Anda di halaman 1dari 18

Skrining Kanker Serviks dengan Tes IVA

Ida Bagus Indrayana M


10.2009.119
E9
Fakultas Kedokteran Universitas Kristen Krida Wacana
Jl. Arjuna Utara No. 6, Jakarta 11510
Email: appucrawler@yahoo.com
Pendahuluan

Kanker serviks merupakan kanker yang terbanyak diderita perempuan di negara


berkembangsepertiIndonesia.Dinegaramaju,kankerserviksmendudukiurutanke10dan
bila digabung, menduduki urutan ke5. Seperti penyakit kanker pada umumnya, kanker
serviks akan menimbulkan masalah pada kesakitan, penderitaan, kematian finansial dan
ekonomi, masalah pada lingkungan kehidupan dan masalah pada pemerintah. Dengan
demikian, penanggulangan kanker serviks harus dilakukan secara menyeluruh dan
terintegrasi.
Hinggasaatinikankerserviksmerupakanpenyebabkematianterbanyakakibatpenyakitkankerdinegara
berkembang.Diperkirakansetiaptahundijumpaisekitar500.000penderitabarudiseluruhduniadanumumnya
terjadidinegaraberkembang.1Dinegaranegaramajujumlahpenderitakankermulutrahimtidaklahsebanyakdi
negaraberkembang,halinidisebabkantingginyakesadaranmasyarakatuntukmengikutiprogrampendeteksian
dinidanpencegahan.
Kematianpadakasuskankerserviksterjadikarenasebagianbesarpenderitayangberobatsudahberada
dalamstadiumlanjut.Padahal,denganditemukannyakankerinipadastadiumdini,kemungkinanpenyakitini
dapat disembuhkan sampai hampir 100%.Kanker serviks ini sebenarnya sangat bisadicegah dan kuncinya
adalahdeteksidini.Pemeriksaaankeadaanserviksseorangwanitabisaditempuhdenganberbagaimacamcara.
Misalnyasajadenganpemeriksaanpapsmear,biopsi,testiva,dll
Definisi
Kanker serviks atau kanker leher rahim atau disebut juga kanker mulut rahim merupakan salah satu
penyakit keganasan di bidang kebidanan dan penyakit kandungan yang masih menempati posisi tertinggi sebagai
1

penyakit kanker yang menyerang kaum perempuan. Kanker serviks adalah kanker leher rahim / kanker mulut
rahim yang di sebabkan oleh virus HPV ( Human Papiloma Virus )1
Etiologi
Penyebab primer kanker leher rahim adalah infeksi kronik leher rahim oleh virus HPV (Human
PapilomaVirus)tipeonkogenikyangberesikotinggimenyebabkankankerleherrahimyangditularkanmelalui
hubunganseksual(sexuallytransmitteddisease).Perempuanbiasanyaterinfeksivirusinisaatusiabelasantahun,
sampaitigapuluhan,walaupunkankernyasendiribaruakanmuncul1020tahunsesudahnya.InfeksivirusHPV
yangberisikotinggimenjadikankeradalahtipe16,18,45,dan56dimanaHPVtipe16dan18ditemukanpada
sekitar70%kasus.InfeksiHPVtipeinidapatmengakibatkanperubahanselselleherrahimmenjadilesiintra
epitelderajattinggi(highgradeintraepitheliallesion/LISDT)yangmerupakanlesiprakanker.SementaraHPV
yangberisikosedangdanrendahmenyebabkankanker(tipenononkogenik)berturutturutadalahtipe30,31,33,
35,39,51,52,58,66dan6,11,42,43,44,53,54,55.13.1

Gambaran Klinik Karsinoma leher rahim


Padaawalstadiumkankerhampirtidakadagejala,kecurigaantimbulbilaadakeluhan
keputihanataumengalamiperdarahansetelahberhubunganseksual.
Gejalalanjutdarikankerserviksiniadalah;
Perdarahandiluarmasahaid
Jumlahdarahhaidtidaknormal
Perdarahanpadamasamenopause(setelahberhentihaid)
Keputihanyangbercampurdarahataunanah
Padastadiumawaltidakterdapatadanyagejalayangditimbulkandanselselkanker
tidakdapatdiamatidenganmatatelanjang,sehinggabanyakpenderitayangdiketahuisetelah
stadiumlanjut(stadium2keatas)padasaatterjadinyagejalayangberupakeluarnyacairan
yangberbaubusuk,pendarahansetelahhubunganseksualdanpegeldiperutbagianbawah.
Jikadilihatdenganmatatelanjang,kankertumbuhsepertibungakol.Sepertisifatbungankol
yangrapuh,biladigosokdengantanganmakabungakolakanjatuhberhamburan.Begitujuga
dengankankerini,sangatrapuh.Bilaterkenasentuhandisaatberhubunganseksualmisalnya,
makakankerakanrontokdanberdarahbahkanbisaterjadi pendarahan yangmemerlukan
perawatan.2,4

Faktor Risiko1,4
Beberapa ko-faktor yang memungkinkan infeksi HPV berisiko menjadi kanker leher rahim
adalah :
a. Faktor HPV :
- Tipe virus
- Infeksi beberapa tipe onkogenik hpv secara bersamaan
- Jumlah virus (viral load)
b. Faktor host/ penjamu :
- Status imunitas, dimana penderita imunodefisiensi (misalnya penderita HIV positif)
yang terinfeksi HPV lebih cepat mengalami regresi menjadi lesi prekanker dan
kanker.
- Jumlah paritas, dimana paritas lebih banyak lebih berisiko mengalami kanker
c. Faktor eksogen
- Merokok
- Ko-infeksi dengan penyakit menular seksual lainnya
- Penggunaan jangka panjang ( lebih dari 5 tahun) kontrasepsi oral

Faktor risiko yang potensial menyebabkan terjadinya kanker leher atau penularan kanker
rahim adalah:1
- Melakukan hubungan seks pada usia muda
- Sering berganti-ganti pasangan
- Sering menderita infeksi di daerah kelamin terutama virus HPV ( Human Papilloma
Virus)
- Melahirkan banyak anak
- Kebiasaan merokok (risiko 2x lebih besar)
- Juga kekurangan vitamin A, C, dan E

Sering kali gejala kanker leher rahim pada stadium dini tidak menunjukkan gejala atau tanda
yang khas. Sedangkan jika telah timbul gejala diantaranya keputihan, perdarahan setelah
hubungan intim suami istri, perdarahan spontan setelah masa menopause (masa tidak haid
lagi), keluar cairan kekuningan yang berbau busuk atau bercampur darah, nyeri panggul, atau
tidak dapat buang air kecil, maka kemungkinan besar penyakit telah masuk stadium lanjut.1
Epidemiologi Kanker Serviks5,6

UntukwilayahASEAN,insidenskankerserviksdiSingaporesebesar25,0padaras
Cina;17,8padarasMelayu;danThailandsebesar23,7per100.000penduduk.Insidensdan
angka kematian kanker serviks menurun selama beberapa dekade terakhir di AS. Hal ini
karenaskriningPapmenjadilebihpopulerdanlesiservikspreinvasiflebihseringdideteksi
daripadakankerinvasif.Diperkirakan terdapat3.700kematianakibatkankerservikspada
2006.DiIndonesiadiperkirakanditemukan40ribukasusbarukankermulutrahimsetiap
tahunnya.Menurutdatakankerberbasispatologidi13pusatlaboratoriumpatologi,kanker
serviksmerupakanpenyakitkankeryangmemilikijumlahpenderitaterbanyakdiIndonesia,
yaitulebihkurang36%.5
Relativesurvivalpadawanitadenganlesipreinvasifhampir100%.Relative1dan5
yearssurvivalmasingmasingsebesar88%dan73%.Apabiladideteksipadastadiumawal,
kankerserviksinvasifmerupakankankeryangpalingberhasilditerapi,dengan5YSRsebesar
92%untukkankerlokal.Keterlambatandiagnosispadastadiumlanjut,keadaanumumyang
lemah,statussosialekonomiyangrendah,keterbatasansumberdaya,keterbatasansaranadan
prasarana,jenishistopatologi,danderajatpendidikanikutsertadalammenentukanprognosis
daripenderita.6
Deteksi Dini Kanker Leher Rahim

KankerleherrahimadalahpenyakityangdiawaliolehinfeksivirusHPVyangmerubahselselleher
rahimsehat menjadidisplasiadanbilatidakdiobatipadagilirannyaakantubuhmenjadikankerleherleher
rahim.Prinsipdasarkontrolpenyakitiniadalahmemutusmatarantaiinfeksi,ataumencegahprogresivitaslesi
displasiaselselleherrahim(disebutjugalesiprakanker)menjadikanker.Bilalesidisplasiaditemukansejak
dini dan kemudian segera diobati, hal ini akan mencegah terjadinya kanker leher rahim dikemudian hari.
Perempuan yang terkena lesi prakanker diharapkan dapat sembuh hampir 100%, sementara kanker yang
4

ditemukanpadastadiumdinimemberikanharapanhidup92%.Karenanyadeteksisedinimungkinsangatpenting
untukmencegahdanmelindungiperempuandarikankerleherrahim.3
WHOmenyebutkan4komponenpentingyangmenjadipilardalampenanganankankerleherrahim,
yaitu:pencegahan infeksi HPV,deteksi dini melalui peningkatan kewaspadaan danprogram skriningyang
terorganisasi,diagnosisdantatalaksana,sertaperawatanpaliatifuntukkasuslanjut.Deteksidinikankerleher
rahim meliputi program skrining yang terorganisasi dengan sasaran perempuan kelompok usia tertentu,
pembentukan sistem rujukan yang efektif pada tiap tingkat pelayanan kesehatan, dan edukasi bagi petugas
kesehatandanperempuanusiaproduktif.1
Skriningdanpengobatanlesidisplasia(ataudisebutjugalesiprakanker)memerlukanbiayayanglebih
murahbiladibandingpengobatandanpenatalaksanaankankerleherrahim.Beberapahalpentingyangperlu
direncanakan dalam melakukan deteksi dini kanker, supaya skrining yang dilaksanakan terprogram dan
terorganisasidenganbaik,tepatsasarandanefektif,terutamaberkaitandengansumberdayayangterbatas.4

Skrining
Skrining, dalam pengobatan, adalah strategi yang digunakan dalam suatu populasi
untuk mendeteksi suatu penyakit pada individu tanpa tanda-tanda atau gejala penyakit itu.
Tidak seperti apa yang biasanya terjadi dalam kedokteran, tes skrining yang dilakukan pada
orang tanpa tanda-tanda klinis penyakit. 7 Tujuan dari skrining adalah untuk mengidentifikasi
penyakit pada komunitas awal, sehingga memungkinkan intervensi lebih awal dan manajemen
dengan harapan untuk mengurangi angka kematian dan penderitaan dari penyakit. 1 Meskipun
skrining dapat mengarah ke diagnosis sebelumnya, tidak semua tes skrining telah terbukti
bermanfaat bagi orang yang sedang diputar; overdiagnosis, misdiagnosis, dan menciptakan
rasa aman palsu beberapa efek negatif dari penyaringan. Untuk alasan ini, tes yang digunakan
dalam program skrining, terutama untuk penyakit dengan insiden rendah, harus memiliki
sensitivitas yang baik selain kekhususan diterima. Beberapa jenis skrining ada: skrining
universal melibatkan skrining semua individu dalam suatu kategori tertentu (misalnya, semua
anak pada usia tertentu).7
Temuan kasus melibatkan skrining sekelompok kecil orang berdasarkan adanya faktor
risiko (misalnya, karena anggota keluarga telah didiagnosis dengan penyakit keturunan).1
Seiring dengan meningkatnya populasi, maka insidens kanker leher rahim juga meningkat
sehingga meningkatkan beban kesehatan negara.2 Padahal penyakit ini dapat dicegah dengan
deteksi dini lesi prankanker yang apabila segera diobati tidak akan berlanjut menjadi kanker

leher rahim. Saat ini banyak penelitian tentang skrining dengan metode IVA dilakukan di
berbagai negara berkembang.
Skrining dengan metode IVA dilakukan dengan cara yang sangat sederhana, murah,
nyaman, praktis, dan mudah. Sederhana, yaitu dengan hanya mengoleskan asam asetat (cuka)
3-5% pada leher rahim lalu mengamati perubahannya, dimana lesi prakanker dapat terdeteksi
bila terlihat bercak putih pada leher rahim. Murah, karena biaya yang diperlukan hanya sekitar
Rp. 3000,- sampai Rp.5000,-/pasien. Nyaman, karena prosedurnya tidak rumit, tidak
memerlukan persiapan, dan tidak menyakitkan. Praktis, artinya dapat dilakukan dimana saja,
tidak memerlukan sarana khusus, cukup tempat tidur sederhana yang representatif, spekulum
dan lampu. Mudah, karena dapat dilakukan oleh bidan dan perawat yang terlatih. 1,2 Beberapa
karakteristik metode ini sesuai dengan kondisi Indonesia yang memiliki keterbatasan ekonomi
dan keterbatasan sarana serta prasarana kesehatan. Karenanya pengkajian penggunaan metode
IVA sebagai cara skrining kanker leher rahim di daerah-daerah yang memiliki sumber daya
terbatas ini dilakukan sebagai salah satu masukan dalam pembuatan kebijakan kesehatan
nasional di Indonesia.8
Test skrining dapat dilakukan dengan cara :7
1. Pertanyaan/kuesioner
2. Pemeriksaan Fisik
3. Pemeriksaan Laboratorium
4. X-ray, termasuk diagnostic imaging
Jenis penyakit yang tepat untuk skrining :7
1. Merupakan penyakit yang serius
2. Pengobatan sebelum gejala muncul harus lebih untung dibandingkan setelah gejala
muncul
3. Prevalensi penyakit pre klinik harus tinggi pada populasi yang diskrining
Syarat syarat skrining :7
1. Penyakit harus merupakan masalah kesehatan yang penting
6

2. Harus ada cara pengobatan yang efektif


3. Tersedia fasilitas pengobatan dan diagnosis
4. Diketahui stadium prepatogenesis dan pathogenesis
5. Test harus cocok, hanya mengakibatkan sedikit ketidaknyamanan, dapat diterima oleh
masyarakat
6. Telah dimengerti riwayat alamiah penyakit
7. Harus ada Policy yang jelas
8. Biaya harus seimbang, biaya skrining harus sesuai dengan hilangnya konsekuensi
kesehatan
Macam-macam skrining7
1. Mass screening adalah screening secara masal pada masyarakat tertentu
2. Selective screening adalah screening secara selektif berdasarkan kriteria tertentu,
contoh pemeriksaan ca paru pada perokok; pemeriksaan ca serviks pada wanita yang
sudah menikah
3. Case finding screening adalah upaya dokter/tenaga kesehatan untuk menyelidiki
suatu kelainan yang tidak berhubungan dengan keluhan pasien yang datang untuk
kepentingan pemeriksaan kesehatan
4. Single disease screening adalah screening yang dilakukan untuk satu jenis penyakit
5. Multiphasic screening adalah screening yang dilakukan untuk lebih dari satu jenis
penyakit contoh pemeriksaan IMS; penyakit sesak nafas
Validitas tes skrining adalah kemampuan tes skrining tersebut dalam mengukur sesuatu yang
seharusnya diukur. Validitas tes skrining dapat dinilai dengan sensitivitas, spesifisitas, nilai
prediksi positif, nilai prediksi negatif, dan akurasi.7
1. Sensitivitas
Sensitifitas menggambarkan kemampuan tes skrining menentukan seseorang menderita suatu
penyakit. Sensitivitas ditunjukkan oleh probabilitas hasil tes benar positif dibandingkan hasil
positif menurut standar (gold standart). Probabilitas dalam persen dihitung dengan membagi
hasil pemeriksaan benar positif (true positive) dengan jumlah hasil pemeriksaan benar positif
dan negatif palsu. Semakin tinggi nilai sensitivitas sebuah tes skrining maka semakin baik
7

kemampuan mendeteksi seseorang menderita penyakit tertentu sehingga dapat memperoleh


penanganan dini.7,8
2. Spesifisitas
Spesifisitas menggambarkan kemampuan tes skrining menentukan seseorang bukan penderita
suatu penyakit. Spesifisitas ditunjukkan oleh probabilitas hasil tes benar negatif dibandingkan
hasil negatif menurut standar (gold standart). Probabilitas dalam per sen dihitung dengan
membagi hasil pemeriksaan benar negatif (true negatif) dengan jumlah hasil pemeriksaan
benar negatif dan positif palsu. Semakin tinggi nilai spesifisitas sebuah tes skrining maka
semakin baik kemampuan mendeteksi seseorang tidak menderita penyakit tertentu.7,8

3. Nilai Prediksi Positif


Nilai Prediksi Positif (NPP/PPV) menggambarkan kemampuan tes skrining memprediksi
kemungkinan seseorang benar-benar menderita penyakit dari hasil pemeriksaan positif
menurut tes skrining. Nilai Prediksi Positif dihitung dengan membandingkan hasil benar
positif dengan seluruh hasil tes positif menurut uji skrining (True Positif dan Palse Positif)
dalam per sen. Semakin tinggi kemampuan tes skrining memperkirakan seseorang menderita
penyakit akan membantu petugas kesehatan memberikan penanganan yang tepat dan segera.7,8
4. Nilai Prediksi Negatif
Nilai Prediksi Negatif (NPN/NPV) menggambarkan kemampuan tes skrining memprediksi
kemungkinan seseorang benar-benar tidak menderita penyakit dari hasil pemeriksaan negatif
menurut tes skrining. Nilai Prediksi Negatif dihitung dengan membandingkan hasil benar
negatif dengan seluruh hasil tes negatif menurut uji skrining (True Negatif dan Palse Negatif)
dalam per sen. Semakin tinggi kemampuan tes skrining memperkirakan seseorang tidak
menderita suatu penyakit akan sangat membantu petugas kesehatan menghindarkan
penanganan atau pengobatan yang tidak perlu sehingga terhindar dari efek samping
pengobatan.7,8
Hasil Test 7
Hasil test sesuatu skrining di gambarkan secara positif maupun negatif
8

Suatu test dikatakan valid apabila tes tersebut dapat memprediksi secara sempurna dan benar,
di mana semua orang yang positif berdasarkan hasil tes skrining adalah benar-benar sakit dan
semua yang tesnya negatif adalah mereka yang benar-benar tidak sakit.
Pada kenyataannya tidak ada test yang benar-benar sempurna

Tabel 1. Hasil skrining di banding status penyakit


Hasil Skrining
Tes
-Positif
-Negatif
Total

Positif

Status Penyakit
Negatif

a
c
a+c

b
d
b+d

Total
a+b
c+d
a+b+c+d

Rumus
Sensitivitas : TP/(TP+FN)
Spesifisitas: TN / (TN + FP)
Nilai prediksi positif : TP/ (TP + FP) X 100%
Nilai prediksi negatif : FN/ (FN + TN) X 100%
Reliabilitas tes skrining
Hasil konsisten jika dilakukan lebih 1 kali pada individu yang sama pada situasi yang beda
waktu berbeda (pengamat sama), pengamat berbeda atau tes serupa.7
Dipengaruhi :7
1. Variasi pada Metode Pemeriksaan - tergantung stabilitas instrumen alat harus dibakukan

2. Variasi didalam subyek / individu (biologis) misal : hasil pengukuran suhu tubuh pagi
berbeda dengan siang dan malam hari
3. Variasi intraobserver misal : pembacaan hasil rontgen pada waktu yang berbeda,hasil
berbeda karena jenuh, lelah & lingkungan
4. Variasi interobserver misal : 2 radiologis mempunyai interpretasi yang berbeda thd sebuah
hasil rontgen gunakan orang terlatih & motivasi tinggi

Sasaran yang akan menjalani skrining 8

WHOmengindikasikanskriningdilakukanpadakelompokberikut:
a.Setiapperempuanyangberusiaantara2535tahun,yangbelumpernahmenjalanitesPap
sebelumnya,ataupernahmengalamitesPap3tahunsebelumnyaataulebih.
b.PerempuanyangditemukanlesiabnormalpadapemeriksaantesPapsebelumnya
c.Perempuanyangmengalamiperdarahanabnormalpervaginam,perdarahanpascasanggamaatauperdarahan
pascamenopauseataumengalamitandadangejalaabnormallainnya
d.Perempuanyangditemukanketidaknormalanpadaleherrahimnya

Penerapan skrining kanker leher rahim di Indonesia, usia target saat ini adalah antara
usia 30-50 tahun, meskipun begitu pada perempuan usia 50-70 tahun yang belum pernah
diskrining sebelumnya masih perlu diskrining untuk menghindari lolosnya kasus kanker leher
rahim. Selain sasaran diatas, semua perempuan yang pernah melakukan aktivitas seksual perlu
menjalani skrining kanker leher rahim. WHO tidak merekomendasikan perempuan yang
sudah menopause menjalani skrining dengan metode IVA karena zona transisional leher rahim
pada kelompok ini biasanya berada pada endoleher rahim dalam kanalis servikalis sehingga
tidak bisa dilihat dengan inspeksi spekulum. 5 Namun untuk pelaksanaan di Indonesia,
perempuan yang sudah mengalami menopause tetap dapat diikut sertakan dalam program
skrining, untuk menghindari terlewatnya penemuan kasus kanker leher rahim. Perlu
disertakan informed consent pada perempuan golongan ini, mengingat alasan di atas. Tidak

10

ditemukannya lesi prekanker tidak berarti tidak ada lesi prakanker pada golongan perempuan
ini.5
Program IVA di Puskesmas

Metode IVA memberi peluang dilakukannya skrining secara luas di tempat-tempat


yang memiliki sumberdaya terbatas, karena metode ini memungkinkan diketahuinya hasil
dengan segera dan terutama karena hasil skrining dapat segera ditindaklanjuti. Metode satu
kali kunjungan (single visit approach) dengan melakukan skrining metode IVA dan tindakan
bedah krio untuk temuan lesi prakanker (see and treat) memberikan peluang untuk
peningkatan cakupan deteksi dini kanker leher rahim, sekaligus mengobati lesi prakanker.9
IVA Sebagai Metode Skrining Alternatif 4,6,9
Mengkaji masalah penanggulangan kanker leher rahim yang ada di
Indonesia dan adanya pilihan metode yang mudah di-ujikan di berbagai negara,
agaknya metode IVA (inspeksi visual dengan aplikasi asam asetat) layak dipilih
sebagai metode skrining alternatif untuk kanker leher rahim. Pertimbangan
tersebut didasarkan oleh pemikiran, bahwa metode skrining IVA itu. Mudah,
praktis dan sangat mampu laksana. Dapat dilaksanakan oleh tenaga kesehatan
bukan

dokter

ginekologi,

dapat

dilakukan

oleh

bidan

di

setiap

tempat

pemeriksaan kesehatan ibu. Alat-alat yang dibutuhkan sangat sederhana. Metode


skrining IVA sesuai untuk pusat pelayanan sederhana.4

Metode IVA
Di negara maju, skrining secara luas dengan metode pemeriksaan sitologi tes Pap telah
menunjukkan hasil yang efektif dalam menurunkan insidens kanker leher rahim. Namun di
negara-negara berkembang yang hanya memiliki sumber daya terbatas, skrining hanya
menjangkau sebagian kecil perempuan saja, terutama di daerah perkotaan. Ada beberapa
kelemahan tes Pap diantaranya keterbatasan jumlah laboratorium sitologi dan tenaga
sitoteknologi terlatih, sehingga menyebabkan hasil tes Pap baru didapat dalam rentang waktu
yang relatif lama (berkisar 1 hari- 1 bulan).4,6 Skrining dengan metode tes Pap memerlukan
tenaga ahli, sistem transportasi, komunikasi dan tindak lanjut (follow-up) yang belum dapat
dipenuhi oleh negara-negara berkembang.4,6 Hanya sebagian kecil dari perempuan yang
menjalani dan mendapatkan hasil tes Pap juga menjalani evaluasi dan pengobatan yang
11

semestinya bila ditemukan abnormalitas. Sebagai konsekuensinya, angka insidens kanker


leher rahim tetap tinggi dan kebanyakan pasien datang pada stadium lanjut.
Masalah yang berkembang akibat keterbatasan metode tes Pap inilah yang mendorong
banyak penelitian untuk mencari metode alternatif skrining kanker leher rahim. Salah satu
metode yang dianggap dapat dijadikan alternatif adalah metode inspeksi visual dengan asam
asetat (IVA). Efektivitas IVA sudah di teliti oleh banyak peneliti. Walaupun demikian
perbandingan masing-masing penelitian tentang IVA agak sulit dievaluasi karena perbedaan
protokol dan populasi. 9
Dasar Pemeriksaan IVA
Pemeriksaan inspeksi visual dengan asam asetat (IVA) adalah pemeriksaan yang
pemeriksanya (dokter/bidan/paramedis) mengamati leher rahim yang telah diberi asam
asetat/asam cuka 3-5% secara inspekulo dan dilihat dengan penglihatan mata telanjang.
46,49,55 Pemeriksaan IVA pertama kali diperkenalkan oleh Hinselman (1925) dengan cara
memulas leher rahim dengan kapas yang telah dicelupkan dalam asam asetat 3-5%.
Pemberian asam asetat itu akan mempengaruhi epitel abnormal, bahkan juga akan
meningkatkan osmolaritas cairan ekstraseluler. Cairan ekstraseluler yang bersifat hipertonik
ini akan menarik cairan dari intraseluler sehingga membran akan kolaps dan jarak antar sel
akan semakin dekat. Sebagai akibatnya, jika permukaan epitel mendapat sinar, sinar tersebut
tidak akan diteruskan ke stroma, tetapi dipantulkan keluar sehingga permukaan epitel
abnormal akan berwarna putih, disebut juga epitel putih (acetowhite).4
Daerah metaplasia yang merupakan daerah peralihan akan berwarna putih juga setelah
pemulasan dengan asam asetat tetapi dengan intensitas yang kurang dan cepat menghilang.
Hal ini membedakannya dengan proses prakanker yang epitel putihnya lebih tajam dan lebih
lama menghilang karena asam asetat berpenetrasi lebih dalam sehingga terjadi koagulasi
protein lebih banyak. Jika makin putih dan makin jelas, makin tinggi derajat kelainan
jaringannya. Dibutuhkan 1-2 menit untuk dapat melihat perubahan-perubahan pada epitel.
Leher rahim yang diberi 5% larutan asam asetat akan berespons lebih cepat daripada 3%
larutan tersebut. Efek akan menghilang sekitar 50-60 detik sehingga dengan pemberian asam
asetat akan didapatkan hasil gambaran leher rahim yang normal (merah homogen) dan bercak
putih (mencurigakan displasia). Lesi yang tampak sebelum aplikasi larutan asam asetat bukan
12

merupakan epitel putih, tetapi disebut leukoplakia; biasanya disebabkan oleh proses
keratosis.9
1. Dalam penerapan di pelayanan primer yang lebih luas, metode IVA direkomendasikan
menjadi metode skrining alternatif pada kondisi yang tidak memungkinkan dilakukan
pemeriksaan yang berbasis sitologi.
2. Sasaran skrining IVA adalah perempuan usia 30-50 tahun. Pada usia diatas 50 tahun,
3.
4.
5.
6.

atau sudah menopause, dianjurkan untuk melakukan skrining yang berbasis sitologi.
Interval skrining dengan metode IVA adalah 3 tahun sekali
Pelaksana skrining IVA dapat dilakukan oleh tenaga kesehatan terlatih
Kasus dengan hasil IVA positif dirujuk untuk mendapat penatalaksanaan lebih lanjut
Pengobatan langsung hanya berdasarkan hasil IVA positif dapat dikerjakan dalam

kaitan suatu program yang disupervisi


7. Perlu dilakukan penelitian lebih lanjut mengenai penerapan skrining IVA dihubungkan
dengan pengobatan dengan pendekatan sekali kunjungan
Beberapa kategori temuan IVA tampak seperti tabel berikut :4

13

Tabel 2. Hasil skrining di banding status penyakit pada skenario 7


Test skrining IVA
Tes (+)
Tes (-)

Menderita ca cervix
6
3

Tidak menderita ca cervix


24
67

14

Hasil:
Sensitivitas : 6/ (6+3)
Spesifisitas : 67/ (67 + 24)
Nilai prediksi positif : 6 / (6 +24) X 100%
Nilai prediksi negatif : 3 / ( 3 + 67 ) X 100%
Meskipun protokol pelaksanaan pemeriksaan ini bervariasi, hasil penelitian yang dilakukan di
beberapa negara berkembang menunjukkan bahwa metode IVA mempunyai sensitivitas yang
sebanding dengan tes Pap dalam mendeteksi lesi prakanker derajat tinggi meskipun
spesifisitasnya lebih rendah dari tes Pap.4
Kurang spesifiknya skrining dengan metode ini diantaranya karena subyektivitas petugas
medis yang melakukan pemeriksaan di lapangan, selain dipengaruhi juga oleh prevalensi
kasus. Pada daerah dengan prevalensi kasus yang rendah, angka kejadian positif palsu dari
pemeriksaan akan lebih tinggi jika dibandingkan dengan daerah yang memiliki prevalensi
kasus lebih tinggi.2 Hal tersebut dapat diperbaiki dengan meningkatkan supervisi.
Tabel 3. Sensitifitas, spesifisitas berbagai metode skrining

Penatalaksanaan Medis

15

Pemeriksaan IVA dilakukan dengan spekulum melihat langsung leher rahim yang
telah dipulas dengan larutan asam asetat 3-5%, jika ada perubahan warna atau
tidak

muncul

plak

putih,

maka

hasil

pemeriksaan

dinyatakan

negative.

Sebaliknya jika leher rahim berubah warna menjadi merah dan timbul plak putih,
maka dinyatakan positif lesi atau kelainan pra kanker.2,8 Jika sudah terdeteksi

mengidap kanker serviks, maka ada beberapa metode pengobatan yang bisa dilakukan.
Jika terdeteksi kanker serviks stadium awal, maka pengobatannya dilakukan dengan cara
menghilangkan kanker serviks tersebut dengan cara dilakukan pembedahan, baik pembedahan
laser, listrik atau dengan cara pembekuan dan membuang jaringan kanker serviks.

Metode

krioterapi

adalah

membekukan

serviks

yang

terdapat

lesi

prakanker pada suhu yang amat dingin (dengan gas CO2) sehingga sel-sel
pada area tersebut mati dan luruh, dan selanjutnya akan tumbuh sel-sel
baru yang sehat

Untuk kasus kanker serviks stadium lanjut akan dilakukan pengobatan dengan cara
kemoterapi serta radioterapi, namun jika sudah terdeteksi cukup parah, tiada lain kecuali
dengan mengangkat rahim (histerektomi) secara menyeluruh agar kanker tidak berkembang.2
Pencegahan Kanker Serviks
Berikut ini adalah beberapa hal yang dapat dilakukan kaum perempuan dalam hal mencegah
kanker serviks agar tidak menimpa dirinya, antara lain:3,9

Jalani pola hidup sehat dengan mengkonsumsi makanan yang cukup nutrisi dan

bergizi
Selalu menjaga kesehatan tubuh dan sanitasi lingkungan
Hindari pembersihan bagian genital dengan air yang kotor
Jika anda perokok, segera hentikan kebiasaan buruk ini
Hindari berhubungan intim saat usia dini
Selalu setia kepada pasangan anda, jangan bergonta-ganti apalagi diikuti dengan

hubungan intim.
Lakukan pemeriksaan pap smear minimal lakukan selama 2 tahun sekali, khususnya

bagi yang telah aktif melakukan hubungan intim


Jika anda belum pernah melakukan hubungan intim, ada baiknya melakukan vaksinasi
HPV

16

Vaksinasi secara berulang dibutuhkan untuk merangsang tubuh membentuk antibodi


(kekebalan tubuh) yang kuat untuk melindungi tubuh dari serangan virus HPV yang akan
masuk. Antibodi akan menangkap virus yang akan masuk ke dalam tubuh sehingga tubuh
terhindar dari infeksi HPV. Idealnya vaksinasi diberikan sebelum adanya bahaya infeksi HPV.
Vaksinasi ini paling efektif apabila diberikan pada perempuan berusia 9 sampai 26 tahun yang
belum aktif secara seksual. Namun bukan berarti wanita yang sudah menikah atau
berhubungan seksual tidak boleh mendapatkannya. Hanya saja angka proteksinya tidak
setinggi pada golongan sebelumnya.3
Vaksin diberikan sebanyak 3 kali dalam jangka waktu tertentu (bulan ke 0,1,dan 6). Dengan
vaksinasi, risiko terkena kanker serviks bisa menurun hingga 75%.4
Penutup
Skrining, dalam pengobatan, adalah strategi yang digunakan dalam suatu populasi
untuk mendeteksi suatu penyakit pada individu tanpa tanda-tanda atau gejala penyakit itu.
Skrining yang sering di lakukan di Puskesmas adalah skrining ca cervix dengan tes IVA
karena skrining ini mudah, praktis dan sangat mampu laksana. Dapat dilaksanakan
oleh tenaga kesehatan bukan dokter ginekologi, dapat dilakukan oleh bidan di
setiap tempat pemeriksaan kesehatan ibu. Alat-alat yang dibutuhkan juga sangat
sederhana. Metode satu kali kunjungan (single visit approach) dengan melakukan skrining

metode IVA dan tindakan bedah krio untuk temuan lesi prakanker (see and treat) memberikan
peluang untuk peningkatan cakupan deteksi dini kanker leher rahim, sekaligus mengobati lesi
prakanker.
Jika terdeteksi kanker serviks stadium awal, maka pengobatannya dilakukan dengan
cara menghilangkan kanker serviks tersebut dengan cara dilakukan pembedahan, baik
pembedahan laser, listrik atau dengan cara pembekuan dan membuang jaringan kanker
serviks. Untuk kasus kanker serviks stadium lanjut akan dilakukan pengobatan dengan cara
kemoterapi serta radioterapi, namun jika sudah terdeteksi cukup parah, tiada lain kecuali
dengan mengangkat rahim (histerektomi) secara menyeluruh agar kanker tidak berkembang.
Meskipun hasil penelitian yang dilakukan di beberapa negara berkembang
menunjukkan bahwa metode IVA mempunyai sensitivitas yang sebanding dengan tes Pap

17

dalam mendeteksi lesi prakanker derajat tinggi meskipun spesifisitasnya lebih rendah dari tes
Pap.

DaftarPustaka
1. Dalimartha, S. Kanker Serviks. In: Dalimartha, S., ed. Deteksi Dini Kanker dan
SimplisiaAntikanker.Jakarta:PenebarSwadaya;2004.h.148.
2. Anwar M, Baziad A, Prabowo RP. Ilmu kandungan. Jakarta: Tridasa
Printer;2011.h.294-300.

3. Chamim.BukuAcuanNasionalOnkologiGinekologi.In:MFaridAziz,Adrijojo,
Abdul Bari Saifuddin, editors. Penentuan stadium klinik dan pembedahan kanker
ginekologi.Jakarta:YayasanBinaPustakaSarwono;2006.h.17381.
4. Diananda, R. Kanker Serviks: Sebuah Peringatan Buat Wanita. In: Diananda, R.
MengenalSelukBelukKanker.Yogyakarta:Katahari;2009.h.4360.
5. Rajab W. Buku ajar Epidemiologi untuk mahasiswa kebidanan. Jakarta : EGC,
2009.h.1558.
6. ChandraB.Ilmukedokteranpencegahandankomunitas.Jakarta:EGC;2009.h.1578.
7. Sastroasmoro S. Dasardasar metodologi penelitian klinis. Jakarta: Sagung
Seto;2011.h.22830.
8. Edianto,D.KankerServiks. In: Aziz,M.F.,Andrijono,Saifuddin,A.B.,ed. Buku
Acuan Nasional Onkologi Ginekologi. Jakarta: Yayasan Bina Pustaka Sarwono
Prawirohardjo;2006.h.44254.
9. Rasjidi,I.,Irwanto,Y.,Sulistyanto,H.,2008.ModalitasDeteksiDiniKankerServiks.
In:Rasjidi,I.,ed.ManualPrakankerServiks.Jakarta:SagungSeto;2008.h.458.

18