pendidikan
a. Formal:S.1PendidikanBahasaArab
b. NonFormal:PonpesSukahideng
4. Telp/HP:(0265)7158533/085223091533
C. TenagaAdministrasi
1. Nama:ALMISBAH
2. TempatTglLahir:Tanggal11Juli1970No.11
3. Pendidikan
a. Formal:S.1PendidikanBahasaArab
b. NonFormal:PonpesSukahideng
5. Telp/HP:(0265)7158533/085223091533
D. TempatBelajar
1. NamaTempat:ALMISBAH

file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

3/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH

2. TempatTglLahir:Tanggal11Juli1970No.11
3. Pendidikan
a. Formal:S.1PendidikanBahasaArab
b. NonFormal:PonpesSukahideng
4.Telp/HP:(0265)7158533/085223091533
E. Tutor
1. Nama:ALMISBAH
2. TempatTglLahir:Tanggal11Juli1970No.11
3. Pendidikan
a. Formal:S.1PendidikanBahasaArab
b. NonFormal:PonpesSukahideng
4. Telp/HP:(0265)7158533/085223091533
BABI
PENDAHULUAN
A. LATARBELAKANG
Revolusiinformasiglobaltelahberhasilmenyatukankemampuankomputerisasi,televisi,radio
dan telepon secara terintegrasi. Hal ini juga merupakan hasil dari suatu kombinasi revolusi
dibidang computer personal, transmisi dan kompresi lebar pita (Bandwidth), teknologi
penimpanan data (Data Storage) dan penyampaian data (Access) integrasi multimedia dan
jaringan computer. Konfigurasi dan teknologi revolusi tersebut telah menyatukan berbagai
media,yaitusuara(Voice,Audio),video,citra(image)grafikdanteks.
Teknologi komunikasi dan informasi pada dasarnya memungkinkan dan memudahkan
manusiauntukdapatsalingberhubungandengancepat,mudahdanterjangkausertamemiliki
potensiuntukmembangunmasyarakatyangdemokratis,dansalahsatudampakterbesarnya
adalah demokrasi di bidang pendidikan, ditandai dengan adanya hubungan antara guru
dengan siswa, siswa dengan siswa, guru dengan guru bahkan antara guru, siswa dan
masyarakatdalamkaitannyadenganprosespendidikandidalamdandiluarsekolah.Dengan
sifatsifat teknologi komunikasi dan informasi seperti itu telah membuka peluang besar bagi
pemerintah daerah dan pemerintah kota untuk dapat menyiapkan diri untuk membangun
sebuahsistemninformasiyangmemungkinkanterjadinyaprosespemanfaatanteknologidan
informasi bagi kemajuan pendidikan di daerah dan di kota. Hal itu merupakan konsekuensi
dari ketersediaannya teknologi yang dimaksud dalam pelaksanaan otonomi daerah. Itu juga
berartibahwapemanfaatanteknologikomunikasidaninformasiitukhususnyainternetkendala
keterjangkauandaneksposeterhadapinformasiantaraberbagaiwilayahdiseluruhIndonesia
dapatdiatasidankeutuhanwilayahNegaraKesantuanRepublikIndonesiadapattetapterjaga.
Namunyangterpentingdarikeadaaniniadalahdibutuhkannyatanggungjawabmoralsetiap
penyedia(provider)danpenggunateknologikomunikasidaninformasitersebutkarenaselain
diperolah kemudahan juga akan berjalan seiring dengan dampak negative yang akan
ditimbulkan seandainya pemanfaatan itu tidak didasari dengan nilainilai keimanan,
ketaqwaan, etika, estetika dan kearifan para pemakainya. Hanya dengan mengembangkan
nilainilai seperti itu dampak negative dari pemanfaatan teknologi komunikasi dan informasi
khusunyainternetdaptdiminimalkanbagigenerasimudayangmasihadadalampertumbuhan
danpercobaan.Membangunsebuahketerbatasan
dalambersentuhandenganteknologikomunikasidaninformasitersebuthampertidakmungkin
begitu terbukanya berbagai informasi yang di sanasini diwarnai dengan berbagai trik yang
mengundang keterlibatan semua orang termasuk generasi muda untuk terlibat ke dalam
sistemteknologikomunikasidaninformasiyangmerekabangun.
Hal itu sangat dimungkinkan karena dengan arahan yang tepat dan sedikit intervensi,
teknologiinformasidankomunikasidapatmembantumentransportasikanmerekayangselama
ini berada dalam posisi marginal di banyak daerah dengan peralatan sebuah computer
multimediadapatberubahdariposisipengamatmenjadiposisipartisipasiaktif,dandisisilah
peranan teknologi informasi dan komunikasi terhadap dunia pendidikan dalam proses
demoksasri pendidikan menjadi sangat segnifikan. Dengan berkembangnya teknologi

file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

4/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH

informasitersebutantarabatasmenjadihilang(BorderlessNations)demikianpulaantarbisnis,
pendidikan bahkan media. Perkembangannya begitu dahsyat sehingga hampir tidak ada
aspekkehidupan(pendidikan,perdagangan,semuasegiusaha,hiburan,pemerintahan,pola
kerja, pola produksi dan pola hubungan antar manusia) yang terlepas dari pengaruh juga
dampak yang ditimbulkan yang pada saat ini jadi perhatian serius dari berbagai Negara di
dunia.Apayangumumnyasulitdicapaidaerahumumnyakhususnyadaerahterpencilhampir
dapat dipastikan tidak ada kendala lagi sepanjang perangkat teknologi yang dibutuhkan
memangtersedia.

Untukmencapaitujuantersebut,kamisebagaipenanggungjawabprogramtelahmenyusun
rencana strategis untuk peningkatan mutu dan akses yang memiliki fungsi dalam proses
pembelajaransepertidapat:
1.MengembangkankemampuanpesertadidikdenganmengenalberbagaifasilitasTIK
2. Mengembangkan pengetahuan, keterampilan peserta didik melalui inovasi Teknologi dan
Informasi(TIK)untukpendidikan
3.Dapatmemberikanmanfaatbagilingkunagansetempatdanoranglain
4.Dapatmemberikansolusimasalahyangdihadapiyaituglobalisasidantantangandunia
5.Skillyangmapanuntukterjundalamduniausaha.
Adanya pengendalian yang ketat sehingga kita dapat diketahui berhasil tidaknya program
yangdilaksanakandandapatmemberikanmasukanuntukperencanaanselanjutnya.
Berdasarkanperencanaandiatasmakastrategiyangakankamiditempuhadalah:
1. Melakukankerjasamadengansekolah/lembagapendidikanlain.
2. Memilikikemampuandapatmengaksesinternet,mengaplikasikansoftware,memuatweb
site,instalasijaringankomputerLAN,menguasaisalahsatubahasapemrograman.
3. ManyiapkansumberdayamanusiayangprofessionaldalambidangITdaninternet
4. Menyiapkanprogramsistempembelajaranonline
5. Menyiapkanprogramevaluasidanpemantauanorangtuasiswaonline
6. Menyiapkan programprogram pelatihan sesuai dengan kebutuhan siswa, guru dan
masyarakatsekitar.
7. MemaksimalkansistemmanajemenpengembanganITberbasisinternetdisekolah.
Berangkatdaridasarpemikirantersebut,makadenganinikamimemberanikandirimengajukan
proposaluntukpendirianSekolahMenengahKejuruan(SMK)Informatika.

BABII
PROFILSMKBINAINFORMATIKA
TASIKMALAYA

A.SEJARAHSINGKAT
Sekolah Menengah Kejuruan (SMK) Bina Informatika Tasikmalaya
merupakan refleksi dari komitmen Yayasan Pembina Pendidikan Islam
(YPPI) AlMisbah terhadap salah satu misinya, yakni ikut serta
menyediakan sumber daya manusia yang berkualitas melalui
penyelenggaraansatuanpendidikanpadajalursekolahsejakpendidikan
pra sekolah hingga pendidikan Menengah, serta pendidikan jalur luar
sekolah seperti majlis talim, pondok pesantren dan kursuskursus
(Anggaran Dasar Pasal 3). Sejak Yayasan ini didirikan pada 11 Juli
1970 dengan Akta Notaris Suharmani, No. 11. Perkembangan ini
menunjukkankemajuanyangpositif.Haliniterlihatdariindikatorrespon
masyarakatdanjumlahpelamarcalonsiswabaru.
Berangkatdaripotensitersebut,PanitiaPendirianmenyiapkanproposal
pendirian mengenai desain Sekolah Menengah Kejuruan Informatika
yang akan didirikan terutama menyangkut tujuan, visi, misi, target,
strategi, dan model pembelajaran serta manajemennya. Setelah
file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

5/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH

melewati serangkaian pembahasan proposal bersama Pengurus


Yayasan yang di dilaksanakan pada tanggal 1 Pebruari 2009, yang
akhirnyaisiperencanaandanprograminidisetujuipihakYayasan.
Setelah tahap persiapan dianggap mencukupi terutama yang berkaitan
dengan penyediaan/pembuatan perangkat keras dan lunak, maka
Yayasan mengusulkan permohonan pendirian Sekolah Menengah
Kejuruan(SMK).
B.NAMASEKOLAH
Sekolah ini bernama Sekolah Menengah Kejuruan (SMK) Bina
Informatika. Kata Bina diambil dari nama Yayasan (Yayasan Pembina
Pendidikan Islam), dan Informatika adalah sesuai dengan prioritas
kejuruanyangtelahkamisusun.
C. BENTUKLOGO
1. AdapunbentuklogoSMKBinaInformatika:

2. MAKNALOGODANSIMBOLSMKBINAINFORMATIKA
SMKBinaInformatikadidonimasiwarnabiru.Warnabirumengandungmaknakedamaian.
Damaidalamkehidupanitulahharapankitasemua.
Garis menutup seluruh komponen simbol yang artinya seluruh warga SMK Bina
Informatikamemilikipagar/aturanuntukseluruhwargaSMKBinaInformatika,baiktertulis
maupuntidaktertulis.
SegilimamerupakanperlambangatausimboldarisilasilaPancasilayangberatiSMK
Bina Informatika tunduk, patuh dan membentengi diri dengan silasila tersebut dalam
tingkahlakuseharihari.
Kujangmenggambarkan"PropinsiJawaBarat".
Sayap : melambangkan sebagai kekuatan dalam memajukan SMK Bina Informatika dan
citacitauntukmasadepan.
Buku dan Pena Emas menggambarkan Dunia Pendidikan yang sangat mulia, dan
merupakansumberilmu,sertasifatSMKBinaInformatikaadalahcintailmu,belajarterus
menerus,kreatifdaninovatif.
Bintang:merupakantujuankeinginanSMKBinaInformatikabahwaSMKBinaInformatika
harussejajar,berprestasidengansekolahpendahulunya,danharusselalumenjadiyang
terdepan.
Warnamerah:warnayangsangatkuatmelambangkankeinginanyangkuatdaripendiri
untuk memajukan pendidikan di Tasikmalaya, warna merah juga berarti berani, berati
bertindak,berajidanmajuberanimengatakanyangbenaradalahbenardanyangsalah
adalahsalah.
WarnaKuning:melambangkankejayaan,sehinggaSMKBinaInformatikaakanmenjadi
suatusekolahyangmajudanmandiri.
GambarParabola/pemancarinternetbahwaSMKyangmempunyaijurusanInformatika
yangbergelutdengankeahliandibidangkomputerisasi.
Tulisan Sekolah Menengah Kejuruan Bina Informatika Tasikmalaya adalah identitas

file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

6/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH
bahwasekolahMenengahKejuruanyangberadadikotaTasikmalaya.

Kesimpulan:
Melahirkan generasi yang siap menyongsong masa depan cerah baik duniawi maupun
ukhrawi.
D. TUJUANSEKOLAH
Mengasilkanlulusanyangmenguasaidasardasarilmupengetahuandanteknologi(basicknowledge
ofscienceandtechnology)yangdilandasikeimanandanketaqwaanyangkuat,sehinggadapat
melanjutkankejenjangpendidikantinggiyangberkualitasbaik,sertamampumengadakanhubungan
timbalbalikdenganlingkungansosial,budayadanalamsekitardenganperilakuakhlaqulkarimah.
StrategiSekolah
1) Menjaring siswa dari lulusan SMP/MTs Negeri/Swasta melalui seleksi nilai raport
untukmatapelajaranMatematika,IPA,BahasaInggris,BahasaIndonesiadanPAIdan
nilaiAkhirUjianNasional,melaluitestulisdanpsikotes.
2) Menciptakaniklimbelajaryangmenyenangkan,sehat,kreatif,inovatifdankompetitif
gunamendorongsiswameraihprestasi.
3) Mengembangkan proses belajar dengan prinsip belajar tuntas dan sesuai
kompetensi.
4) Menyiapkantenagapendidikyangprofesionaldanpenuhdedikasi.
5) Menyediakansaranadanprasaranayangmemadai.
6) Mengadakankerjasamapendidikandenganberbagaipihakterkait.
7) Menyediakanperpustakaanyangmemadai.
8) Melakukanstudibandingkesekolahlainyangberprestasi.
LingkungandanBudayaSekolah
SMK Bina Informatika dirancang sebagai sekolah model yang memiliki keunggulan secara
terpadu dalam prestasi akademik yang berkualitas yang dapat digapai oleh semua lapisan
masyarakatsertamenggunakankurikulumyangrelevandenganduniateknologiinformatika.Untuk
mewujudkankeunggulanini,sistemdirancangsedemikianrupaagarkondusif,harmonisdengan
lingkungansekolahdanmembudaya.
SistemyangdirancangmerupakankekhasanSMKBinaInformatikadisampingmengadopsidari
beberapa model yang sudah ada. Sebagai sekolah model yang akan mengembangkan
keunggulantersebut,seiringdenganwaktudanperubahanyangterjadidimasyarakat,makaSMK
Bina Informatika terus menambah content (isi), merubah context (realitas) dan terus
mengembangkancapacity(kapasitas)sesuaidengankebutuhan.

E.CIRIKHASKEUNGGULAN
SMK Bina Informatika dirancang menjadi model sekolah yang
memiliki keunggulan dalam prestasi akademik, kualitas keshalihan,
dan keterampilan dalam mengoperasikan berbagai program
komputerisasi. Untuk mewujudkan keunggulan ini, kurikulum dan
lingkunganbelajardirancangsedemikianrupaagarkondusif.
F.VISI
MEWUJUDKAN INSAN CERDAS BERKUALITAS DAN KOMPETITIF DI BIDANG
INFORMATIKABERLANDASKANIMANDANTAQWA
E.MISI
Menyiapkancalonpemimpinumatbangsamasadepanyangmenguasaiilmupengetahuan
danteknologiinformatikayangdilandasiimandantaqwayangkuat.
Menyelengggarakan pendidikan yang inovatif dan kompetitif sehingga pembelajaran
berlangsungefektifdanproduktifuntukmeraihprestasibelajaryangmemuaskan.
Menciptakan lingkungan belajar yang religius melalui penegakan keteladanan dan
pembiasaandalampengamalanprilakusholeh.

G.TATANILAI
file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

7/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH

TatanilaisebagainormaprilakuSMKBinaInformatikaadalah:
1.Belajardanmengajarmerupakanamalshalih
2.Bekerjaberdasarkanprinsipprofesional
3.Melakukanperbaikanmutusecarakontinue
4.Menumbuhkansikapkreatif,inovatif,dankompetitif
H.TARGET
1. Mulai tahun lulus pertama, lulusan SMK Bina Informatika dapat
diterimapadaperusahaanatauinstansilain.
2. Terwujudnya kehidupan siswa yang religius di lingkungan sekolah
yangditandaidenganperilakushalih,adab,ikhlas,ukhuwah,kreatif,
danmandiri.
I.STRATEGI
1. MenjaringcalonsiswadarilulusanSLTPsederajatNegeri/Swasta
melaluiseleksinilairaportdarikelasIXdantesmasukyangmeliputi
Matematika,IPA,Imla,BacaAlQurandanPsycoTest(wawancara)
2. Menciptakaniklimbelajaryangsenang,sehat,kreatif,inovatif,dan
konpetitifgunamendorongsiswameraihprestasi.
3. Mengembangkan proses pembelajaran dengan prinsip Mastery
Learning(belajartuntas)
4.Menyiapkantenagapendidikyangprofesionaldanpenuhdedikasi
5.Menyediakansaranadanprasaranayangmemadai
6.Mengadakankerjasamapendidikandenganberbagaipihakterkait
7.Melakukanstudibandingkesekolahlainyangberprestasi
J.KURIKULUM
SMK Bina Informatika menggunakan kurikulum 1994 dan kurikulum
tahun pelajaran 2000/2001, serta struktur program kurikulum yang
diperkayavisidanmisisekolah.
K.KEGIATANBELAJARMENGAJAR
1.Kapasitassiswaperkelasmaksimal30orang
2.Lamawaktuperjampelajaransebanyak40menit
3. Jam pelajaranefektifperharidelapanjamdaripukul07.00s.d
13.20WIB.
4.Jumlahhariefektifbelajarperminggusebanyak6hari
5. Pendekatan yang digunakan dalam kegiatan belajar adalah
pendekatansiswaaktif(studentactivelearning).
L.TENAGAKEPENDIDIKAN
Sejak tahun ajaran pertama dilakukan rekrutmen guru dan tenaga
kependidikanlainnyadenganketentuan:
BerpendidikanminimalS.1
Memilikiaktamengajar
Keahlianrelevandengantuntutanmatapelajaran
Gurutetapyayasansebanyak9orang
Guruhonornonyayasan8orang
file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

8/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH

N.EKTRAKURIKULER
PendidikankepemimpinanmelaluiOSIS,Imamshalat,danpidato.
Kepramukaan
Kemasyarakatan(baktisosial,pedulilingkungandanpengajian)
O.KEGIATANKEAGAMAAN
SMK Bina Informatika adalah merupakan lembaga pendidikan
formalyangberusahamenghidupkanruhdannuansapesantrendengan
melaksanakan kegiatankegiatan keagamaan yang bersifat umum yang
meliputi pelaksanaan shalat fardu berjamaah di masjid, menghidupkan
shalatnawafil(sunnah),mengucapkansalambilabertemudenganorang
lain dan berbudaya akhlakul karimah, sehingga tercipta suasana
kehidupanyangIslamidilingkungansekolahyangdiperlihatkandengan
prilakuikhlas,tawadhu,ukhuwah,mandiridankreatif.
Disampingitu,adapulakegiatankeagamaanuntukmeningkatkan
pemahaman dan pengalaman ajaran agama melalui kegiatan
tausyiah/mentoring, bimbingan praktek ibadah, training pendalaman
agama,mabitdanlainlaindilingkunganpesantrenAlMisbah.
Q.SARANAPENDIDIKAN
SaranaDanPrasaranaYangDimilikiSekolah
No

Ruang

Jumlah

Mesjid

Kelas

Perpustakaan

KantorSekolah

LapanganOlahraga

WC

Luas(M2)

LuasTanah
StatusPemilikan

Milik
Sewa

Luastanah

Penggunaan
Bangu

Lapangan

nan

olahraga

7000m2

500m2

90m2

18m2

BlmSertifikat

Setifikat

seluruhnya

Kebun

R.PEMBIAYAAN
Pada awalnya sumber biaya untuk operasional pendidikan berasal
daripenerimaanSPPsiswadanYayasanAlMisbah.

Rincian Biaya untuk Pemenuhan Kebutuhan sarana pembelajaran dan program


pembelajaran

No
(1)
1.

JenisKebutuhan
(2)
Komputer:@Rp.3.900.000,00

Jumlah
(3)
2

Biaya(Rp)
(4)
7.800.000,00

Processor:inteldualcore2.66GHz
Mainboard:AsusP5RD1VM

file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

9/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH
VGA:onboard
Sound:onboard
Hardisk:seagate80Gb
Memory:Twinmos256
OpticalDrive:CDRWTeac32x16x8x
Case:Powerup
Monitor:Advance
Flopy:Panasonic
2.

LCDProyektor

30.000,000,00

3.

Printer

1.000.000,00

4.

SoftwareAkuntansi

(1)

1set
(3)

(2)

5.

LemariPerpustakaankelas

1buah

6.

5.000,000,00
(4)
1.000.000,00

Lemariuntukadministrasi

1buah

800.000,00

7.

MejaKursiuntukpembelajaran

24set

13.200.000,00

8.

BukuperpustakaanKelas

100judul

5.000.000,00

9.

Mejakursisiche/sofa

1set

1.500.000,00

TotalBiaya

Rp.65.300.000,00

Terbilang:*Enampuluhlimajutatigaratusriburupiah
BABIII
ORGANISASISEKOLAH
AdapunsusunanorganisasiSMKBinaInformatikaterdiriatas:
A. PimpinanSekolah,meliputi:
a. KepalaSekolah
b. Wk.KepalaBidangKurikulum
c. Wk.KepalaSekolahBidangKesiswaan
d. Wk.KepalaSekolahBidangSaranadanPrasarana.
B. PelaksanaAkademik,meliputi:
a. Walikelas
b. GuruMataPelajaran
c. GuruBimbingandanKonseling
d. KoordinatorKerohanian
e. PembinaEkstrakurikuler
C. PelaksanaAdministratif
a. KepalaTataUsaha
b. BendaharaSekolah
D. OrganisasiSiswa

1.PIMPINANSEKOLAH
A.KepalaSekolah

Kepala Sekolah berfungsi sebagai educator,


administratordansupervisor,manajer, pemimpin,
daninovator.
Kepalasekolahselakuedukator
Kepala Sekolah selaku edukator bertugas melaksanakan proses belajar mengajar
secaraefektifdanefisien.
Kepalasekolahselakuadministrator
Bertugas menjalankan fungsifungsi administrasi dalam pengertian administration,
yakni melakukan perencanaan, pengorganisasian, pengarahan, pengkoordinasian,
dan pengawasan mengenai kurikulum, kesiswaan, ketatausahaan, ketenagaan,

file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

10/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH
perkantoran, keuangan, perpustakaan, laboratorium, bimbingan belajar, OSIS, UKS,
DAN 7 k (keamanan, kebersihan, keindahan, kekeluargaan, kesehatan, dan
kerindangan).
Kepalasekolahselakusupervisor
Selaku supervisor, kepala sekolah bertugas menjalankan kegiatan supervisi untuk
meningkatkanhasilbelajarmelaluiperbaikandanbantuanunsurunsuryangberkait
dengankomponenberikut:
1. Kegiatanbelajarmengajar,
2. Kegiatanbimbingandankonseling,
3. Kegiatanekstrakurikuler,
4. Kegiatanketatausahaan,
5. Kegiatankerjasamadenganmasyarakatininstansiterkait,
6. Saranadanprasarana,
7. KegiatanOSIS
Kepalasekolahselakumanajer
Sebagai manajer, kepala sekolah menjalankan fungsi pengelolaan sumber daya
manusia,material,uang,waktu,danlingkungandengankegiatansebagaiberikut:
1. Merencakan, mengorganisasikan,, menkoordinasikan , mengarahkan,
mengawasi,mengevaluasikegiatankegiatansekolah
2. Membuatsuatukebikaksanaandanmengambilkeputusan
3. Mengaturprosesbelajarmengajar,
4. Mengatur administrasi, ketatausahaan, siswa, ketenagaan, sarana dan
prasarana,keuangan/RAPBS.
5. Mengaturorganisasisiswaintrasekolah(OSIS/QIDS),
6. Mengaturhubungansekolahdenganmasyarakatdaninstansiterkait.
Kepalasekolahsebagaipemimpin
1. Menjalankanmisisekolahuntukmencapaitargetdanvisisekolah
2. Mempengaruhikesadarandanpikiranwargasekolahdalammenjalankanfungsi
masingmasinguntukmencapaivisi
3. Melakukanupayapeningkatankemampuanprofesionalguru
4. Membangunhubunganmanusiawiyangharmonisdiantarawargasekolahdan
denganlingkungansekolah
5. Menerapkanprinsipmeritsystemdalammenentukankarirwargasekolah

6. Menerapkanprinsiprewardandpunishmentdalammemperlakukankinerjaguru
7. Mengusahakankesejahteraanbagiwargasekolah
8. Mengambilkeputusanurusaninterndaneksternsekolah,
9. Merumuskangagasangagasanbaruuntukperbaikandankemajuansekolah
Kepalasekolahsebagaiinovator,
1. Melakukan pembaharuan di bidang pengembangan kurikulum, proses
pembelajaran,dansystemevaluasipembelajaran.
2. Melakukan perbaikan dan pembaharuan dalam bidang system pengelolaan
sekolahdanpenataanlingkungansekolah
3. Melakukan upaya kreatif dalam menggali sumber dana bagi pem,biayaan
sekolah
4. Melakukankerjasamadenganberbagaipihakyangrelevanuntukmemajukan
sekolah.

B.WakilKepalaSekolahBidangKurikulum
Wakilkepalasekolahbidangkurikulumbertindaksebagaipelaksanaharian
(Plh)bilamanakepalasekolahberhalangantidaktetap
dalampengembangankurikulum,prosespembelajaran,evaluasi,pengendalianmutu,
administrasi pengajaran dan pembelajaran, pengembangan ketenagaan, dengan
rinciantugassebagaiberikut:
Menyusundanmenjabarkankalenderpendidikan
Menyusunpembagiantugasmengajardanjadwalpelajaran
Mengatur penyusunan program pengajaran (program semester, program satuan
pelajarandanpersiapanmengajar,penjabarandanpenyesuaiankurikulum).

file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

11/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH
Mengaturpelaksanaankegiatankurikulerdanekstrakurikuler,
Mengaturpelaksanaanprogrampenilaian,criteriakelulusan,kenaikankelas,dan
laporankemajuanbelajarsiswasertapembagianlapor&STTB,
Melakukan pengembangan kurikulum, baik mengenai materi, metoda, system
evaluasi,maupunpenggunaanalatbelajar
Melakukanpengendaliansystempembelajaranuntukmenciptakan,mempertahan,
danmeningkatkanmutuhasilbelajar
Melakukanpembinaandanpengembangankemampuanprofesionalismeguru
Melakukanpengawasanterhadapkinerjagurudanprilakubelajarsiswa
Mengaturpelaksanaanprogramperbaikandanpengayaan,
Mengaturpemanfaatanlingkungansebagaisumberbelajar,
Mengaturpelaksanaanklinikmatapelajaran
Mengkordinirpelaksanaantryoutmatapelajaran
MengaturpelaksanaanintensifUANdanPraUAN
MengaturpengembanganMGMPdankoordinatormatapelajaran,
Merencanakandanmelaksanakanlombalombamatapelajaran
Mengaturmutasisiswa,
Melakukansupervisipengajaran,
Menyusunlaporankepadakepalasekolah.

C.WakilKepalaSekolahBidangKesiswaaan
Wakil kepala sekolah bidang kesiswaan membantu kepala sekolah dalam
peningkatan aktivitas belajar, pengembangan bakat dan minat, pengendalian
prilakusholih,pengadaanbeasiswa,denganrinciantugassebagaiberikut:
Memantaudanmembimbingaktivitasbelajarsiswa
Memantaudanmengendalikanprilakukeberagamaansiswa
Mengaturprogramdanpelaksanaanbimbingandankonseling,
Berkoordinasidengankesiswaankord.Kerohaniandalampengaturkegiatanbelajar
malamdanmentoring
Mengatur dan mengkoordinasikan pelaksanaan 7 K (keamanan, kebersihan,
ketertiban,keindahan,kekeluargaan,kesehatandankerindangan),
MengaturdanmembinaprogramkegiatanOSIS
MenyusundanmengaturpelaksanaanpemilihanpengurusOSIS
Mencari sumber bea siswa dan menyeleksi calon untuk diusulkan mendapat bea
siswa,
Mengkoordinir perencanaan dan pelaksanaan kegiatan di luar sekolah/ektra
kurikuler,
Membimbing dan mengawasi pengembangan hubungan siswa dengan siswa
sekolahlainmelaluiorganisasisiswaatausekolah,
Mengawasidanmengevaluasipelaksanaanpembinaankesiswaan,
Mengkoordinirdanmembimbingkegiatankeagamaansekolah
Mengkoordinirkegiatanupacaraupacarasekolah,
Merencanakanlombalombapengembanganminatdanbakatsiswa
MembuatlaporanberkaladaninsidentilkepadaKepalaSekolah.

D.WakilKepalaSekolahBidangHubunganMasyarakat
Wakil kepala sekolah bidang Hubungan Masyarakat membantu kepala sekolah
dalammenjalinhubungankerjasamadenganpihakluarsekolah,denganrincian
tugassebagaiberikut:
Mengatur dan mengembangkan hubungan baik dengan yayasan, pemerintah,
sekolah sejenis, dan perusahaan yang relevan untuk pemetaan siswa
berprestasi.
Membuat kerja sama dengan pihak lain yang relevan untuk meningfktkan kinerja
sekolah
Membina hubungan baik dengan masyarakat lingkungan sekolah berupa bakti
sosial,santunansocial,karyawisata,

E.WakilKepalaSekolahbidangSaranadanPrasarana
Wakil kepala sekolah bidang Hubungan Masyarakat membantu kepala sekolah
dalampengadaan,penggunaandanpemeliharaansaranabelajar,denganrincian
file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

12/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH

tugassebagaiberikut:
Merencanakan kebutuhan sarana prasarana untuk penunjang proses belajar
mengajar,
Mengaturpenggunaandanpemanfaatansaranabelajar,
Mengelolaperawatan,perbaikandanpengisian,
Mengaturpembukuannya,
Menyusunlaporan.
2.PELAKSANAAKADEMIK

Walikelas
Wali kelas membantu Kepala Sekolah dalam pengelolaan kelas dengan rincian tugas
sebagaiberikut:
Mengelolakelas,meliputi
Penataanlingkungankelasyangsehatdannyaman
penataanformasitempatduduk,
membimbingfungsionalisasiorganisasikelas,
Melakukanpembinaansiswa,meliputi:
Memberinasihatkebaikankepadasiswa
Memberimotivasibelajardanmembantumemecahkankesulitanbelajar
Membimbingprilakuberagamasiswa
Mengaturkegiatanagamasepertiberjamaahdluhurdanashar,mabit,danmentoring
Penyelenggaraanadministrasikelasmeliputi:
Denahtempatduduksiswa
Papanabsensisiswa
Daftarpelajarankelas
Daftarpiketkelas
Bukuabsensisiswa
Bukukegiatanpembelajaran
Tatatertibsiswa
Penyusunanpembuatanstatistikbulanansiswa
Pengisiandaftarnilaisiswa(leger)
Pembuatancatatankhusustentangsiswa
Pencatatanmutasisiswa
Pengisianbukulaporanpenilaianhasilbelajar
Pembagianbukulaporanpenilaianhasilbelajar
3.Guru

GurubetanggungjawabkepadaKepalaSekolahdanmempunyaitugasmelaksanakan
kegiatanprosesbelajarmengajarsecaraefektifdanefisien.
Tugasdantanggungjawabgurumeliputi:
Membuatperangkatprogrampengajaran,meliputi:
Analisismateripelajaran
Programtahunan/semester
Programsatuanpelajaran
Programrencanapengajaran
Programmingguanguru
Melaksanakanpenilaianprosesbelajar,ulanganharian,ulanganumum,ujianakhir.
Melaksanakananalisisulanganharian
Menyusundanmelasanakanprogramperbaikandanpengayaan
Mengisidaftarnilaisiswa
Melaksanakan kegiatan pembimbing (pengimbasan pengetahuan) kepada guru lain
dalamkegiatanprosesbelajarmengajar
Melaksanakantugastertentudisekolah
Mengadakanpengembangandanpemasyarakatankurikulum
Membuatcatatantentangkemajuanhasilbelajarsiswa
Mengisidanmenelitidaftarhadirsiswasebelummemulaipengajaran

Catatanpencapaian
1. Programmabituntuksemuasiswadalamsatubulan.
2. Pertandinganantarkelassetiapliburansemester

file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

13/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH

3. PelatihankepemimpinanuntukPengurusOSISdikotaTasikmalaya
4. Pelatihanorganisasidankepemimpinanuntuksiswa
5. mengikutilombalombasekotaTasikmalaya

4.StrukturOrganisasi
KepsekWakasekKesiswaanPembinaOsis
Departemensebagaiberikut:
DepartemenDanaUsaha
DepartemenLingkunganHidup
DepartemenIptek
DepartemenAgamadanDakwah
DepartemenRemajadanOlahraga
PENDIDIKANDANPENGAJARAN

KEGIATANBELAJARSISWA
Kegiatan belajar siswa adalah jenisjenis kegiatan yang harus dijalani siswa selama proses
belajardiSMKBINAINFORMATIKA.
BelajarTatapMuka
Belajarberupatatapmukadidalamkelasataudiluarkelas(outdoor)selama6hariper
minggudansebanyak8jamperhari(kecualihariJumatdanSabtu).
MentoringKeagamaan
Mentoring keagamaan adalah kegiatan bimbingan agama secara kelompok untuk
meningkatkan pemahaman dan pengamalan agama siswa. Dilaksanakan setiap hari
Jumatbadaashardarijam15.30s.d.16.40.
TadarusalQuran
TadarusalQuranadalahkegiatansiswaberupamembacaalQurandenganbimbingan
guru.Dilaksanakansetiapharisekitar7menitsebelumKBMdimulai.
Mabit
Setiapminggusekali,semuasiswawajibmondokdisekolahuntukmelakukankegiatan
agamadanbimbinganbelajarmatapelajarantertentu.
BimbinganIntensifUAN
MenjelangUANdilakukanbimbinganintensifsebagaipersiapanmenghadapiUAN.
EkstraKurikuler
Ekstra kurikuler adalah kegiatan pelengkap kurikulum inti yang harus dilakukan siswa
menurutpilihanmasingmasingberdasarkanminatdanbakatsiswanya.
KegiatanLainlain
Di samping kegiatan tersebut, diselenggarakan pula kegiatan khusus yang bersifat
insidental,baikyangmenyangkutpengembanganakademik,maupunkeagamaan.
PROSESKEGIATANAKADEMIKSISWA
Proseskegiatanakademiksiswaadalahurutankegiatanyangharusdilaluisiswaselamamengikuti
prosespembelajarandiSMKBinaInformatika.Jeniskegiatannyaadalah:
Pendaftarancalonsiswa
Seleksipenerimaansiswabaru
Daftarulang
Orientasistudi
Belajardanbimbingan
Ujianujian
1. PendaftaranCalonSiswaBaru
Pendaftaran calon siswa baru SMK Bina Informatika dilaksanakan pada bulan Mei dan
Juni.Persyaratanpendaftaranadalah:

SiswaSLTPkelasIXNegeri/Swasta
NilairaporkelasIXminimal6untuksemuamatapelajaran
2. Seleksi penerimaan siswa baru dilakukan melalui Tes Potensi
Akademik(MatematikadanIPA),ImladanBacaalQuran.
3. Daftarulang
Siswa yang telah lulus seleksi diharuskan daftar ulang dengan memenuhi persyaratan
berikut:
menyerahkanpotocopySTTBdansertifikatkelulusankelasIXSMKsederajat

file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

14/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH
mengisibiodatalengkap
membayarbiayaawaltahun

4. OrientasiStudi
Sebelumsiswamengawalikegiatanbelajarefektif,semuasiswawajibmengikutikegiatan
orientasi studi. Kegiatan ini dimaksudkan untuk mengenalkan siswa terhadap program
sekolah, peraturanperaturan sekolah, cara belajar efektif, organisasi sekolah, wawasan
perguruantinggi,danlainlain.
5. KegiatanBelajardanBimbingan
Kegiatan belajar dan bimbingan merupakan kegiatan inti sekolah sebagai realisasi dari
tuntutankurikulum.Kegiataninimeliputi:belajarefektifberupatatapmukadidalamatau
luarkelas,klinikmatapelajaran,mentoring,mabit,ekstrakurikulerdanlainlain.
6. Ujianujian
Semua siswa wajib mengikuti kegiatan ujian dalam rangka evaluasi hasil belajar, baik
ujian yang dilaksanakan oleh guru, sekolah, maupun Pemerintah secara nasional. Dari
segijenisnya,ujiandapatberupaposttest(akhirsetiapsubpokokbahasan/pertemuan),
formatif (setiap akhir suatu pokok bahasan), sumatif (setiap akhir program
pembelajaran/semester).
BEBANTUGASKERJAGURU
GuruyangdimaksudkandisiniadalahguruSMKBinaInformatikayangberstatusgurutetap
yayasan,baikdalamkategorigurukontrakmaupungurudinas.
Bebantugasguruadalahkewajibankerjagurupermingguyangteridiratastugaspendidikan
danpengajaran,frekuensikehadirandisekolahdanketerlibatandalamprogramsekolah.
TugasPendidikandanPengajaran
Guruwajibmelaksanakantugaspendidikandanpengajaransesuaidenganjampelajaran
perminggunya,berupamengajartatapmuka.
PROSEDURTUGASPENGAJARAN
1. TahapPersiapanMengajar
a) Padaawalsemestermenjelangkegiatanbelajardimulai,setiapguruharusmembuat
perangkatprogrampengajaranyangmeliputi:
Analisamateripelajaran
Programtahunan/semester
Programsatuanpelajaran
Programrencanapengajaran
b) Padasetiapminggu,guruharusmembuatpersiapanmingguanyangterdiriatas:
Programmingguan
LKS/Modul
Bahanajaruntukpenyajian
Soalsoallatihan
c) Berpakaianrapih
Gurulakilakimemakaistelansafariataukemejaberdasidanbersepatu,tidak
memakaipakaiansantai.
Guruperempuanmemakaipakaiansopanberjilbab
2. TahapPelaksanaanMengajar
a) Kegiatanawal
Gurudansiswaharussudahsiapdidalamkelaspadaawalwaktu.
Gurumengecekkehadiransiswadanmengisibukuagendamengajar
Gurumembacasalamdanmengajaksiswaberdoabersama
Gurumemberitahukankepadasiswatujuandanmateripembelajaranyangakan
disajikan serta prosedur kegiatan belajar seperti apa yang akan dilakukan oleh
siswadanguru.Jugasampaikanmengapamateriinipentingbagisiswa.
b) KegiatanInti
Guru melakukan kegiatan pembelajaran sesuai prosedur pembelajaran yang
telahdirencanakan
Ketikakegiatanbelajarberlangsung,gurumemeperhatikansikapdanrespon
belajarsiswauntukdiberiresponbalikolehguru
Gurumemberibantuankepadasiswayanglambatbelajar
Menjelangakhirpelajaran,mengevaluasi/mengetessiswauntukmengukurhasil
prosespembelajaran
Memberiresponbalikatashasilevaluasipembelajaran
c) KegiatanAkhir
Menyimpulkanataumerangkumhasilbelajar/materipelajaran

file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

15/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH
Memberitugaskepadasiswauntukperbaikanataupengayaanmateriyangtelah
disampaikan.Setiaptugassiswaharusdikembalikansetelahdiperiksa
Menginformasikan apa yang harus dilakukan siswa untuk kegiatan materi
pelajaranyangakandatang.
Menutuppelajarandenganmembacahamdalahdansalam

MATAPELAJARANdanPersiapanUAN
Mulai semester II Setiap dua minggu dilakukan try out mata pelajaran yang meliputi Matematika,
IPA,B.Inggris,danB.Indonesia
1. Tujuantryoutmatapelajaranadalahuntukmelatihsiswadalammengerjakansoalsoal
sekaligusmengukurkemampuanbelajarsiswaselamaperiodetertentu.
2. Try out UAN dilaksanakan menjelang UAN yang dimaksudkan sebagai latihan dan
persiapanpsikologismenjelangUANyangsesungguhnya.
BIMBINGANINTENSIFUAN
Bimbingan intensif UAN dilaksanakan menjelang UAN. Kegiatan ini berupa pemantapan
konsepkonsep dan drill soalsoal UAN. Waktunya dimulai pada awal semester II sampai
beberapaharimenjelangUAN.
SISTEMEVALUASI
1. UjianAkhirSemester
Ulangan Akhir Semester (UAS) dilaksanakan selama 7 hari, karena siswa mengerjakan
UAS sekolah dengan soal yang dibuat oleh guruguru SMK Bina Informatika, dan UAS
penyetaraankhususuntukmatapelajaranyangdiUANkan:

2.PenyelenggaraanTryOutuntukkelasXsebanyaksembilankali
dalam1tahun.
3. UjianAkhirNegara
PenyelenggaraanUANsepenuhnyamengikutiketentuanDiknas
SUPERVISIPENGAJARAN
1. Tujuan supervisi pengajaran adalah untuk meningkatkan hasil belajar siswa melalui
peningkatankualitasprosespembelajaran
2. Sasaransupervisiadalahkemampuanguru,kinerjaguru,siswa,suasana/iklimbelajar
mengajardanalatpembelajaran
3. Prosedursupervisiadalah:
a. Identifikasimasalahterhadapunsurunsuryangterkaitdenganhasilbelajarsiswa
danprosesbelajarmengajar
b. Formulasimasalahhasilidentifikasi
c. Perumusanalternatifpemecahanmasalah
d. Implementasialternatifpemecahanmasalah
e. Followup
4. Tekniksupervisiadalah(a)studidokumensepertihasilbelajarsiswa,dokumenkinerja
guru,dll(b)kunjungankelas,(c)pertemuanlangsungdengangurusepertirapat,diskusi,
seminar dll, (d) pertemuan tidak langsung seperti surat, bulletin dll (e) penugasan, dan
lainlain
5. Pelaksanasupervisiadalah(a)KepalaSekolahdan(c)Timkendalimutusekolah
PENGENDALIANMUTU

1.TujuanPengendalianMutuPrestasiBelajar
Terwujudnya sistem pembelajaran yang memenuhi standar kualitas
input, standar kualitas proses, dan standar kualitas hasil belajar
harian dan semesteran, sehingga menjamin tercapainya prestasi
lulusansesuaidengantargetyangditetapkan.
2.ObjekPengendalianMutu
a.KualitasInput,meliputi:
1.Kualitaskompetensiguru
2.Kualitaskemampuanakademiksiswa
3.Ketepatanisikurikulum
file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

16/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH

4.KuantitasdankualitasSaranabelajar
5.Ketersediaanwaktubelajaryangmemadai
6.Kualitaspengelolaaninput
b.KualitasProsesPembelejaran,meliputi:
1.KualitasProsesPembelajaran
2.Kualitaskinerjaguru
3.Kualitasprilakubelajarsiswa
4.Ketepatanpendekatandanmetodabelajarmengajar
5.Kelengkapandankualitasbahanajar
6.Kualitaspenggunaanalatbelajar
7.Kualitasiklim/suasanabelajar
8.Kuantitasdankualitasevaluasibelajar
9.Kuantitasdankualitasadministrasipembelajaran
c.KualitasHasilBelajar
1)Prestasibelajar
Nilaiulanganharian
Nilaiujiansemesteran
Nilaiujiannegara
2)PrilakuSholih
Akhlaqsiswadisekolah
Akhlaqsiswadirumah
3)Kemampuansenikalighrafi
3.TugasdanProsedurPengendalianMutu
1) Mengidentifikasi objek pengendalian yang meliputi variable
input, proses, dam hasil untuk menemukan gejala dan indicator
penyimpangandaristandarkualitasyangseharusnya
2) Mengkaji gejala dan indicator penyimpangan untuk ditemukan
factorpenyebabnyasertaalternatifpemecahannya
3) Mengkomunikasikan temuan hasil identifikasi dan pengkajian
kepada guru lain dan/atau pihak terkait untuk konfirmasi factor
penyebabdanalternatifpemecahan
4) Mengimplementasikan alternatif pemecahan dalam bentuk
rekomendasidan/atautindakan/kegiatan
5) Mengawasi realisasi alternatif pemecahan untuk evalauasi
kemajuan.
4.Teknikpengendalianmutu
a.Observasiterhadapobjekpengendalian
b.Kunjungankelas
c.Wawancaradenganguru,murid,danpihakterkait
d.Studidokumenhasilbelajar
e.Tekniklainyangrelevan
3.Waktupengendalian
Sepanjang waktu secara berkelanjutan sejalan
berlangsungnyasistempendidikanSMKBinaInformatika.
file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

dengan

17/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH

4.Pelaksanapengendalianmutu
Pelaksana pengendalian mutu adalah Tim Kendali Mutu yang
diangkatolehkepalasekolah.

BABIII
ORGANISASI

A.SUSUNANPENGURUSSMKBINAINFORMATIKA

KetuaYPPI:K.KhairilAnbar
KepalaSekolah:RivaFuadFauzi,S.Pd.I
Sekretaris:M.Abduh,S.Si
Bendahara:EtihJuhaeriyah
Anggota:Mukhlisin.A.Md
LindaKholidatunnur,S.Pd
AgungJunjunan,S.Pd
RobiHermawan,SPd
ImanKadariSMKn,SPdI
BangbangSobandi,SPd
KomiteSekolah:Ir.Pipit
Dra.TatiRohimah
Hj.EviSilviani
Taufiq
BABVI
PENUTUP
DemikianproposalinidibuatsebagaiacuandalamprogrampengajuanpendirianSekolah
MenengahKejuruan(SMK)BinaInformatikaTasikmalayayangdiharapkandapatterlaksanasesuai
harapan,danhanyakepadaAllahkitaberserahdiri.
Atasperhatiannyakamiucapkanterimakasih.

PROPOSAL | CONTOH PROPOSAL PROGRAM PENGAJUAN PENDIRIAN SEKOLAH MENENGAH

file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

18/19

5/22/2015

CONTOHPROPOSALPROGRAMPENGAJUANPENDIRIANSEKOLAHMENENGAHKEJURUAN(SMK)|GUDANGMAKALAH

KEJURUAN(SMK)

Shareon

Facebook

Twitter

Google+

Berita: CONTOH PROPOSAL PROGRAM PENGAJUAN PENDIRIAN SEKOLAH


MENENGAHKEJURUAN(SMK)
PROPOSALUSULANPENANGANANBENCANAALAMDAERAHIRIGASI
PROPOSAL USULAN PENANGANAN BENCANA ALAM DAERAH IRIGASI
LENGKONGDESASINDANGRAJAKECAMATANJAMANISPEMERINTAH...
PROPOSALREHABILITASILAPANGANSEPAKBOLA
PROPOSALREHABILITASI LAPANGAN SEPAK BOLAPEMERINTAH KABUPATEN
TASIKMALAYAKECAMATANJAMANISDESASINDANGRAJAPEME...
CONTOHSURATMOHONBANTUANPEMBANGUNANSARANAPERIBADATAN
PANITIA PEMBANGUNAN SARANA PERIBADATANMESJID ASSAADAHKp. Bbk.
AsemNagrakRT.01RW.08Ds.SindangrajaKecJ...
CONTOH PROPOSAL PROGRAM PENGAJUAN PENDIRIAN SEKOLAH
MENENGAHKEJURUAN(SMK)
Nomor:01/YPPIAM/24/III/2009Lamp:1(satu)bundelPerihal:
...
CONTOHPROPOSALBANTUANREHABRUMAHTIDAKLAYAKHUNI
PEMERINTAH
KABUPATEN
TASIKMALAYAKECAMATAN
JAMANISDESA
SINDANGRAJAJl.SentralPeuyeumNyalindungJamanisKode...
PROPOSALPENGGUNAANBANSOSPOSKESDES
PROPOSAL
PENGGUNAANBANSOS
POSKESDES
TAHUN
2010DESA
SINDANGRAJAKECAMATANJAMANISKABUPATENTASIKMALAYAKETUA:...
CONTOHSURATMOHONBANTUANPEMBANGUNANSARANAPERIBADATAN
PANITIA PEMBANGUNAN SARANA PERIBADATANMESJID ASSAADAHKp. Bbk.
AsemNagrakRT.01RW.08Ds.SindangrajaKecJ...
CONTOHPEMBUATANPROPOSALPERINGATANKEMEDEKAANHUTRIKE69
PROPOSAL KEGIATANDALAM RANGKA PERINGATAN KEMERDEKAAN HUT RI
KE69I.PENDAHULUANI.1LATARBELAKANGTemaHUTRI...
PROPOSALUSULANPENANGANANBENCANAALAMDAERAHIRIGASI
PROPOSAL USULAN PENANGANAN BENCANA ALAM DAERAH IRIGASI
LENGKONGDESASINDANGRAJAKECAMATANJAMANISPEMERINTAH...
CONTOHPROPOSALBANTUANREHABRUMAHTIDAKLAYAKHUNI
PEMERINTAH
KABUPATEN
TASIKMALAYAKECAMATAN
JAMANISDESA
SINDANGRAJAJl.SentralPeuyeumNyalindungJamanisKode...
TambahkanKomentar...
KirimjugakeFacebook

KirimkansebagaiNanankDomboz

Komentari

MandiusKogoyaBekerjadiFreeWestPapuaCampaign
thankyou
BalasSukaIkutiKiriman15Meipukul17:16
PluginsosialFacebook

NewerPost

Home

OlderPost

ShareIt

file:///C:/Users/Domboz/Documents/Contoh%20Pendirian%20SMK.html

19/19