Anda di halaman 1dari 51

SKENARIO A BLOK 26

Ny. Lola, 40 tahun datang ke dokter karena mengeluh demam yang hilang timbul sejak pulang
dari Bangka 6 bulan yang lalu. Sejak satu minggu ini demam muncul setiap hari, disertai
menggigil dan berkurang setelah keluar keringat dingin. Ny. Lola juga mengeluh sakit kepala,
mual dan rasa penuh di perut.
Pemeriksaan fisik:
Keadaan umum: kesadaran Compos Mentis, tekanan darah: 120/80 mmHg, Nadi: 96x/menit, RR:
24x/menit, temperature Axilla: 39oC
Kepala: Sklera ikterik -/-, konjunctiva pucat +/+
Leher: pembesaran KGB -/Thorak: Paru dan Jantung dbn
Abdomen: lien teraba Schuffner 4, hepar teraba 1 jari di bawah arcus coste
Ekstremitas: edema pretibia -/Pemeriksaan penunjang:
Hb 9 gr/dl, RBC 4,5jt, WBC 11.000/mm3, Trombosit 200.000/mm3
DDR: tampak eritrosit yang terinfeksi membesar dengan gambaran ring form cenderung tebal
dan kasar, tampak sitoplasma tida teratur (ameboid) dan terdapat Schuffners dot

I. Klarifikasi Istilah
1. Demam

Suhu abnormal tubuh diatas 37,2oC (axillary), 38oC

(rectal), 37,5oC (oral)


2. Menggigil :
Perasaan dingin disertai dengan getaran tubuh
3. Keringat dingin
:
Proses ekskresi yang dilakukan oleh kelenjer
keringat pada kulit yang mengandung hasil sisa metabolisme
4. Schuffner
: Garis yang menghubungkan titik SIAS kanan dengan
umbilicus dan diteruskan sampai arcus costa, garis ini dipergunakan
untuk mengukur pembesaran limfa dan terbagi atas 8 titik
5. Edema pretibia
:
Pengumpulan cairan secara abnormal di
ruang interseluler tubuh di daerah depan os tibia
1

6. DDR

: Drike Drupple, adalah uji untuk menentukan ada atau

tidaknya parasit malaria dalam darah


7. Schuffners dot
: Granul kecil yang terlihat pada eritrosit yang
terinfeksi Plasmodium vivax

II. Identifikasi masalah


1. Ny. Lola, 40 tahun datang ke dokter karena mengeluh demam yang hilang timbul sejak
pulang dari Bangka 6 bulan yang lalu.
2. Sejak satu minggu ini demam muncul setiap hari, disertai menggigil dan berkurang
setelah keluar keringat dingin.
3. Ny. Lola juga mengeluh sakit kepala, mual dan rasa penuh di perut.
4. Pemeriksaan fisik:
Keadaan umum: kesadaran CM, tekanan darah: 120/80 mmHg, Nadi: 96x/menit, RR:
24x/menit, temperature Axilla: 39oC
Kepala: Sklera ikterik -/-, konjunctiva pucat +/+
Leher: pembesaran KGB -/Thorak: Paru dan Jantung dbn
Abdomen: lien teraba Schuffner 4, hepar teraba 1 jari di bawah arcus coste
Ekstremitas: edema pretibia -/5. Pemeriksaan penunjang:
Hb 9 gr/dl, RBC 4,5jt, WBC 11.000/mm3, Trombosit 200.000/mm3
DDR: tampak eritrosit yang terinfeksi membesar dengan gambaran ring form cenderung
tebal dan kasar, tampak sitoplasma tida teratur (ameboid) dan terdapat Schuffners dot

III.

Analisis Masalah
2

1. Ny. Lola, 40 tahun datang ke dokter karena mengeluh demam yang hilang timbul sejak
pulang dari Bangka 6 bulan yang lalu.
a. Apa saja etiologi yang menyebabkan demam hilang timbul?
Demam hilang timbul dapat disebabkan oleh abses, penyakit
autoimun,

inflamasi

kardiovaskular,

inflamasi

intestinal,

efek

samping obat, tuberkulosis, kelainan tiroid, dan paling sering


dihubungkan

dengan

malaria.

Demam

hilang

timbul

juga

dapatdisebabkan oleh infeksi seperti infeksi Plasmodium vivax dan


Plasmodium ovale, penyakit tifoid (hilang pada pagi hari, timbul pada malam hari).
b. Apa saja jenis-jenis demam?

Pola demam

Penyakit

Kontinyu

Demam tifoid, malaria falciparum malignan

Remitten

Sebagian besar penyakit virus dan bakteri

Intermiten

Malaria, limfoma, endokarditis

Hektik atau septic

Penyakit Kawasaki, infeksi pyogenik

Quotidian

Malaria karena P.vivax

Double quotidian

Kala azar, arthritis gonococcal, juvenile rheumathoid


arthritis, beberapa drug fever (contoh karbamazepin)

Relapsing atau periodic

Malaria tertiana atau kuartana, brucellosis

Demam rekuren

Familial Mediterranean fever

c. Bagaimana mekanisme demam hilang timbul?


Nyamuk anopheles betina menggigit manusia dan melepaskan sporozoit ke dalam
pembuluh darah Dalam 45 menit sporozoit masuk ke hati terjadi perkembangan
4

aseksual di dalam sel parenkim hati terbentuk skizont hati (pada P. vivax dapat
terbentuk hipnozoit yang bisa bertahan sampai bertahun-tahun) skizon hati pecah
dan mengeluarkan banyak merozoit ke sirkulasi darah merozoit menyerang eritrosit
dalam waktu <12 jam berubah menjadi bentuk ring setelah 36 jam parasite
berubah menjadi sizon sizon pecah dan mengeluarkan 6-36 merozoit (pada P. vivax
siklus aseksual ini berlangsung selama 48 jam

menyebar secara sistemik

menginfeksi eritrosit merangsang makrofag mengeluarkan pirogen endogen


sekresi IL-1, IL-6, TNFa dikirim ke hipotalamus pengeluaran asam arakidonat
sintesis prostaglandin PGE2 peningkatan thermostat set point demam muncul
setiap 2 hari terhitung dari serangan demam sebelumnya (demam hilang timbul).

d. Apa hubungan demam yang dikeluhkan Ny.lola dengan riwayat perjalanan ke


Bangka 6 bulan yang lalu?
Demam yang terjadi pada kasus ini berhubungan dengan proses skizogoni
(pecahnya merozoit/skizon) akibat malaria. Sedangkan, menurut Peta Endemisitas
Malaria di Indonesia tahun 2007 diperkirakan sekitar 45% masyarakat Indonesia
bertempat tinggal di lokasi yang berisiko untuk tertular malaria. Satu di antara
wilayah di Indonesia yang yang merupakan daerah endemis malaria adalah
Kabupaten Bangka di Provinsi Kepulauan Bangka Belitung. Wilayah tersebut
dikategorikan sebagai wilayah endemis sedang untuk malaria dengan angka AMI 29,3
per 1000 penduduk pada tahun 2007 (Depkes RI 2008).
Masa inkubasi P. vivax adalah 12-17 hari namun juga bisa sampai 6-12 bulan.
Demam yang dikeluhkan oleh Ny. Lola setelah melakukan perjalanan ke Pulau
5

Bangka 6 bulan yang lalu disebabkan oleh reaktivasi dari bentuk laten plasmodium di
dalam hati yang disebut sebagai hipnozoit.

2. Sejak satu minggu ini demam muncul setiap hari, disertai menggigil dan berkurang
setelah keluar keringat dingin.
a. Mengapa sejak satu minggu demam muncul setiap hari disertai menggigil?
Sejak satu minggu ini, Ny. Lola tengah menjalani fase relaps, yaitu berulangnya
gejala klinik atau parasitemia setelah 24 minggu serangan primer.
Pecahnya sel darah merah yang terinfeksi Plasmodium dapat menyebabkan timbulnya
gejalademam disertai menggigil. Periodisitas demam pada malaria berhubungan
dengan waktu pecahnya sejumlah skizon matang dan keluarnya merozoit yang masuk
aliran darah (sporulasi). Respon yang terjadibilaorganismepenginveksitelahmenyebar
di dalamdarah, yaitupengeluaransuatubahankimiaolehmakrofag yang disebutpirogen
endogen (TNF alfadan IL-1).
Pirogen endogen ini menyebabkan pengeluaran prostaglandin, suatu perantara
kimia lokal yang dapat menaikan termostat hipotalamus yang mengatur suhu tubuh.
Setelah terjadi peningkatan titik patokan hipotalamus, terjadi inisiasi respon dingin,
dimana hipotalamus mendeteksi suhutubuh di bawah normal, sehingga memicu
mekanisme respon dingin untuk meningkatkan suhu. Respon dingin tersebut berupa
menggigil dengan tujuan agar produksi panas meningkat dan vasokonstriksi kulit
untuk segera mengurangi pengeluaran panas.

b. Bagaimana mekanisme demam yang disertai menggigil dan keringat dingin?

3. Ny. Lola juga mengeluh sakit kepala, mual dan rasa penuh di perut.
a. Bagaimana mekanisme sakit kepala, mual dan rasa penuh di perut pada kasus?
Sakitkepala
Infeksi Plasmodium melepaskan toksin malaria atau GPI sehingga mengaktifasi
makrofagdanmensekresikanIL2>mengaktifasiselTh>mensekresikanIL3>
mengaktifasi sel mast > mensekresikan PAF (Platelet Activating Factor) yaitu
pembawapesankimiawiyangmenyebabkaninflamasi,pengerutanpembuluhdarah,
penggumpalandarah,danakhirnyagangguanfungsicerebral>mengaktifkanfaktor
hagemann(factorkoagulasiataupenggumpalan)>sintesisbradikinin(bradikardin
bersifat vasodilatasi, meningkatkan permeabilitas vaskuler, dsb) >
merangsang/responserabutsarafdiotak>nyeri>sakitkepala.
Mual
Nyamukyangdidalamtubuhnyaterdapatparasitmalaria menggigitmanusia
sporozoit sporozoit ke sel hati dan di parenkim hati melakukan perkembangan
secaraaseksual(skizogonieksoeritrosit)selama5,5hari skizoit skizoitpecah
7

menjadi mengeluarkan merazoidmerazoid merazoid ke sirkulasi darah dan


menyerang RBC terbentuk eritrosit parasit (EP) bereplikasi secara aseksual
(skizogoni eritrosit) parasit dalam eritrosit mengalami 2 stadium yaitu stadium
cincin (tropozoid) dan matur (skizon) permukaan membran EP stadium matur
menonjol dan membentuk knob dengan HRP1 (komponen umum knob) EP
mengalamimerogoni/skizogoni(pembelahansecaraberulang) melepaskantoksin
malariaberupaGP1GPImerangsangpelepasanTNFalpha,IL1,IL6,IL3dengan
mengaktivasi makrofag IL 3 mengaktivasi sel mast pelepasan histamin
peningkatanasamlambungnauseaperasaanperuttidaknyaman.
Rasapenuhdiperut
Manifestasi klinis malaria sangat khas dengan adanya serangan demam yang
intermitten,anemiadansplenomegali.Keadaanspelomegaliinilahyangmenimbulkan
rasapenuhdiperutpadapendertitamalaria.
b. Apa hubungan keluhan utama (demam setiap hari) dengan keluhan tambahan?
Gejala malaria tumbul saat pecahnya eritrosit yang mengandung parasit. Gejala
yang paling mencolok adalah demam yang diduga disebabkan oleh pirogen endogen,
yaitu TNF dan interleukin-1. Akibat demam terjadi vasodilatasi perifer yang mungkin
disebabkan oleh bahan vasoaktif yang diproduksi oleh parasit. Pembesaran limpa
disebabkan oleh terjadinya peningkatan jumlah eritrosit yang terinfeksi parasit,
teraktivasinya sistem retikuloendotelial untuk memfagositosis eritrosit yang terinfeksi
parasit dan sisa eritrosit akibat hemolisis. Juga terjadi penurunan jumlah trombosit
dan leukosit neurtofit. Terjadinya kongesti pada organ lain meningkatkan resiko
terjadinya ruptur limpa.
4. Pemeriksaan fisik:
Keadaan umum: kesadaran CM, tekanan darah: 120/80 mmHg, Nadi: 96x/menit, RR:
24x/menit, temperature Axilla: 39oC
Kepala: Sklera ikterik -/-, konjunctiva pucat +/+
Leher: pembesaran KGB -/Thorak: Paru dan Jantung dbn
Abdomen: lien teraba Schuffner 4, hepar teraba 1 jari di bawah arcus coste
8

Ekstremitas: edema pretibia -/a. Bagaimana interpretasi dan mekanisme abnormalitas pemeriksaan fisik?
Hasil pemeriksaan
Keadaan umum:
- Kesadaran
- Tekanan darah
- Nadi
- RR
- Temperatur axilla

Nilai normal
CM
120/80 mmHg
60-100 x/menit
18-24 x/menit
36,5-37,2C

Interpretasi
Normal
Normal
Normal
Batas atas
Fever

Mekanisme abnormalitas
Demam:
Pirogen eksogen aktivasi
makrofag IL-1 dan TNF

DD
Malaria
Tifoid
DF

peningkatan PGE PGE


berikatan dengan reseptor di
Termostat vasokontriksi
perifer demam RR
meningkat untuk memenuhi

Kepala:
- Sklera ikterik -/- Konjungtiva

Non ikterik
Non anemis

Normal
Anemis

pucat +/+

demand oksigen
Konjungtiva pucat:
Anemia terjadi akibat
pecahnya eritrosit yang
terinfeksi maupun tidak
terinfeksi. P. vivax hanya
menginfeksi eritrosit muda.
Oleh karenanya, kadar Hb
yang menurun menunjukkan
gambaran anemis pada

Leher: pembesaran

Tidak ada

Normal

konjungtiva.
-

KGB -/Thorak: Paru dan

pembesaran
Dalam batas

Normal

Jantung dbn
Abdomen:

normal
Tidak teraba

Abnormal

Hepatomegali:
Akibat dari aktivitas

Tidak teraba

Abnormal

Lien teraba

Schuffner 4
Hepar teraba 1
jari di bawah
arcus coste

merozoit di dalam hepatosit


mengakibatkan hipertropi
dan hiperplasia sel hepar.
Splenomegali:
Limpa mengalami kongesti,
9

menghitam, dan mengeras


akibat timbunan
penghancuran parasit,
pigmen, sel radang, dan
Ekstremitas: edema

Tidak edema

Normal

jaringan ikat.
-

pretibial -/5. Pemeriksaan penunjang:


Hb 9 gr/dl, RBC 4,5jt, WBC 11.000/mm3, Trombosit 200.000/mm3
DDR: tampak eritrosit yang terinfeksi membesar dengan gambaran ring form cenderung
tebal dan kasar, tampak sitoplasma tida teratur (ameboid) dan terdapat Schuffners dot
a. Bagaimana interpretasi dan mekanisme abnormalitas pemeriksaan penunjang?
Hasil Lab

Nilai normal

Hb 9 gr/dl

Pria: 13-17 gr/dl


Wanita: 12-15
gr/dl

Interpretasi
Anemia.
Menurut kriteria
WHO, dikatakan
anemia apabila:

RBC 4,5 jt

Pria :
4,5 jt-5,5 jt
sel/ul darah

Laki-laki
dewasa
<13gr/dL
Perempua
n dewasa
tidak
hamil
<12gr/dL
Perempua
n hamil
<11gr/dL

Masih dalam
batas normal

Mekanisme
Anemia terjadi karena pecahnya
sel darah merah yang terinfeksi
maupun
yang tidak terinfeksi.
Plasmodium vivax dan P. ovale
hanya menginfeksi sel darah
merah muda
yang jumlahnya hanya 2% dari
seluruh jumlah sel darah merah,
Sehingga anemia yang
disebabkan
oleh P. vivax , P. ovale dan P.
malariae umumnya terjadi pada
keadaan kronis. Ini menandakan
bahwa pasien ini sudah
menderita malaria kronis, sejak
ia pulang dari Bangka.
Jadi, walaupun pasien sudah
mengalami anemia ringan, nilai
RBC masih dalam batas normal,
10

karena mungkin pembentukan


RBC yang masih terus
diproduksi.
Menandakan tidak adanya
kerusakan pada sumsum tulang
belakang.

Wanita :
3,8 jt 4,8 jt
sel/ul darah.

WBC
11.000/mm3

5.000 - 10.000
sel/ul darah.

Meningkat

Ini disebabkan karena adanya


infeksi parasit malaria
(Plasmodium Vivax/ovale) di
dalam tubuh yang menyebabkan
sistem pertahanan tubuh dipacu
untuk melawan parasit tersebut.

Trombosit
200.000/mm3

150.000400.000/ ul
darah.

Normal

Pada malaria biasanya jumlah


trombosit normal, jarang
ditemukan adanya penurunan
jumlah trombosit.

b. Bagaimana prinsip dan metode pemeriksaan DDR?


DDR (Drike Drupple) merupakan pemeriksaan apusan darah tebal.
Pemeriksaan ini sebaiknya dilakukan setelah puncak demam terutama pada infeksi
oleh Plasmodium Falciparum sebab untuk plasmodium lainnya dapat dibuat setiap
saat. Untuk menemukan parasit dalam sediaan darah, tergantung pada derajat
parasitemia (parasite count) dan ambang microscopic (microscopic treshhold).
Pemeriksaan darah dilakukan pada setiap kasus yang diduga malaria pada saat
pertama kali berobat, jika hasilnya negative diulang setiap 6 jam dan baru dinyatakan
negatif jika setelah 3-4 hari dilakukan pemeriksaan tidak menemukan parasitnya.
Pemeriksaan mikroskopik terhadap apusan darah yang diwarnai oleh Giemsa
merupakan metode pilihan untuk mengidentifikasi pasien dengan infeksi parasit darah
seperti malaria. Sebelum diwarnai, apusan darah tebal tidak di fiksasi. Apusan darah
tebal harus diwarnai dengan reagen Giemsa karena reagen pewarna Wright
mengandung suatu fiksatif alcohol yang mencegah lisis eritrosit.
Langkah kerja :
1. Bersihkan ujung jari dengan kapas alcohol 70% dan biarkan kering
2. Tusuk jari dengan blood lancet, dan darah pertama di hapus dengan tisu
3. Teteskan darah pada sebuah objek glass yang bersih, sebarkan dengan membentuk
suatu lingkaran dengan garis tengah 0,5 cm dan diameter 2 cm
11

4. Biarkan mengering
5. Tetesi sediaan dengan air yang mengalir untuk melisiskan sel darah merah
6. Setelah darah lisis, rendam atau genangi dengan dengan Giemsa selama 15-20
menit
7. Biarkan sampai kering
8. Siapkan mikroskop yang sudah dibersihkan dengan Xylol
9. Pasang sediaan dengan perbesaran 100x dengan diberi anisol
10. Catat hasil pengamatan
Interpretasi Hasil
Positif

: Bila ditemukan Plasmodium

Negatif

: Bila tidak ditemukan Plasmodium

Gambar : Schuffners dots dan cincin ameboid

IV.Hipotesis
Ny. Lola 40 tahun menderita malaria et causa infeksi Plasmodium vivax
a. Differential Diagnosis

12

1. Malaria tanpa komplikasi harus dapat dibedakan dengan penyakit infeksi lain
sebagai berikut:
a. Demam tifoid
Demam lebih dari 7 hari ditambah keluhan sakit kepala, sakit perut (diare,
obstipasi), lidah kotor, bradikardi relatif, roseola, leukopenia, limfositosis relatif,
aneosinofilia, uji Widal postif bermakna, biakan emepedu positif.
b. Demam dengue
Demam tinggi terus menerus selama 2 7 hari, disertai keluhan sakit kepala,
nyeri tulang, nyeri ulu hati, sering muntah, uji torniquet positf, penurunan jumlah
trombosit dan peninggian hemoglobin dan hematokrit apda demam berdarah
dengue, tes serologi inhibis hemaglutinasi, IgM atau IgG anti dengue positif.
c. Infeksi Saluran Pernafasan Akut (ISPA)
Batuk, beringus, sakit menelan, sakit kepala, manifestasi kesukaran bernafas
antara lain: nafas cepat / sesak nafas, tarikan dinding dada ke dalam dan adanya
stridor.
d. Leptospirosis ringan
Demam tinggi, nyeri kepala, mialgia, nyeri perut, mual, muntah, conjuncival
injection (kemerahan pada konjungtiva bola mata), dan nyeri betis yang
menyolok. Pemeriksaan serologi Microscopic Agglutination Test (MAT) atau tes
Leptodipstik positif
e. Infeksi virus akut lainnya
2. Malaria berat atau malaria dengan komplikasi dibedakan dengan penyakit infeksi lain
sebagai berikut:
a. Radang otak (meningitis/ensefalitis)
Penderita panas dengan riwayat nyeri kepala yang progresif, hilangnya kesadaran,
kaku kuduk, kejang dan gejala neurologis lainnya.
b. Stroke (gangguan serebrovaskuler)
Hilangnya atau terjadi gangguan kesadaran, gejala neurologik lateralisasi
(hemiparese atau hemiplegia), tanpa panas, ada penyakit yang mendasari
(hipertensi, diabetes melitus dan lain lain)
c. Tifoid ensefalopati
Gejala demam tifoid ditandai dengan penurunan kesadaran dan tanda-tanda
demam tifoid lainnya.
d. Hepatitis

13

Prodromal hepatitis (demam, mual, nyeri pada hepar, muntah tidak bisa makan
diikuti dengan timbulnya ikterus tanpa panas), mata atau kulit kuning, urin seperti
e.
f.
g.
h.

air teh. Kadar SGOT dan SGPT meningkat > 5x.


Leptospirosis berat
Glomerulonefritis akut atau kronik
Sepsis
Demam berdarah dengue atau Dengue shock syndrome.

b. WD dan penegakan diagnosis


Anamnesis
Keluhan utama pada malaria adalah demam, menggigil, berkeringat dan
dapat disertai sakit kepala, mual, muntah, diare, dan nyeri otot atau pegalpegal.
Pada anamnesis juga perlu ditanyakan:
1. Riwayat berkunjung dan bermalam 1 4 minggu ke daerah endemik malaria;
2. Riwayat tinggal di daerah endemik malaria;
3. Riwayat sakit malaria/riwayat demam;
4. Riwayat minum obat malaria satu bulan terakhir;
5. Riwayat mendapat transfusi darah.
Selain itu, pada malaria berat, dapat ditemukan keadaan di bawah ini:
1. Gangguan kesadaran dalam berbagai derajat
2. Keadaan umum yang lemah (tidak bisa duduk/berdiri)
3. Kejang-kejang
4. Panas sangat tinggi
5. Mata atau tubuh kuning
6. Perdarahan hidung, gusi atau saluran pencernaan
7. Nafas cepat dan atau sesak nafas
8. Muntah terus menerus dan tidak dapat makan minum
9. Warna air seni seperti teh tua dan dapat samapi kehitaman
10. Jumlah air seni kurang (oliguria) sampai tidak ada (anuria)
11. Telapak tangan sangat pucat
Pemeriksaan Fisik
1. Demam (>37,5 C aksila)
2. Konjungtiva atau telapak tangan pucat

14

3. Pembesaran limpa (splenomegali)


4. Pembesaran hati (hepatomegali)
Pada malaria berat, ditemukan:
1. Temperatur rektal 40oC
2. Nadi cepat dan lemah/kecil
3. Tekanan darah sistolik <70 mmHg pada orang dewasa dan pada anak-anak <50
mmHg.
4. Frekuensi nafas > 35x per menit pada orang dewasa atau > 40x per menit pada
balita, anak di bawah 1 tahun > 50x per menit.
5. Penurunan derajat kesadaran dengan Glasgow coma scale (GCS) < 11
6. Manifestasi perdarahan (ptekie, purpura, hematom)
7. Tanda dehidrasi (mata cekung, turgor, dan elastisitas kulit berkurang, bibir
kering, produksi air seni berkurang).
8. Tanda-tanda anemia berat (konjungtiva pucat, telapak tangan pucat, lidah pucat
dan lain-lain)
9. Terlihat mata kuning/ikterik
10. Adanya ronki pada kedua paru
11. Pembesaran limpa dan atau hepar.
12. Gagal ginjal ditandai dengan oliguria sampai dengan anuria.
13. Gejala neurologi (kaku kuduk, reflek patologik)
c. Definisi
Malaria adalah suatu penyakit akut maupun kronik, yang disebabkan oleh
protozoa genus Plasmodium dengan manifestasi klinis berupa demam, anemia dan
pembesaran limpa. Sedangkan meurut ahli lain malaria merupakan suatu penyakit
infeksi akut maupun kronik yang disebakan oleh infeksi Plasmodium yang
menyerang eritrosit dan ditandai dengan ditemukannya bentuk aseksual dalam darah,
dengan gejala demam, menggigil, anemia, dan pembesaran limpa.

d. Epidemiologi

15

300 500 juta manusia di seluruh dunia terinfeksi malaria.

120 juta kasus klinis setiap tahun.

40% populasi dunia tinggal di wilayah dimana terjadi transmisi endemis, terutama
di Sub-sahara Afrika ( 92 negara ).

1,4 2,7 juta kematian setiap tahun, terutama anak < 5 tahun dan wanita hamil
(primigravida).

Kematian disebabkan malaria berat, gagal organ multipel, malaria serebral,


anemia kronik, Acute Respiratory Distress Syndrome (ARDS) dan malaria
plasental yang disebabkan Plasmodium falciparum.

e. Etiologi
16

Malaria disebabkan oleh protozoa dari genus Plasmodium. Pada manusia


Plasmodiumterdiridari4spesies,yaituPlasmodiumfalciparum,Plasmodiumvivax,
PlasmodiummalariaedanPlasmodiumovale.Plasmodiumfalciparfummerupakan
penyebab infeksi berat bahkan dapat menimbulkan kematian. Keempat spesies
Plasmodium yang terdapat di Indonesia yaitu Plasmodium falciparfum yang
menyebabkan malaria tropika, Plasmodium vivax yang menyebabkan malaria
tertiana,PlasmodiummalariaeyangmenyebabkanmalariakuartanadanPlasmodium
ovaleyangmenyebabkanmalariaovale.
SeorangdapatterinfeksilebihdarisatujenisPlasmodium,dikenalsebagaiinfeksi
campuranataumajemuk.PadaumumnyaduajenisPlasmodiumyangpalingbanyak
dijumpaiadalahcampuranantaraPlasmodiumfalciparumdanPlasmodiumvivaxatau
Plasmodium malariae. Kadangkadang dijumpai tiga jenis Plasmodium sekaligus,
meskipunhalinijarangsekaliterjadi.Infeksicampuranbiasanyaterdapatdidaerah
denganangkapenularantinggi.Akhirakhirinidibeberapadaerahdilaporkankasus
malaria yang telah resisten terhadap klorokuin, bahkan juga resisten terhadap
pirimetaminsulfadoksin.
Penyakit ini jarang ditemui pada bulanbulan pertama kehidupan, tetapi pada
anakanakyangberumurbeberapatahundapatterjadiseranganmalariatropikayang
berat,bahkantertianadankuartanadandapatmenyebabkankematianterutamapada
anakdengangangguangizi.
f. Factor risiko
Tinggal di daerah endemis malaria.
Berpergian menuju daerah endemi malaria.
a. Tanpa profilaksis
b. Tanpa perlindungan diri
i. Obat obatan (profilaksis)
ii. Berada di luar ruangan (terpapar nyamuk)
iii. Tidak menggunakan obat nyamuk
iv. Tidak menakan kelambu, kawat nyamuk
v. Keluar rumah pada senja, atau saat fajar (waktu aktif

nyamuk)
Wanita hamil (penekanan sistim imun selama kehamilan).
Anak kecil (sistem imun belum sebaik orang dewasa).
Orang tua
17

Imunosupressed, Orang dengan splenektomi

g. Patofisiologi dan pathogenesis


Patofisiologi malaria sangat kompleks dan mungkin berhubungan dengan hal-hal
sebagai berikut:
1. Penghancuran eritrosit yang terjadi oleh karena:
Pecahnya eritrosit yang mengandung parasit
Fagositosis eritrosit yang mengandung dan tidak mengandung parasit. Akibatnya
terjadi anemia dan anoksia jaringan dan hemolisis intravaskuler
2. Pelepasan mediator Endotoksi-makrofag. Pada proses skizoni yang melepaskan
endotkosin, makrofag melepaskan berbagai mediator endotoksin
3. Pelepasan TNF merupakan suatu monokin yang dilepas oleh adanya parasit malaria.
TNF ini bertanggung jawab terhadap demam, hipoglikemia, ARDS.
4. Sekuetrasi eritrosit. Eritrosit yang terinfeksi dapat membentuk

knob

dipermukaannya. Knob ini mengandung antigen malaria yang kemudian akan bereaksi
dengan antibody. Eritrosit yang terinfeksi akan menempel pada endotel kapiler alat
dalam dan membentuk gumpalan sehingga terjadi bendungan.

18

Masa inkubasi malaria:


Berhubungan dengan stadium hepar dari parasit malaria :

P. falciparum 12 hari

P. vivax

14 hari*

P. ovale

14 hari*

P. malariae

30 hari

*dapat 8 10 bulan atau lebih pada beberapa strain.


Patogenesis
Demam mulai timbul bersaam dengan pecahnya skizon darah yang mengeluarkan
bermacam-macam antigen. Antigen ini akan merangsang sel-sel makrofag, monosit
atau limfosit yang mengeluarkan berbagai macam sitokin, antara lain TNF (tumor
nekrosis factor). TNF akan dibawa aliran darah ke hipotalamus yang merupakan pusat
pengatur suhu tubuh yang terjadi demam. Proses skizogoni pada ke empat plasmodium
memerlkan waktu yang berbeda-beda, P. Falciparum memerlukan waktu 36 48 jam,
P. vivax/ovale 48 jam, dan P. malariae 72 jam. Demam pada P. falciparum dapat
19

terjadi setiap hari, P. vivax/ovale selang waktu satu hari, P. malariae demam timbul
selang waktu 2 hari.
Anemia terjadi karena pecahnya sel darah merah yang terinfeksi maupun yang tidak
terinfeksi. Plasmodium falciparum menginfeksi semua jenis sel darah merah, sehingga
anemia dapat terjadi pada infeksi akut dan kronis. Plasmodium vivax dan P. ovale
hanya menginfeksi sel darah merah muda yang jumlahnya hanya 2% dari seluruh
jumlah sel darah merah, sedangkan Plasmodium malariae menginfeksi sel darah
merah tua yang jumlahnya hanya 1% dari jumlah sel darah merah. Sehingga anemia
yang disebabkan oleh

P. vivax, P. ovale dan P. malariae umumnya terjadi pada

keadaan kronis.
Splenomegali
Limpa merupakan organ retiuloendothelial, dimana Plasmodium dihancurkan oleh selsel makrofag dan limfosit. Penambahan sel-sel radang ini akan menyebabkan limpa
membesar.
Malaria berat akibat Plasmodium falciparum mempunyai patogenesis yang khusus.
Eritrosit yang terinfeksi P. falciparum akan mengalami proses sekuestrasi yaitu
tersebarnya eritrosit yang berparasit tersebut ke pembuluh kapiler alat dalam tubuh.
Selain itu pada permukaan eritrosit yang terinfeksi akan membentuk knob yang berisi
berbagai antigen Plasmodium falciparum. Pada saat terjadi proses sitadherensi, knob
tersebut akan berikatan dengan reseptor sel endotel kapiler. Akibta dari proses ini
terjadilah obstruksi (penyumbatan) dalam pembuluh darah kapiler yang menyebabkan
terjadinya iskemia jaringan. Terjadinya sumbatan ini juga didukung oleh proses
terbentuknya rosette yaitu bergerombolnya sel darah merah yang berparasit dengan sel
darah merah lainnya.
Pada proses sitoadrensi ini diduga juga terjadi proses imunologik yaitu terbentuknya
mediator-mediator antara lain sitokin (TNF, interleukin), dimana mediator tersebut
mempunyai peranan dalam gangguan fungsi pada jaringan tertentu (Depkes, 2008).

20

h. Manifestasi klinik
Manifestasi umum malaria adalah sebagai berikut: (Nugroho, 2000)
1. Masa inkubasi
Masa inkubasi biasanya berlangsung 8-37 hari tergantung dari spesies parasit
(terpendek untuk P. falciparum dan terpanjanga untuk P. malariae), beratnya infeksi
dan pada pengobatan sebelumnya atau pada derajat resistensi hospes. Selain itu juga
cara infeksi yang mungkin disebabkan gigitan nyamuk atau secara induksi (misalnya
transfuse darah yang mengandung stadium aseksual).
2. Keluhan-keluhan prodromal
Keluhan-keluhan prodromal dapat terjadi sebelum terjadinya demam, berupa:
malaise, lesu, sakit kepala, sakit tulang belakang, nyeri pada tulang dan otot,
anoreksia, perut tidak enak, diare ringan dan kadang-kadang merasa dingin di
punggung. Keluhan prodromal sering terjadi pada P. vivax dan P. ovale, sedangkan P.
falciparum dan P. malariae keluhan prodromal tidak jelas.
3. Gejala-gejala umum
Gejala-gejala klasik umum yaitu terjadinya trias malaria (malaria proxym)secara
berurutan: (Sudoyo, 2007)
a.Periode dingin
Dimulai dengan menggigil, kulit dingin, dan kering, penderita sering membungkus
dirinya dengan selimut atau sarung pada saat menggigil, sering seluruh badan
gemetar, pucat sampai sianosis seperti orang kedinginan. Periode ini berlangsung
antara 15 menit sampai 1 jam diikuti dengan meningkatnya temperatur.
b. Periode panas
Wajah penderita terlihat merah, kulit panas dan kering, nadi cepat dan panas tubuh
tetap tinggi, dapat sampai 40oC atau lebih, penderita membuka selimutnya, respirasi
meningkat, nyeri kepala, nyeri retroorbital, muntah-muntah dan dapat terjadi syok.
Periode ini berlangsung lebih lama dari fase dingin dapat sampai 2 jam atau lebih,
diikuti dengan keadaan berkeringat.
c. Periode berkeringat
Penderita berkeringan mulai dari temporal, diikuti seluruh tubuh, penderita merasa
capek dan sering tertidur. Bila penderita bangun akan merasa sehat dan dapat
melakukan pekerjaan biasa.
i. Tatalaksana
Tatalaksana malaria vivax
Lini pertama:

21

Dihydroartemisin (DHA) + Piperakuin (DHP), diberikan peroral satu kali sehari


selama 3 hari ditambah Primakuin 0,25 mg/kgBB/hari. DHA + DHP tersedia dalam
sediaan tablet Fixed Dose Combination yang mengandung 40 mg dihydroartemisin
dan 320 mg piperakuin. Sediaan primakuin tablet 15 mg.
Lini kedua:
Kina + Primakuin 15mg.
Dosis kina 10mg/kgBB/kali, 3 kali sehari selama 7 hari. Dosis primakuin 0,25
mg/kgBB selama 14 hari. Sediaan kina tablet 200 mg, sediaan primakuin tablet 15
mg.
Pengobatan malaria vivax yang kambuh (relaps):
a. Diberikan regimen DHP yang sama tetapi dosis primakuin ditingkatkan
menjadi 0,5 mg/kgBB/hari
b. Dugaan relaps pada malaria vivax adalah apabila pemberian primakuin
selama 14 hari tetapi penderita sakit kembali dengan parasit positif dalam
kurun waktu 3 minggu - 3 bulan.
Pengobatan efektif apabila sampai dengan hari ke 28 setelah pemberian obat,
ditemukan keadaan sebagai berikut: klinis sembuh (sejak hari keempat) dan tidak
ditemukan parasit stadium aseksual sejak hari ketujuh. Pengobatan tidak efektif
apabila dalam 28 hari setelah pemberian obat:

Gejala klinis memburuk dan parasit aseksual positif, atau

Gejala klinis tidak memburuk tetapi parasit aseksual tidak berkurang


atau timbul kembali setelah hari ke-14.

Gejala klinis membaik tetapi parasit aseksual timbul kembali antara


hari ke-15 sampai hari ke-28 (kemungkinan resisten, relaps atau
infeksi baru).

j. KIE (promotif dan preventif)


Menghindarkan diri dari gigitan nyamuk dengan cara:
- Tidur dengan kelambu sebaiknya dengan kelambu impregnated (dicelup peptisida
pemethrin atau deltamethrin)
- Menggunakan obat pembunuh nyamuk: gosok, spray, asap, dan elektrik.

22

- Mencegah berada di alam bebas dimana nyamuk dapat menggigit atau harus
memakai proteksi (baju lengan panjang, kaus/stocking)
- Memproteksi tempat tinggal/kamar tidur dari nyamuk dengan kawat anti nyamuk
Kemoprofilaksis
- Sensitif klorokuin, beri klorokuin 2 tablet (250 mg klorokuin difosfat) per
minggu, 1 minggu sebelum berangkat dan empat minggu setelah tiba kembali.
- Resisten klorokuin, beri doksisiklin 100 mg/hari atau mefloquin 250 mg/minggu
atau klorokuin 2 tablet/minggu ditambah proquanil 200 mg/hari.
Vaksin malaria
Masih dalam penelitian.
k. Komplikasi
1. Malaria serebral
2. Anemia berat
3. GGA
4. Edema paru atau ARDS
5. Hipoglikemia
6. Syok
7. Perdarahan karena gangguan koagulasi intravasculer
8. Kejang berulang
9. Asidosis
l. Prognosis
Tergantung pada derajat beratnya malaria. Secara umum, prognosisnya dubia ad
bonam. Penyakit ini dapat terjadi lagi apabila daya tahan tubuh menurun.Prognosis
malaria yang disebabkan oleh P.vivax pada umumnya baik, tidak menyebabkan
kematian, walaupun apabila tidak diobati infeksi rata-rata dapat berlangsung 3 bulan
atau lebih lama oleh karena mempunyai sifat relaps. Sedangkan P.malariae dapat
berlangsung sangat lama dengan kecenderungan relaps, pernah dilaporkan sampai 30
50 tahun. Infeksi P.falciparum tanpa penyulit berlangsung sampai satu tahun.
Infeksi P.falciparum dengan penyulit prognosis menjadi buruk, apabila tidak
ditanggulangi secara cepat dan tepat bahkan dapat meninggal terutama pada gizi
buruk.

m. SKDI
Kompetensi dokter umum untuk kasus malaria adalah 4A. Kriteria pasien harus
dirujuk:
23

1. Malaria dengan komplikasi


2. Malaria berat, pasien harus terlebih dahulu diberikan dosis awal Artemisin atau
Artesunat IM atau IV dengan dosis awal 3,2 mg/kgBB.
3. Malaria pada kehamilan

V. Sintesis
1. Struktur dan fungsi organ yang terlibat
ANATOMIHEPAR

Organtubuhterbesardenganberatkuranglebih1,5kg

Terletakdibagiankananatasronggaabdomen

Pada aspek ventral/depan terbagi 2 lobus yang dipisahkan oleh ligamentum


falsiformishepar:
24

Lobuskanan

Lobuskiri

Padaaspekdorsal/belakangterbagiatas4lobus:

Lobuskanan

Lobuskiri

Lobuskaudata

Lobusquadrata

Dalamkeadaannormaltidakteraba

Padabagianbawahhatiterdapatkandungempedu

SistemVaskularisasi

Terdapat2pembuluhdarahbesaryangmasukhati:

Venaportatidakmengandungoksigen(dariusus,limpa,pankreas,lambung&
esofagus):

Tekanan>tinggiuntukmengatasitekanansinusoidhati

Oksigen>tinggialirandarahrelatif>banyak

Mengandung>banyakzatmakanan

Mengandungsisasisabakteridarisaluranpencernaan

ArterihepatikamembawaOksigendarijantung

*Volumetotaldarahmelaluihati:1,21,5l/menit*
25

Lobusdanlobulushati
Tiaplobushatidibagimenjadilobulus2
Lobulusmerupakanunitfungsionalhati
Didalamhatimanusiaterdapat50.000100.000lobuli
Tiap lobulus berbentuk heksagonal yang terdiri: lembaran sel hati berbentuk
kubusyangtersusunradialmengelilingivenasentralis
Diantaralembaranselhatiterdapatkapiler=sinusoidhatimerupakancabang
venaportadariarterihepatika
Sistemfagositik

Sinusoiddibatasiolehselfagositik/selKpffer

SelKppfersistemretikuloendotelialfungsiutamamenelanbakteridanbenda
asinglain

Hatipertahanantubuhterhadapseranganbakteridanbahantoksik

FISIOLOGIHEPAR
Hatimerupakanpusatdarimetabolismeseluruhtubuh,merupakansumberenergi
tubuhsebanyak20%sertamenggunakan2025%oksigendarah.Adabeberapafungsi
hatiyaitu:
a.
Metabolismekarbohidrat
Sesudahmakan,glukosadiambildaridarahvenaportalolehhatidandiubahmenjadi
glikogenyangdisimpandalamhepatosit.Selanjutnyaglikogendiubahkembalimenjadi
glukosa dan jika diperlukan, akan dilepaskan ke dalam aliran darah untuk
mempertahankankadarglukosayangnormal.Glukosatambahandapatdisintesisoleh
hati lewat proses glukoneogenesis. Untuk proses ini hati menggunakan asamasam
aminohasilpemecahanproteinataulaktatyangdiproduksiolehotot.
b.
Metabolismelemak
Asamasamlemakdapatdipecahuntukmemproduksienergidanbadanketon.Badan
ketonmerupakansenyawasenyawakecilyangdapatmasukkedalamalirandarahdan
menjadisumberenergibagiototsertajaringantubuhlainnya.Pemecahanasamlemak
26

menjadibahanketonterutamaterjadiketikaketersediaanglukosauntukmetabolisme
sangatterbatassepertipadakelaparanataudiabetesyangtidakterkontrol.
c.
Konversiamonia
Penggunaanasamasamaminountukglukoneogenesisakanmembentukamoniasebagai
hasilsampingan.Hatimengubahamoniadariprosesinimenjadiureum.Amoniayang
diproduksiolehbakteridalamintestinumjugaakandikeluarkandaridalamdarahportal
untuksintesisureum.Dengancarainihatimengubahamoniayangmerupakantoksin
berbahayamenjadiureumyaitusenyawayangdapatdiekskresikankedalamurin.
d.
Metabolismeprotein
Hati mensintesis hampir seluruh plasma protein termasuk albumin, faktorfaktor
pembekuandarahproteintransportyangspesifikdansebagianbesarlipoproteinplasma.
VitaminKdiperlukanhatiuntukmensintesisprotombindansebagianfaktorpembekuan
lainnya.Asamasamaminoberfungsisebagaiunsurpembangunbagisintesisprotein.
e.
Metabolismevitamin
SemuavitamindisimpandidalamhatikhususnyavitaminA,D,E,K
f.
Detoksifikasi
Hati adalah pusat detoksikasi tubuh, Proses detoksikasi terjadi pada proses oksidasi,
reduksi,metilasi,esterifikasidankonjugasiterhadapberbagaimacambahansepertizat
racun,obatoverdosis.
g.
Sebagaifagositosisdanimunitas
Sel kupfer merupakan saringan penting bakteri, pigmen dan berbagai bahan melalui
prosesfagositosis.Selainituselkupferjugaikutmemproduksiglobulinsebagaiimun
liversmechanism.
h.
Fungsihemodinamik
Hatimenerima25%daricardiacoutput,alirandarahhatiyangnormal1500cc/menit
atau10001800cc/menit.Darahyangmengalirdidalama.hepatica 25%dandi
dalamv.porta75%dariseluruhalirandarahkehati.Alirandarahkehepardipengaruhi
olehfaktormekanis,pengaruhpersarafandanhormonal,aliraniniberubahcepatpada
waktu exercise, terik matahari, shock.Hepar merupakan organ penting untuk
mempertahankanalirandarah.
i.
Pembentukanempedu
Empedu dibentuk oleh hepatosit dan dikumpulkan dalam kanalikulus serta saluran
empedu. Fungsi empedu adalah ekskretorik seperti ekskresi bilirubin dan sebagai
pembantuprosespencernaanmelaluiemulsifikasilemakolehgaramgaramempedu.
27

j.
Ekskresibilirubin
Bilirubin adalah pigmen yang berasal dari pemecahan hemoglobin oleh selsel pada
sistem retikuloendotelial yang mencakup selsel Kupfer dari hati. Hepatosit
mengeluarkanbilirubindaridalamdarahdanmelaluireaksikimiamengubahnyalewat
konjugasimenjadiasamglukoronatyangmenbuatbilirubinlebihdapatlarutdalamair.
Bilirubin terkonjugasi disekresikan oleh hepatosit ke dalam kanalikulus empedu
didekatnya dan akhirnya dibawa dalam empedu ke duodenum. Konsentrasi bilirubin
dalamdarahdapatmeningkatjikaterdapatpenyakithati,bilaaliranempeduterhalang,
atau bila terjadi penghancuran selsel darah merah yang berlebihan. Pada obstruksi
daluran empedu, bilirubin tidak memasuki intestinum dan sebagai akibatnya
urobilinogentidakterdapatdalamurin.
Menurut pendapat ahli lain, patogenesis malaria adalah multifaktorial dan
berhubungan dengan hal-hal sebagai berikut:
1.

Penghancuran eritrosit
Fagositosis tidak hanya pada eritrosit yang mengandung parasit tetapi juga terhadap
eritrosit yang tidak mengandung parasit sehingga menimbulkan anemia dan hipoksemia
jaringan. Pada hemolisis intravascular yang berat dapat terjadi hemoglobinuria (black
white fever) dan dapat menyebabkan gagal ginjal.

2.

Mediator endotoksin-makrofag
Pada saat skizogoni, eritrosit yang mengandung parasit memicu makrofag yang sensitive
endotoksin untuk melepaskan berbagai mediator. Endotoksin mungkin berasal dari
saluran cerna dan parasit malaria sendiri dapat melepaskan faktor nekrosis tumor (TNF)
yang merupakan suatu monokin, ditemukan dalam peredaran darah manusia dan hewan
yang terinfeksi parasit malaria. TNF dan sitokin dapat menimbulkan demam,
hipoglikemia, dan sndrom penyakit pernapasan pada orang dewasa.
3. Sekuestrasi eritrosit yang terluka
Eritrosit

yang

terinfeksi

oleh Plasmodium dapat

membentuk

tonjolan-tonjolan

(knobs) pada permukaannya. Tonjolan tersebut mengandung antigen dan bereaksi


28

dengan antibodi malaria dan berhubungan dengan afinitas eritrosit yang mengandung
parasit terhadap endothelium kapiler alat dalam, sehingga skizogoni berlangsung di
sirkulasi alat dalam. Eritrosit yang terinfeksi menempel pada endothelium dan
membentuk gumpalan yang mengandung kapiler yang bocor dan menimbulkan anoksia
dan edema jaringan.
Mengenai patogenesis malaria lebih ditekankan pada terjadinya peningkatan
permeabilitas pembuluh darah daripada koagulasi intravaskular. Oleh karena skizogoni
menyebabkan kerusakan eritrosit maka akan terjadi anemia. Beratnya anemia yang tidak
sebanding dengan parasitemia menunjukkan adanya kelainan eritrosit selain yang
mengandung parasit, pada percobaan binatang dibuktikan adanya gangguan transportasi
natrium sehingga keluar dari eritrosit yang mengandung parasit dan tanpa parasit
malaria. Diduga terdapat toksin malaria yang menyebabkan gangguan fungsi eritrosit
dan sebagian eritrosit pecah saat melalui limpa dan keluarlah parasit. Faktor lain yang
menyebabkan terjadinya anemia mungkin karena terbentuknya antibodi terhadap
eritrosit. Suatu bentuk khusus anemia hemolitik pada malaria adalah black water fever,
yaitu bentuk malaria berat yang disebabkan oleh Plasmodium falciparum, ditandai oleh
hemolosis intravaskular berat, hemoglobinuria, kegagalan ginjal akut akibat nekrosis
tubulus, disertai angka kematian yang tinggi. Telah lama dicurigai bahwa kini dapat
memprovokasi terjadinya black water fever. Sebagai tambahan, kasus meninggal yang
disebabkan malaria selalu menunjukkan adanya perubahan yang menonjol dari sistem
retikuloendotelial dan mungkin juga melibatkan berbagai sistem organ.
Pada infeksi malaria, limpa akan membesar, mengalami pembendungan dan
pigmentasi sehingga mudah pecah. Dalam limpa dijumpai banyak parasit dalam
makrofag dan sering terjadi fagisitosis dari eritrosit yang terinfeksi maupun yang tidak
terinfeksi. Pada malaria kronis terjadi hiperplasi dari retikulum disertai peningkatan
makrofag. Pada sindrom pembesaran limpa di daerah tropis atau penyakit pembesaran
limpa pada malaria kronis biasanya dijumpai bersama dengan peningkatan kadar IgM.
Peningkatan antibodi terhadap malaria ini mungkin menimbulkan respons imunologis
yang tidak lazim pada malaria kronis.
Pada malariajugaterjadi pembesaran hepar, sel Kupffer seperti sel dalam sistem
retikuloendotelial terlibat dalam respon fagositosis. Sebagai akibatnya hati menjadi
berwarna kecoklatan agak kelabu atau kehitaman. Pada malaria kronis terjadi infiltrasi
29

difus oleh sel mononukleus pada periportal yang meningkat sejalan dengan berulangnya
serangan malaria. Hepatomegali dengan infiltrasi sel mononukleus merupakan bagian
dari sindrom pembesaran hati di daerah tropis. Nekrosis sentrilobulus terjadi pada syok.
Organ lain yang sering diserang oleh malaria adalah otak dan ginjal. Pada malaria
serebral, otak berwarna kelabu akibat pigmen malaria, sering disertai edema dan
hiperemis. Perdarahan berbentuk petekie tersebar pada substansi putih otak dan dapat
menyebar sampai ke sumsum tulang belakang. Pada pemeriksaan mikroskopik, sebagian
besar dari pembuluh darah kecil dan menengah dapat terisi eritrosit yang telah
mengandung parasit dan dapat dijumpai bekuan fibrin, dan terdapat reaksi selular pada
ruang perivaskular yang luas. Terserangnya pembuluh darah oleh malaria tidak saja
terbatas pada otak tetapi juga dapat dijumpai pada jantung atau saluran cerna atau di
tempat lain dari tubuh, yang berakibat pada berbagai manifestasi klinik.
Pada ginjal selain terjadi pewarnaan oleh pigmen malaria juga dijumpai salah satu
atau dua proses patologis yaitu nekrosis tubulus akut dan atau membranoproliverative
glomerulonephritis. Nekrosis tubulus akut dapat terjadi bersama dengan hemolisis masif
dan hemoglobinuria pada black water fever tetapi dapat juga tanpa hemolisis, akibat
berkurangnya aliran darah karena hipovolemia dan hiperviskositas darah Plasmodium
falciparum menyebabkan nefritis sedangkan Plasmodium malariae menyebabkan
glomerulonefritis kronik dan sindrom nefrotik.
Imunologi
Imunitas yang terjadi pada infeksi malaria sangat perlahan. Respon Th1 dan Th2 berperan
dalam mengontrol penyakit. Antibodi berperan dalam imunits terhadap sporozoit yang
disuntikkan ke nyamuk yang dapat mencegah infeksi hepatosit. Sel CD8 + dapat
menghancurkan parasit yang sudah ada dalam sel hepatosit. Produksi IFN- oleh sel
CD8+ lebih berperan untuk mengontrol replikasi parasit dibanding aktivasi lisis direk.
Diduga bahwa sel Th1 CD4+ yang memproduksi IFN- juga berperan dalam mengontrol
fase ekstraeritrosit ini.
Pada fase ekstraeritrosit gejala timbul diakibatkan sel Th1 memproduksi sitokin
proinflamsi yang memicu aktivasi makrofag dan destruksi sel darah merah yang
terinfeksi. Lalu, sel Th2 memicu produksi antibodi spesifik yang mampu menghambat
reinvasi sel darah lebih banyak. Antibodi ini berperan dalam destruksi eritrosit terinfeksi
30

melalui aktivasi komplemen dan memicu makrofag untuk memakannya melalui Fc-R
(Baratawidjaja, 2012).

2. Demam
Definisi
Suhu pasien biasanya diukur dengan termometer air raksa dant empat
pengambilannya dapat di aksila, oral atau rektum. Suhu tubuh normal berkisar antara
36,5oC 37,2oC. Suhu abnormal dibawah 36oC. Dengan demam pada umumnya
diartikan suhu tubuh di atas 37,2oC. Hiperpireksia adalah suatu keadaan kenaikan suhu
tubuh sampai setinggi 41,2oC atau lebih, sedangkan hipotermia adalah keadaan suhu
tubuh di bawah 35oC. Biasanya terdapat perbedaan antara pengukuran suhu di aksila dan
oral maupun rektal. Dalam keadaan biasa perbedaan ini berkisar sekitar 0,5oC; suhu
rektal lebih tinggi daripada suhu oral.
Mekanisme
Demam terjadi karena pelepasan pirogen dari dalam leukosit yang sebelumnya
telah terangsang oleh pirogen eksogen yang dapat berasal dari mikroorganisme atau
merupakan suatu hasil reaksi imunlogik yang tidak berdasarkan suatu infeksi. Dewasa
ini diduga bahwa pirogen adalah suatu protein yang indentik dengan interleukin-1. Di
dalam hipotalamus zat ini merangsang pelepasan asam arakidonat serta mengakibatkan
peningkatan sintesis prostaglandin E2 yang langsung dapat menyebabkan suatu pireksia.

31

Pengaruh pengaturan autonom akan mengakibatkan terjadinya vasokonstriksi


perifer sehingga pengeluaran (dissipation) panas menurun dan pasien merasa demam.
Suhu badan dapat bertambah tinggi lagi karena meningkatnya aktivitas metabolisme
yang juga mengakibatkan penambahan produksi panas dan karena kurang adekuat
penyalurannya ke permukaan maka rasa demam bertambah pada seorang pasien.

32

Etiologi Demam
1. Infeksi: bakterial, viral, jamur, parasit, riketsia
2. Penyakit autoimun: SLE, poliartritis nodosa, demam rematik, polimyalgia
rheumatika,

giant

cell

granulamatosis,vaskulitis,

arthritis,
relapsing

adult

stills

polychondritis,

disease,

wegeners

dermatomyositis,

adult

rheumatoid arthritis.
3. Penyakit sistem saraf pusat: perdarahan serebral, trauma kepala, tumor otak dan
spinal, penyakit degeneratif sistem saraf pusat (misal: sklerosis multipel), trauma
medulla spinalis.
4. Penyakit neoplasma ganas: neoplasma primer (misal: kolon dan rectum, hepar,
ginjal, neuroblastoma), tumor metastase dari hepar.
5. Penyakit darah: Limfoma, leukemia, anemia hemolitik.
6. Penyakit kardiovaskuler: infark miokard, tromboflebitis, emboli paru.

33

7. Penyakit gastrointestinal: penyakit bowel, abses hepar, hepatitis alkoholik, hepatitis


granulomatosa.
8. Penyakit endokrin: Hipertiroid atau feokromositoma.
9. Penyakit karena agen kimia: reaksi obat (termasuk serum sickness), sindroma
neuroleptik maligna, hipertermi maligna pada anestesi, sindroma serotonergik.
10. Penyakit miscelaneous: sarkoidosis, demam mediterania, trauma jaringan lunak dan
hematoma.
Tipe Demam
Beberapa tipe demam yang mungkin kita jumpai, antara lain:
1. Demam septik
Pada tipe demam septik, suhu badan berangsur naik ke tingkat yang tinggi sekali
pada malam hari dan turun kembali ke tingkat diatas normal pada pagi hari. Sering
disertai keluhan menggigil dan berkeringat. Bila demam yang tinggi tersebut turun
ke tingkat yang normal dinamakan juga demam hektik.
2. Demam remiten
Pada tipe demam remiten, suhu badan dapat turun setiap hari tetapi tidak pernah
mencapai suhu badan normal. Perbedaan suhu yang mungkin tercatat dapat
mencapai dua derajat dan tidak sebesar perbedaan suhu yang dicatat pada demam
septik.
3. Demam intermiten
Pada tipe demam intermiten, suhu badan turun ke tingkat yang normal selama
beberapa jam dalam satu hari. Bila demam seperti ini terjadi setiap dua hari sekali
disebut tersiana dan bila terjadi dua hari bebas demam diantara dua serangan
demam disebut kuartana.
4. Demam kontinyu
Pada tipe demam kontinyu variasi suhu sepanjang hari tidak berbeda lebih dari satu
drajat. Pada tingkat demam yang terus menerus tinggi sekali disebut hiperpireksia.
5. Demam siklik
Pada tipe demam siklik terjadi kenaikan suhu badan selama beberapa hari yang
diikuti oleh periode bebas demam untuk beberapa hari yang kemudian diikuti oleh
kenaikan suhu seperti semula.
34

Patofisiologi Demam
Interaksi Pejamu-Mikroba
-

Pirogen eksogen dari mikroorganisme menstimulasi pengeluaran pirogen endogen

(sitokin).
Pirogen sitokin secara langsung merangsang respon demam yaitu IL-1, TNF, &

IL-6.
Sitokin-sitokin tidak dapat menembus sawar otak untuk dapat memodulasi
hipotalamus. Sehingga sel-sel endoteliat otak yang berperan sebagai sinyal
transduser untuk menghubungkan ke neuron otak.

Diagnosis Demam
35

Anamnesis
1. Kronologis gejala
2. Penggunaan obat sebelumnya
3. Riwayat pekerjaan (kontak dengan hewan, asap beracun, organisme yang infeksius,
kontak dengan penderita lain yang mengalami panas, di rumah, di tempat kerja, atau
di sekolah)
4. Riwayat perjalanan
5. Riwayat konsumsi makanan
6. Riwayat keluarga
7. Keadaan lingkungan dan geografis
8. Riwayat penyakit sebelumnya
Pemeriksaan Fisik
1. Pemeriksaan harus teliti, diulangi secara reguler.
2. Suhu tubuh harus diukur pada lokasi spesifik yang digunakan secara konsisten.
3. Pemeriksaan harus diperhatikan pula pada kulit, kelenjar limfe, mata, dasar kuku,
sistem kardiovaskuler, dada, abdomen, sistem muskuloskletal dan sistem saraf.
4. Suhu pasien biasanya diukur dengan thermometer air raksa dan tempat
pengambilannya dapat di aksila, oral atau rektal.
5. Terdapat perbedaan antara pengukuran suhu di aksila, oral dan rektal.
6. Dalam keadaan biasa perbedaan ini berkisar antara 0,4C - 0,5C, suhu rektal lebih
tinggi daripada suhu oral.
Pemeriksaan Penunjang
1. Patologi klinik : Hitung darah lengkap, dll.
2. Kimia darah
: Profil elektrolit, gula darah, kreatinin, SGOT-SGPT dan
lain-lain.
3. Mikrobiologi : Isolasi kuman penyebab infeksi merupakan
kriteria

36

diagnosis utama pada pasien yang

tersangka

demam

karena

menderita infeksi.
4. Radiologi

: Merupakan pemeriksaan penunjang medis sangat vital dalam


membantu diagnosis kelainan paru, ginjal, tulang.

Tatalaksana Demam
Non Farmakologis berupa metode fisik untuk memfasilitasi pelepasan panas yang lebih
besar dari tubuh.
1.

Kompres air hangat.

2.

Jangan membungkus orang yang menderita demam.

3.

Singkirkan baju atau selimut yang tebal.

4.

Lingkungan sebaiknya sejuk dan nyaman.

5.

Minum cairan lebih banyak dapat menurunkan demam.

Farmakologis :
1. OAINS Obat penghambat siklooksigenase (cyclooxygenation inhibition/COX)
antipiretik.
2. Antipiretik lain Asetaminofen (Parasetamol, antipiretik yang paling aman).
3. Glukokortikoid Preparat ini menghambat sintesis PGE 2 dengan menghambat
enzim fosfolipase A2 dan memblok baik transkripsi mRNA untuk IL-1 serta TNF
dan translasi sitokin efek imunosupresif dan antifagositik yang poten

37

3. Malaria Karateristik Plasmodium


PLASMODIUM

38

Siklus hidup Plasmodium terjadi pada tubuh nyamuk dan manusia.Siklus seksual
parasit malaria berkembang di darah manusia yang telah terinfeksi. Nyamuk Anopheles sp.
betina akan terinfeksi setelah menggigit orang yang darahnya mengandung gametosit. Siklus
perkembangan Plasmodium dalam nyamuk berkisar 7-20 hari, dan akhirnya berkembang
menjadi sporozoit yang bersifat infektif. Sporozoit ini yang akan bermigrasi ke kelenjar
ludah nyamuk dan kemudian akan ditransmisi kepada manusia lainnya apabila digigit oleh
nyamuk yang terinfeksi ini. Nyamuk Anopheles yang terinfeksi ini akan bersifat infektif
sepanjang hidupnya.
Sporozoit yang telah diinokulasi pada manusia akan bermigrasi kepada hati dan
bermultiplikasi dalam hepatosit sebagai merozoit. Setelah beberapa hari, hepatosit yang
terinfeksi akan ruptur dan melepaskan merozoit ke dalam darah di mana mereka akan
menginfeksi eritrosit. Parasit akan multiplikasi dalam eritrosit sekali lagi dan berubah dari
merozoit menjadi trofozoit, skizont, dan akhirnya muncul sebagai 8-24 merozoit yang baru.
Eritrosit akan pecah, dan melepaskan merozoit untuk menginfeksi sel-sel yang lain. Setiap

39

siklus dari proses ini, yang dikenali sebagai skizogoni eritrositik, akan berlangsung selama 48
jam pada Plasmodium vivax, Plasmodium ovale, Plasmodium falciparum dan 72 jam pada
Plasmodium malariae. Dengan setiap siklus ini, parasit akan bertambah secara logaritmik
dan setiap kali sel-sel ruptur akan terjadi serangan klasik demam yang intermiten.
Morfologi dan Identifikasi
Morfologi Plasmodium berbeda-beda tiap spesies.Sitoplasmanya mempunyai bentuk
yang tak teratur pada berbagai stadium pertumbuhan dan mengandung kromatin, pigmen
serta granula.Pigmen malaria terdiri dari protein yang telah didenaturasi, yaitu hemozoin atau
hematin yang merupakan hasil metabolisme antara parasit dengan bahan-bahan dari eritrosit.
1. Plasmodium vivax

Eritrosit yang terinfeksi oleh parasit ini mengalami pembesaran dan pucat karena
kekurangan hemoglobin.

Terdapat bintik-bintik merah yang disebut titik Schuffner pada eritrosit yang
terinfeksi parasit ini.

Tropozoit muda tampak sebagai cincin dengan inti pada satu sisi.

40

Tropozoit tua tampak sebagai cincin ameboid akibat penebalan sitoplasma yang tidak
merata.

Dalam waktu 36 jam parasit akan mengisi lebih dari setengah sel eritrosit yang
membesar.

Proses selanjutnya inti sel parasit akan mengalami pembelahan dan menjadi bentuk
schizont yang berisi merozoit berjumlah antara 12 sampai 24 buah.

Gametosit mengisi hampir seluruh eritrosit. Mikrogametosit berinti besar dalam


pewarnaan Giemsa akan berwarna merah muda sedangkan sitoplasma berwarna biru.
Makrogametosit berinti padat berwarna merah letaknya biasanya di pinggir.

2.

Plasmodium falciparum

Eritrosit yang terinfeksi tidak mengalami pembesaran.

Bentuk acolle (inti menempel dinding eritrosit) dan spliting (inti parasit terpecah
dua).

41

Bisa terjadi multiple infeksi dalam eritrosit (ada lebih dari satu parasit dalam
eritrosit)

Schizont berisi merozoit berjumlah 8-24 buah.

Pigmen berwarna hitam

Makrogametosit berbentuk pisang dengan plasma yang biru, inti padat dan kecil,
serta pigmen di sekitar inti.

Mikrogametosit berbentuk sosis dengan plasma berwarna merah muda, inti tidak
padat dan pigmen tersebar.

3.

Plasmodium ovale

Morfologinya sama seperti Plasmodium vivax namun pada stadium tropozoid,


bentuknya oval, ujungnya bergerigi dan ditemukan titik James.
4. Plasmodium malariae

42

Morfologi Plasmodium malariae, pada eritrosit yang diinfeksinya tidak


mengalami pembesaran dan ditemukan titik Ziemann.Pada stadium tropozoidnya terdapat
pigmen berwarna kuning tengguli tua dan kasar.Sedangkan pada stadium skizon nya
memiliki inti 8 sampai 12 buah berbentuk seperti bunga serunai dan pigmen berkumpul di
tengah.

Malaria
Penyakit malaria adalah penyakit menular yang dapat ditularkan oleh nyamuk
bernama Anopheles. Nyamuk inimembawa parasit plasmodium dan menggigit orang
sekaligus menyebarkannya melalui peredaran darah. Malaria merupakan penyakit
berbahaya yang dapat menyebabkan kematian. Dari pernyataan yang saya kutip dari
Wikipedia, berdsarkan data di dunia, penyakit malaria membunuh anak setiap 30 detik.
Sekitar 300-500 juta orang terinfeksi dan sekitar 1 juta orang meninggal karena penyakit
ini setiap tahunnya. 90% kematian terjadi di Afrika, terutama pada anak-anak.

Nyamuk yang menyebarkan parasit ini yaitu nyamuk betina yang sebelumnya
sudah terinfeksi oleh plasmodium. Selain melalui nyamuk, penyakit malaria juga dapat
43

menyebar melalui beberapa hal seperti transfusi darah, transplantasi organ, jarum suntuk
yang sudah terkontaminasi. Ibu hamil juga dapat menularkan penyakit ini kepada
bayinya.
Penyebab Penyakit Malaria
Penyakit malaria disebabkan oleh parasit yang merupakan golongan plasmodium.
Media utama yang menjadi penyebar penyakit ini yaitu nyamuk Anopheles betina.
Nyamuk ini terinfeksi oleh parasit plasmodium dari gigitan yang dilakukan terhadap
seseorang yang sudah terinfeksi parasit tersebut. Nyamuk tersebut akan terinfeksi selama
satu mingguan hingga waktu makan selajutnya. Pada saat makan, maka nyamuk ini
menggigit orang lain sekaligus menyuntikkan parasit plasmodium ke dalam darah orang
tersebut sehingga orang tersebut akan terinsfeksi malaria.
Ada 4 jenis plasmodium yang dapat menginfeksi manusia, diantaranya yaitu:
1.
2.
3.
4.

Plasmodium ovale
Plasmodium malariae
Plasmodium falciparum
Plasmodium vivax
Dari kasus-kasus tentang penyakit malaria di seluruh dunia, disimpulkan bahwa

jenis plasmodium vivax yang paling sering ditemukan pada pasien yang terserang
penyakit ini. Selain itu plasmodium falciparum merupakan penyumbang kematian paling
besar pada penyakit malaria yang menyerang manusia di dunia yaitu sekitar 90%.
Penularan Malaria
Malaria ditularkan ke penderita dengan masuknya sporozoit plasmodium melalui
gigitan nyamuk betina Anopheles yang spesiesnya dapat berbeda dari satu daerah dengan
daerah lainnya.Terdapat lebih dari 15 spesies nyamuk Anopheles yang dilaporkan
merupakan vektor malaria di Indonesia.Penularan malaria dapat juga terjadi dengan
masuknya parasit bentuk aseksual (tropozoit) melalui transfusi darah, suntikan atau
melalui plasenta (malaria congenital).
Dikenal adanya berbagai cara penularan malaria:

44

1. Penularan secara alamiah (natural infection) 10 Penularan ini terjadi melalui gigitan
nyamuk anopheles betina yang infektif. Nyamuk menggigit orang sakit malaria maka
parasit akan ikut terhisap bersama darah penderita malaria. Di dalam tubuh nyamuk
parasit akan berkembang dan bertambah banyak, kemudian nyamuk menggigit orang
sehat, maka melalui gigitan tersebut parasit ditularkan ke orang lain.
2. Penularan yang tidak alamiah
a. Malaria bawaan (congenital).
Terjadi pada bayi yang baru dilahirkan karena ibunya

menderita

malaria.Disebabkan adanya kelainan pada sawar plasenta sehingga tidak ada


penghalang infeksi dari ibu kepada bayi yang dikandungnya.
b. Secara mekanik.
Penularan terjadi melalui transfusi darah atau melalui jarum suntik.Penularan
melalui jarum suntik banyak terjadi pada para pecandu obat bius yang
menggunakan jarum suntik yang tidak steril.
c. Secara oral (melalui mulut).
Cara penularan ini pernah dibuktikan pada burung, ayam (P.gallinasium) burung
dara (P.Relection) dan monyet (P.Knowlesi). Pada umumnya sumber infeksi
bagi malaria pada manusia adalah manusia lain yang sakit malaria baik dengan
gejala maupun tanpa gejala klinis. Kecuali bagi simpanse di Afrika yang dapat
terinfeksi oleh penyakit malaria, belum diketahui ada hewan lain yang dapat
menjadi sumber bagi plasmodium yang biasanya menyerang manusia. Malaria,
baik yang disebabkan oleh P. falciparum, P. vivax, P. malariae dan P. ovale
semuanya ditularkan oleh nyamuk anopheles.Nyamuk yang menjadi vektor
penular malaria adalah Anopheles sundaicus, Anopheles aconitus, Anopheles
barbirostris, Anopheles subpictus, dan sebagainya. Vektor malaria yang
dominan terhadap penularan malaria di Indonesia adalah sebagai berikut:
Wilayah Indonesia Timur, yaitu Papua, Maluku, dan Maluku Utara, di
wilayah pantai adalah An. subpictus, An. farauti, An. koliensis dan An.
punctulatus sedangkan di wilayah pegunungan adalah An. farauti.
Wilayah Indonesia Tengah, yaitu Pulau Sulawesi, Pulau Kalimantan, NTT
dan NTB, vektor yang berperan di daerah pantainya adalah An. subpictus, An.
barbirostris. Khusus di NTB adalah An.subpictus dan An.sundaicus. Sedangkan
di wilayah pegunungan adalah An. barbirostris, An. flavirostris, An

45

letifer.Khusus wilayah Kalimantan, selain Anopheles tersebut di atas juga


An.balabacencis.
Untuk daerah pantai di wilayah Sumatera, An. sundaicus; daerah
pegunungan An. leucosphyrus, An. balabacencis, An. sinensis, dan An.
maculatus.iv. Wilayah Pulau Jawa. Vektor yang berperan di daerah pantai adalah
An. sundaicus dan An. subpictus dan di pegunungan adalah An. maculatus, An.
balabacencis dan An. Aconitus.

Gejala Penyakit Malaria


Gejala malaria dapat dibagi menjadi 2 bagian ditinjau dari berat-ringannya.
Gejalanya yaitu sebagai berikut.
A. Gejala Penyakit Malaria Ringan (Malaria tanpa Komplikasi)
Pada penderita penyakit malaria, umumnya mengalami demam dan menggigil,
sakit kepala, mual-mual, muntah, diare, terasa nyeri pada otot, pegal-pegal. Pada gejala
malaria ringan, dapat dibagi menjadi 3 stadium yaitu sebagai berikut.
1. Stadium dingin
Pada stadium dingin penderita merasakan dingin dan menggigil yang luarbiasa, denyut
nadi terasa semakin cepat namun lemah, bibir dan jari terlihat kebiruan, kulit kering,
muntah-muntah yang terjadi kurang lebih 15 menit hingga 1 jam.
2. Stadium demam
Pada stadium ini penderita merasakan panas, muka merah, kulit kering, muntah dan kepala
rasanya sangat sakit. Suhu tubuh biasanya mencapai 40 derajat celcius atau lebih. Kadang
penderita mengalami kejang-kejang. Gejala ini berlangsung biasanya 2 hingga 4 jam lebih.
3. Stadium berkeringat
Stadium berkeringat yaitu pengidap penyakit malaria ini selalu berkeringat, suhu tubuh
dibawah rata-rata sehingga menyebabkan suhu tubuh menjadi dingin. Karena sering
berkeringat, biasanya sering merasakan haus dan kondisi tubuh sangat lemah.
46

Gejala Penyakit Malaria Berat (Malaria dengan Komplikasi)


Penderita yang masuk dalam criteria ini biasanya sangat lemah sekali. Malaria berat
dapat diketahui dengan melakukan pemeriksaan laboratorium sendian darah tepi dan
penderita juga memiliki komplikasi sebagai berikut ini.
Tidak sadarkan diri kadang hingga koma
Sering mengigau
Bicara yang salah-salah (tidak terkontrol)
Kejang-kejang
Suhu tubuh sangat tinggi
Dehidrasi
Nafas cepat, sesak nafas

Cara Mencegah Penyakit Malaria


Penyakit malaria ini disebarkan oleh nyamuk sehingga kita harus menjaga
kebersihan diri maupun lingkungan sekita sehingga tidak ada nyamuk yang berkembang
biak. Bila anda sedang mengujungi tempat-tempat yang terkenal sebagai timbulnya
penyakit malaria, minumlah obat Klorokuin yang berfungsi untuk mencegah masuknya
parasit plasmodium falciparum ke dalam tubuh.

47

VI.

Kerangka Konsep

Riwayat bepergian
ke Bangka

Terinfeksi Plasmodium Vivax

Demam,
Menggigil,
Keringat dingin

Sakit
kepala

Mual

Rasa
penuh di
perut

Menginfeksi
eritrosit

Anemia

Penghancuran
eritrosit

Kerja RES

Hepatomegali

Splenomegali

48

VII. Kesimpulan
Ny. Lola 40, tahun menderita penyakit malaria tanpa komplikasi et causa infeksi
Plasmodium vivax

49

Daftar Pustaka
Anonim.

2011.

BAB

II

Tinjauan

Pustaka.

Diakses

pada

19

Augstus

2015.http://repository.usu.ac.id/bitstream/123456789/20157/4/Chapter%20II.pdf
Anonim. 2011. Malaria. Diakses pada 19 Agustus 2015. http://www.itokindo.org/?wpfb_dl=99
Dalal, S., and Zhukovsky D.S., 2006. Pathophysiology and Management of Fever.J
Support

Oncol.,

2006

(4),

916.

www.supportiveoncology.net/journal/articles/0401009.pdf. Diakses 19 Agustus 2015.


Davis, C.P., 2011. Fever in Adults. University of Texas Health Science Center at San
Antonio.http://www.emedicinehealth.com/script/main/art.asp?articlekey=58831.
Diakses 19 Agustus 2015.
Departemen Kesehatan RI. 2008. Pedoman Penatalaksanaan Kasus Malaria di Indonesia.
Jakarta: Bakti Husada.
Dinarello, C.A., and Gelfand, J.A., 2005. Fever and Hyperthermia. In: Kasper, D.L., et. al., ed.
Harrisons Principles of Internal Medicine. 16th ed. Singapore: The McGraw-Hill
Company, 104-108.
Graneto, J.W., 2010. Pediatric Fever. Chicago College of Osteopathic Medicine of Midwestern
University.

http://emedicine.medscape.com/article/801598-overview.

Diakses

19

Agustus 2015.
Gunawan S. Epidemiologi Malaria. Dalam: Harijanto PN (editor). Malaria, Epidemiologi,
Patogenesis, Manifestasi Klinis dan Penanganan. Jakarta: EGC, 2000; Hal: 1-15
Harijanto, P.N. 2009. Malaria. Dalam: Sudoyono, dkk (Editor) Buku Ajar Ilmu Penyakit Dalam
(halaman 2813-2825).InternaPublising, Jakarta Pusat, Indonesia.

50

Jenson, H.B., and Baltimore, R.S., 2007. Infectious Disease: Fever without a focus. In:
Kliegman, R.M., Marcdante, K.J., Jenson, H.B., and Behrman, R.E., ed. Nelson
Essentials of Pediatrics. 5th ed. New York: Elsevier, 459-461.
Kaneshiro, N.K., and Zieve, D. 2010. Fever. University of Washington. Available
http://www.nlm.nih.gov/medlineplus/ency/article/000980.htm. Diakses 19 Agustus
2015.
Nelwan, R.H., 2009. Demam: Tipe dan Pendekatan. Dalam: Sudoyo, A.W., Setiyohadi, B., Alwi,
I., Simadibrata, M., dan Setiati, S., ed. Buku Ajar Ilmu Penyakit Dalam Jilid III. Edisi
5. Jakarta: Interna Publishing, 2767-2768.
Novita, L. 2009. Diagnosis dan Penatalaksanaan Malaria. Laporan pada Jurusan Pendidikan
Dokter Universitas Riau yang tidak dipublikasikan.
Sherwood, L., 2001. Fisiologi Manusia: Dari Sel ke Sistem. Edisi 2. Jakarta: EGCKaushik, A.,
Pineda, C., and Kest, H., 2010. Diagnosis and Management of Dengue Fever in
Children.

Pediatr.

Rev.,

31

(1),

28-35.

http://pedsinreview.aappublications.org/cgi/reprint/31/4/e28.pdf. Diakses 19 Agustus


2015.
Susanto, I. Pribadi, W.2008.Parasit Malaria. Dalam Susanto, I. dkk (Editor) Buku Ajar
Parasitologi Kedokteran (halaman 189-241). Balai Penerbit FKUI, Jakarta, Indonesia.
Wibisono, Elita; Aditya Susilo; Leonard Nanggolan. Malaria. Dalam Tanto, Chris., dkk. 2014.
Kapita Selekta Kedokteran Edisi IV. Jakarta: Media Aesculapius.

51