Anda di halaman 1dari 24

LAPORAN PENDAHULUAN

ABORTUS IMMINEN

OLEH:
1.
2.
3.
4.

DEBY ILLAHI
RITA CAHYANTI
LUTFI NUR ICHWAN
FITRI SRI LESTARI

11O1300013
1101300017
1101300027
1101300029

TINGKAT II A
PRODI DIII KEPERAWATAN BLITAR
POLITEKNIK KESEHATAN KEMENKES MALANG
2012

ABORTUS IMMINEN

1. KONSEP DASAR
A. Pengertian
Abortus imminen adalah perdarahan bercak yang menunjukkan ancaman terhadap
kelangsungan suatu kehamilan. Dalam kondisi seperti ini kehamilan masih mungkin
berlanjut atau dipertahankan. (Syaifudin. Bari Abdul, 2000)
Abortus imminen adalah perdarahan pervaginam pada kehamilan kurang dari 20
minggu, tanpa tanda-tanda dilatasi serviks yang meningkat. (Mansjoer, Arif M, 1999)
Abortus imminen adalah pengeluaran secret pervaginan yang tampak pada paruh
pertama kehamilan. (William Obstetri, 1990)
Perdarahan pervaginan pada kehamilan kurang dari 20 minggu tanpa adanya
tanda tanda dilatasi serviks yang mengikat. (Kapita Selekta Kedokteran, 2002:263)
Terjadi pendarahan bercak yang menunjukkan ancaman terhadap kelangsungan
suatu kehamilan. Dalam kondisi seperti ini, kehamilan masih mungkin berlanjut atau
diperhatikan. (Pelayanan Kesehatan Material dan Neonatal, 2002:147)
B. Patofisiologi
Pada awal abortus terjadi perdarahan dalam desidua basalis kemudian diikuti
dengan adanya nekrosis jaringan yang menyebabkan hasil konsepsi terlepas dan
dianggap sebagai benda asing di dalam uterus, kemudian uterus berkontraksi untuk
mengeluarkan benda asing tersebut. Pada kehamilan 8 minggu hasil konsepsi biasanya
dikeluarkan seluruhnya karena villi korialis belum menembus desidua secara
mendalam. Pada kehamilan 8-14 minggu villikorialis menembus desidua secara
mendalam, sehingga umumnya placenta tidak dapat dikeluarkan dengan sempurna dan
perdarahan lebih banyak. Pada kehamilan lebih dari 14 minggu biasanya abortus
didahului dengan ketuban pecah, diikuti dengan keluarnya hasil konsepsi, kemudian
disusul dengan placenta.

C. Tanda dan Gejala


Tanda dan gejala pada abortus Imminen :

1. Terdapat perdarahan, disertai sakit perut atau mules


2. Pada pemeriksaan dijumpai besarnya rahim sama dengan umur kehamilan dan
terjadi kontraksi otot rahim
3. Hasil periksa dalam terdapat perdarahan dari kanalis servikalis, dan kanalis
servikalis masih tertutup, dapat dirasakan kontraksi otot rahim
4. Hasil pemeriksaan tes kehamilan masih positif
D. Diagnostik
Diagnosis abortus imminens ditegakan antara lain

Tanda-tanda hamil muda,


Perdarahan melalui OUI,
Uterus membesar sesuai usia kehamilan,
Serviks belum membuka, sehingga untuk menegakan diagnosis abortus imminens
kita perlu memperhatikan riwayat menstruasi, riwayat penggunaan obat-obatan
dan zat, riwayat penyakit dahulu, riwayat operasi terutama pada uterus dan

adneksa, riwayat obstetrik dan ginekologis dahulu.


Pemeriksaan dengan USG terlihat kantong kehamilan utuh berisifetus/embrio
dengan tanda-tanda kehidupan yaitu kegiatan jantung dan gerakan janin.Bisa
terlihat bagian-bagian yang anekoik oleh perdarahan pada desidua.

E. Penatalaksanaan
1. Istirahat baring agar aliran darah ke uterus bertambah dan rangsang mekanik
berkurang.
2. Periksa denyut nadi dan suhu badan dua kali sehari bila pasien tidak panas dan tiap
empat jam bila pasien panas.
3. Tes kehamilan dapat dilakukan. Bila hasil negatif mungkin janin sudah mati.
Pemeriksaan USG untuk menentukan apakah janin masih hidup.
4. Berikan obat penenang, biasanya fenobarbiotal 3 x 30 mg, Berikan preparat
hematinik misalnya sulfas ferosus 600 1.000 mg.
5. Diet tinggi protein dan tambahan vitamin C.
6. Bersihkan vulva minimal dua kali sehari dengan cairan antiseptik untuk mencegah
infeksi terutama saat masih mengeluarkan cairan coklat.
2. KONSEP ASUHAN KEPERAWATAN
A. Pengkajian

Pengkajian

adalah

pendekatan

sistematis

untuk

mengumpulkan

data

dan

menganalisanya sehingga dapat diketahui masalah dan kebutuhan perawatan bagi


klien.

Adapunhal-hal yang perludikajiadalah :

Biodata : mengkajiidentitaskliendanpenanggung yang meliputi ; nama,


umur, agama, sukubangsa, pendidikan, pekerjaan, status perkawinan,
perkawinanke- , lamanyaperkawinandanalamat

Keluhanutama

Kajiadanyamenstruasitidaklancardanadanyaperdarahanpervaginamber
ulang

Riwayatkesehatan , yang terdiriatas :

1)RiwayatkesehatansekarangyaitukeluhansampaisaatklienpergikeRumahSakita
taupadasaatpengkajiansepertiperdarahanpervaginam

di

luarsiklushaid,

pembesaran uterus lebihbesardariusiakehamilan.


2) Riwayatkesehatanmasalalu

Riwayatpembedahan :Kajiadanyapembedahan yang pernahdialamiolehklien,


jenispembedahan , kapan , olehsiapadan di manatindakantersebutberlangsung.

Riwayatpenyakit yang pernahdialami :Kajiadanyapenyakit yang


pernahdialamiolehklienmisalnya DM , jantung , hipertensi ,
masalahginekologi/urinary , penyakitendokrin , danpenyakit-penyakitlainnya.

Riwayatkesehatankeluarga : Yang dapatdikajimelalui genogram


dandarigenogram
tersebutdapatdiidentifikasimengenaipenyakitturunandanpenyakitmenular yang
terdapatdalamkeluarga.

Riwayatkesehatanreproduksi : Kajitentangmennorhoe, siklusmenstruasi,


lamanya, banyaknya, sifatdarah, bau, warnadanadanyadismenorhoesertakajikapan
menopause terjadi, gejalasertakeluahan yang menyertainya

Riwayatkehamilan ,persalinandannifas :
Kajibagaimanakeadaananakklienmulaidaridalamkandunganhinggasaatini,
bagaimanakeadaankesehatananaknya.

Riwayatseksual :Kajimengenaiaktivitasseksualklien, jeniskontrasepsi yang


digunakansertakeluahn yang menyertainya.

Riwayatpemakaianobat:Kajiriwayatpemakaianobat-obatankontrasepsi oral, obat


digitalis danjenisobatlainnya.

Polaaktivitassehari-hari :Kajimengenainutrisi, cairandanelektrolit, eliminasi


(BAB dan BAK), istirahattidur, hygiene, ketergantungan,
baiksebelumdansaatsakit.

Pemeriksaanfisik, meliputi :

Inspeksi adalah proses observasi yang sistematis yang tidak hanya terbatas pada
penglihatan tetapi juga meliputi indera pendengaran dan penghidung.
Hal yang diinspeksi antara lain :
mengobservasi kulit terhadap warna, perubahan warna, laserasi, lesi terhadap drainase,
pola pernafasan terhadap kedalaman dan kesimetrisan, bahasa tubuh, pergerakan dan
postur, penggunaan ekstremitas, adanya keterbatasan fifik, dan seterusnya
Palpasiadalahmenyentuhataumenekanpermukaanluartubuhdenganjari.
Sentuhan : merasakan suatu pembengkakan, mencatat suhu,
derajat kelembaban dan tekstur kulit atau menentukan kekuatan
kontraksi uterus.
Tekanan

menentukan

karakter

nadi,

mengevaluasi

edema,

memperhatikan posisi janin atau mencubit kulit untuk mengamati


turgor.
Pemeriksaan dalam : menentukan tegangan/tonus otot atau respon
nyeri yang abnormal

Perkusi adalah melakukan ketukan langsung atau tidak langsung pada permukaan
tubuh tertentu untuk memastikan informasi tentang organ atau jaringan yang ada
dibawahnya.
Menggunakan jari : ketuk lutut dan dada dan dengarkan bunyi yang
menunjukkan ada tidaknya cairan , massa atau konsolidasi.
Menggunakan palu perkusi : ketuk lutut dan amati ada tidaknya refleks/gerakan
pada kaki bawah, memeriksa refleks kulit perut apakah ada kontraksi dinding
perut atau tidak
Auskultasi adalah mendengarkan bunyi dalam tubuh dengan bentuan stetoskop
dengan menggambarkan dan menginterpretasikan bunyi yang terdengar. Mendengar :
mendengarkan di ruang antekubiti untuk tekanan darah, dada untuk bunyi jantung/paru
abdomen untuk bising usus atau denyut jantung janin.
(Johnson & Taylor, 2005 : 39)
Pemeriksaan laboratorium :
Darah dan urine serta pemeriksaan penunjang : rontgen, USG, biopsi, pap smear.
Keluarga berencana : Kaji mengenai pengetahuan klien tentang KB, apakah klien
setuju, apakah klien menggunakan kontrasepsi, dan menggunakan KB jenis apa.
Data lain-lain :
Kaji mengenai perawatan dan pengobatan yang telah diberikan selama dirawat di
RS.Data psikososial.

Kaji orang terdekat dengan klien, bagaimana pola komunikasi dalam keluarga,
hal yang menjadi beban pikiran klien dan mekanisme koping yang digunakan.
Status sosio-ekonomi : Kaji masalah finansial klien
Data spiritual : Kaji tentang keyakinan klien terhadap Tuhan YME, dan kegiatan
keagamaan yang biasa dilakukan.
B. DiagnosaKeperwatan
1. Berduka berhubungan dengan krisis situasional
2. Ansietas berhubungan dengan krisis situasional
3. Nyeri berhubungan dengan kontraksi uterus berlebih

DAFTAR PUSTAKA
Wilkinson, M.Judhit (2007), Buku Saku Diagnosa Keperawatan dengan Intervensi
NIC dan Kriteria Hasil NOC, Jakarta: EGC

Hamilton, C. Mary, 1995, Dasar-dasar Keperawatan Maternitas, edisi 6, EGC, Jakarta


Mansjoer, Arif, dkk. 2001. KapitaSelektaKedokteran, Jilid I. Media Aesculapius.
Jakarta
Mochtar Rustam Prof, Dr, MPIL, 1997. Sinopsis Obstetri Jilid 2.Penerbit Buku
Kedokteran EGC. Jakarta.
Prawirohardjo Sarwono. 1996. Ilmu kebidanan dan Penyakit Kandungan. Yayasan
Bina Pustaka. Jakarta.
Syahrum MH, Dkk. 1994. Reproduksi Dan Embriologi Dari Satu Sel Sampai Menjadi
Organisme. Balai Penerbit FKUI. Jakarta
Herman. S. 2003. Obstetri Patologi Edisi 2. EGC. Fakultas Kedokteran Padjajaran.
Bandung.
Cuningham. F. G. MacDonald. P, C., Gant. N. F. 1995. Obstetri William.EGC.
Jakarta.
Haqiqi Missiani A 20060310018, Bagian Ilmu Obstetri dan Ginekologi, RSUD
Djojonegoro, Kab. Temanggung, Jawa Tengah.
Doengoes, M. 2001. RencanaPerawatanMaternitas/Bayi. EGC: Jakarta.

JURUSAN KEPERAWATAN
POLTEKKES KEMENKES MALANG

FORMAT PENGKAJIAN
ASUHAN KEPERAWATAN KLIEN
Dengan:
ABORTUS IMMINEN

DISUSUN OLEH:
1.
2.
3.
4.

Rita Cahyanti
Deby Illahi
Fitri Sri Lestari
Lutfi Nur Ichwan

KEMENTRIAN KESEHATAN RI
POLITEKNIK KESEHATAN MALANG
JURUS KEPERAWATAN

FORMAT ASUHAN KEPERAWATAN

A. PENGKAJIAN

1 PENGUMPULAN DATA
a. Biodata
1) Nama
2) Jenis Kelamin
3) Umur
4) Status Perkawinan
5) Pekerjaan
6) Agama
7) Pendidikan terakhir
8) Alamat
9) Tanggal MRS
b. Diagnosa Medis

: Ny. E
: Perempuan
: 24 tahun
: kawin
: Ibu rumah tangga
: Islam
: SMA
: Jl.Kresnowidodo no.7 Ds.SumberjoSutojayan
: 27 Juni 2012
: Abortus Imminen

c. Keluhan Utama

: Saat Pengkajian

Ibu mengatakan ia merasa nyeri pada perut bawah


d. Riwayat Penyakit sekarang
Ibu mengatakan bahwa sejak 1 hari lalu ia merasa nyeri pada perut bagian bawah dan
keluar bercak bercak darah. Nyeri pada skala 4, mulas mulas bertambah jika
bergerak, berkurang jika ibu tiduran. Keluaran darah pervaginum 100 cc/3 jam.
Ekspresi wajah Ibu tampak berkeringat, cemas dan sesekali mendesis nyeri.
e. Riwayat Kesehatan/Penyakit Yang Lalu
Ibu tidak pernah menderita penyakit menurun/turunan seperti hipertensi, DM, Asma,
Jantung dan TBC. Namun ibu mengalami abortus berulang.
f. Riwayat Kesehatan Keluarga
Ibu mengatakan dalam keluarga tidak ada anggota keluarga yang mempuyai penyakit
menurun/turunan. Ibu juga tidak mempunyai keturunan kembar.
g. Riwayat Obstetri
1. Riwayat Menstruasi
Menarche
: 12 tahun
Siklus
: 28 hari
Lama
: 7 hari
Banyak
: 100 ml
Warna
: Merah segar
Bau
: Amis
Flour albous : Kadang kadang
HPHT
: 30 Januari 2013
Disminorhe : Tidak pernah
2. Riwayat Kehamilan
Saat ini kehamilan kedua
3. Riwayat Kehamilan Sekarang
G2 P00 Ab100: 12 minggu 3 hari
HPL
: 6 November 2013

ANC
: Belum pernah
TT
: 1x capeng
Ibu tidak mengkonsumsi obat obatan
Ibu tidak mempunyai kebiasaan buruk seperti: merokok, minum

minuman keras.
4. Riwayat Kontrasepsi
Ibu belum pernah memakai kontrasepsi
h. Riwayat Perkawinan
Menikah
: 1 kali
Lama perkawinan
: 4 tahun
Umur saat menikah : Suami 24 tahun, Ibu 20 tahun.
i. Aktivitas hidup sehari hari
Aktivitas sehari
hari
A. Makan dan
minum
1. Nutrisi

2. Minum
B. Eliminasi
1. BAB

2. BAK
Istirahat dan
tidur
1. Istirahat

Sebelum hamil

Selama hamil

Ibu makan tiga kali sehari


dengan porsi nasi, sayur
dan lauk. Ibu tidak ada
makanan pantangan.

Ibu mengatakan makan tiga


kali sehari namun hanya
setengah porsi nasi, sayur dan
lauk.

Ibu minum air putih 6 8


gelas/hari, kadang juga teh

Ibu minum air putih 6-8


gelas/hari dan ditambah
minum susu

1 kali sehari, tidak


konstipasi, warna dan
jumlah normal serta tidak
ada kelainan dan bau

BAB 2x/hari konsistensi


lunak, kuning kecoklatan

BAK 3-4 kali/hari, tidak


ada kelainan

BAK 4-5 kali/hari, jumlah


tidak tentu, warna kuning dan
tidak ada kelainan

Siang istirahat siang jam


11.00-13.00, malam jam
19.00-21.00

Lebih banyak waktu untuk


istirahat

Tidur malam 8 jam dan


jarang terbangun.
Tidur siang 1-1,5 jam
Ibu dapat melakukan
pekerjaannya sendiri tanpa
bantuan
Ibu mandi 2 X/hari,
menggosok gigi dan
keramas. Tidak ada

Tidur malam 8 jam dan


jarang terbangun.
Tidur siang kadang - kadang
Ibu dapat melakukan
pekerjaannya kadang
kadang dengan bantuan
Ibu mandi 2 X/hari,
menggosok gigi dan keramas.
Tidak ada hambatan dalam

C.

2. Tidur
D. Aktivitas
E.

Kebersihan diri

hambatan dalam
melakukan personal
hygiene

melakukan personal hygiene

j. Psikososial
1. Psikologis
Emosi ibu stabil namun ibu cemas terhadap keadaan kehamilannya.
2. Sosial
Hubungan ibu dengan keluarga dan keluarga lain harmonis, hubungan ibu dengan
masyarakat sekitar juga terjalin dengan baik.
3. Spiritual
Sebagai pemeluk agama islam ibu rajin menjalankan sholat 5 waktu

k. Pemeriksaan fisik
1. Keadaan umum :
Nampak berusaha tenang, lemah. Tingkat kesadaran compos mentis, GCS : 4 5
6. TB 157 cm, LILA 24 cm dan BB sebelum hamil 48 Kg, BB setelah hamil 52
Kg.. Tanda vital : nadi 84 X/menit, RR 24 X/menit, tekanan darah 120/70 mmHg
dan suhu 36 oC..
2. Head to toe

Kepala
Bentuk kepala bulat, tidak ada luka atau cedera kepala dan kulit kepala tidak
ada kotoran atau bersih.

Rambut
Rambut lurus, nampak bersih, tidak ada ketombe, tertata rapih.

Mata (penglihatan).
Visus normal, tidak menggunakan alat bantu. Konjungtiva agak pucat.

Hidung (penciuman).
Bentuk normal, tidak ada kelainan seperti deviasi septum, mempunyai dua
lubang, peradangan mukosa dan polip tidak ada, sedangkan fungsi penciuman
normal.

Telinga (pendengaran).
Ketajaman pendengaran baik, bentuk normal : simetris kiri dan kanan, fungsi
pendengaran baik, tidak ada serumen dan cairan, serta alat bantu tidak ada.

Mulut dan gigi.

Bentuk bibir normal, tidak bau mulut. Tidak ada perdarahan dan peradangan
pada mulut. Mulut tampak kering. Sedangkan fungsi pengecapan baik, bentuk
dan ukuran tonsil normal serta tidak ada peradangan pada faring.

Leher
Kelenjar getah bening tidak mengalami pembesaran, tidak ada kaku kuduk.

Thoraks (fungsi pernapasan)


Inspeksi
Palpasi
Perkusi
Auskultasi

: simetris dimana dada kanan dan kiri sama,


pengembangan dada optimal, payudara membesar
: hangat, tidak ada kelainan.
: bunyi sonor .
: tidak ada ronchii, ataupun wheezing, bunyi
vesikuler.

Abdomen
Inspeksi
Auskultasi
Perkusi
Palpasi

: terdapat striegravidium.
: bising usus normal (15 X/menit).
: normal.
: ada nyeri tekan pada perut bawah, uterus teraba lunak.

Genetalia
Keluar darah dari jalan lahir

Ekstremitas
Tidak ada luka pada tangan kiri dan kanan. Kekuatan cukup, dimana mampu
membolak balikan tangan dan menggerakan kakinya.

Integumen
Secara umum kulit kelihatan bersih, tidak ada penyakit kulit, turgor kulit jelek.

l. Pemeriksaan penunjang
1. Hb : 14 gr%
2. Tes kehamilan (-)

Blitar, 27 Juni 2012


Perawat

ANALISA DATA
Nama Pasien : Ny. E
Umur

: 24 tahun

No.registrasi : 24
Data
Subyektif :
Klien mengaku bingung dengan
kehamilannya yang selalu mengalami
keguguran
Obyektif :
Klien terlihat gelisah, berkeringat
Subyektif :
Klien mengatakan nyeri pada daerah perut
bawah, merasa mulas mulas dan nyeri
akan bertambah jika bergerak, berkurang
bila klien duduk
Obyektif :
Skala nyeri 4.
Klien sesekali mendesis nyeri. Kontraksi
uterus berlebih

Masalah

Etiologi

Ansietas

Abortus

Nyeri

Kontraksi uterus

Subyektif:
Ibu mengatakan lemas.
Obeyektif:
Keadaan umum ibu nampak lemah, turgor
kuliat jelek, mulut kering, perdarahan
pervaginum 100 cc per 3 jam

B. DIAGNOSA KEPERAWATAN
Nama Pasien : Ny. E
No. Registrasi : 24

Resiko kekurangan
volume cairan
dalam tubuh

Perdarahan
pervaginum

1. Ansietas berhubungan dengan abortus


2. Nyeri berhubungan dengan kontraksi uterus
3. Resiko kekurangan volume cairan dalam tubuh berhubungan dengan
perdarahan pervaginum

C. PERENCANAAN
1. PRIORITAS MASALAH
DAFTAR MASALAH

Nama Pasien

: Ny.E

Usia

: 34 tahun

No. Registrasi

: 24

No.

TANGGAL

DX
1

MUNCUL
27 Juni 2012
08.00 WIB

DIAGNOSA

TANGGAL

TANDA

KEPERAWATAN
Nyeri berhubungan

TERATASI
27 Juni 2012

TANGAN

dengan kontraksi

12.00 WIB

uterus berlebih

27 Juni 2012

Ansietas berhubungan

27 Juni 2012

08.00 WIB

dengan abortus

17.00 WIB

27 Juni 2012

Resiko kekurangan

27 Juni 2012

08.00 WIB

volume cairan

22.00 WIB

berhubungan dengan
perdarahan
pervaginum

2. TUJUAN, KRITERIA STANDAR, INTERVENSI, RASIONAL


3.

4. RENCANA ASUHAN KEPERAWATAN


5. Nama klien
6. Usia
7. No. REG

: Ny. E
: 34th
: 24

8.
9.

17.
18.

10.
D

19.
N

11.
14.Tujuan &
criteria hasil
20.Setelah
diberikan
tindakan
keperawatan
selama
2x24jam,
pasien
diharapkan
mampu
mengontrol
nyeri yang
dibuktikan
dengan
criteria hasil :
1. Klien mengatakan
nyeri hilang/
terkontrol.
2. Ekspresi wajah tidak
menunjukkan rasa
menahan sakit.

Perencanaan

15.Intervensi
1. Berikan informasi dan
petunjuk antisipassi
mengenai penyebab
ketidaknyamanan dan
intervensi yang tepat.
22.
2. Evaluasi tekanan darah
dan nadi. Perhatikan
perubahan perilaku.
23.
3. Ubah posisi klien dan beri
gosokan punggung.
Anjurkan teknik
pernapasan dalam dan
relaksasi serta distraksi
(rangsangan jaringna
kutan)
24.
4. Palpasi kandung kemih,
perhatikan adanya rasa

16.Rasional
1. Meningkatkan pemahaman dan
kooperatifnya pasien.
25.
26.

2. Untuk membedakan antara


kegelisahan karena nyeri atau
kehilangan tekanan darah
akibat dari proses pembedahan.
27.
3. Merilekskan otot dan
mengalihkan perhatian dari
sensasi nyeri.
28.
29.
30.
4. Memudahkan waktu berkemih
secara periodic.

31.

32.
C

3. Kualitas nyeri
menunjukkan skala
0-3.
4. TD 120/80-130/90
21.mmHg.
5. Nadi 90x/mnt.
6. Pola nafas efektif
24x/mnt.
33.Setelah
diberikan
tindakan
keperawatan,
selama
3x24jam, klien
diharapkan
mampu
mengatasi
ansietas yang
dibuktikan
dengan
criteria hasil :
1. Klien dapat
mengungkapkan
rasa takut dari
masalah.
2. Klien
mengungkapkan
rasa ansietas
berkurang
3. Menggunakan
mekanisme koping
yang tepat.

penuh.

1. Kaji respon psikologis


kejadian, dan ketersediaan
system pendukung.
34.

1. Makin klien mengatakan


ancaman, makin besar tingkat
ansietas.
42.

2. Tetap bersama klien dan


tetap bicara perlahan,
tunjukkan empati.
35.

2. Membantu mengatasi transmisi


ansietas interpersonal dan
mendemonstrasikan perhatian
terhadap klien.
43.

3. Berikan penguatan aspek


positif dari ibu.
36.
4. Anjurkan klien
mengungkapkan dan
mengekspresikan
perasaan.
37.
38.
5. Arahkan mekanisme
koping yang diekspresikan.
39.
40.
41.
6. Berikan masa privasi,

3. Memfokuskan pada
kemungkinan keberhasilan hasil
akhir dan membantu membawa
ancaman yang dirasakan.
44.
4. Membantu mengidentifikasi
perasaan atau masalah
negative dan member
keseempatan untuk mengatasi
perasaan berduka.
45.
5. Mendukung mekanisme koping
dasar otomatik, meningkatkan
kepercayaan diri, dan
penerimaan menurunkan
ansietas.

kurangi rangsang
lingkungan.

48.

49.
R

50.

1.

46.
6. Memungkinkan kesempatan
bagi klien untuk
menginternalisasi informasi.
Menyusun sumber-sumber dan
mengatasi dengan efektif.
47.
1.

51.

D. PELAKSANAAN

52.
53. CATATAN KEPERAWATAN
54.
55. Nama Pasien : Ny. E
56. Umur
: 34 tahun
57. No. Registrasi : 24

58.
59.

62.

60.
H
64.
R
65.
27

61. Implementasi
1.

Mengajarkan Ibu tehnik non farmakologis untuk


mengurangi rasa nyeri
2.
Mengajarkan ibu tehnik nafas dalam
3.
Membantu ibu meningkatkan rasa nyaman dengan
mengambil data klien tentang karakteristik nyeri
4.
Mengukur tanda tanda vital setiap 10 menit sekali

66.
67.
68.
08
69.
70.
72.

73.
R
74.
27

1. Mengakji respon psikologis


2. Mendampingi klien dan menunjukkan empati
3. Menganjurkan klien mengungkapkan dan
mengekspresikan perasaan
4. Mengarahkan mekanisme koping yang di ekspresikan
77.

75.
76.
08
78.

82.
83.

79.

86.
R
87.
27

80.

95.
1. Mengajarkan Ibu tehnik non farmakologis untuk
mengurangi rasa nyeri
2. Mengajarkan ibu tehnik nafas dalam
3. Membantu ibu meningkatkan rasa nyaman dengan
mengambil data klien tentang karakteristik nyeri

88.
89.
10

4. Mengukur tanda tanda vital setiap 10 menit sekali


5. Memberikan lingkungan yang tenang
6. Mengevaluasi rentang nyeri

90.
91.
92.
93.
94.
99.
97.

107.
1. Mengakji respon psikologis
100. 2. Mendampingi klien dan menunjukkan empati
R
3. Menganjurkan klien mengungkapkan dan
mengekspresikan perasaan
101. 4. Mengarahkan mekanisme koping yang di ekspresikan
27
108.
109.
102.
110.
103.
11
104.
105.
106.

111.
112.

113. 1. Mengakji respon psikologis


R
2. Mendampingi klien dan menunjukkan empati
3. Menganjurkan klien mengungkapkan dan
114.
mengekspresikan perasaan
27 4. Mengarahkan mekanisme koping yang di ekspresikan
117.
115.
118.
116.
14

119.
E. EVALUASI
120.
121.

Nama

: Ny.E

122.

Umur

: 34 tahun

123.

No.Registrasi : 24
124.
No.

127.
128.
129.

125.

Tangga

EVALUASI FORMATIF

126.

EVALUASI

l dan Waktu

27 Juni 2012
10.00 WIB

130.
131.
132.
133.
134.
135.
136.

S : Ibu mengatakan nyeri belum berkurang


O : TD: 12/80 mmHg
RR: 20x/menit
ND : 80x/menit
Skala nyeri 2
A : masalah belum teratasi
P : Intervensi no.1-4 dipertahankan dan ditambah
137.

139.
140.

27 Juni 2012
12.00 WIB

149.
150.
151.
152.

27 Juni 2012
11.00 WIB

158.
159.
160.
161.
167.
168.
169.
174.
175.
176.

182.

183.

141.
142.
143.
144.
145.
146.
147.
148.

27 Juni 2012
14.00 WIB

27 Juni 2012
17.00 WIB
27 Juni 2012
22.00 WIB

177.
178.
179.
180.

S : pasien mengatakan nyeri berkurang bahkan kadang sudak tidak terasa


O : ibu nampak rileks
TD: 12/80 mmHg
RR: 20x/menit
ND : 80x/menit
Skala nyeri 1
A : masalah teratasi
P : rencana intervensi dihentikan
153.
S : Ibu mengatakan merasakan cemas
154.
O : Raut muka ibu nampak gelisah
155.
A : masalah belum teratasi
156.
P :Intervensi no 1-4 dipertahankan
162.
S : Ibu mengatakan sedikit lebih tenang
163.
O : Ibu nampak mampu mengontrol kecemasannya
164.
A : Masalah teratasi sebagian
165.
P : Intervensi no 1-4 dipertahankan
170.
S : Ibu mengatakan perasaan sudah tenang
171.
O : Klien dapat menggunakan mekanisme koping yang tepat
172.
A: Masalah teratasi
173.
P :Intervensi dihentikan
S:
O:
A:
P:
181.