Anda di halaman 1dari 413

UNIVERSIDAD TCNOLGICA EQUINOCCIAL

FACULTAD DE ARQUITECTURA, ARTES Y DISEO

TESIS PREVIA A LA OBTENCIN DEL TTULO DE LICENCIADO EN


RESTAURACIN Y MUSEOLOGA

TEMA: MUSEO DE ARTE CONTEMPORNEO ECUATORIANO PARA


DISCAPACITADOS VISUALES, DISCART MIND EYES MUSEUM.
TTULO: DISCART MIND EYES MUSEUM

POR: JOAO CESAR GUERRN CIRO

DIRECTOR DE TESIS: Msc. JUAN CARLOS FERNNDEZ CATALAN

QUITO- ECUADOR 18 DE AGOSTO DE 2009

DEDICATORIA

A mis padres y a mi hijo Baltazar

INDICE
PAG
PLAN DE TESIS
1.- PROBLEMA
2.- TEMA
3.- TTULO
4.- DEFINICIN DEL PROBLEMA
4.1.- DIAGNSTICO
4.2.- PRONSTICO
4.3.- CONTROL DEL PRONSTICO
4.4.- SISTEMATIZACIN
4.5.- FORMULACIN
5.- OBJETIVOS
5.1.- OBJETIVOS GENERALES
5.2.- OBJETIVOS ESPECFICOS
6.- JUSTIFICACIN DEL ESTUDIO
6.1.- IMPCTO SOCIAL
6.2.- IMPACTO PRCTICO
6.3.- IMPCTO METODOLGICO
6.4.- IMPCTO TERICO
6.5.- VIABILIDAD DE LA PROPUESTA
7.- HIPTESIS
7.1.- IDENTIFICACIN DE VARIABLES
7.2.- IDENTIFICACIN DE INDICADORES
8.- MARCO DE REFERENCIA
9.- LIMITACIONES Y DELIMITACIONES
10.- METODOLOGA
INTRODUCCIN
RESUMEN
ABSTRACT

CAPITULO I
HISTORIA Y DEFINICIN
1.1 Antecedentes histricos
1.2.1.- Evolucin Educativa
1.3 Definiciones y clasificaciones en torno a la discapacidad visual
1.3.1.- La Baja Visin y la Ceguera
1.4 Tipos de escrituras y lenguajes.
1.4.1.- Escritura y publicaciones.
1.5 El sistema braille
1.5.1. Louis Braille
1.5.2. La lectura Braille
1.5.3. Tipos de Lectura
1.6. Tipos de Escritura para personas no videntes.
1.6.1. Boston Line Type
1.6.2. New York Point
1.6.3. American Modified Braille
1.6.4. Maquinas de Escribir en Braille
1.6.5. Cdigo Moon

I
I
I
I
II
II
II
II
II
III
III
III
III
IV
IV
IV
IV
IV
V
V
V
V
VI
VI

PAG
1
3
5
5
12
12
13
15
16
18
19
19
19
20
20
22
3

1.6.6. Sistema Fishburne


24
1.6.7. TACK TILES
24
1.6.8. Smbolos Tctiles
25
1.6.9. Acceso a la alfabetizacin
26
1.7. Los derechos humanos
27
1.7.1. Derechos humanos de los discapacitados
27
1.8.- Instituciones ecuatorianas implicadas y organismos de control
29
1.8.1. FGE.- (FUNDACIN GENERAL ECUATORIANA)
29
1.8.2. CECADIS.- Centro de capacitacin, documentacin
30
e investigacin social.
1.8.3. PRAM.- Programa Ramn Arregui Monreal
31
1.8.4. Federacin Nacional de Ciegos del Ecuador - FENCE
32
1.8.5. Federacin Nacional de ecuatorianos con Discapacidad Fsica/FENEDIF 33
1.8.6 Federacin Ecuatoriana Pro Atencin a la Persona con Deficiencia Mental, 34
Parlisis Cerebral, Autismo y Sndrome de Down - FEPAPDEM
1.8.7.- Comisiones provinciales de discapacidades
36
1.8.8.- Federacin Nacional de Organismos no Gubernamentales para la
39
Discapacidad (FENODIS)
1.9.- Distribucin de las personas con discapacidad por tipo de deficiencia
40
CAPITULO II
2. Anlisis espacial y de barreras arquitectnicas en los museos
de la ciudad de quito.
2.1.- Elementos principales para el diagnstico.
2.2.- Museos objeto del diagnostico
2.2.1. Museo de la Ciudad
2.2.2.- Museo Miguel de Santiago - Convento de San Agustn
2.2.3.- Centro Cultural Metropolitano Museo Alberto Mena Caamao.
2.2.3.1. Museo Alberto Mena Caamao
2.2.4.- Casa Museo Mara Augusta Urrutia
2.2.5.- Museo Fray Pedro Gocial - Convento de San Francisco
2.2.6.- Museo Numismtico del Banco Central del Ecuador.
2.2.7.- Fundacin Iglesia de la Compaa de Jess
2.2.8.- Museos Casa de la Cultura Ecuatoriana
2.2.9.- Museo Ecuatoriano de Ciencias Naturales
2.3.-Capilla del hombre
2.3.1.-Fundacin Guayasamn
2.3.2.-Fundacin Posada de las artes Kingman
2.3.3.- Museo Amaznico
2.3.4.- Museo Artes
2.3.5.- Museo Nacional del Banco Central del Ecuador
2.3.6.- Museo del colegio militar Eloy Alfaro
2.3.7.- Museo Padre Francisco de Jess Bolaos
2.3.8.- Museo Camilo Egas
2.3.9.- Museo Fray Pedro Bedn.
2.4.0.- Museo Monacal Santa Catalina de Siena
2.4.1.- Museo Histrico militar Casa de Sucre

41
41
46
46
55
63
68
76
83
91
97
102
108
116
123
130
132
135
137
142
147
148
154
157
160

CAPITULO III
3.- Guin museolgico
3.1.- Plan director
3.2.-Guin Museogrfico
3.3.- Planos del Museo
3.4.- Propuesta de adecuacin Museolgica y Museogrfica
para el Museo Camilo Egas.

168
170
212
262

CONCLUSIONES, RECOMEDACIONES Y ANEXOS

PLAN DE TESIS

1. EL PROBLEMA

La gran mayora de instituciones y organismos encargadas o que tienen como misin la


difusin de la cultura y el arte en particular, no disponen de diseos estructurales ni
operativos para atender a personas con discapacidades entre ellas la visual; lo que ha
provocado una limitacin en las funciones de las instituciones, es la manera de
inaccesibilidad demostrada la que se ha proyectado como una suerte de marginacin.
Particularmente en Quito los museos, en este sentido no cumplen con el precepto
constitucional ni con los objetivos para lo que fueron creados, incumplen las leyes y
reglamentos que protegen el derecho de estas personas.

2. TEMA:

La museologa y museografa aplicada hacia las personas con discapacidad visual entre
seis y setenta aos.

3. TITULO

DISCART MIND EYES MUSEUM


4.

DEFINICIN DEL PROBLEMA


La forma tradicional de concebir y poner en funcionamiento museos, centros culturales,
salas de exposiciones, bibliotecas u otros organismos similares que fueron diseados
para atender a personas sin limitaciones fsicas, por lo que un considerable sector social
ha permanecido marginado del acceso al conocimiento por estas va.
Las instalaciones de los inmuebles, en cuanto a la estructura arquitectnica sobre todo lo
referente a la circulacin, no consideraron la posibilidad de acceso o al menos facilitar
el ingreso y la libre circulacin de personas con limitaciones fsicas.
De igual forma las muestras en cuanto al recurso museogrfico y museolgico estn
creadas para personas sin limitaciones, lo que hace imposible el acceso para no videntes
para citar un caso.

4.1.

DIAGNSTICO
Esta suerte de conducta, aparentemente involuntaria y sin repercusiones es realmente un
limitante para que se practiquen derechos constitucionales como la igualdad de
derechos, el libre acceso a la educacin y a la cultura, el disfrute de nuestro patrimonio
cultural.
El que no se hayan diseados sitios en particular con estructuras arquitectnicas sin
barreras de acceso; el que los museos, bibliotecas y organismos similares no hayan
creado sistemas alternos de exhibicin, posibilitan que un gran sector de la sociedad
permanezca prcticamente marginado, sin posibilidad de insertarse en la sociedad como
entes productivos.

4.2.

PRONSTICO
De persistir esta situacin un gran sector de la poblacin con discapacidades est
prcticamente impedido de acceder a la educacin, a la cultura, fundamentales
elementos del desarrollo humano

4.3.

CONTROL DEL PRONSTICO


La creacin y el funcionamiento del Museo DISCART, La museologa y museografa
aplicada hacia las personas con discapacidad visual entre seis y setenta aos, ser una
alternativa, que se podr generalizar a nivel nacional, constituyndose en espacios de
acceso libre y asimilacin del conocimiento de las perdonas con discapacidad visual.

4.4.

SISTEMATIZACION
Qu vamos hacer para conocer las consecuencias positivas o negativas de la
marginacin de personas discapacitadas?
Una serie de anlisis, entrevistas, cuestionarios, observaciones y experiencias de
actividades en este campo
Qu otros factores podran llevarnos a conocer el comportamiento de de los
discapacitados?
Informacin cientficas relacionadas con las discapacidades visuales y alternativas para
superar estas falencias.
Qu preguntas podra incluir en la encuesta?
Fundamentalmente cerradas y especficas para conocer el sentir de los involucrados
directos, de directores de museos, de promotores culturales, de cientficos, artistas,
diseadores y antroplogos entre otros.

4.5.

FORMULACION
La investigacin se suscribe entre otras a las siguientes:
Las discapacidades, orgenes causas y manifestacin
Anlisis psicolgicos y psicopedaggicos
Clasificacin de las discapacidades
7

Elementos, sistemas o procedimientos para superar las limitaciones


Revisiones del marco legal referido a este campo
Revisin de propuestas y soluciones de experiencias anteriores, a nivel nacional e
internacional
Anlisis de casos
Planteamiento de alternativas o propuestas concretas referidas al tema: Discapacidad
visual en personas entre los seis y setenta aos.
Diseo de proposiciones concretas
Conclusiones y recomendaciones
5. OBJETIVOS
5.1. GENERALES
Establecer una propuesta de museo modelo, adecuado y dirigido para personas con
discapacidad visual, basada en una correcta y sistemtica aplicacin museolgica y
museogrfica que haga accesible al conocimiento y disfrute de estas personas, que
contribuya a la concientizacin, respeto, tolerancia y solidaridad con los discapacitados.
5.2. OBJETIVOS ESPECIFICOS

Investigar desde el punto de vista cientfico los diferentes grados de


manifestacin de las discapacidades y en particular las que se consideran
visuales.
Conocer como las discapacidades visuales se han hecho evidentes en la
evolucin histrica de la humanidad
Establecer propuestas referidas a las adecuaciones o diseos de circulacin,
accesos, entrada, salida en interiores, bajo condicionantes en muchos casos de
estructuras arquitectnicas coloniales.
Elaborar diseos museogrficos y museolgicos para este tipo de discapacidades
Construir una serie de rplicas de obras particularmente de arte contemporneo
Disear muestras itinerantes.

6. JUSTIFICACION DEL ESTUDIO

Sin lugar a duda, la propuesta en primer trmino se orienta a construir y hacer una
prctica humana del cultivo de valores, entre respeto, tolerancia y sobre todo
solidaridad.
A provocar que las leyes creadas por el legislador, no se constituya en letra muerta, por
lo tanto a su inmediata aplicacin, en procura del acceso al derecho a la educacin y
cultura de un importante sector de la sociedad por asuntos de discapacidad.
El incorporar una propuesta, que haga del museo un centro cultural accesible a los no
videntes, como una accin objetiva de incorporacin a la educacin, y cultura de este
sector de la sociedad.

6.1.- IMPACTO SOCIAL


Cul es la relevancia social?
La propuesta plantea una solucin a una situacin tan grave como es la marginacin por
razones de limitacin fsica
Quines se beneficial?
En principio toda la poblacin, si bien, es cierto que el proyecto beneficia de forma
directa e inmediata a los no videntes, la propuesta, no es excluyente para los videntes,
con lo que se logra una experiencia prctica para ellos en el sentido de experimentar las
limitaciones de los no videntes.
De qu modo?
La muestra resuelta para la percepcin, apreciacin, conocimiento y disfrute de los no
videntes, permite la participacin de los videntes, quienes en una experiencia singular,
comprendan los efectos de las limitaciones visuales.
6.2.

IMPACTO PRCTICO
Museos, centros de interpretacin cultural, Casas Museo, entre organismos vinculados
con la exposicin y exhibicin de obras, disponen de una propuesta, que puede hacer
accesible sus servicios a personas con deficiencias visuales.

6.3.

IMPACTO METODOLGICO
Los resultados nos permitirn establecer un modelo a seguir o a implementar en
diferentes sitios de la geografa ecuatoriana

6.4.

IMPACTO TEORICO
Se incorporan nuevos conocimientos y procedimientos idneos para hacer accesible a
los no videntes al consumo de museos y sitios de exposicin de obras o manifestaciones
culturales

6.5.

VIABILIDAD DE LA PROPUESTA
El resultado, analizado, interpretado, sistematizado y estandarizado, es un verdadero
aporte para el logro del acceso de personas no videntes, ya que actualmente, esta
informacin especfica y sobre todo el procedimiento, mtodos y medios que no existen,
oferta una propuesta es viable para cubrir este vaco o falencia.
6.5.1.-POSEE EL RECURSO HUMANO CAPACITADO PARA LLEVAR A CABO
LA ALTERNATIVA DE SOLUCIN SELECCIONADA
Fundamentalmente se recurrir a restauradores, muselogos, diseadores, fsicos,
antroplogos, socilogos, psiclogos entre otros profesionales los mismos que se
encuentran identificados y han demostrado su disponibilidad de colaborar con la
investigacin.
9

6.5.2.- CUENTA CON LA INFORMACIN NECESARIA


Mi formacin como restaurador- muselogo en el Universidad, la prctica profesional
me permiten estar en posesin de la informacin suficiente y necesaria para la tarea,
existe adems informacin de propuestas de experiencias de otros pases que han
desarrollado este tema, pero sobre todo el deseo de atender a este sector de la sociedad
6.5.3.DISPONIBILIDAD
DE
RECURSOS
ECONOMICOS,
DE
INFRAESTRUCTURA, ESPACIO Y TIEMPO PARA LOGRAR LOS OBJETIVOS
PROPUESTOS.
Como restaurador- muselogo y relaciones personales que dispongo me permiten contar
el apoyo de profesionales, el tiempo necesario y suficiente. En este sentido estimo est
garantizado el aspecto antes descrito.

7. HIPOTESIS O IDEA A DEFENDER

Si se forma y se pone en funcionamiento un museo modelo, dirigido hacia las perdonas


con discapacidad visual en la ciudad de Quito, se estableceran acercamientos entre la
difusin de la educacin, la cultura y el arte en particular con este sector de la
poblacin.

7.1.

IDENTIFICACION DE VARIABLES
Independientes: Diferentes edades y sexo, niveles de educacin o formacin
profesional
Dependientes: Diversos niveles de limitacin visual

7.2.

7.2.1.
7.2.2.
7.2.3.
7.2.4.
8.
8.1.

IDENTIFICACION DE INDICADORES
7.2.1. Normas
7.2.2. Estndares establecidos
Registros de ingresos
Estadsticas
Encuestas
rea de evaluacin. Pruebas objetivas
MARCO DE REFERENCIA
MARCO TEORICO
Existe un aspecto fundamental de punto de partida que tiene que ver con los
conocimientos de las discapacidades, manifestaciones de estas, tipos, estadsticas,
causas de afectacin, instituciones vinculadas con las discapacidades visuales.
10

Se debe plantear un Anlisis cientficos de este tipo de limitaciones y el marco legal


existente, que proteja a este sector de la poblacin
Se plantearn nuevos sistemas, medios, tcnicas y procedimientos disponibles que
mejores la atencin de casos de personas con discapacidad visual en diferentes grados.
Plantear de forma objetiva y analizar casos de museos que brindan este tipo de
servicios, tanto a nivel nacional como internacional.
Plantear una serie de propuestas propias orientadas a dar solucin tcnica, cientfica y
sobre todo inteligente y creativa, las mismas que sern referentes a otras propuestas que
podrn implementarse.
Es realmente un anlisis altamente cientfico y confiable que nos permitir dar
soluciones para evitar el marginamiento de un importante sector de la poblacin.

9.

LIMITACIONES Y DELIMITACIONES
Los estudios y en concreto la investigacin se referir exclusivamente a los
discapacitados visuales en la ciudad de Quito
La muestra est orientada a una poblacin de discapacitados comprendidos desde los
siete aos de edad de los dos sexos en adelante.
Desde la edad de siete aos el ser humano ya ha calmado la impulsividad para realizar
la mayora de acciones, tambin ha solidificado y organizado los conocimientos
adquiridos desde su primer ao de existencia, as como la lateralidad y el razonamiento
lgico.
Participacin de las asociaciones de discapacitados.

10. METODOLOGIA
Segn el proceso formal
Mtodo Inductivo:
Se analizan casos particulares a partir de los cuales se extraen conclusiones de carcter
general.
Mtodo Deductivo:
En el proceso de la investigacin lo utilizar para ir desde los hechos particulares de
cada grado de discapacidad visual, para crear una procedimiento de diseo
museogrfico en general.
Mtodo hipottico deductivo
A partir de la observacin de casos particulares e plantea un problema, a travs de un
proceso de induccin este problema remite a una teora
SEGN SU GRADO DE ABSTRACCION.11

Investigacin aplicada
Encaminada a la resolucin de problemas prcticos con un margen de generalizacin
limitado.
Investigacin pura (bsica)
Su objetivo es aumentar la teora sin importar aplicaciones prcticas, se buscan en
definitiva nuevos conocimientos
Mtodo cuantitativo
Admite aplicar a las ciencias sociales, mtodo de investigacin de las ciencias psiconaturales
Mtodo cualitativo

POR GENERALIZACION.
Investigacin fundamental
Las conclusiones se hacen extensivas a una poblacin muy superior a la muestra. Esta
orientada a conclusiones
SEGN LA DIMENSIN CRONOLGICA.Investigacin Histrica.- Al momento de investigar las grandes personalidades y
famosos a travs de la historia que tuvieron discapacidades visuales. Describe
fenmenos que acontecieron en el pasado, la fuente bsica de la informacin son los
documentos

Investigacin descriptiva.- Al momento de describir los fenmenos sociales que crean


marginacin. Describe los fenmenos tal cual aparecen en la actualidad.

Investigacin Experimental.- al momento de crear cedulas y paneles en Braile, salas


con climatizacin, aparatos porttiles para que funcionen en circuito cerrado. Predice lo
que ocurrir si se introdujeran algunas modificaciones en las condiciones actuales

SEGN SU FUENTE.Investigacin Bibliogrfica.- Toda la documentacin Histrica y descriptiva que sirva


para la realizacin de este proyecto. Una de las primeras fases del mtodo cientfico
consiste en una revisin de la bibliografa sobre el tema, a partir de all se pueden
formular hiptesis que posteriormente se pretende validar empricamente
SEGN EL LUGAR.Investigacin de campo.- Es necesario asistir a un da en la vida de un discapacitado
visual. Se busca conseguir una situacin lo ms real posible.
Investigacin de Laboratorio
El Objetivo es conseguir el mximo control. La situacin carece de las caractersticas
propias de ambiente naturales

12

Investigacin- Accin
Su objetivo es producir cambios en la realidad estudiada, ms que llegar a conclusiones
de carcter terico, pretende evitar el divorcio entre teora y prctica.
SEGN EL OBJETO
Mtodo Descriptivo
El objetivo es describir un fenmeno. Est en primer nivel el conocimiento cientfico, la
observacin es el elemento bsico, pudiendo utilizar varias tcnicas: Observacin
sistemtica, participante, encuesta, entrevista, test, entre otras.
Mtodo Explicativo
Su objetivo es explicar el fenmeno, llegar al conocimiento de las causas es el fin
ltimo, se pretende llegar a generalizaciones ms all de los sujetos analizados.
Mtodos Experimentales
S busaca controlar el fenmeno
Mtodo Predictivo
Su objetivo es predecir el fenmeno, se basa en datos anteriores y en tcnicas de anlisis
apropiadas como la regresin mltiple o el anlisis casual.
Segn el Enfoque
Mtodo Experimental
Se dispone de una variable independiente, experimental, que puede ser manipulada
segn las intenciones del investigador. Implica una intervencin o una experimentacin

a) METODOS EMPRICOS.Observacin, Medicin, experimentacin.- En el proceso de


investigacin ser necesario par por esta fase, en la cual se plantearn
maquetas y replicas en tres dimensiones y zonas climatizadas, para
representar a diferentes obras de arte , se observaran las reacciones por la
participacin activa del observador y no participante; se cuantificarn los
resultados obtenidos en escalas sociomtricas y mtodos estadsticos.

En definitiva se trata de recurrir al empleo de los mtodos tericos como los siguientes:
Anlisis- Sntesis, Induccin- Deduccin, Hipottico-Deductivo, Histrico lgico,
Gentico, Modelacin, Enfoque del sistema, Dialctico.

13

RESUMEN

Este trabajo de corazn y amor esta creado para compartir y aportar un grano de arena
en la construccin del nuevo ser humano, ese ser humano que crece y se desarrolla pese
a la mente ciega de la ignorancia; hacia la toma de conciencia para prevenir la
discapacidad y una aceptacin de las diferencias de todos despertamos la voz de la
comunidad musestica, y activamos el museo social; todos tenemos los mismos deberes
y derechos.
Discart Mind Eyes Museum es un museo especialmente dirigido para personas con
discapacidad visual de cualquier grado, sin exclusin del pblico en general que visita
los museos de Quito; este museo cuenta con 3 salas de exposicin, una sala de talleres,
un rea de informacin y recepcin, adems de amplias reas de recreacin y
simulacin de ambientes con alta tecnologa en sistemas de audio y sonido para brindar
al visitante discapacitado confort y entretenimiento al mismo tiempo que se est
impartiendo informacin y conocimiento acerca del arte contemporneo en el Ecuador.
Este trabajo contiene investigaciones sobre la discapacidad a travs de la historia, los
diferentes tipos de discapacidad visual que se pueden presentar, las leyes de los
discapacitados, las instituciones ecuatorianas que trabajan con discapacitados entre otra
informacin.

14

ABSTRACT

This work of heart and love this one created to share and to contribute a grain of sand in
the construction of the new human being, this human being who grows and develops in
spite of the blind mind of the ignorance; towards the capture of conscience to provide
the disability and an acceptance of the differences with all we wake the voice of the
community up musestic, and activate the social museum; we all have the same duties
and rights.
Discart Mind Eyes Museum is a museum specially directed for persons with visual
disability of any degree, without exclusion of the public in general that visits the
museums of Quito; this museum possesses (relies on) 3 rooms of exhibition, a room of
workshops, an area of information and receipt, besides wide areas of recreation and
simulation of environments high technology in systems of audio and sound to offer to
the disabled visitor comfort and entertainment at the same time as information is given
and knowledge brings over of the contemporary art in the Ecuador.
This work contains investigations (researches) on the disability across the history, the
different types of visual disability that they can present, the laws of the disabled
persons, the Ecuadoran institutions that work with disabled persons between(among)
another information.

15

INTRODUCCIN

A lo largo de la historia siempre han existido conflictos acerca de la


normalidad y la anormalidad, conflictos de carcter conceptual, filosfico y
moralista; sin embargo nunca se ha llegado a un acuerdo de lo que es
normal, y que es anormal. Ms all de lo establecido por las conductas
sociales sobre las cualidades y caractersticas de las personas normales, se
encuentran un grupo social a los cuales estas caractersticas y cualidades
son impropias.
Las personas con discapacidades han estado a la par de todo el ajetreo del
mundo moderno, superando las limitaciones que pueden sostener algunas
sociedades, superando sus propias cualidades y estableciendo regimenes
de vida de real admiracin y fortaleza. Este trabajo aunque un poco corto y
superficial lo que pretende es resaltar el valor de las personas con
discapacidad as como tambin el papel desempeado dentro de una
sociedad como la de los ecuatorianos, que se encuentra siempre en
constante cambio debido a sus caractersticas pluriculturales y pluritnicas
y por que no decirlo a su extrema capacidad para adoptar las influencias
forneas. Este trabajo es una oportunidad al cambio, un aviso de
prevencin y un expectante de nuevas museologas ms humanas.

16

1.1.-ANTECEDENTES HISTRICOS
A lo largo de la historia de la humanidad siempre ha habido nios discapacitados y
superdotados. Sin embargo, los programas de educacin especial son relativamente
recientes. En tiempos pasados, las personas discapacitadas iban frecuentemente a parar
a hospitales, asilos u otras instituciones que proporcionaban una formacin escasa, si es
que impartan alguna.
En la prehistoria, a medida que las distintas tribus y agrupaciones humanas se
movilizaban buscando mejores cotos de caza o despus mejores tierras para realizar sus
cultivos, decidan abandonar a su suerte a las personas discapacitadas, para no
entorpecer los desplazamientos del resto de la tribu. Durante la poca de las primeras
civilizaciones, los espartanos de la antigua Grecia, arrojaban desde el Monte Tai geto a
las personas con discapacidad, pues no queran que "en su bella y floreciente
civilizacin" existieran personas diferentes.
La historia de los discapacitados no ha sido nunca estable ni segura, lo cierto es que las
desviaciones de cualquier tipo siempre nos han parecido una amenaza, lo diferente nos
molesta, pero al mismo tiempo tenemos una fuerte curiosidad por aquello que nos
parece sobrenatural, desde considerarlos demonios hasta dioses, de lo mtico a lo vulgar.
En esa eterna bsqueda nos hemos encontrado con contrastes muy notables; as como
entre los animales hay quienes destruyen a sus cachorros imperfectos o simplemente los
dejan morir, existen animales que los protegen amorosamente.
Los hombres tambin a lo largo de la historia les han dado diferentes tratamientos a las
personas con algn tipo de discapacidad.

En la Grecia del siglo IV a.C. El eminente filsofo Aristteles trat de


interpretar algunas desviaciones, existen registros de estudios de las diferencias
fsicas y mentales realizadas por Digenes, Hipcrates y Galeno quienes
estudiaron la epilepsia, y la demencia, entre otras formas atpicas.
Los indios Masai asesinaban a sus nios discapacitados.
Los Chagga de frica Oriental utilizaban a sus discapacitados para ahuyentar al
demonio.
Los antiguos Hebreos crean que los defectos fsicos eran una marca del pecado.
Los Jukun de Sudan consideraban que eran obra de los malos espritus y los
abandonaban para que murieran.
Los Semang de Malasia empleaban a sus lisiados como hombres sabios.
Para los Nrdicos los discapacitados eran verdaderos Dioses.
En algunas sociedades antiguas, era normal el infanticidio cuando se observaban
anormalidades en los nios y nias; un ejemplo est en el pueblo de Esparta que,
por su carcter ofensivo, no permita miembros no vlidos.

17

Durante la Edad Media, principalmente en Francia, se construyeron verdaderas


fortalezas y ciudades amuralladas en donde se guardaban y escondan a
centenares de personas con algn tipo de discapacidad.
En el siglo XIV, los nacidos con alguna deficiencia ya sea fsica, sensorial o
mental, como la sordera, la ceguera, la parlisis, la cuadriplejia, entre otros, eran
confinados a grandes encierros, en los que eran exhibidos los fines de semana a
manera de espectculo circense o de gran zoolgico, para que las familias se
divirtieran un poco o bien, manejando la conciencia social, rectificaran los actos
cometidos en el pasado, por considerar a estos "monstruos" o "fenmenos" como
la ms grande seal de un castigo enviado por Dios.
Posteriormente, los "anormales", constituyeron un pretexto tambin de Dios para
despertar la caridad, el fin: la promesa de salvacin y vida eterna. Por lo menos,
ya no eran considerados "fenmenos", ahora eran llamados "miserables"; su
funcin ya no era la de divertir, ni la de solamente despertar el arrepentimiento,
sino que su funcin sufri un cambio aparentemente ms "digno": el de ser los
portadores del objetivo de Dios, liberar a los "normales" del pecado, por la
caridad. 1

Esto fue lo que en trminos generales la sociedad oblig a creer durante mucho tiempo a
las personas con alguna deficiencia: personas minusvlidas, sin valor, incapaces de
desarrollar una conciencia crtica, un sentimiento; seres por tanto, sin voz ni voto.
Tras la aparicin de la iglesia cristiana, se condena el infanticidio pero se alienta a
atribuirles el origen de cualquier suceso sobrenatural y se les denominan endemoniados
o endemoniadas, personas posedas por el demonio y otros espritus infernales,
sometindoles a prcticas exorcistas.
Como puede observarse, muchos han sido los papeles sociales y los conceptos que se
han manejado alrededor de las personas discapacitadas en las diferentes sociedades y
culturas, sin embargo en la gran mayora de los casos, no han sido justas ni favorables e
incluso la exclusin social se ha exacerbado durante algunas pocas.
Durante los siglos XVII y XVIII, a quien tena una discapacidad psquica se le
consideraba persona trastornada, que deba ser internada en orfanatos, manicomios sin
recibir ningn tipo de atencin especfica. Se les denominaba imbciles, amentes,
dbiles mentales, diferentes, locos o locas. A finales del siglo XVIII y principios del
XIX, se inicia la institucionalizacin, de modo especfico, de quienes tienen una
discapacidad psquica. Esto se debi a la idea de que haba que proteger a las personas
normales de la no-normal. La persona con discapacidad es separada, segregada,
discriminada. Aparece la terminologa nios y nias idiotas en el entorno de quienes
investigan la materia y, posteriormente desde el mbito mdico, oligofrnico u
oligofrnico.
Esta situacin se alarga hasta comienzos del siglo XX por ser considerados como seres
perturbados y perturbadores, antisociales y obsesos sexuales.
1 www.discapnet.es/Discapnet/Castellano/Accesibilidad/Lenguaje/Lenguaje_007.htm -

Por ejemplo, durante el siglo XX se cometieron grandes crmenes en Alemania, por el


ejrcito Nazi, durante la segunda guerra mundial, diversas atrocidades se realizaron, "en
busca de la raza perfecta" en la cmara de gases o con la ingestin de sustancias letales
que se proporcionaron en forma selectiva, antes que a nadie, a las personas con
168

discapacidad mental para aniquilarlas tratando de construir un supuesto mundo de "seres


perfectos".
El racismo, intolerancia y complejos de superioridad, imperaron en esa poca no solo
para exterminar a los judos, mujeres y ancianos; sino tambin a las personas con
discapacidad. En este mismo siglo, las personas con discapacidad dieron origen a una
industria floreciente en los pases ricos, en donde se construyeron enormes edificios,
llenos de pseudo especialistas, algunas veces en condiciones precarias, otras veces con
todo el lujo posible. En donde han reunido a personas con discapacidad mental para que
vivan all para siempre, olvidados de sus familias y de la sociedad. Considerando que no
deban de molestar a las dems personas, ni tampoco constituir las manchas de las
ciudades, y otras consideraciones.
En Suecia, hasta mediados de los aos 70, se esterilizaba a las personas con
discapacidad, incluso, sin su consentimiento.
Sin embargo desde hace muchos aos, han surgido personas que iniciaron un camino de
liderazgo para hacer que las personas con discapacidad puedan vivir mejor, Toms
Moro, en libro clsico "Utopa", describe las relaciones que se pueden establecer entre
las personas con discapacidad y las personas aparentemente normales; as como los
sentimientos y espritu de fraternidad que surgen entre ellos. Considerando a las
personas a cargo de los discapacitados como privilegiadas, que deban ser seleccionadas
cuidadosamente, con las ms altas condiciones morales, pues deberan de ser las ms
fuertes, las ms nobles; ya que ellas tendran la mejor tarea a desempear en esta ciudad
utpica, estaran en contacto con los seres ms nobles, puros y queridos, las personas
con discapacidad.
En materia de discapacidad vivimos an en una jungla al inicio del nuevo milenio en la
que se cristaliza la mxima Darwiniana de la "supervivencia del ms fuerte". En nuestra
sociedad moderna, dos tercios del mundo no cuentan con facilidades especiales, ni
mdicas, ni educativas para los discapacitados, y otros continan ponindoles rtulos,
los segregan fsica, educativa y emocionalmente del resto de la poblacin, con abusos,
exclusin, carencia de oportunidades, marginacin, falta de valoracin, discriminacin,
indiferencia, negligencia, olvido y hasta vergenza. Este es el panorama real mundial en
nuestros das, que nos muestran los reportes de las organizaciones internacionales de
discapacitados.

1.2.1. EVOLUCIN EDUCATIVA.Entre las aportaciones ms antiguas al campo de la enseanza a sujetos con problemas
especiales, se debe mencionar el nombre de fray Gilabert Jofre, quien a comienzos
del siglo XV cre en Valencia un centro en el que se prestaba atencin a personas con
defectos psquicos. A mediados del siglo XVI, el monje benedictino espaol Pedro
Ponce de Len fue el precursor de un mtodo para la enseanza de estudiantes sordos.
Juan Pablo Bonet desarroll otro mtodo para la enseanza de este grupo de personas y
en 1620 public el primer libro sobre la educacin de los sordos. La primera escuela
para invidentes fue fundada en Pars en 1785 por el educador francs Valentn Hay,
con el nombre de Institution Nationale, y todava hoy existe. En 1790 se abrieron
169

escuelas para ciegos necesitados en Inglaterra y Escocia. Su propsito original era la


formacin de estas personas en oficios manuales, pero, unos aos despus, se adopt un
sistema de educacin general. En 1806 Hay fund una escuela en Rusia y particip en
el establecimiento de otra en Berln. Estas escuelas tuvieron tanto xito que hacia 1811
existan instituciones similares en toda Europa.
Dentro de este mismo tipo de discapacidad ha de mencionarse la investigacin, a finales
del siglo XIX, de Louis Braille, quien descubri el mtodo que lleva su nombre, de
amplia difusin en la actualidad. El doctor y educador francs Jean Marc Gaspard Itard
fue uno de los primeros educadores en defender que deberan aplicarse unos mtodos
educativos especiales para la formacin de los nios discapacitados. En 1801 Itard
descubri vagando por los bosques de su regin un nio salvaje, y entre 1801 y 1805
us sistemticamente ciertas tcnicas para ensear a Vctor (ese fue su nombre) a
comunicarse con sus semejantes, as como a realizar acciones cotidianas tales como
vestirse. Un discpulo suyo (Edouard Sguin) llev las tcnicas de Itard a Estados
Unidos, donde experimentaron un importante progreso.
A partir del ltimo cuarto del siglo XX se ha prestado una gran atencin a la educacin
especial en los pases desarrollados. En estos aos se oper un cambio radical en las
actitudes profesionales y pblicas hacia las necesidades especiales que marc el
comienzo de un gran movimiento hacia la integracin de las personas con dificultades
educativas dentro de las escuelas ordinarias.
Con la aparicin de las escalas de inteligencia se comienza a hablar de torpes y
retrasados o retrasadas. Segn se avanza en el tiempo, hablamos de deficiencia mental,
minusvalas, handicapado, discapacidad psquica, y, finalmente, con la nueva
conceptualizacin de la A.A.R.M (Asociacin Americana de Retraso Mental) se habla
de retardo mental, aunque otras corrientes y estudios prefieren utilizar trminos como
discapacidad intelectual.
Lo cierto es que, segn se avanza en la aceptacin de la diversidad de personas, la
sociedad incorpora trminos y matiza Conceptos. Por ejemplo, en un nivel educativo, la
L.O.G.S.E. (ley de Orientacin General del Sistema Educativo) introduce el Concepto
de alumnos o alumnas Con necesidades educativas especiales. Dicho Concepto supone,
por un lado, la aceptacin de la diversidad y, por otro, la posibilidad de atender
especficamente a cualquier persona porque todas y todos podemos necesitar de una
educacin especial de forma definitiva o de forma temporal.
Los padres se han ido involucrando activamente en la evaluacin y en la revisin de las
necesidades educativas de sus hijos y cada vez muestran con ms inters su preferencia
(limitada a ciertas condiciones) a que sus hijos se eduquen en escuelas ordinarias. La
ampliacin de servicios sociales y de salud ha contribuido a valorar mejor las
necesidades educativas especiales que permitan identificar los puntos fuertes y los
dbiles de cada alumno con el fin de asegurarle la educacin ms apropiada dentro de
un amplio abanico de necesidades educativas especiales. En la prctica, las buenas
intenciones no siempre culminan en logros satisfactorios. En cualquier caso, hay que
constatar que este proceso de cambio en la mayora de los pases de Europa y del mundo
en general ha contribuido a que las familias afectadas y las escuelas demanden a los
poderes pblicos leyes y mtodos de aprendizaje que garanticen el derecho a una mayor

170

integracin en las escuelas y centros de formacin de las personas con necesidades


especiales.
En el ao, 2006, fue el Sesquicentenario de la fundacin de la Escuela para los Ciegos y
Discapacidades Visuales de Texas. En 1856, cuando se fund la TSBVI (Tecnologa
Asistiva de Outreach), no slo estaba Texas en la frontera del oeste norteamericano,
sino que la educacin para las personas con ceguera y discapacidades visuales tambin
estaba en la frontera de la educacin. En esa poca, no haba un cdigo de lectura tctil
estndar para las personas ciegas. Como reconocimiento a los avances y cambios en la
educacin de los ciegos en los ltimos 150 aos, presentamos una descripcin de los
cdigos de lectura y escritura tctil para las personas ciegas.

1.3.-DEFINICIONES
Y
CLASIFICACIONES
DISCAPACIDAD VISUAL:

EN

TORNO

LA

1.3.1. LA BAJA VISIN Y LA CEGUERA


Para evaluar el grado de discapacidad en un individuo se debe medir el
desenvolvimiento de sus actividades diarias. Segn la Organizacin Mundial de la
Salud (OMS), se estima que el 10% de la poblacin mundial sufre de algn tipo de
discapacidad, existiendo en el futuro un notable incremento debido al crecimiento
demogrfico de la poblacin, as como sus actividades en eventos catastrficos tanto
naturales como artificiales (guerras, accidentes); peligros que aumentan con la edad y la
mayor exposicin a riesgos laborales o enfermedades.
La vista y el odo son los dos principales canales a travs de los cuales una persona
percibe y experimenta el mundo. Cuando estos canales sufren un deterioro, bien sea por
lesiones o enfermedades, el mundo de estas personas queda restringido, generando una
serie de problemas que varan de acuerdo a la personalidad del ser humano, pero que
afecta su interaccin con el entorno. Pero si esta enfermedad conlleva a una
discapacidad, el trastorno produce un desequilibrio mayor, necesitando una atencin
especializada con programas rehabilitadores, que permitan su incorporacin al medio
social
Slo la ceguera total implica ausencia de visn. La mayora de las personas ciegas
conservan restos visuales tiles para la movilidad e incluso para la lectoescritura en tinta
sistemticamente.
Entre los lmites que se han dado en llamar inferior y superior de la discapacidad visual
grave, en cuyos extremos estaran la ceguera total y la visin normal se sita una
terminologa ms o menos afn, pero que entraa matices y modos de ver de muy
distinta funcionalidad.
Si bien existen muy diversos factores que inciden en la visin, son los parmetros de la
agudeza visual de lejos (AVL) y del campo visual los ms usuales para la valoracin de
la misma, sobre todo en el mbito asistencial, incluido el educativo. En torno a ellos
gira el concepto de ceguera legal, casi unificado para los pases occidentales,
considerndose que un ojo es ciego cuando su agudeza visual con correccin es 1/10
(0,1), cuyo campo visual se encuentre reducido a 20 (Crespo, 1980).
171

No obstante, estos parmetros no son adoptados unnimemente por la comunidad


internacional.
Lmite superior de la ceguera legal en trminos de agudeza visual (Herren y
Guillemet, 1982)
Suecia..........................................1/30 (0,03).
Alemania...................................... 2/50 (0,04).
Francia, Holanda..........................1/20 (0,05).
Canad, Espaa, Italia, USA, UK.1/10 (0,10).
En Espaa, se reconocen como personas subsidiarias de prestaciones econmicas y
servicios educativos especiales (Orden de 8 de mayo 1979) a las personas ciegas,
aquellas que tienen una agudeza visual de lejos menor de 20/200 (Garca Viso, 1992).
La amplitud del campo visual para esta misma condicin, tanto en Espaa como en
otros muchos pases ha de ser igual o inferior a 10.
Tomando como factor clasificador exclusivo la agudeza visual, Herren y Guillemet
(1982) proponen la siguiente clasificacin de las personas con disfuncin visual grave:
Categorizacin Lmite inferior Lmite superior
Ciego total 0 DC = 0,5 m (*)
Ciego parcial 1/50 (0,02) 2/50 (0,04)
Amblope profundo 3/50 (0,06) 4/50 (0,08)
Amblope p.d. (**) 1/10 (0,10) 4/10 (0,40)
(*) Medida de la agudeza visual de lejos que debe entenderse como la capacidad de la
persona para contar dedos a 0,5 m.
(**) Amblope propiamente dicho. Terminologa para un concepto que no se
corresponde con el oftalmolgico, sino con una concepcin funcional del resto visual.
Herren y Guillemet (1982) definen bajo el trmino ambliopa una disminucin
importante de la visin de ambos ojos, que deja, sin embargo, un residuo visual
compatible con ciertos aspectos de la vida corriente, fijndose el lmite superior de
la visin residual en 4/10 (0,4).
Una clasificacin de las discapacidades visuales basadas en los parmetros
suficientemente sealados es la Tabla de Niveles de Deterioro Visual, fundados en las
recomendaciones del Grupo de Estudio sobre la Prevencin de la Ceguera de la OMS
(Ginebra, noviembre 6-12,1972; Serie de Informes Tcnicos de la OMS, 518), y del
Consejo Internacional de Oftalmologa de 1976 (MSC, 1994). Esta clasificacin ha
servido a las administraciones pblicas y organizaciones no gubernamentales de los
distintos pases en la toma de decisiones respecto a la prestacin de los servicios
sociales dirigidos a las personas afectadas de discapacidad visual.
La VISIN (CASI) NORMAL se correspondera con los niveles de deterioro visual
situado en la gama de visin normal o de visin casi normal (AVL entre 2,0 y 0,8.;
siendo la AVL normal igual a la unidad <1,0>).
La BAJA VISIN, trmino que se retomar ms adelante, se correspondera con los
niveles de:

172

(a) Deterioro visual moderado (AVL entre 0,25 y 0,12), baja visin moderada; y
(b) deterioro visual grave (AVL entre 0,1 y 0,06) y/o campo visual de 20
menos), baja visin grave.
La CEGUERA (en uno o en ambos ojos; en trminos de ceguera legal, siempre en el ojo
de mejor visin, tomando la de ambos ojos siempre con correccin ptica) se
correspondera conos niveles de:
(a) deterioro visual profundo (AVL entre 0,04 y 0,02; DC a menos de 3 m; o campo
visual de 10 menos), baja visin profunda;
(b) deterioro visual casi total (AVL de menos de 0,02; DC a 1 m menos; MM (*) a 5
m menos; o Proyeccin/percepcin de luz; o un campo visual de 5 menos), ceguera
grave o casi total; y,
(c) deterioro visual total (Ninguna percepcin de luz), ceguera total.
La OMS (1980) sugiere como lmite superior de la discapacidad visual una agudeza
visual de lejos, en el ojo de mejor correccin, equivalente a los 3/10 (0,3) de la
considerada como normal.*
Otros autores acuan trminos como dificultad visual severa, deficiencia visual
grave, visin subnormal, visin parcial, visin residual, etc., para definir el
tramo intermedio entre la visin normal y la ausencia total o casi total de visin,
caracterizado por un sistema visual con alteraciones irreversibles y con una
prdida en la capacidad visual que constituye un obstculo para el desarrollo de la
vida de las personas (Faye, 1972).
Otro trmino, ms reciente en la literatura profesional, baja visin, se emplea para
definir un intervalo de capacidad de visin que se sita entre la visin normal y la
ceguera total, caracterizado por una visin funcional segn circunstancias fisiolgicas,
ambientales y psicolgicas. Trmino que para Corn (1989) se asocia a un nivel de
visin que, con correccin estndar, impide a la persona la planificacin o la
ejecucin visual de una tarea pero que mejora el funcionamiento mediante el uso
de ayudas, pticas o no pticas, adaptaciones del medio, o el empleo de tcnicas.
La controversia bsica respecto a la visin limitada no radica en cmo llamarla o en
cmo describirla, sino con qu vara se mide (Dickman, 1988). Las discrepancias surgen
en cmo averiguar cul es el comportamiento visual, lo que una persona ve con el
resto que posee.
La inexistencia, pues, de criterios unificados en materia de definicin basada en la
clasificacin de las personas con discapacidad visual originan diferencias en las
normativas gubernamentales con una clara repercusin en las prestaciones educativas,
econmicas, sanitarias y de otro ndole social.
Todo ello a pesar de los distintos informes de la OMS que tratan de propiciar criterios
ms o menos homogneos en cuanto a la definicin y a la clasificacin.

Interedvisual@telefonica.net
Manuel Bueno Martin

En este sentido la Clasificacin Internacional de Enfermedades - CIE- 9 Revisin,


define a un nio de baja visin como a un individuo de menos de 16 aos cuya
agudeza visual corregida para el ojo de mejor visin es menor de 6/18 (0,3), pero
173

igual o mayor que 3/60 (0,05). Los nios de esta categora requieren atencin especial
para su educacin y permanente cuidado ocular para prevenir mayor deterioro de la
visin (OMS, 1994).
La definicin funcional de la baja visin: Una persona con baja visin es quien tiene
un impedimento del funcionamiento visual y, aun despus de tratamiento y/o
correccin, tiene una agudeza Visual de 6/18 hasta percepcin de luz, o un campo
visual de 10 desde el punto de fijacin, pero que usa la visin para la planificacin
y/o ejecucin de una tarea visual (OMS, 1994).
En identificacin con las caractersticas educacionales de las personas de baja
visin, Barraga (1992) estableci cuatro niveles de discapacidad visual que guardan
correlacin con los Niveles de deterioro visual y coincidente con la efectuada por
Colenbrander (1977):
a) Ceguera: Carencia de visin o slo percepcin de luz. Imposibilidad de realizar
tareas visuales.
b) Discapacidad visual profunda: Dificultad para realizar tareas visuales gruesas.
Imposibilidad de hacer tareas que requieren visin de detalle.
c) Discapacidad visual severa: Posibilidad de realizar tareas visuales con
inexactitudes, requiriendo adecuacin de tiempo, ayudas y modificaciones.
d) Discapacidad visual moderada: Posibilidad de realizar tareas visuales con el
empleo de ayudas especiales e iluminacin adecuada similares a las que realizan las
personas de visin normal.
Otro criterio de clasificacin desde el punto de vista educacional es el seguido por
Bueno y Ruiz (1994), que responde a la capacidad visual para utilizar el sistema
lectoescritor en tinta de manera funcional, excluyendo cualquier otro nivel de
competencias. As surgen dos grupos:
a) Personas con deficiencia visual grave sin restos aprovechables para la
lectoescritura funcional en tinta. Esta categora se corresponde con los grupos
ceguera y discapacidad visual profunda de la clasificacin anteriormente sealada. Son
personas de nulo o pobre resto visual, aunque su capacidad visual les permita ver
grandes titulares en tinta e incluso textos con ayuda de auxiliares especficos estticos, y
que han de recurrir al braille para poder leer lo que escriben.
b) Personas con deficiencia visual grave con restos para la lectoescritura en tinta.
Se corresponde con los grupos de personas con discapacidades visuales severa y
moderada. Son personas que tienen acceso a la lectura y la escritura en tinta aunque
necesiten lentes e instrumentos especficos en el desempeo de una o ambas tareas.
En adelante, siempre que se haga referencia a personas con ceguera (ceguera funcional)
o de baja visin, se har alusin a esta clasificacin establecida segn el
comportamiento visual: ciegos y ciegas, las personas del primer grupo; de baja visin,
las del segundo.
Las personas con ceguera legal, pueden, segn el criterio ltimamente establecido, estar
en uno u otro grupo. As, pues, deshaciendo tpicos, debemos descartar que la ceguera
legal conlleve impedimento para ver. En contra de lo que pudiera pensarse, la mayora,
como apuntbamos al principio, tiene resto visual, e incluso puede realizar tareas como
la lectura en tinta sin necesidad de ningn tipo de auxiliar ptico. Es por ello que, por
extrao que pudiera parecer, encontramos vendedores de cupones que miran para
comprobar el nmero que han de dar a los compradores.

174

Por tanto en la evaluacin de la funcin visual se estudia la agudeza visual y el campo


visual de cada uno de los ojos. Su cuantificacin nos permite establecer las siguientes
situaciones:
Visin normal: cuando la agudeza visual del mejor de los dos ojos es superior o igual a
0.8 y el campo visual es normal.
Visin casi normal; si la agudeza visual del mejor ojo est comprendida entre 0.7 y 0.5
Siendo normal el campo visual.
Visin subnormal: la agudeza visual est comprendida entre 0.4 y 0.3 o el campo
visual est limitado a 40 grados.
Baja visin agudeza visual entre 0.25 y 0.12 o el campo visual disminuido hasta los 20
grados.
Ceguera legal; si la agudeza visual es igual o inferior a 0.1 y el campo visual est
reducido a 10 grados o menos. Esta situacin permite a una persona tener la
consideracin legal de ciego.
Por otra parte y en la prctica dentro del grupo de personas con ceguera legal hay un
rango de diferentes grados de afectacin de la funcin visual dentro de ese margen
cuantitativo de 0.1 a 0 que nos permite diferenciar entre:
Deterioro visual profundo: agudeza visual entre 0.1 y 0.02 o el campo visual est entre
10 y 5 grados. 3
Deterioro visual casi total: agudeza visual inferior a 0.02, contar dedos a un metro, ver
solo movimientos de la mano o de objetos a un metro o menos, localizar una fuente de
luz en ese espacio prximo o tener un campo visual inferior a 5 grados.
Deterioro visual total o amaurosis: ausencia de percepcin de luz.
Todos los alumnos que participaron en esta investigacin, estaban dentro de los
parmetros de ceguera legal y de baja visin, siguiendo las pautas de clasificacin que
hemos presentado anteriormente. Con vistas a determinar la prevalencia de la
minusvala visual, detectndose la misma en un 30,8%. Dentro de las causas ms
frecuentes se encontraron el glaucoma con 9,52% y las ametropas con 8,40%. Existi
un sub. Registro de algunas enfermedades invalidantes de la agudeza visual como la
retinosis pigmentaria, los cuadros degenerativos y las cataratas por presentar muy
escaso porcentaje, siendo las mismas causas de cegueras en el mundo. En la tabla 1 se
reflejaron los grupos de edades comprendidos en nuestro estudio. Observe que, tanto en
los pacientes foliados como en los no foliados, el nmero se incrementa con la edad
predominando las personas ms ancianas, con 13 pacientes en los foliados y 49 en los
no foliados; lo que represent el 40% del total de discapacitados visuales.
3

Interedvisual@telefonica.net Manuel Bueno Martin

175

Tabla 1. Discapacitados visuales segn grupo de edades.


Edades

Foliados

No Foliados

Total

0-15 aos

30

12

42

10

16-30

51

16

67

16

31-45

33

27

60

14

46-60

70

17

87

20

61 ms

123

49

172

40

Total

297

121

418

100

Fuente: Estudio de discapacitados.


Se relaciona el sexo en la tabla 2 donde no se aprecia relacin significativa entre ambos
sexos aunque hubo un pequeo predominio del femenino (50,5%). En la tabla 3 se
recogen las principales causas de discapacidad visual. Ntese que la comisin valor
418 discapacitados, pero de ellos slo 357 presentaron trastornos oculares.
Con respecto a las causas de discapacidad, las Ametropas y el glaucoma fueron las de
mayor incidencia; las primeras con 54 discapacitados y 30 minusvalas para un 8,4% y
la segunda con 34 discapacitados y el mismo nmero de minusvalas representando el
9,52%.
Al resumir los datos de la tabla 3, se constata que, de 357 enfermos con trastornos
visuales, 155 (43,4%) eran discapacitados y 110 minusvlidos para un 30,8%.
Tabla 2. Discapacitados visuales segn sexo.
Sexo

Foliados

No Foliados

Total

Masculino

150

57

207

49,5

Femenino

147

64

211

50,5

Total

297

121

418

100

Fuente: Estudio de discapacitados.


Tabla 3.Discapacitados visuales segn causas y grado de repercusin.
Causas

Total

Deficiencias

Discapacidad

Minusvala

Ametropias

239

239

54

30

8,40

Glaucoma

37

37

34

34

9,52

Enf / Degenerativas 21

21

20

10

2,80

Ausencia Globo

14

14

14

14

3,92

Estrabismo

12

12

----

----

Cataratas

1,12

Malf. Congnitas

0.84

Enf Metablicas

1,14

Retinosis

1,14

176

Pigmentaria
Enf/ Nervio ptico

0,84

Desprend. retiniano 2

0,56

Subtotal

357

357

155

110

30,8

No Enf. Ocular

61

Total

418

43,4%

Fuente: Estudio de discapacitados


Las discapacidades en el ser humano son alteraciones que aumentan con el decursar de
los aos (fundamentalmente en personas mayores de 60 aos) y surgen como
consecuencia de agresiones psquicas, fsicas o ambas, provocando afectaciones de
rganos o sistemas. Segn la bibliografa consultada, el sexo femenino tiene mayor
incidencia de discapacidad, lo cual no fue palpable en este estudio. Para analizar los
datos de la tabla 3, donde se recogen las principales causas de discapacidad visual, se
utiliz la Grfica de Integracin de Conceptos propuesta por lvarez Sints, donde una
enfermedad lleva a una deficiencia estructural o funcional; la cual a su vez puede o no
conllevar a una discapacidad, y si se profundiza el cuadro puede ocasionar una
minusvala. En ocasiones, una deficiencia severa puede llevar a una minusvala sin
pasar por la discapacidad.

GRFICA: Integracin de conceptos.

Llama poderosamente la atencin que en este estudio no se reflejaron con incidencia


altas las cataratas, las enfermedades degenerativas, la retinosis pigmentaria y las
enfermedades metablicas, entidades que constituyen verdaderas causas de ceguera en
todo el mundo, en contraste con estudios realizados por otros autores.

1.4.- TIPOS DE ESCRITURAS Y LENGUAJES


177

La realidad existe segn se nombra.


El lenguaje es un elemento clave en la construccin de la cultura y del pensamiento. Los
lenguajes que hablan las diferentes sociedades surgen de la necesidad de comunicarse,
de transmitir valores, expresar sentimientos,. ..La palabra hablada y escrita es lo que
diferencia la forma de comunicacin de las personas de la de cualquier especie animal.
El contexto social en el que persona se desenvuelve va a determinar el lenguaje y, por
tanto, el pensamiento de la persona. No es lo mismo desarrollarse en un contexto social
que en otro.
Por ello, cada lengua refleja las reglas socio-comunicativas, los valores y las formas de
percibir el mundo del grupo que lo habla, la que es aceptable y lo que no lo es, lo que se
puede y lo que no, los mandatos, las metas, lo insignificante, lo importante...
Lenguaje y sociedad son dos conceptos que interactan recprocamente. La sociedad
cambia y con ella el modo de expresarnos. Los valores que tiene una sociedad estn
escritos en el lenguaje, a la vez que el lenguaje refleja y refuerza los valores de cada
sociedad.
El lenguaje, adems, es un instrumento de clasificacin de la realidad. A travs del
lenguaje nombramos la realidad, le ponemos etiquetas; tambin la interpretamos y la
creamos simblicamente cuando establecemos abstracciones o cuando generalizamos.
Construiremos la realidad, segn la nombremos.
Expresiones como "Le gusta ms que a un tonto un lpiz", "Sale ms caro que un hijo
tonto" o "Le falta un hervor" denotan que, en nuestros esquemas mentales, incluso de
forma inconsciente, percibimos a las personas con discapacidad en un plano inferior que
quienes no la tienen.
El lenguaje es una construccin social e histrica que influye en nuestra percepcin de
la realidad: condiciona nuestro pensamiento y determina nuestra visin del mundo.
1.4.1.- ESCRITURA Y PUBLICACIONES.La primera impresin en relieve sobre papel para posibilitar la lectura de invidentes fue
desarrollada por Hay en 1784. Utiliz letra itlica; ms tarde se ensayaron otros tipos
de letra. Pero se hacan necesarias letras muy grandes, y los libros eran muy
voluminosos y caros. El nico sistema utilizado de letras de lneas (caracteres formados
por lneas en relieve) se basa en los perfiles de las letras de imprenta y fue desarrollado
por el ingls William Moon en 1847.
En 1821 un capitn del ejrcito francs, Charles Barbier, invent un sistema de letras de
puntos, cdigo alfabtico basado en grupos de puntos. Louis Braille adapt el sistema
de Barbier utilizando grupos de 1 a 6 puntos. La conferencia de Londres de educadores
de invidentes de 1932, estableci el modelo para los sistemas de puntos, adoptando un
alfabeto conocido como Standard English Braille. ste es idntico al Braille original
con algunas pequeas modificaciones. Este sistema se usa en todo el mundo
angloparlante y ha sido adaptado a la mayora de las lenguas, incluido el chino. Braille
tambin dise un sistema de caracteres de puntos para la escritura musical.
Entre los primeros instrumentos que se disearon para esta escritura destaca la pizarra o
pizarrn de surcos, que consiste en una hoja metlica o de madera labrada en forma de
pequeos cuadrados. El papel se colocaba sobre la pizarra, y el lpiz, guiado por los
surcos, marcaba un relieve sobre el papel, obtenindose una caligrafa manual
cuadrangular que se poda ver y tocar. En la actualidad se utilizan mquinas de escribir
para comunicarse con las personas videntes, y pizarras para guiar al escritor en la
178

formacin de caracteres Braille. Adems se dispone de la mquina de escribir Hall


Braille, una modificacin de la mquina de escribir normal, que crea caracteres Braille
en el papel en lugar de imprimir en l caracteres visuales.
Los pacientes invidentes y sordos, con o sin capacidad de hablar, deben ser tratados de
manera individualizada. Su rehabilitacin requiere profesores especiales y siempre
depende de la comprensin personal y de la paciencia. 4

1.5 El SISTEMA BRAILLE


Antecedentes Histricos
De entre los muchos mtodos ensayados para la lectura y la escritura de los ciegos, el
sistema braille, inventado en 1825 y modificado segn las necesidades en distintas
convenciones, es hoy da el ms extendido, si bien su aceptacin y difusin no fue fcil
ni rpida debido a que supona una ruptura con la tendencia hasta entonces basada en el
empleo de letras en relieve.
Han existido muchos otros medios de lectura tctil para personas ciegas en los ltimos
200 aos. Originalmente, la mayor parte de la instruccin en lectura se haca con libros
con letras grabadas o en relieve creadas humedeciendo el papel e imprimiendo con tinta
en una prensa letterpress. Las personas tambin aprendieron las letras y a leer usando
letras talladas en madera dispuestas en palabras y con letras hechas con alambre torcido
y doblado. Por muchos aos los educadores de los ciegos pensaban que al tener un
cdigo tctil con letras diferentes a las que leen las personas videntes, las personas
ciegas quedaran fuera de la tendencia normal de la sociedad y que esto limitara la
cantidad de material de lectura a los que tienen acceso. Tener cdigos de lectura
especiales tambin significara que la capacitacin de los profesores fuera ms
demandante y ms difcil encontrar profesores capaces de trabajar con estudiantes
ciegos. En el tiempo en que Louis Braille estaba desarrollando su cdigo, tambin se
estaban desarrollando otros cdigos. Muchos estudiantes ciegos aprendan en secreto
Braille y otros cdigos de escritura tctil basados en puntos cuando sus escuelas
oficialmente enseaban con letras grabadas. Finalmente, las letras con puntos del Braille
se transformaron en el cdigo tctil ms ampliamente aceptado y en la mayor parte del
mundo.
Durante muchos siglos se ha credo que las personas carentes de visin eran incapaces
de ser educados y, si alguno destacaba por su inteligencia y cultura, era fruto de una
clarividencia innata o de una ciencia infusa. Tal es el caso de Ddimo de Alejandra
(311-358), ciego que goz de gran erudicin, llegando a dirigir la Escuela Catequstica.
Concibi un procedimiento de lectura y escritura basado en un conjunto de piezas de
marfil o madera de boj con letras en relieve usadas por los invidentes para formar
palabras y frases.

Historia de los Cdigos de Lectura para los Ciegos


http://www.nyise.org/blind/barbier2,htm

179

En 1517, el calgrafo napolitano, Girolamo Cardano, ide procedimientos para la lectura


y escritura de los ciegos, entre los que destacan la utilizacin de letras sueltas en relieve
realizadas en madera que el invidente aprende a distinguir y juntar, formando un texto,
as como, el aprendizaje de la escritura a partir de letras grabadas en relieve, sobre las
que el ciego, en un papel colocado encima y con un estilete, marca la silueta o los
contornos de las distintas letras.
Luis Vives, en su obra De subventione Pauperum(1525) recomienda no slo dar
trabajo a los faltos de vista, sino ensearles manual e intelectualmente con el fin de
hacerles tiles. Y, aunque algunos maestros e impresores como los que citamos- siguen
el ejemplo, en toda la Edad Moderna no se imparte instruccin alguna a invidentes.
Hasta el siglo XVI, como consecuencia del momento cultural que se vive en Europa
(Humanismo y Renacimiento), la preocupacin por, la educacin de los ciegos no
empieza a ser tenida en cuenta.
En 1543, el toledano Alejo Venegas del Busto, escribe invitando a los maestros en la
enseanza de los ciegos, a seguir el mtodo de los monjes de la Edad Media que
consista en leer y escribir a oscuras, lo que haban aprendido a hacer con los ojos
vendados utilizando tiralneas, con el fin de no gastar aceite y no fatigar la vista.
En 1545, el italiano Rampazetto en su libro, Ejemplares de letras grabadas en madera
para instruir a los ciegos, pretende que stos reconozcan al tacto el alfabeto visual en
letras sueltas y movibles para que puedan escribirlas.
Francisco de Lucas, impresor espaol que introdujo a Espaa la grabacin en relieve,
conoca los procedimientos de Flix Antonio de Cabezn y Francisco Salinas, ciegos
clebres.
En su obra Arte de escribir la letra bastarda espaola (1580), incluye reglas que
pueden servir para que los invidentes escriban, explicando el manejo de pautas para
trazar los caracteres vulgares con los ojos cerrados o vendados.
Si estos sistemas no llegaron a extenderse fue simplemente porque no existan escuelas
para ciegos y porque, tanto el reconocimiento de las letras en relieve a travs del tacto
como la escritura por medio de estos mtodos, son procesos especialmente complicados.
La idea de proporcionar educacin a las personas ciegas, al menos de una manera
generalizada, es relativamente reciente. Comienza cuando el francs Valentn Hay
funda en Pars, 1784, la Instution National des Jeunes Aveugles, sin el carcter de asilo
u orfanato que hasta ahora han tenido las instituciones creadas al efecto, es decir,
aparece la primera escuela para ciegos del mundo. En ella se educar Luis Braille.
En su aspiracin de equiparar lo ms posible la educacin de los ciegos a los niveles y
procedimientos seguidos en la educacin de los videntes, Hay idea un procedimiento
para la lectura y la escritura de los ciegos. Con moldes de letras en posicin inversa
aplicadas sobre papel hmedo se imprimen libros para ciegos que pueden ser ledos por
las personas con visin. Si bien permite la lectura, este mtodo no facilita la escritura.
El sistema Braille fue introducido en Espaa en el ao 1840 por Jaime Bruno
Berenguer, profesor de la Escuela Municipal de Ciegos de Barcelona. Tras diversas
vicisitudes, en 1918 fue declarado como mtodo oficial para la lectura y la escritura de
los ciegos en este pas (Montoro, 1985).
En el Ecuador fue introducido el sistema braille aproximadamente en 1920.

180

1.5.1. LOUIS BRAILLE


BRAILLE LOUIS (Coupvray, Francia, 1809-Pars, 1852) ciego desde los tres aos a
causa de un accidente, se educa en este sistema como alumno del instituto fundado por
Hay donde, finalizados sus estudios, es nombrado profesor de msica.
Advirtiendo las dificultades que sus alumnos, tambin ciegos, tenan para leer la msica
se interes por el sistema puntiforme inventado por Nicols Barbier y publicado en su
Sonografa (1822). Este sistema, ideado con fines militares, se basa en combinaciones
de doce puntos en relieve escritas mediante una pizarra y un punzn para ser descifradas
a travs del tacto de un dedo. En el Instituto Nacional para ciegos Louis Braille conoci
a Charles Barbier, inventor de un sistema de lectura para ciegos que Braille reform y
complet hasta convertirlo en el que iba a ser el sistema universal de lectura para los
afectados de ceguera. Dicho sistema, llamado Braille en honor a su inventor, consta de
63 caracteres formados de uno a seis puntos y que al ser impresos en relieve en papel
permiten la lectura mediante el tacto. As mismo, los caracteres que integran el sistema,
que Braille public en 1829 y 1837, estn adaptados a la notacin musical, lo cual
facilita su comprensin. El sistema barbier, usado tambin por los ciegos, es
considerado por Luis Braille como el precursor de su propio sistema en la advertencia
que pone al principio de cada una de las dos ediciones del mismo, publicadas en vida,
aos 1829 y 1837. En la primera, Luis Braille escribe: Si hemos indicado las ventajas
que tiene nuestro procedimiento sobre el de ese inventor (Barbier), hemos de decir en su
honor que debemos a su procedimiento la primera idea del nuestro. (Henri, 1988).
Luis Braille, a la edad de 16 aos redujo las combinaciones de doce a seis puntos, de
manera que cada una de ellas fuese percibida por la yema de los dedos, generalmente
los ndices, inventando as su propio sistema.
La combinacin de puntos en relieve en dos columnas de tres filas ideada por Luis
Braille que permite representar todas las letras del alfabeto, signos de ortografa, de
numeracin y aritmticos, supone tal renovacin en el acceso a la lectura y a la escritura
para los ciegos que se considera como mtodo universal.No obstante, Luis Braille muri
sin el reconocimiento que su sistema mereca. Enfermo de tuberculosis durante los
ltimos aos de su vida, a su muerte fue enterrado en su localidad natal y, en 1952, sus
restos fueron trasladados a Pars y enterrados en el Panten.Hasta 1854 no es aceptado
como mtodo oficial en la Institution Ryale des Jeunes Aveugles de Pars.
Posteriormente, en el Congreso Internacional celebrado en Pars (1878) se acord la
utilizacin del braille como mtodo universal por su probada utilidad didctica.
5

www.discapnet.es/Discapnet/Castellano/Accesibilidad/Lenguaje/Lenguaje_007.htm

1.5.2. LA LECTURA BRAILLE

181

El Braille, el cdigo de lectura y escritura actualmente usado en muchos pases de habla


inglesa y para hispanohablantes es utilizado por miles de lectores con sordo ceguera y
discapacidades visuales, fue inventado por Louis Braille. Braille era un francs que
perdi su visin en la infancia a causa de una infeccin en el ojo provocada por un
accidente con las herramientas para trabajar el cuero que tena su padre. Louis Braille
desarroll sus ideas de un sistema de cdigo tctil adaptado de los soldados franceses
que queran ser capaces de leer notas en la oscuridad. Louis Braille modific este
sistema de 12 puntos a 6 puntos y en 1832 ya haba escrito en Braille y enseado a los
dems.

La lectura, independientemente de su forma visual o tctil, es un proceso que implica


diversos niveles de anlisis de la informacin, se trata de una actividad psicolgica ms
all de la simple decodificacin de unos caracteres. Cuando leemos buscamos la
comprensin de lo ledo.
Mecnica de la lectura
El braille, un verdadero alfabeto, consiste en leer moviendo la mano de izquierda a
derecha, pasando por cada lnea. Los lectores de braille pueden leer un promedio de 104
a 125 palabras por minuto, aunque algunos pueden alcanzar a leer 250 palabras por
minuto utilizando ambas manos.
Una celda de braille consiste de seis puntos en relieve perceptibles al tacto. Al arreglar
los puntos en varias combinaciones, se pueden formar 64 patrones diferentes.
Existen diversos modelos con los que se intenta explicar el proceso de la lectura en los
videntes (ascendentes, descendentes, interactivos). En cuanto a los procesos de la
lectura en braille, la mayora de los estudios han observado que las diferencias entre la
lectura en braille y la visual o en tinta , no son significativas. Las diferencias las
encontramos en la recogida de la informacin y no en los procesos psicolgicos. As, un
vidente cuando lee realiza un movimiento rtmico de sus ojos barriendo el texto de
forma ms o menos rpida (movimientos sacdicos) separados por pausas (fijaciones).
Durante estas pausas procesamos la informacin.
En la lectura, y mediante el reconocimiento de las palabras, ya sea a travs de un
estmulo tctil o visual encontramos esas palabras almacenadas en la memoria a largo
plazo. El almacenamiento de las palabras, que se va generando desde el momento de la
aparicin del lenguaje en el nio, forma lo que podra considerarse como el lxico
interno donde el individuo tiene almacenados sus conocimientos lxicos, semnticos y
sintcticos.
182

El lector vidente en su mecnica de lectura llega a percibir un rea de tres a cuatro letras
o espacios a la izquierda y de seis a diez a la derecha de un punto de fijacin, con lo que
su velocidad lectora depender entre otras cosas del ritmo de sus fijaciones.
En un ciego el rea tctil no abarca ms all de la superficie de contacto del dedo lector
y el papel, por lo que la velocidad lectora de un buen lector ciego ser siempre inferior a
la de un buen lector vidente. Un universitario ciego con buen nivel lector difcilmente
alcanzar las 180 palabras por minuto, mientras que un vidente en idnticas condiciones
superar casi con seguridad el doble de esa velocidad. Si hiciramos disminuir a un
vidente su rea perceptiva a un slo carcter, las velocidades entre ciegos y videntes se
asemejaran.
Es importante incidir en el aspecto de la velocidad, siempre que est acompaada de la
correspondiente comprensin de lo ledo. Para que un ciego adquiera una buena
velocidad lectora (alrededor de 150 p/m.) es necesario combinar una correcta tcnica de
lectura bimanual con las estrategias de contextualizacin. Para llegar a este punto el
alumno ciego ha pasado por diferentes etapas.
Enseanza de la lectura en Braille
Todo proceso de lectoescritura debe ser secuenciado partiendo de lo bsico, lo simple,
hacia lo complejo. El entrenamiento del tacto debe ser de igual forma sistematizado. El
alumno tiene que adquirir los conceptos espaciales bsicos (arriba/abajo, delante/detrs,
izquierda/derecha...) y las nociones de cantidad (ninguno, uno, pocos, muchos, ms,
menos...) lo antes posible para no demorar su incorporacin a la lectura que debera ser
simultnea con la de sus compaeros videntes de clase.
Asimismo, el trabajo de manipulacin con ambas manos de puntos en relieve, utilizando
diferentes formas, texturas y tamaos ser prctica diaria, familiarizndose cada vez
ms con la clula braille. Lectura y preescritura se simultnea a fin de combinar
actividades y ejercitar los movimientos digito manuales hacia la exploracin tctil. Para
ello las pizarras macro tipos de preescritura sern herramientas indispensables en el
trabajo del profesor de apoyo con su alumno ciego. Conocer, localizar e identificar los
puntos del signo generador (discriminacin) sern objetivos programados por el
profesor en este momento del proceso.
Es importante que las primeras palabras estn apoyadas en imgenes grficas en relieve
buscando la similitud con el objeto representado e intentando utilizar en su elaboracin,
materiales cuyas texturas evoquen, sugieran y aproximen el objeto real representado, y a
veces inaccesible para su manipulacin. Con ello favoreceremos el proceso de
animacin a la lectura llenando de formas en relieve (equivalente a los dibujos de los
libros de los nios videntes) y potenciando con ello el inters por la actividad lectora.
En el proceso de lectoescritura es conveniente incorporar la mquina de escribir braille
(Perkins) de forma que lectura y escritura se hagan simultneas.
La escritura en mquina ofrece una serie de ventajas considerables sobre la escritura
manual (pautas y regletas). En la escritura con la mquina Perkins la lectura puede
realizarse inmediatamente sobre lo escrito. En pauta y regleta es necesario sacar el papel
del bastidor y darle la vuelta para leer o corregir. La simpleza de la mquina y su fcil
manejo la convierten en un instrumento similar al lpiz del vidente. Otra ventaja de la
mquina sobre la regleta es que no es necesario invertir el sentido de la escritura ni rotar
las letras como sucede con la escritura con regleta y pauta.
Una vez que el alumno comienza a leer con comprensin del texto, un objetivo en la
enseanza del braille es adquirir la mxima velocidad para seguir con normalidad el
183

ritmo de la clase. Este objetivo se consigue con la lectura bimanual. No todos los ciegos
la realizan, y es por esto principalmente por lo que no se consiguen buenos resultados
cuando esta tcnica no es aplicada. 6
1.5.3. TIPOS DE LECTURA
Teniendo en consideracin el movimiento de las manos sobre el texto en braille pueden
establecerse, de manera resumida, dos tipos de lectura:
Lectura unimanual
Lectura bimanual
La lectura bimanual es mucho ms eficiente y dinmica, siempre que se realice
correctamente. Para llegar a este punto, el entrenamiento bimanual debe ser constante.
En este sentido el ndice de cada mano va a leer una porcin de lnea de manera que si
empezamos a leer un texto en braille, el dedo ndice de la mano izquierda empezara la
lectura de la lnea.
Hacia la mitad, aproximadamente de la lnea, el dedo ndice de la mano derecha
continuara la lectura hasta el final de la lnea mientras que el dedo ndice de la mano
izquierda retrocede en diagonal y bajando hasta encontrar el principio de la siguiente
lnea, de forma que cuando el ndice de la mano derecha haya terminado de leer la lnea
anterior, el ndice de la izquierda est preparado para empezar la siguiente. Con ello
evitamos prdidas de tiempo y continuidad en la lectura mejorando as la comprensin.
Para alcanzar una buena velocidad lectora es necesario adems utilizar otras estrategias
de mejoramiento (desverbalizacin, bsqueda de imgenes, ideas, situaciones, acciones)
que nos encaminen hacia la globalizacin, la contextualizacin.
Adems de los movimientos de manos es necesario trabajar con el alumno los
desplazamientos de los dedos (movimientos horizontales, verticales y de presin)
debiendo reducirse al mximo los dos ltimos de manera que predominen los
movimientos horizontales sobre los dems.
La adquisicin de una correcta tcnica lectora a travs del entrenamiento ayudar, sin
duda, a que la lectura en braille sea una actividad gratificante. Corregir los vicios de la
lectura durante los primeros momentos en el aprendizaje del sistema braille es
imprescindible si queremos conseguir que nuestros alumnos sean buenos lectores.

6 OCHAITA. E. Lectura Braille y Procesamiento de la Informacin Tctil. Coleccin Rehabilitacin,


INSERSO,
Madrid 1988

1.6. TIPOS DE ESCRITURA PARA PERSONAS NO VIDENTES


Los cdigos tctiles incluidos son el New York Point, el Boston Line Type, el American
Modified Braille, el Moon Type, el Fishburne y el Braille estndar. Tambin se discuten
medios alternativos como el Tack-tiles y los smbolos tctiles.

184

1.6.1. BOSTON LINE TYPE


El Boston Line Type fue desarrollado por Samuel Gridley Howe, el fundador de la
Escuela para los Ciegos de Nueva Inglaterra (posteriormente, la Escuela para los Ciegos
Perkins) en Massachussets. Como en esa poca no haba medios de lectura para las
personas ciegas, Howe desarroll un alfabeto romano angular simplificado grabado sin
letras maysculas el que llam Boston Line Type. Public el primer libro en Boston
Line Type en 1834 y ste continu siendo el principal cdigo de lectura tctil usado en
Estados Unidos durante los prximos 50 aos. La American Printing House for the
Blind public por primera vez libros en Boston Line Type y ste se transform en el
cdigo oficial usado por los estudiantes de Perkins hasta 1908.

Embossed type, probably Boston

1.6.2. NEW YORK POINT


William Bell Wait, quien trabajaba en Nueva York a mediados de la dcada de 1800,
desarroll un cdigo de puntos para lectores que eran ciegos, que usaba caracteres que
tenan dos puntos de alto y uno, dos, tres y cuatro puntos de ancho. Cuando trabajaba en
el Instituto para los Ciegos de Nueva York, Wait comenz a ensear este sistema a los
estudiantes e invent una mquina de escribir con puntos llamada el Kleidgrafo, que
permita producir texto fcilmente sin usar el slate and stylus. El New York Point fue
ampliamente usado en las escuelas para los ciegos de Estados Unidos a fines del 1800.
Mary Ingalls, la hermana de Laura Ingalls Wilder, autora de los libros de la Pequea
Casa en la Pradera, aprendi New York Point y letras grabadas en la Escuela de Braille
y Preservacin de la Vista de Iowa (Iowa Braille and Sight Saving School) a fines de las
dcada de 1870 y en 1880.

185

The New York Point alphabet


1.6.3. AMERICAN MODIFIED BRAILLE
Joel Smith, un profesor de afinacin de piano de la Escuela para los Ciegos Perkins de
Massachussets, desarroll el Cdigo Braille Norteamericano Modificado en la dcada
de 1870. Cuando desarroll este sistema, Smith dise caracteres que pensaba seran
rpidos de leer y usaran eficientemente el papel. Este cdigo fue usado en 19 escuelas
para los ciegos en Estados Unidos, incluyendo Perkins. El American Modified Braille
asignaba la menor cantidad de puntos a los caracteres que ocurren con mayor frecuencia
en el idioma ingls. Si observan este tipo de Braille, notarn los caracteres familiares de
tres puntos de alto y dos puntos de ancho, pero con configuraciones de puntos que
corresponden a diferentes letras impresas y combinaciones de letras que el del Braille
estndar de hoy.

American Modified Braille

1.6.4. MQUINAS DE ESCRIBIR EN BRAILLE


Antes del desarrollo de las mquinas de escribir en Braille, las personas escriban en
Braille usando un slate and stylus. El slate sostena el papel y el stylus se usaba para
perforar agujeros en l. Como los puntos estn en relieve, la persona tena que aprender
a escribir a la inversa desde la parte de atrs del papel. Frank Hall, superintendente de la
Escuela para los Ciegos de Illinois desarroll una mquina personal de escribir en
Braille a fines de la dcada de 1880. En las siguientes dcadas, otros inventores

186

desarrollaron mquinas de escribir en Braille y New York


Slate and Stylus
Point. Como la mayora de las mquinas no se producan en masa, su confiabilidad y la
consistencia de la escritura variaban enormemente.
En la dcada de 1930, la Fundacin para los Ciegos de Norteamrica comision una
mquina para escribir Braille de un fabricante de mquinas de escribir. Era pesada y no
suficientemente durable para un uso prctico.
Ms tarde, David Abraham del departamento de artes industriales de la Escuela para los
Ciegos Perkins trabaj para desarrollar una mquina de escribir Braille a peticin de
Gabriel Farell, director de Perkins. l tena un modelo trabajando a principios de la
dcada de 1940, pero los aos de la guerra limitaron la fabricacin. Despus de la
Segunda Guerra Mundial, La mquina de escribir en Braille de Abraham entr en
produccin y en 1951 estaba en el mercado como el Perkins Braille.
El Perkins Braille est disponible a los estudiantes que leen Braille en Estados Unidos
sin costo a travs de un sistema de financiamiento con cuotas de la American Printing
House for the Blind, es el mtodo de escritura en Braille ms usado en Estados Unidos,
sin embargo hay muchas otras mquinas de escribir en Braille disponibles,
particularmente en Europa.

Perkins Braille Writer


Ahora, en Estados Unidos est disponible el Tatrapoint de Maxiaids. Tiene un peso
liviano y es fcilmente porttil y algunos de los componentes estn fabricados de
plstico de alto impacto. El modelo adoptivo permite ser ajustado para acomodarlo a
diferentes tamaos de mano y dedos. Quantum Technology en Australia sac hace poco
una pequea mquina manual para escribir en Braille llamada JotA-Dot. Usa papel
tipo carta de tamao pequeo y est destinado a tomar breves notas. La misma
compaa fabrica tambin el Mountbatten Brailler, un dispositivo electrnico para
escribir Braille con salida de voz. Algunos modelos tienen interfases con computadoras
187

e impresoras de tinta. El Mountbatten entrega un apoyo adecuado a las personas que


ayudan a los estudiantes a leer en Braille pero que no leen en Braille.

Jot- a- Dot

Mountbatten Brailler
1.6.5. CODIGO MOON
William Moon de Gran Bretaa perdi gran parte de su visin en la infancia debido a la
fiebre escarlata. Despus de terminar la escuela a mediados de la dcada de 1800, el Dr.
William Moon experiment con una variedad de alfabetos en relieve para ensear a leer
y escribir a los estudiantes ciegos. Finalmente cre el Moon type, un cdigo de lneas en
relieve basado en letras impresas. Los partidarios del Moon type, que an es usado en
Gran Bretaa para las personas con problemas de aprendizaje o dificultades motoras
finas y para aquellas que han perdido su vista ms tarde en su vida, creen que este
sistema es ms fcil de aprender y ms simple de discriminar en forma tctil que el
Braille.

Moon
Aunque es prcticamente desconocido en Estados Unidos, estn disponibles libros en
Moon del Royal National Institute for the Blind, que tambin estn disponibles en
Canad, Australia y en Gran Bretaa.

188

Actualmente, el cdigo Moon puede ser generado con un software computacional. El


Duxbury, que ya est disponible en Estados Unidos, tiene un traductor Moon en ingls
disponible en su men tablas de traduccin (translation tables). Los archivos pueden
ser grabados en un estilo dotty Moon (Moon con puntos) con un grabador en relieve
de Enabling Technologies, con una configuracin para Moon. En Internet se pueden
encontrar algunas fuentes de Moon para usarlas con una computadora. Todava se
producen libros en Moon a travs de un proceso modificado de configuracin de la
pgina.
Actualmente, tambin se generan materiales de lectura con Moon Writers, mquinas de
termoformado, fuentes de Moon para computadoras impresas en papel de micro
cpsulas (swell paper) y grabadores en relieve y software de traduccin en Moon.
Tambin se puede escribir a mano el cdigo Moon con un stylus sobre lminas de papel
plstico con una gua de borde, de una manera similar al uso de un slate and stylus para
producir Braille.
El Royal National Institute for the Blind en Gran Bretaa tiene disponible un currculum
de enseanza de Moon.
1.6.6. SISTEMA FISHBURNE
El sistema Fishburne de escritura tctil fue desarrollado en 1972 por S.B. Fishburne. El
Sr. Fishburne se familiariz con algunos adultos ciegos y descubri que muchos de ellos
no podan leer Braille. Desarroll un alfabeto tctil, que es ms extenso que el del
Braille, para usarlo principalmente para etiquetar elementos usados por las personas en
actividades diarias.

189

Fishburne
El Fishburne generalmente es usado para etiquetar objetos, envases y controles de
artefactos, no para propsitos literarios.

Etiquetador Fishburne y etiquetas magnticas con una sola letra del alfabeto en cada
una.
1.6.7. TACK TILES
Como el Braille estndar es siempre del mismo tamao, cada carcter tiene 1/8 pulgada
de ancho por pulgada de alto, puede ser difcil de leer para las personas con
discapacidades motores o problemas de sensibilidad tctil. Incluso el Jumbo Braille es
muy pequeo. Para abordar el problema de la alfabetizacin de individuos con
discapacidades importantes, Kevin Murphy desarroll los Tack-tiles, que son pequeos
bloques del tamao de los Lego con puntos en Braille en cada uno de ellos. Se usan
principalmente en ambientes educativos para ensear Braille a nios muy pequeos y a
los que presentan discapacidades adicionales.

190

Tack-tiles mostrando, El Braille es divertido! (Braille is fun).


Los Tack-tiles pueden ser usados para crear un teclado computacional con etiquetas en
Braille usando el teclado Intellikeys. Los tack-tiles estn disponibles con todos los
smbolos de Braille, incluyendo las contracciones y los signos de puntuacin. Estn
disponibles sets especiales para matemtica y msica en Braille. Para muchos
estudiantes con discapacidades visuales y discapacidades adicionales, los Tack-tiles y
una computadora son los mejores o nicos medios para leer y escribir.
1.6.8. SMBOLOS TCTILES
Aunque no son tradicionalmente considerados como un medio de alfabetizacin, los
smbolos tctiles o tangibles han llegado a tener un amplio uso en estudiantes con
sordoceguera o discapacidades visuales que presentan discapacidades adicionales. Los
educadores, en su bsqueda por expandir las oportunidades para que estos estudiantes se
comuniquen y participen en experiencias de alfabetizacin con apoyo en la sala de
clases, estn usando smbolos tctiles en una variedad de actividades de aprendizaje.
Estos smbolos se usan en tableros de comunicacin, etiquetas en la sala de clases y
libros de literatura infantil e historias de la experiencia en lenguaje. Aunque no hay un
vocabulario estndar de smbolos tctiles, como en el tan usado sistema de smbolos con

Un libro hecho por un profesor que incluye Braille y smbolos tctiles

191

Dibujos Meyer-Johnson, s existen algunos estndares recomendados. La Escuela para


los Ciegos y Discapacidades Visuales de Texas mantiene un diccionario ilustrado de
smbolos de dibujos. La American Printing House for the Blind actualmente tiene un kit
llamado Tactile Connections con instrucciones para crear y usar smbolos tctiles.
1.6.9. ACCESO A LA ALFABETIZACIN
A comienzos del siglo veinte, el uso extendido de varios sistemas y cdigos de lectura
tctil diferentes hizo de la lectura un desafo para los estudiantes ciegos. El desacuerdo
respecto a qu cdigo era el ms fcil de leer y el ms eficiente de usar caus la Guerra
de los Puntos entre los educadores de los pases de habla inglesa. En 1932, se lleg al
acuerdo de usar un sistema Braille en Ingls uniforme, que inclua el alfabeto y
contracciones grado 2. Desde esa poca, la discusin sobre otros modos de
alfabetizacin tctil ha sido limitada. En los ltimos cinco aos, la preocupacin
respecto al acceso a la alfabetizacin de individuos con discapacidades visuales y
discapacidades adicionales a dado origen a discusiones sobre el uso de Braille sin
contracciones, Tack-tiles y otros sistemas Braille de formato ms grande, Moon type u
otros tipos de letras grabadas en relieve o smbolos tctiles. Aunque la adopcin del
Braille estndar ha dado a los lectores tctiles acceso a una gran cantidad de material y
una calidad ms consistente de sus experiencias educativas, la consideracin del acceso
a la alfabetizacin para todos los estudiantes debe incentivar a los educadores y a los
padres a ampliar sus definiciones de lectura tctil y considerar el uso de medios tctiles
alternativos.
Nota: Las fotografas de los materiales grabados en relieve, por ejemplo en Boston line
type, Moon, New York Point, Fishburne y Tack-tiles son cortesa del Centro de
Recursos para el Aprendizaje de la Escuela para los Ciegos e Discapacidades Visuales
de Texas, archivos y materiales de enseanza. 7

Quantum Technology
Fabricante del Mounbatten Brailler y el Jot-A-Dot
http://www.quantech.com.au/

192

1.7. LOS DERECHOS HUMANOS


1.7.1. DERECHOS HUMANOS DE LOS DISCAPACITADOS
La Declaracin Universal de los Derechos Humanos considera "que todos los seres
humanos nacen libres y en igualdad de condiciones. Tambin considera que es un ideal
comn por el que todos los pueblos y naciones deben de esforzarse, a fin de que tanto
los individuos como las instituciones promuevan, mediante la enseanza y la educacin,
el respeto a estos derechos y libertades y se esfuercen para que su aplicacin sea
universal y efectiva". 1
El logro de la igualdad de oportunidades para todas las personas con discapacidad, sin
ningn tipo de discriminacin es una contribucin fundamental al esfuerzo mundial de
movilizacin de recursos humanos y es parte de la democracia e igualdad social por la
que luchan millones de personas en todo el mundo.
La preocupacin de las Naciones Unidas sobre los derechos humanos, se precipit con
el Holocausto y con los horrores de la Segunda Guerra Mundial. La Declaracin
Universal de los Derechos Humanos, proclamada por la Asamblea General de las
Naciones Unidas en 1948, asevera que los respetos para los derechos humanos y la
dignidad son "la base y cimientos de la justicia, de la libertad y de la paz en el mundo".
Estos derechos se articulan posteriormente en dos convenios internacionales, uno sobre
los derechos econmicos, sociales y culturales; y el otro en los derechos civiles y
polticos. Junto con la Declaracin, estos convenios constituyen el Documento
Internacional de los Derechos Humanos, el cual es legalmente obligatorio.
Sin embargo y a pesar de la fuerza legal de estos derechos, no describen la realidad. En
muchos pases, los derechos humanos han sido asimilados con la libertad de represin
de los Estados. Pero cuantos de los Gobiernos llegan tan siquiera a atender sus
compromisos internacionales en derechos humanos cuando se trata de polticas
domsticas...
Mientras que aumenta la retrica y el enfoque en asuntos relacionados con la igualdad,
todava existe una gran distancia que separa las palabras de la accin. En 1995, las
Naciones Unidas convocaron a la Reunin Cumbre del Mundo para el Desarrollo Social
para mejorar "la condicin humana". Los temas medulares de la Cumbre, incluan la
erradicacin de la pobreza y la promocin de "sociedades seguras, estables y justas".
Sin embargo una vista retrospectiva de los ltimos cinco aos, muestra un panorama
desolador. Una copia del reporte del Secretario General de las Naciones Unidas sobre la
implementacin de los compromisos de la Cumbre, indica lo siguiente:
El mundo se ha convertido en un lugar con mayores desigualdades, lo mismo dentro
que entre las naciones.
La desigualdad aumenta en la pobreza, desempleo y en la exclusin social.
Al centrarse los sistemas de seguridad social en los grupos ms vulnerables de la
sociedad, est resultando en una reduccin en la solidaridad social, lo cual a su vez est
minando el apoyo poltico y la asignacin de recursos para esos servicios.
La reduccin de los gastos sociales ha trado como consecuencia una reduccin en la
capacidad del gobierno para promover la integracin social, en esfuerzos tales como:
promocin de la democratizacin, incluyendo promocin en la igualdad y de los
derechos humanos, as como frmulas participativas del gobierno y proteccin social e
inclusin de los grupos vulnerables, tales como una persona con una discapacidad.
El objetivo en los derechos humanos, no debe ser garantizar derechos especiales para
las personas slo en base a su discapacidad, sino ms bien asegurar que todas las
personas, sin importar su discapacidad o cualquier otro factor, puedan ejercitar

193

plenamente sus derechos como ciudadanos. Para lograr esto, nuestras comunidades
deben actuar de tal manera que permitan que todos los ciudadanos participen.
Muchos han argumentado que la promocin de los derechos humanos, especialmente
para los grupos tan vulnerables como lo son las personas con una discapacidad, resulta
muy costosa y que no puede sostenerse mientras el mundo est enfrentando la demanda
de otras prioridades. Sin embargo es indiscutible la importancia, trascendencia y gran
relevancia histrica que guarda la promocin de los derechos humanos de las personas
discapacitadas.
El derecho al trabajo.
Sin duda el derecho que ms reclaman las personas con discapacidad es el derecho al
trabajo, independientemente de la condicin socioeconmica, son el grupo social con
mayor desempleo. Pero el trabajo no slo es un derecho, sino una obligacin social, de
su realizacin depende la consecucin de un nivel digno de vida. Pero sobre todo, el
tener un empleo y la posibilidad de progresar en l es el medio idneo de realizacin de
cualquier persona humana.
En Ecuador carecemos de medios legales de proteccin eficiente en contra de la
discriminacin. Las leyes laborales protegen fundamentalmente los derechos de quienes
tienen trabajo, pero no existen mecanismos eficientes para proteger a los que se les
niega trabajo por discriminacin. El objetivo de legislar en esta materia es el de
garantizar igualdad de oportunidades para las personas con discapacidad, es decir, no se
pretende crear una legislacin que otorgue ventajas y consideraciones, ni que les
considere a las personas con discapacidad como un sector que debe recibir ventajas y
apoyos, sino igualdad de oportunidades.
Pero hay que estar claros que no se puede competir en condiciones similares entre
desiguales, como lo ha definido la Organizacin Internacional del Trabajo "el principio
de la igualdad de derechos significa que las necesidades de cada persona tienen igual
importancia". Un gran logro ha sido la ratificacin, el 11 de diciembre de 1998, del
Convenio 159 de la Organizacin Internacional del Trabajo sobre readaptacin
Profesional y Empleo a las Personas con Discapacidad, el gran reto es trabajar y legislar
lo ms pronto posible para que esta ratificacin este plasmada en nuestra legislacin
vigente.
As, partiendo de la Declaracin Universal de Derechos Humanos, producto de la era en
que vivimos, se ha emprendido el camino que nos lleva a comprender que tales
derechos no son meramente polticos, sino que son esencialmente humanos.
La realidad se vive con la presencia de personas que tienen sus peculiaridades en cuanto
a habilidad fsica o mental, capacidad para comprender idas o realizar tareas, pero nada
de ello diferencia a los seres humanos entre s. Ha sido fcil entender que personas de
diferente raza, estatura o peso corporal no son distintas Entre s; ahora es evidente que
se comprenden que existen entre humanos otro tipo de caractersticas que distinguen
a las personas y que se relacionan con la destreza, el intelecto o la apariencia fsica...
pero en esencia, y as lo afirma el Artculo 7 de la Declaracin Universal, todos somos
iguales ante la ley y tenemos derecho a igual proteccin de la ley en todo lo relativo a
discriminacin.
Sin embargo, la historia de marginacin hizo que el 7 de junio de 1999 la Asamblea
General de la Organizacin de Estados Americanos (OEA) adoptara la "Convencin
Interamericana para la eliminacin de todas las formas de discriminacin contra las
personas con discapacidad" la que an debe ser ratificada por los Estados del
Continente.

194

1.8.- INSTITUCIONES ECUATORIANAS IMPLICADAS Y ORGANISMOS DE


CONTROL
1.8.1. FGE.- (FUNDACIN GENERAL ECUATORIANA)
La Fundacin General Ecuatoriana, con ocasin de los veinte y cinco aos de vida
institucional, constituy este nuevo Programa que est encaminado a mejorar la vida
de las personas con discapacidad intelectual, ofrecindoles la oportunidad de
formar una amistad de uno a uno con personas sin discapacidad, que tengan
intereses, edad y gustos parecidos.
En Best Buddies Ecuador, queremos alcanzar un mundo donde las personas con
discapacidad intelectual estn integradas exitosamente en sus escuelas, lugares de
trabajo y en las actividades de la comunidad a la que pertenecen. 8
Misin
Es una Fundacin de Apoyo al Desarrollo Social, con un equipo humano eficiente y
comprometido, que contribuye a la prevencin de deficiencias y al mejoramiento de la
calidad de vida de las personas con discapacidad, a travs de la prestacin de servicios
cualificados de capacitacin, asesora, documentacin, investigacin, formacin
profesional e intermediacin laboral. Apoyan al fortalecimiento del sector de las
discapacidades para lograr su plena integracin a la sociedad.
Visin
Liderazgo de autntico servicio social entre las Organizaciones No Gubernamentales, en
las reas de capacitacin, informacin y sensibilizacin, orientados al desarrollo
humano y social, con nfasis en las personas con discapacidad; basados en los
principios de la justicia social.
Relaciones
La Fundacin est asociada a las siguientes instituciones:
Grupo Latinoamericano para la Participacin, la Integracin y la Inclusin de Personas
con Discapacidad
Federacin de Organismos No Gubernamentales para la Discapacidad "FENODIS"
Federacin Ecuatoriana Pro Atencin a la Persona con Deficiencia Mental
"FEPAPDEM"
Foro Ecuatoriano Permanente de Organizaciones Por y Con los Nios, Nias y
Adolescentes
Universidad Tcnica Particular de Loja
Corporacin Euro-americana de Seguridad "CEAS"
Compaeros de las Amricas, Kentucky
Fundacin Leonard Cheshire International, Londres
Maidstone Foundation, New York
Melwood Foundation, Washington
Best Buddies International, Miami

8 Conadis, Directorio Nacional de Instituciones que trabajan en el mbito de las discapacidades 2007 VER ANEXOS SOBRE
PROYECTOS ACTUALES

195

1.8.2. CECADIS.- CENTRO DE CAPACITACIN, DOCUMENTACIN E


INVESTIGACIN SOCIAL.

Objetivo
El Centro de Capacitacin, Asesora, Documentacin e Investigacin Social,
CECADIS, es un programa permanente de la Fundacin General Ecuatoriana, su
objetivo es brindar apoyo en los procesos de aprendizaje, intercambio y desarrollo de
las personas y organizaciones del mbito de las discapacidades y el sector social en
general, con el fin de contribuir al mejoramiento de la calidad en la intervencin y
gestin.
mbito de accin
Su mbito de accin es a nivel nacional y cuenta con equipos regionales de
capacitacin y formacin, tiene convenios con entidades estatales y privadas por medio
de los cuales brinda cobertura de sus servicios a todo nivel.
Servicios
El CECADIS realiza actividades en cuatro grandes reas: capacitacin, asesora,
documentacin e investigacin social
Capacitacin
En el rea de capacitacin imparte cursos, seminarios, talleres, procesos de formacin y
actualizacin en temas referentes a las discapacidades, la educacin, servicios socioculturales, administracin de ONGs. De la misma forma, y mediante convenios con
instituciones de educacin superior ofrece el DIPLOMADO EN INTERVENCIN
SOCIAL y, prximamente la MAESTRIA INTERNACIONAL EN GESTION
SOCIAL.

1.8.3.- PRAM.- PROGRAMA RAMN ARREGUI MONREAL

196

Objetivo
Tiene como objetivo la formacin e integracin laboral de jvenes de ambos sexos
con discapacidad intelectual, brindando los apoyos necesarios en las siguientes reas:
Mdica, Trabajo Social, Psicologa, Fisioterapia, Ubicacin Laboral, Refuerzos
Pedaggicos, Tiempo Libre y Deportes, para una atencin integral que favorezca su
independencia.
Resultados
Hasta el ao 2007 han egresado 17 promociones con un total de 379 graduados, de los
cuales el 52.6% se encuentra laborando en empresas privadas, el 34.8% ubicados
productivamente por sus familias y el 12.6% pendientes de ubicacin, o no se conoce.
Trabajo con Familia
Mantiene el subprograma Trabajo con Familia, cuyo objetivo es "Potenciar la capacidad
y responsabilidad de padres, madres y representantes de jvenes con discapacidad
intelectual, para lograr habilidades y fortalezas que les permita orientar con claridad y
amor la formacin y acompaamiento a su hijo/a en todas las etapas de su vida".
Apoyo Econmico
La implementacin y mantenimiento del PRAM ha sido posible gracias al apoyo
solidario del sector empresarial, Gobierno Nacional y donaciones de organismos e
instituciones internacionales. El aporte econmico que realizan las familias es
simblico, pues representa el 8,8% de los costos del programa.
Centro de Empleo
Como respuesta a la demanda laboral, para quienes no han podido incluirse en el
mercado comn, se cre el Centro de Empleo en enero de 2001, a travs del cual se
pone a disposicin de empresas, servicios de calidad en: ensamblaje, etiquetado,
empacado y otras tareas afines, realizadas por jvenes con discapacidad intelectual;
dando la oportunidad a este sector social de ser til y contribuir al desarrollo del pas,
mediante un trabajo remunerado a destajo.
El apoyo en la integracin socio laboral tiene como fin encontrar un trabajo estable en
empresas y microempresas para los jvenes que egresan del Centro de Capacitacin;
esta actividad se complementa con seguimientos peridicos para lograr una mejor
integracin en su lugar de trabajo.
La labor de varios aos de la Fundacin y las empresas privadas ha permitido recoger
experiencias positivas, demostrando a la sociedad que estos jvenes son excelentes
trabajadores.
El Programa es centro de pasantas para profesionales, estudiantes ecuatorianos y
voluntarios, brinda asesora "in situ" a otros proyectos de rehabilitacin profesional de
personas con discapacidad. 9
9 Conadis Directorio Nacional de Instituciones que trabajan en el mbito de las discapacidades 2007 VER MAS INFORMACIN
EN ANEXOS

1.8.4.- Federacin Nacional de Ciegos del Ecuador - FENCE

197

Fundada el 12 de abril de 1985


Con Personera Jurdica segn
Acuerdo Ministerial N 801 del 16 de junio de 1987
"Con vuestro apoyo y solidaridad
estamos logrando que el ciego sea
una Persona respetada y socialmente integrada".
Filosofa, Accin y Futuro
Un Sueo Hecho Realidad

Finalidad de la FENCE
Impulsar en los ciegos su progreso y desarrollo de
acuerdo con las corrientes modernas de la tiflologa; velar
por el mejoramiento cultural, econmico y social de sus
instituciones y consecuentemente de sus afiliados.
Filiales
La FENCE, aglutina 26 filiales, 15 de ciegos y 11 para
ciegos (2001). Instituciones de Ciegos conformadas por
asociaciones dirigidas por los propios ciegos.
Instituciones para ciegos constituidas por Instituciones de
Educacin Especial y Centros de Rehabilitacin.
Miembros colaboradores: integrados por fundaciones y
otras semejantes.
Dependencias
Imprenta Braille, Departamento de Kioskos, Oficina permanente en Quito:
Capacitacin, Asesoramiento y Gestin.
Desde 1991 la FENCE, mediante la capacitacin a los asociados de sus filiales
propende al fortalecimiento de su liderazgo ejecutivo, capaz de administrar sus
instituciones con eficiencia.
Brinda asesoramiento a las
como en la elaboracin de
reciente creacin, se esta
organismos seccionales, la
sociales. 10

instituciones filiales tanto en la direccin administrativa,


planes, proyectos, presupuestos. Con las instituciones de
gestionando juntamente con sus directivos, ante los
adquisicin de terreno para edificar sus propias sedes

10 Conadis Directorio Nacional de Instituciones que trabajan en el mbito de las discapacidades 2007

1.8.5.- Federacin Nacional de ecuatorianos con Discapacidad Fsica - FENEDIF


198

Fundada el 25 de julio de 1991


Acuerdo Ministerial 3178 del 26 de junio de 1992
"Unidos por un Ecuador Accesible"

Misin de la FENEDIF
Gestionar ante los organismos pertinentes la
consecucin de recursos para cubrir costos de
funcionamiento y proyectos de desarrollo.
Colaborar en la emisin de polticas y
normas e impulsar la creacin de planes y
programas nacionales que permitan la
integracin de las personas con Discapacidad
del Ecuador.

Generalidades
La Federacin Nacional de Ecuatorianos con Discapacidad Fsica, FENEDIF, es afiliada
como Asamblea Nacional del Ecuador a la Disabled Peoples International, DPI
(Organizacin Mundial de Personas con Discapacidad, OMPD) constituida por las
Asambleas Nacionales de cinco regiones a saber: Regin de Norteamrica, y El Caribe;
Regin Latinoamericana; Regin Europea; Regin Africana; Regin de Asia y El
Pacfico y, en formacin, la Regin de los Pases rabes. La FENEDIF Ecuador, forma
parte del Directorio de la Regin Latinoamericana ocupando el cargo de la Direccin de
Informacin y Comunicaciones.
Fines de la FENEDIF
1. La unidad y solidaridad de sus miembros.
2. La capacitacin de los miembros que integran la Federacin a fin de que les
permita participar dignamente en las actividades de la sociedad.
3. Propender al mejoramiento Econmico, social, cultural y de salud, tanto de las
organizaciones, como de sus respectivos socios.
4. Velar por la defensa de los intereses comunes e individuales de los
discapacitados neuromusculares y osteoarticulares.
5. Respaldar a sus miembros en los conflictos y acciones relacionados con la
defensa de los intereses y aspiraciones de los socios.
6. Cumplir y hacer cumplir con lo establecido en la Ley sobre Discapacidades, el
Estatuto Social, reglamentos, normas y ms disposiciones emitidas por los
organismos. 11
11 Conadis Directorio Nacional de Instituciones que trabajan en el mbito de las discapacidades 2007

199

1.8.6.- Federacin Ecuatoriana Pro Atencin a la Persona con Deficiencia Mental,


Parlisis Cerebral, Autismo y Sndrome de Down - FEPAPDEM

Constituida legalmente desde 1987


Acuerdo Ministerial N 162

"Queremos una sociedad basada en la equidad, la justicia, la igualdad y la


independencia que asegure una mejor calidad de vida para todos, sin discriminaciones
de ningn tipo, que reconozca y acepte la diversidad como fundamento para la
convivencia social. Una sociedad en donde lo primero sea la condicin de persona de
todos sus integrantes, que garantice su dignidad, sus derechos, su autodeterminacin y
su contribucin a la vida comunitaria."
Declaracin de Managua 1993

La Federacin Ecuatoriana Pro Atencin a la Persona con


Deficiencia Mental, Parlisis Cerebral, Autismo y Sndrome
de Down - FEPAPDEM -, es una entidad sin fines de lucro
que agrupa a asociaciones de padres de familia e instituciones
que atienden a estas personas.
Naci ante la necesidad de los padres y profesionales de
apoyarse y lograr una adecuada concientizacin de la
comunidad que promueva la normalizacin.
Misin de la FEPAPDEM
Mejorar la calidad de vida de las personas con Discapacidad
Intelectual, Autismo, Parlisis Cerebral, Sndrome de Down y
de sus familias.
En el plano internacional, FEPAPDEM es miembro pleno de INCLUSION
INTERNACIONAL que agrupa las organizaciones para personas con discapacidad
intelectual de todo el mundo y a travs de ella se vincula con organizaciones
intergubernamentales como ONU, UNESCO, OIT, etc.
Adems es miembro fundador de INCLUSION INTERAMERICANA (antes
CILPEDIM) Confederacin Interamericana de la Liga Internacional de Asociaciones a
favor de las personas con deficiencia mental - Nivel Continental.
Cuenta con tres oficinas Regionales en Pichincha, Guayas y Azuay y un Centro de
Documentacin Nacional en Guayaquil.

200

Objetivos
1. Trabajar intensamente para lograr que la INCLUSION de la persona con
deficiencia mental sea respetuosa, normalizada y se vea reflejada en los campos
educativo, laboral, comunitario y familiar.
2. Vigilar el cumplimiento de la Ley sobre Discapacidades y su Reglamento.
3. Fomentar la formacin de grupos de padres, familiares y personas interesadas en
la atencin integral.
4. Capacitar a jvenes, padres y profesionales, con el fin de mejorar la calidad de
vida y de servicios; para ello se realizan conferencias, seminarios nacionales e
internacionales, mesas redondas, talleres de coordinacin y capacitacin.
5. Propiciar programas de jvenes para que sean gestores de su crecimiento e
inclusin. En el Ecuador existe un conjunto de Instituciones del sector pblico
que prestan atencin y servicios a las personas con discapacidad, como son:

Las Comisiones Provinciales


Los departamentos provinciales de los distintos Ministerios del Ecuador, entre
otros el de Bienestar Social, el de Educacin y Cultura, el de Salud y el de
Trabajo.
En el rea de la Educacin se tienen varias Escuelas
En el rea de la Salud, se cuenta con distintos Hospitales que han destinado las
unidades de rehabilitacin para el servicio a este sector de la poblacin.

As mismo en el pas existe un grupo de Organizaciones Privadas, que prestan servicio


para las personas con discapacidad, como son:

Las Fundaciones
Las Corporaciones
El Instituto Nacional del Nio y la Familia - INNFA -,
con sus centros de rehabilitacin en Ibarra, Quito, Portoviejo y Guayaquil, y sus
Unidades del Programa de Atencin Mdico Solidario (PAMS)

Por otro lado, existen Organizaciones Privadas, formadas de Personas con


Discapacidad y que han sido creadas por un grupo de personas con alguna discapacidad
especfica:
Estas son:

La Federacin Nacional de Sordos del Ecuador - FENASEC


La Federacin Nacional de Ciegos del Ecuador - FENCE
La Federacin Nacional de Ecuatorianos con Discapacidad Fsica - FENEDIF;
y,
La Federacin Ecuatoriana Pro Atencin a la Persona
con Deficiencia Mental, Parlisis Cerebral, Autismo y Sndrome de Down. 12

12 Conadis,

Directorio Nacional de Instituciones que trabajan en el mbito de las discapacidades 2007

201

1.8.7 COMISIONES PROVINCIALES DE DISCAPACIDADES


Definicin
Son instancias tcnico administrativas desconcentradas y de desarrollo comunitario del
CONADIS que tienen como propsito efectuar un trabajo interinstitucional coordinado
y efectivo en beneficio de las personas con discapacidades en cada una de las provincias
del Pas.
Objetivos de las Comisiones Provinciales de Discapacidades
Las comisiones provinciales de discapacidades tienen como objetivos especficos:

Coordinar acciones de los sectores pblico y privado en materia de


discapacidades dentro de su provincia.
Impulsar, apoyar, ejecutar y difundir planes, programas, proyectos y acciones a
nivel provincial, cantonal, parroquial y local, en beneficio de las personas con
discapacidad, enmarcadas en las polticas generales, sectoriales y otras
disposiciones emitidas por el CONADIS.
Velar por la defensa de los derechos de las personas con discapacidad.
Difundir, cumplir y hacer cumplir la Ley de Discapacidades y su Reglamento.

Integracin de las Comisiones Provinciales


Las Comisiones Provinciales de Discapacidades son instancias desconcentradas del
CONADIS que estn integradas por:
a. Un nivel ejecutivo, conformado por un Coordinador y un Asistente
Administrativo a nombramiento o Comisin de Servicios con Sueldo, otorgada
por una entidad del Estado y designados por el Director Ejecutivo del Consejo
Nacional de Discapacidades.
b. Un nivel coordinador conformado por un funcionario delegado de cada una de
las siguientes entidades:
Ministerio de Salud Pblica,
Ministerio de Educacin y Cultura,
Ministerio de Bienestar Social,
Ministerio de Trabajo y Empleo,
Municipio de la Capital Provincial
Instituto Nacional del Nio y la Familia
Federacin Nacional de Organismos no Gubernamentales para la
Discapacidad, FENODIS.
Un representante de las Asociaciones de personas por cada tipo de
discapacidad.
c. Un Nivel comunitario, conformado por los representantes sealados en los dos
niveles anteriores ms los organismos seccionales, organismos de desarrollo,
militares, religiosos, empresariales y otros que estime la Comisin.

202

mbitos de Trabajo de las Comisiones Provinciales de Discapacidades


Dependiendo de los recursos, voluntad poltica y dinmica, propias de cada provincia,
cantn, parroquia o localidad, las Comisiones Provinciales pueden desarrollar
actividades relacionadas con los siguientes aspectos:
Prevencin

Riesgo materno infantil: embarazo, parto, desarrollo infantil


Enfermedades crnico degenerativas
Accidentes: trnsito, domsticos, deportivos, laborales
Salud ambiental y contaminacin.

Capacitacin

Para los miembros de la comisin provincial.


Para las organizaciones de y para personas con discapacidad.
Para las familias de personas con discapacidad.
Para las personas con discapacidad.
Para los medios de comunicacin y la comunidad en general.

Accesibilidad

Las barreras comunicacionales y de la informacin.


Las barreras psicolgicas y la discriminacin hacia las personas con
discapacidad.
Las barreras fsicas
Arquitectnicas
Urbansticas
De transporte

Orientacin Legal

Convenios con universidades e Instituciones que ejerciten la defensa legal.


Aplicacin democrtica del rol del Defensor del Pueblo en materia de
Discapacidades.
Gestin con los organismos encargados de la aplicacin de las leyes.
Cumplimiento de la Ley sobre Discapacidades y su reglamento.

Servicio Social

Gestin y orientacin para obtencin de servicios: Salud, Educacin, Trabajo,


Ayudas Tcnicas, Provisin de Medicamentos e insumos mdicos.

Fortalecimiento de Organizaciones para personas con discapacidades

Asesora y asistencia tcnica


Entrega de informacin
Canalizacin de recursos

203

Registro de Discapacidades

Registro de personas naturales, jurdicas e Instituciones.


Apoyo a los procesos descentralizados de calificacin de discapacidad.
Carnetizacin.

Gestin de Proyectos

Precalificacin de proyectos
Promocin de proyectos auspiciados por el CONADIS.
Apoyar en acciones de seguimiento, gestin y evaluacin de proyectos

Alternativas Ocupacionales

Bsqueda de puestos de trabajo y alternativas laborales para personas con


discapacidad.
Evaluacin y seguimiento de beneficiarios para programas de crdito "fondo
semilla", con el Banco Nacional de Fomento de cada Provincia y el Ministerio
de Trabajo.

Recreacin, Arte y Tiempo Libre

Promocin e integracin de las personas con discapacidad en actividades de


recreacin, cultura, arte, deporte y tiempo libre. 13

13 Conadis Directorio Nacional de Instituciones que trabajan en el mbito de las discapacidades 2007

204

1.8.8.- Federacin Nacional de Organismos no Gubernamentales para la


Discapacidad (FENODIS)

Aprobada mediante acuerdo Ministerial #001982 del 4 de Agosto de 1994 del


Ministerio de Bienestar Social
Fines de la Federacin

Orientar, promover y divulgar a nivel nacional los objetivos para la prevencin,


atencin, e integracin de las discapacidades.
Fortalecer a los organismos miembros a travs de la formacin e informacin
para que estas logren la prestacin de sus servicios de una manera efectiva.
Propiciar la integracin total de las personas con discapacidad.
Unificar esfuerzos de los organismos que trabajan con y para las personas con
discapacidad, coordinando el desarrollo de programas y proyectos en las reas
de salud, educacin, bienestar social y recreacin.
Exigir el cumplimiento de las leyes que tienen relacin con la discapacidad y
proponer reformas a las existentes para mejorar su calidad de vida. 13

13 Conadis Directorio Nacional de Instituciones que trabajan en el mbito de las discapacidades 2007

205

1.9.- DISTRIBUCION DE LAS PERSONAS CON DISCAPACIDAD POR TIPO


DE DEFICIENCIA

Del total de la poblacin del Ecuador, el 13,2 % son personas con algn tipo de
discapacidad (1`600.000 personas), y podemos sealar que en el pas existen
aproximadamente:

592.000 personas con discapacidad por deficiencias fsicas


432.000 personas con discapacidad por deficiencias mentales y psicolgicas
363.000 personas con discapacidad por deficiencias visuales; y,
213.000 personas con discapacidad por deficiencias auditivas y del lenguaje.

1024.000 Total de personas con discapacidad por alguna deficiencia fsica, mental o
psicolgica. 14
Poblacin con discapacidad

Poblacin de PCD menor de 5 aos con


limitacin en la actividad y restriccin en
la participacin.
Poblacin de PCD de 5 aos y ms
deficiencia.
Poblacin de PCD de 5 aos y ms con
limitacin leve y moderada.
Poblacin de PCD de aos y ms con
limitacin grave.
Total
*

No.

1.608.334
17.838

12.14%
1.11%

702.793

43.70%

247.520

15.39%

640.183

39.80%

1.608.334

100%

14

Ecuador La Discapacidad en Cifras, Anlisis de resultados de la Encuesta Nacional de Discapacidades,


1996.

* Ecuador La Discapacidad en Cifras, Anlisis de resultados de la Encuesta Nacional de Discapacidades,


marzo 2005.

206

CAPITULO 2

2. ANLISIS ESPACIAL Y DE BARRERAS ARQUITCTONICAS EN LOS


MUSEOS DE LA CIUDAD DE QUITO.

2.1.- ELEMENTOS PRINCIPALES PARA EL DIAGNSTICO.


En 1979 se promulg la Ley de Patrimonio Cultural que rige en la actualidad. Los
valores culturales acumulados en el Centro Histrico de Quito, en medio de un paisaje
natural de singular belleza, as como el estado de conservacin del centro histrico,
llevaron a que la UNESCO declarara a Quito en 1978, bien perteneciente al Patrimonio
Cultural de la Humanidad y curiosamente, solamente en el ao 1984, como bien
perteneciente al Patrimonio Cultural del Estado.
Como parte sustancial de los fundamentos de esta declaracin constan:
- Que, las reas Histricas de Quito constituyen mbitos transcendentales de la cultura
ecuatoriana, con significacin universal, contribuyendo para que Quito fuese declarada
PATRIMONIO CULTURAL DE LA HUMANIDAD por la UNESCO el 8 de
septiembre de 1978 y confirmada oficialmente el 27 de julio de 1979;
- Que la Ley de Rgimen Municipal en su artculo 217, establece que el Plan Regulador
de desarrollo urbano podr contemplar estudios parciales para la conservacin y
ordenamiento de ciudades o zonas de la ciudad de gran valor artstico e histrico o de
proteccin del paisaje urbano. Para los efectos expresados podrn dictarse normas
especiales para la conservacin, restauracin y mejora de los edificios y elementos
naturales y urbansticos.
- Que el Concejo aprob los siguientes estudios: El Plan de Estructura Espacial
Metropolitana, el Plan Maestro de reas Histricas y el Plan Estratgico de la Zona
Centro, que en conjunto forman parte del Plan del Distrito Metropolitano de Quito.
Especficamente en el tema que nos interesa, el Cdigo en su Captulo IV, De las
Normas Generales de Desarrollo Urbano dedica la Seccin IV a tratar De las
Edificaciones en las reas Histricas, Normas de Conservacin, Recuperacin,
Transformacin y Nueva Edificacin en donde claramente se evidencia el inters por
preservar la tipologa de la casa de patio y sus elementos caractersticos.
Toda intervencin en las reas histricas est obligada a sujetarse a las normas
particulares establecidas en este cuerpo normativo y en el Cdigo de Arquitectura y
Urbanismo, Ordenanza 2925.
La Reglamentacin aplicada
Estructura, Usos y Funcionamiento urbano
207

El estudio urbanstico del Centro Histrico permite ver relaciones muy diferentes, segn
reas de planificacin, entre la ocupacin del suelo, la distribucin de la poblacin y la
red vial, o entre sta, los equipamientos y los usos del suelo.
En respuesta se plantea el esquema funcional deseado para el rea histrica en
articulacin con la Estructura Espacial Metropolitana. Este esquema viene a ser el que
define el Patrn de Ordenamiento Urbano, (POU) el cual comprende los ndices y
caractersticas sobre los siguientes aspectos:

- Esquema vial y ordenamiento de la circulacin


- Usos de suelo.
- Distribucin de la poblacin.
- Ocupacin del suelo.
En sujecin a este POU y, a la Propuesta de Estructura Urbana para Quito, se plantean
las propuestas sobre cada aspecto sealado.
Categoras de Intervencin de las reas Histricas de Quito
Bajo la premisa de que el conjunto histrico, desde el punto de vista morfolgico, es un
sistema, integrado y jerarquizado se determinan las categoras de intervencin urbanas y
arquitectnicas.

Nivel urbano:
Conservacin: Intervencin en tramos urbanos, para mantener sus caractersticas
originales de altura, sistema constructivo, traza, proporciones y elementos compositivos.
La intervencin consiste en conservar integralmente el tramo, manteniendo las
caractersticas de unidad morfolgica y funcional.
Integracin: Para aquellos tramos que han perdido sus caractersticas originales. La
intervencin consiste en recuperar la unidad y homogeneidad del tramo.
Reestructuracin: para aquellos tramos que han sufrido alteraciones sustanciales en
relacin a la traza, altura de edificacin, sistema constructivo y morfologa. La
intervencin consiste en volver a estructurar los elementos del tramo considerado para
recuperar su composicin original.
Nivel arquitectnico:
Conservacin: Intervencin que permite el buen estado permanente de la edificacin. Se
definen dos niveles componentes:
a. Mantenimiento: Intervencin cuya finalidad es mantener la edificacin en correctas
condiciones de habitabilidad, salubridad y ornato, sin alterar su estructura portante, ni su
tipologa arquitectnica.

208

b. Acondicionamiento: Intervencin que tiene por objeto modificar las caractersticas


fsico-funcionales de una edificacin, o de parte de la misma, sin alterar su estructura
portante, ni su tipologa arquitectnica.
Recuperacin: Intervencin mayor, para aquellas edificaciones o conjuntos con nivel de
proteccin, con la finalidad de devolver sus caractersticas tipolgicas, morfolgicas y
de habitabilidad. Se han definido tres niveles componentes:
a. Restauracin: Intervencin referida a aquellos conjuntos o edificaciones a
conservarse ntegramente, y consiste en la recuperacin de su forma y caractersticas
originales y la eliminacin de aadidos o superposiciones que no presenten inters para
la historia de la edificacin ni para su lectura tipolgica.
b. Rehabilitacin: Consiste en devolver a la edificacin sus caractersticas de
habitabilidad y buenas condiciones, en armona con el contexto urbano donde se
localiza y con la tipologa arquitectnica del edificio.
c. Reconstruccin: Intervencin que tiene por objeto la devolucin parcial o total de una
edificacin, que debido a su estado de deterioro no es posible restaurar o rehabilitar,
reproducindose sus caractersticas, pero denotando su contemporaneidad.
Transformacin: Intervencin en edificaciones que no poseen caractersticas para su
conservacin, o en solares vacos. Se han definido tres niveles componentes:
a. Integracin: Para aquellos edificios que no armonizan con el contexto urbano por sus
caractersticas arquitectnicas contrapuestas o deterioradas. La intervencin se orienta a
integrar la edificacin al contexto urbano y arquitectnico a travs de la demolicin de
las partes, volmenes o elementos que alteren la unidad y homogeneidad del conjunto y
la posibilidad de una reconstruccin sucesiva.
b. Demolicin: Para aquellas edificaciones que ocupan reas de importancia dentro del
conjunto urbano, obstaculizndolo formal y funcionalmente, aquellas edificaciones que
por su estado de deterioro y ninguna aportacin a la unidad del conjunto urbano y
arquitectnico requieran ser eliminadas.
c. Nueva edificacin: Para los solares y espacios vacos existentes en la trama, se prev
la posibilidad de construir nuevas edificaciones que permitan consolidar la unidad de la
estructura y dotar de mejores estndares a la poblacin que habita en la zona.
Para el caso de las edificaciones y conjuntos monumentales y considerando las
caractersticas arquitectnicas, histricas y contextuales de cada conjunto, se han
realizado estudios particulares, considerando los aspectos: histricos, tipolgicos,
arqueolgicos, estructurales y morfolgicos, determinando el estado de conservacin de
las edificaciones que conforman la unidad arquitectnica y urbana, para la definicin, de
acuerdo a los mtodos cientficos de la restauracin, las intervenciones que requieren
para la recuperacin de sus caractersticas originales.
La propuesta de proteccin y rehabilitacin de los elementos, conjuntos y reas
patrimoniales se orienta a un conjunto de acciones que se plantean como una base

209

referencial necesaria para las intervenciones particulares e institucionales y que se


sintetizan en:
-

La definicin de parmetros de intervencin que garanticen la rehabilitacin


integral del rea.
La determinacin de los usos del suelo compatibles con las caractersticas de
cada una de las edificaciones del Centro.

Las intervenciones, a nivel arquitectnico y urbano, que son requeridas de


acuerdo a las condiciones, usos y tipologa de las edificaciones y tramos de
calles del rea Histrica Central.
La optimizacin de infraestructuras y estructuras existentes, a travs de la
formacin del patio de manzana, como mecanismo de ampliacin de la
superficie para equipamientos, instalaciones y servicios.
La implementacin de un instrumento de planificacin, control y desarrollo a
travs de la catalogacin de los componentes urbanos y arquitectnicos,
inventariados y por inventariarse.
La provisin de un cuerpo normativo que garantice la proteccin, rehabilitacin
y desarrollo de las reas histricas.

Categora a: Conjuntos y edificios monumentales


Estas edificaciones por sus peculiares caractersticas estructurales formales y de
organizacin espacial debern orientar su utilizacin a las actividades colectivas a nivel
de ciudad, del centro histrico y de los barrios. Se posibilita el uso de una tecnologa de
punta que permita su adaptacin a los usos y funciones compatibles con las necesidades
de la ciudad y de los sectores poblacionales del centro, asimilando y profundizando su
valor simblico y su significacin en trminos urbanos. Los usos previstos son
bsicamente equipamientos y servicios colectivos, centros culturales, tursticos,
asistenciales y de la administracin pblica.
Categora b: Edificaciones de inters especial y atpicas de importancia
Corresponde a edificaciones que tienen caractersticas tipolgicas diferentes a las
existentes en la trama del Centro Histrico pero que se integran morfolgica y
simblicamente a la estructura del mismo.
Para stas se prevn usos de tipo cultural, comercio especializado, instalaciones
hoteleras y de recepcin, organizaciones comunitarias y centros asistenciales. No se
descarta los usos de vivienda y pequeos comercios para densificar las reas
subutilizadas y elevar el nivel de habitabilidad y servicios de la poblacin.
Categora c: Edificacin comn
Edificaciones particulares con caractersticas tipolgicas generalizables en el rea del
centro, que correspondan originalmente a edificaciones destinadas a vivienda y que se
210

constituyen en elementos bsicos de la rehabilitacin de las estructuras, por tratarse de


documentos histrico-sociales a nivel de parcela y de conjunto urbano dada su
valoracin como elementos singulares del rea considerada.
Su caracterstica de organizacin alrededor de los patios permite una intervencin de
recuperacin de estas estructuras con una reutilizacin fundamentalmente dirigida a la
vivienda, pero dotndolas de las instalaciones necesarias para disponer de adecuadas
condiciones de habitabilidad.

Se plantea incorporar y generalizar el concepto de propiedad horizontal o copropiedad,


a travs de la utilizacin de la legislacin nacional vigente, amplindola y
particularizndola para el caso del centro por medio de regulaciones municipales que,
impidiendo las subdivisiones y las modificaciones tipolgicas, generen un proceso
dinmico de intervencin en el cual, tanto los organismos de gestin, como el habitante
y el propietario, se involucren en las tareas de proteccin de las estructuras.

Categora especial 1: Edificaciones de inters especial y atpico de importancia fuera del


centro histrico.
Categora especial 2: Edificaciones de inters especial y atpico de importancia fuera del
centro histrico, de carcter religioso.

Catalogacin
Para efectos de la lectura y manejo de la informacin de una manera sistmica se ha
clasificado a cada unidad, de acuerdo a los siguientes parmetros:
- Tipologa de la edificacin.
- Sistema constructivo
- Estado de la edificacin
- Grado de intervencin
- Usos de suelo posibles.
Con la informacin contenida en la ficha de catalogacin, que ha sido procesada para
ms de tres mil predios del Centro, la Municipalidad cuenta con un instrumento de
manejo para control y despacho administrativo, planificacin y desarrollo de proyectos
de intervencin, y registro de las edificaciones y espacios urbanos.
As mismo el inventario y catalogacin permiten establecer para la ciudad, por primera
vez, un sistema de archivo y catalogacin de las edificaciones de valor histrico, para el
desarrollo de investigaciones y trabajos relacionados con la historia de la ciudad y su
proceso urbano.
211

2.2.- MUSEOS OBJETO DEL DIAGNOSTICO


1. Museo de la Ciudad.
2. Museo Miguel de Santiago- Convento de San Agustn.
3. Centro Cultural Metropolitano- Museo Alberto Mena Caamao.
4. Casa Museo Maria Augusta Urrutia
5. Museo Fray Pedro Gocial convento de San Francisco
6. Museo Numismtico del Banco Central del Ecuador
7. Fundacin Iglesia de la Compaa de Jess
8. Museos Casa de la Cultura Ecuatoriana
9. Museo Ecuatoriano de Ciencias Naturales
10. Capilla del hombre
11. Fundacin Guayasamn
12. Fundacin Posada de las artes Kingman
13. Museo Amaznico
14. Museo Artes
15. Museo Nacional del Banco Central del Ecuador
16. Museo del Colegio militar Eloy Alfaro
17. Museo Padre Francisco de Jess Bolaos
18. Museo Camilo Egas
19. Museo Fray Pedro Bedn. Convento de Santo Domingo.
20. Museo Monacal Santa Catalina de Siena.
21. Museo Histrico Militar Casa de Sucre.
2.2.1. Museo de la Ciudad
Ubicacin: Antiguo Hospital San Juan de Dios, calle Garca Moreno 572 y
Rocafuerte

1 .Entrada al Museo de la Ciudad


212

Informacin General:
El Museo de la Ciudad es un centro de expresin de la cultura de Quito, con una
instalacin museogrfica que se basa en la memoria cotidiana. Funciona desde 1998 en
la construccin civil ms antigua de la ciudad, edificada desde 1565 para el hospital de
la misericordia de Nuestro Seor Jesucristo (luego llamado Hospital San Juan de Dios).

Aparte de sus exposiciones permanentes el Museo de la Ciudad es uno de los espacios


culturales ms dinmicos en cuanto a exposiciones temporales, programacin artstica y
acadmica. Su muestra permanente cuenta con cinco salas: la Sala Quito con escenas de
la vida cotidiana; el Siglo XVI donde se aborda la fundacin espaola de Quito y la
difcil convivencia entre dos culturas distintas; el Siglo XVII con imgenes del
nacimiento de una ciudad donde predomina la cultura barroca; el Siglo XVIII en que se
destaca un importante desarrollo del arte y la ciencia; y finalmente, la Sala del Siglo
XIX que muestra cmo se introduce la cultura francesa en la sociedad transformando
los estilos de vida cotidianos.

Tres museos de sitio integran adems esta propuesta cultural: la Capilla de los ngeles,
la iglesia y la morgue del hospital. Entre los servicios del museo estn las visitas
guiadas en espaol, ingles, francs, alemn e italiano. *

*Museos de Quito, TRAMA ediciones, 2007.

- Tipologa de la edificacin.: Categora b: Edificaciones de inters especial y atpicas


de importancia.
- Sistema constructivo: Colonial; Mixto Piedra y Adobe (Arquitectura monumental
Civil).
- Estado de la edificacin: Muy bueno
- Grado de intervencin: Acondicionamiento
- Usos de suelo posibles. Usos de tipo cultural, comercio especializado, instalaciones
hoteleras y de recepcin, organizaciones comunitarias y centros asistenciales. No se
descarta los usos de vivienda y pequeos comercios para densificar las reas
subutilizadas y elevar el nivel de habitabilidad y servicios de la poblacin.

213

ACCESIBILIDAD EXTERNA.-

2. Accesos de entrada al Museo de Ciudad (escaleras y rampa)

Su entrada principal se encuentra en la calle Garca Moreno, existen pocas gradas y de


un ngulo de elevacin de menos de 20 grados.

Existe una rampa para el acceso de visitantes en silla de ruedas en la calle Garca
Moreno, y su salida llega hasta la recepcin del Museo.

ACCESIBILIDAD INTERNA:

En el claustro Norte se encuentran amplios corredores, cuyos espacios suelen ser


utilizados para exposiciones y talleres temporales.

Tambin se encuentran las reas de administracin y 2 ascensores, uno de ellos dirige


al visitante hacia la segunda planta y el otro dirige al visitante hacia el claustro central.

214

3. Claustro Central

4. Claustro Central (corredores)

215

5.

Ascensor

para

acceder al Claustro central.

6. Ascensor

216

7. Bao adaptado para


discapacitados ubicado en la primera planta.

Subiendo hacia la segunda planta se encuentran un grupo de gradas de piedra de 45


grados de inclinacin.

8. Gradas de acceso al segundo nivel.

A continuacin se localiza una entrada hacia el coro alto de la capilla de los ngeles. Y
una entrada hacia el campanario.

217

9 y 10. Gradas de acceso al coro alto y coro alto.

11. Esta entrada al campanario es muy estrecha y


tiene forma de tmpano.

En la segunda planta del museo existen varias salas de exposicin con rampas de muy
poca inclinacin y amplios corredores.

218

12 -13. Corredores del segundo nivel sobre el claustro sur.

14. Rampa de entrada a una sala de exposicin.

Existe un claustro central amplio con una pileta hay un leve desnivel para acceder a este
patio. A los lados del claustro se encuentran diferentes salas de exposiciones
temporales y permanentes de fcil acceso por su amplio espacio.

219

15. Claustro central.


En la segunda planta del claustro central se hallan tres diferentes salas de exposicin
con temas referentes a la poca Colonial y sus protagonistas.

16. Corredor del segundo nivel (claustro central)

220

17. Sala de exposicin. Representacin del taller de Miguel de Santiago.


Tambin existe un tercer patio, el cual es utilizado para eventos culturales, el acceso a
este patio es un poco complicado ya que hay que pasar por algunos grupos de gradas y
no hay rampas ni ascensores.
Existe un ascensor que se utiliza para entrega de materiales y carga que sale hacia la
calle 24 de Mayo.

18. Gradas de acceso a claustro aledao a la calle 24


de Mayo.

221

19. Claustro aledao a la Calle 24


de Mayo.

Ascensor

20. Ascensor con salida a la Calle 24 de Mayo.


Recursos humanos con los que cuenta el museo: 70 personas que rotan en tres museos.
Parque Museo del Agua Yaku, Museo de la Ciudad, Museo Interactivo de Ciencias
MIC.

222

2.2.2.- Museo Miguel de Santiago - Convento de San Agustn


Ubicacin: Convento de San Agustn, calle Guayaquil y Chile

21. Entrada al Museo de Miguel de Santiago por la Calle Chile.

Informacin General:
Cuentan que el artista Miguel de Santiago vivi casi dos aos refugiado en este
convento y -como el visitante apreciar- en este lapso no hizo ms que pintar. El paseo
inicia en el claustro principal, con su gran patio central y cuadros sobre la vida de San
Agustn en los muros. Los 48 lienzos incluyen algunas obras de gran formato en la
escalinata. El Museo, en el piso superior contiene escultura y pintura de los siglos XVII
y XVIII, adems de exquisitos objetos de uso religioso. Una obra impresionante es el
Cristo Yacente, una escultura del siglo XVI en tamao natural (1,7 metros de largo): la
Sala capitular del convento tambin es parte del recorrido. Sus asientos, con capacidad
para 150 personas, fueron labrados en cedro negro en el siglo XVII y all se firm el
Acta de Independencia del territorio de la presidencia de Quito con respecto a Espaa
en 1822. El visitante puede conocer a las catacumbas donde reposan los restos de los
patriotas de la masacre del 2 de agosto de 1810 y del artista Miguel de Santiago.

- Tipologa de la edificacin.: Categora b: Edificaciones de inters especial y atpicas


de importancia.

223

- Sistema constructivo: Colonial; Mixto Piedra, ladrillo y Adobe (Arquitectura


Monumental Religiosa).
- Estado de la edificacin: Muy bueno
- Grado de intervencin: Conservacin.
- Usos de suelo posibles. Usos de tipo cultural y religioso, de recepcin, organizaciones
comunitarias y centros asistenciales.
ACCESIBILIDAD EXTERNA:

22. Detalle de gradas deceso desde la calle Chile.


Su entrada se encuentra en la calle Chile, existen primeramente 4 gradas con una
inclinacin de 30 grados al nivel de entrada de la iglesia.

23. Detalle de Gradas de entrada al Museo.

224

Luego 5 gradas desde el nivel de entrada de la iglesia hacia el interior de la recepcin


del museo; inclinacin de la pendiente 130 grados.

24. Recepcin.

Los Claustros y el patio con jardn y pila forman un conjunto de extraordinaria belleza y
monumentalidad, concebido en el arte mudjar, plasmado en las esbeltas columnas de
piedra de los claustros bajos, de cuyos capiteles arrancan gruesos arcos de medio punto
que van sacudindose uniformemente hasta rematar en los imponentes machones
localizados en las esquinas del patio. 15

ACCESIBILIDAD INTERNA:

25. Claustro Central

225

26. Entrada desde la recepcin hacia el claustro


Central.

Para ingresar al interior del claustro se debe pasar por una puerta doble y una pequea
grada.
A continuacin existen amplios corredores en los cuales se encuentran obras del
maestro pintor Miguel de Santiago y un rico vestigio del artesonado en el techo.

15

Quito Patrimonio de la Humanidad. La ciudad de Ayer y Hoy. Ediciones Paralelo


Cero. Pg. 138

226

27. Artesonado y corredor frente a la Sala Capitular.

28. La entrada de la sala capitular no presenta problemas de acceso.

29. Detalle de la Sala Capitular

Dentro de la Sala capitular existe una entrada de la visita al museo para bajar a las
catacumbas, este es un inconveniente para un visitante en silla de ruedas, parapljico o
que posee una discapacidad motora avanzada; debido a la escalera inclinada y al
reducido espacio.

227

30. Entrada de las Catacumbas

31. Gradas de acceso a catacumba.

32. Dentro de la catacumba.

El Museo no cuenta con ninguna rampa de acceso, tampoco ascensores que comuniquen
a los visitantes a la segunda planta.

Para acceder a la segunda planta es necesario subir dos conjuntos de gradas de 37


grados de inclinacin, y un descanso.

228

33. Gradas de acceso al segundo nivel.

34. segundo grupo de gradas para acceder al


segundo nivel.

Despus otro grupo de gradas de piedra de 35 grados de inclinacin nos conducen a la


segunda planta donde se encuentra la sala de exposicin Miguel de Santiago.

35. Tercer grupo de gradas de acceso


al segundo nivel.

229

Para entrar a la sala Miguel de Santiago hay que subir una pequea grada.

36. Entrada a la Sala Miguel de Santiago.

37. Detalle de grada en la entrada a la sala


miguel de santiago.

38. Interior de la Sala Miguel de Santiago.


230

Para llegar a donde se encuentra una de las esculturas ms representativas del museo
hay que subir por un estrecho grupo de gradas de 48 grados de incitacin; imposible el
ingreso de una persona en silla de ruedas.

39. Detalle de conjunto de Gradas de


acceso a la galera de esculturas representativas.

40. Detalle de 2 gradas ms para ingresar a la


galera.

231

41. Detalle de esculturas


representativas.

Recursos Humanos con los que cuenta el mueso:


2 Guas de planta y 4 pasantes, 1 Director del Museo, 1 persona de seguridad y 1
persona de mantenimiento

232

2.2.3.- Centro Cultural Metropolitano Museo Alberto Mena Caamao.


Ubicacin: Garca Moreno y pasaje Espejo

42. Claustro principal del


Centro Cultural Metropolitano.
Informacin General:
En este Centro Cultural se encuentran: El Museo Alberto Mena Caamao, Las salas de
exposicin de Arte contemporneo y el Saln de Arte Contemporneo Mariano
Aguilera que se abren al Pblico temporalmente. Todo este conjunto es un espacio
cultural muy importante y dinmico en la ciudad.
- Tipologa de la edificacin.: Categora a: Conjuntos y edificios monumentales
Estas edificaciones por sus peculiares caractersticas estructurales formales y de
organizacin espacial debern orientar su utilizacin a las actividades colectivas a nivel
de ciudad, del centro histrico y de los barrios. Se posibilita el uso de una tecnologa de
punta que permita su adaptacin a los usos y funciones compatibles con las necesidades
de la ciudad y de los sectores poblacionales del centro, asimilando y profundizando su
valor simblico y su significacin en trminos urbanos. Los usos previstos son
bsicamente equipamientos y servicios colectivos, centros culturales, tursticos,
asistenciales y de la administracin pblica.
- Sistema constructivo: Republicano; Piedra, ladrillo (Arquitectura Monumental Civil).
- Estado de la edificacin: Muy bueno
- Grado de intervencin: Recuperacin.
- Usos de suelo posibles. Usos de tipo cultural, de recepcin, organizaciones
comunitarias y centros asistenciales.
ACCESIBILIDAD EXTERNA:
233

Su entrada se encuentra en la calle Garca Moreno, cuenta con pocas gradas de ingreso,
con inclinacin de 25 grados.
Este conjunto arquitectnico posee muchos pasillos y corredores en cada nivel para
aligerar las aglomeraciones de visitantes, ya que funcionan para servicios colectivos.
ACCESIBILIDAD INTERNA:
Desde la Calle Garca Moreno se entra por la recepcin del Centro Cultural
Metropolitano y a continuacin siguen el claustro principal acompaado de 3
corredores.

43 44 Corredores del Claustro Principal.

234

45. Detalle de Corredor que comunica a las gradas que acceden al segundo nivel del
claustro principal.

El Centro Cultural posee amplios corredores en el Primer nivel.

46 -47. Corredores del segundo nivel que comunican a las salas de exposicin y a
algunas reas de la biblioteca.
Algunos corredores del Centro Cultural Metropolitano estn aprovechados para
comunicar la historia de la edificacin.

48. Detalle de Panel Informativo.

49. Detalle de Imprenta antigua.


235

50.-Claustro sur C.C.M.

Otros espacios destinados para eventos, como en el claustro sur y este patio norte a
continuacin de la entrada principal.

51.- Claustro Principal

236

Los tres diferentes niveles del centro crean un sinnmero grupo de gradas de formas
e inclinaciones diferentes, las cuales comunican a los niveles entre si y llevan al
visitante a la entrada del museo Alberto Mena Caamao y a la sala de
sensopercepciones.
Existe un ascensor al lado de la entrada de la biblioteca de la calle Garca Moreno,
para acceso a los niveles superiores de personas en sillas de ruedas.

52-53.- Gradas que comunican al segundo nivel.


Tambin se puede acceder a los diferentes niveles por este conjunto de gradas.

54-55.- Gradas con pasamanos con estructura de acero forjado.


Algunas de accesos al tercer nivel con detalles fitomorfos en acero forjado en las
estructuras de los pasamanos.
237

2.2.3.1. Museo Alberto Mena Caamao

56.- Entrada al Museo Alberto Mena Caamao

Informacin General:
Se inaugur en 1959 con una importante donacin del quiteo Alberto Mena Caamao a
la ciudad de Quito. La edificacin ocupa antiguos aposentos jesuitas que luego
conformaron el Cuartel Real de la Audiencia de Quito. La coleccin comprende pintura
y escultura coloniales, principalmente de la Escuela Quitea, y obras republicanas. La
sala permanente de Quito al Ecuador consiste en seis ambientaciones de poca con
iluminacin y efectos sonoros, macrofotografas, 19 figuras de cera de tamao natural
de personajes histricos, una escena de la masacre de los prceres independentistas en
1810, entre otros. El Museo es parte del Centro Cultural Metropolitano.
El museo de Alberto Mena Caamao incluye:
Muestra permanente del arte colonial y republicano.
Muestra permanente del arte moderno ecuatoriano, que se basa en los trabajos que han
merecido el premio anual de pintura y escultura "Mariano Aguilera".
La muestra permanente histrica "de Quito al Ecuador", que lleva al visitante por una
ruta desde Pedro Vicente Maldonado al primer grito de la independencia y la masacre
del 2 de agosto de 1810, y culmina en el museo de cera.

ACCESIBILIDAD EXTERNA.-

238

Se puede ingresar a este museo por dos partes una es por las gradas que comunican con
el patio norte del Centro Cultural Metropolitano y la otra por el lado de la calle Espejo
al frente del palacio del gobierno.

57.- gradas de acceso .Inclinacin 46 grados

ACESIBILIDAD INTERNA:
Despus de la recepcin del museo viene un claustro pequeo. El recorrido comienza,
se puede acceder por las gradas o en ascensor.

57-58.- Gradas de acceso al segundo nivel del museo.

239

59.- Ascensor
En la tercera planta se encuentran amplios corredores y varias salas de exposicin.

60.- Detalle Escultura de Cera

61-62 Corredores de circulacin.


240

63.-Sala de exposicin.

No existen problemas de circulacin para personas en sillas de ruedas existe espacio


suficiente para giros y autonoma en entradas a estas salas de exposicin.

A continuacin del recorrido se encuentra este corredor bajando un grupo de gradas, o


por un ascensor al lado derecho.

64-65.- Gradas y ascensor para comunicacin con otros subniveles.

241

Para entrar a las galeras ubicadas en a este corredor es necesario subir una grada en
cada galera, esto resultara un poco incomodo para una persona en silla de ruedas. Las
salas que poseen esculturas de cera estn cercadas por cordones de seguridad.

66.-Gradas existentes para entrar a cada galera de este corredor.

67.- Representaciones y Cordones de seguridad.

Al final del pasillo se encuentra un espacio de descanso y otra recreacin de la vida de


Eugenio Espejo, existen gradas que nos conducen a la primera planta y tambin se
utiliza el ascensor ubicado al principio del corredor.

242

68.- rea de descanso

69.- Gradas de comunicacin a la planta Baja.


Acto seguido se encuentran 3 salas de exposicin referentes al cambio, inquietudes y
resistencias del pueblo quiteo. Estas salas no poseen problemas de accesibilidad para
personas en sillas de ruedas.

70-71.- Salas de exposicin.

243

72.- Rampa
Continuando con el recorrido existen 2 caminos para llegar a la representacin de la
masacre de los prceres, ubicada en las bvedas de la planta baja; ascensor y escaleras
en forma de churo.

73-74.- Gradas de acceso y ascensor

74.- Salida del ascensor.


244

Aunque el espacio es un poco angosto alcanza a pasar una silla de ruedas.


Una vez que se encuentra el visitante en esta rea, se puede dirigirse por medio de
angostos pasillos hacia las representaciones de la masacre y del modo de vida de la
poca.

75.- Corredor.

76.- Representacin de la masacre del 2 de Agosto de 1810.

Salida del recorrido por gradas y ascensor.

245

77.- Gradas de salida del recorrido

Los baos del museo son los mismos que los del Centro cultura Metropolitano.
La Sala de Sensopercepciones se encuentra cerrada momentneamente por problemas
con el audio de los objetos de exposicin.
Recursos humanos del museo:
4 personas de planta, 10 pasantes y 2 personas de seguridad.

246

2.2.4.- Casa Museo Mara Augusta Urrutia


Ubicacin: Calle Garca Moreno 760 entre Sucre y Bolvar.

78.- Entrada al Museo Mara Augusta Urrutia


Informacin General:
Mara Augusta Barba, mujer quitea altruista y de gustos refinados naci en 1901 y
muri en 1987. En 1921 ella recibi como regalo de bodas la casa de la calle Garca
Moreno en Quito que lleva su nombre a partir de la restauracin concluida en 199. Se
trata de una galera sobre la cotidianidad elegante de inicios de siglo en lo que refiere a
la decoracin de interiores y artefactos de uso domstico. El visitante puede mirar las
lujosas vajillas de porcelana parisina, los baos con decoracin inglesa y mquinas
revolucionarias de entonces como lavadoras a manivela, heladeras, tostadoras y
moledoras de caf. La casa conserva la Obra del pintor del siglo X Vctor Mideros.

Tipologa de la edificacin.: Categora b: Edificaciones de inters especial y atpicas de


importancia.
- Sistema constructivo: Republicano; Mixto Piedra, ladrillo y Adobe. Pisos de madera
(Arquitectura civil).
- Estado de la edificacin: Muy bueno
- Grado de intervencin: Restauracin- Conservacin.

247

- Usos de suelo posibles. Usos de tipo cultural.


ACCESIBILIDAD EXTERNA
No existen problemas para el ingreso desde la calzada ubicada en la calle Garca
Moreno.
ACCESIBILIDAD INTERNA

79.-Puerta interna del Museo en la recepcin.

Esta reja de metal separa a la recepcin del interior del claustro, que es en donde
comienza el recorrido del visitante.

80.- Claustro y pileta.

248

Una ves dentro de la casa museo, aparece este hermoso espacio con 2 corredores
internos que comunican al visitante con el rea de audiovisuales, descanso y las gradas
para acceder al segundo nivel.

81.-Corredores

82.-Sala de Audiovisuales

83.- rea de descanso y


cafetera.
Pasando la cafetera se encuentran dos cuartos en donde funcionaba la cocina y una
bodega o alacena de Mara Augusta Urrutia.

249

84-85.- Cuartos de bodega y cocina.

86-87.-Gradas de acceso al segundo nivel.

Imposible la creacin de una rampa por la inclinacin y forma del conjunto de gradas.
El Museo esta pensando incorporar un ascensor en el segundo claustro para poder
acceder hasta la tercera planta donde funciona el rea de restauracin y conservacin.

En la segunda planta se encuentran las salas principales, el dormitorio, el estudio, el


comedor y dems lugares que representan una poca, la de una acaudalada y honorable
mujer republicana en Quito.

250

88.- Segundo nivel.

89.- Segundo nivel detalle de entrada a los


dems espacios de exposicin.

90.- Sala de Exposicin.


La mayor parte de las salas del segundo nivel, poseen un cordn se seguridad para evitar
que los visitantes se pasen a zonas en conservacin y se pongan en riesgo la integridad
de las obras.

251

91.-Puerta con bisagras de presin para el ingreso a los


corredores, las salas y los cuartos del segundo nivel.

92- 93.- Corredores de circulacin del segundo nivel.

252

94-95.-Salas de Exposicin, Cordones de seguridad

96.- Detalle de Sala de


Exposicin y Cdula.

97.- Espacios de circulacin dentro de cada galera.


Los espacios de circulacin dentro de las salas que poseen cordones de seguridad
oscilan entre 1,30 m. hasta 1,80 m. de ancho por el largo de las salas.

253

98.- Fin del recorrido.

Gradas hacia abajo guan al visitante hacia la salida ubicada en la primera planta.
El Museo cuenta con un sistema de audio para msica ambiental.
Los baos no estn adaptados para personas con discapacidad fsica.

99.- Baos

Recursos humanos con los que cuenta el museo:


10 personas de planta y un promedio de 6 pasantes.

254

2.2.5.- Museo Fray Pedro Gocial - Convento de San Francisco


Ubicacin: Convento de San Francisco en la Plaza del mismo nombre.

.
100.-Fachada de la Iglesia 100

101.- Entrada del Museo

Informacin General:
La Construccin del Convento de San Francisco inici en el siglo XVI y se prolong
hasta el siglo XVIII, cuando se completaron los siete claustros que integran este
complejo, el mayor de Amrica Latina. All se fund en el siglo XVI el Colegio de
Artes y Oficios de San Andrs lo que hizo del Convento un prolfico centro de
produccin artstica. El museo presenta una de las mayores colecciones de arte colonial
255

de la ciudad en un espacio que ocupa un claustro completo del convento. La coleccin


destaca no solamente por la cantidad de sus obras, sino tambin por la diversidad de
piezas en exhibicin como los bargueos trabajados en la tcnica del taraceado;
esculturas en miniatura trabajadas en cera y otras en madera; mesas de estilo rabe con
incrustaciones de hueso, carey, espejos y madera; la coleccin de cuadros sobre la vida
de la Virgen Maria pintados en alabastro (mrmol tierno y cada cuadro pesa cerca de
dos quintales); varias esculturas de tamao natural que an se utilizan para las
ceremonias religiosas en el tiempo de Semana Santa. El Museo alberga 300 obras y es
el hogar de la ms clebre creacin del reconocido escultor de la Escuela Quitea
Bernardo de Legarda, la Apocalptica Alada, una de las imgenes de la Virgen Mara
ms singulares de la Colonia, que por su carisma y belleza es aclamada como la Virgen
de Quito. Su magnfico coro restaurado permite el disfrute del antiguo artesonado de la
Iglesia y visin integral del altar principal. La sillera con sus relieves de Santos
mrtires, construida en el siglo XVI se suman el rgano contemporneo instalado a
inicios del siglo XX formando un conjunto de gran belleza esttica.

Tipologa de la edificacin.: Categora a: Conjuntos y edificios monumentales


Estas edificaciones por sus peculiares caractersticas estructurales formales y de
organizacin espacial debern orientar su utilizacin a las actividades colectivas a nivel
de ciudad, del centro histrico y de los barrios. Se posibilita el uso de una tecnologa de
punta que permita su adaptacin a los usos y funciones compatibles con las necesidades
de la ciudad y de los sectores poblacionales del centro, asimilando y profundizando su
valor simblico y su significacin en trminos urbanos. Los usos previstos son
bsicamente equipamientos y servicios colectivos, centros culturales, tursticos, y
asistenciales.
- Sistema constructivo: Colonial; Mixto Piedra, ladrillo y Adobe. (Arquitectura
Monumental Religiosa).
- Estado de la edificacin: bueno
- Grado de intervencin: Conservacin Restauracin.
- Usos de suelo posibles. Usos de tipo cultural y religioso, de recepcin, organizaciones
comunitarias y centros asistenciales.

ACCESIBILIDAD EXTERNA:
La entrada al museo se la puede hacer por dos lados de la plaza, en ambos casos hay
grupos de gradas de 36 a 40 grados de inclinacin.

256

102.- Gradas del lado norte para el acceso al museo.

103.- Gradas de Acceso Este a la Iglesia y al Museo.


ACCESIBILIDAD INTERNA

104-105.- Entrada a la recepcin del Museo y a la sacrista del convento.


257

106-107.- Entrada del Museo y Claustro Principal

Para ingresar al claustro principal, donde comienza el recorrido es necesario subir 2


gradas de 39 grados de inclinacin.

Amplios corredores caractersticos de las construcciones de templos religiosos


coloniales.

108.- Entrada a las galeras de


exposicin.

258

109.-Amplios corredores para circulacin.

110.- Sala de semana Santa.

111- 112.- Salas del XVII y XVIII


259

No hay problemas de circulacin dentro de las salas de exposicin; existe suficiente


espacio para el giro de una silla de ruedas 1,30 m. mnimo.
Recorrido en la primera planta.

113.- Galera de exposicin

114.- Detalle de panel informativo.

115.- Detalle de espacios en sala de exposicin.

260

Se contina el recorrido hacia el coro alto, este se encuentra en el interior de la iglesia


en la segunda planta del convento. Para acceder a este lugar es necesario subir el
siguiente conjunto de gradas, no existen rampas ni ascensores.

116-117.- Gradas de acceso al segundo nivel del Museo

118-119.-Entrada al coro
alto.

261

120.- Espacio de descanso en el


coro alto.

121.-Espacio de circulacin en
el coro alto.

122.- Espacio de circulacin en


el coro alto.

262

Un rea de exposicin del museo se encontraba en restauracin, su ingreso es complejo


por lo angosto de sus pasillos y la inclinacin de sus gradas.
El ingreso a las bateras sanitarias para los visitantes, se lo realiza por medio de unas
gradas ubicadas en una parte baja tipo stano de el museo; No se encuentran adaptadas
para discapacitados.

123-124.- Entrada al bao de visitantes.

Recursos humanos con los que cuenta el museo:


5 personas de planta y practicantes 15 por la maana y 15 por la tarde en
temporada; y 5 por la maana y 5 por la tarde cuando no es temporada.

263

2.2.6.- Museo Numismtico del Banco Central del Ecuador.


Ubicacin: Garca Moreno y Sucre Esquina

125.- Edificio del Museo Numismtico del Banco Central del Ecuador

Informacin General:
A travs de distintos recursos museogrficos este espacio presenta informacin de los
procesos de intercambio o trueque de las sociedades originarias americanas y revisa el
origen y evolucin de almoneda en la Amrica Hispana durante la poca colonial. Son
temas puntuales la produccin de la Casa de Moneda de Quito y las emisiones de
billetes e introduccin de metales por los bancos particulares en la etapa republicana
hasta la segunda dcada del siglo XX. Estn en exhibicin las especies monetarias
emitidas por el Banco Central del Ecuador durante el siglo XX hasta la adopcin del
dlar norteamericano como moneda circulante.
Tipologa de la edificacin.: Categora b: Edificaciones de inters especial y atpicas de
importancia.
- Sistema constructivo: Republicano; Mixto Piedra, ladrillo. (Arquitectura Monumental
civil).
- Estado de la edificacin: Muy Bueno
- Grado de intervencin: Conservacin Restauracin
- Usos de suelo posibles. Usos de tipo cultural, de recepcin, organizaciones
comunitarias.
264

ACCESIBILIDAD EXTERNA:
Para entrar al Museo se lo puede hacer por la Calle Garca Moreno o por la Sucre; se
debe subir 12 gradas cncavas de 45 grados de inclinacin.
ACCESIBILIDAD INTERNA:
Inmediatamente que se pasa el primer conjunto de gradas nos encontramos con un
descanso en el cual existen divisiones hacia la planta baja y hacia la planta alta por
medio de gradas.
Hacia la planta baja se encuentra las instalaciones y reas de exposicin del museo.
El espacio de ingreso es un poco incomodo para los visitantes y complejo por la
adecuacin de un detector de metales para la seguridad del museo; adems se encuentra
al final de un conjunto de gradas de 40 grados de inclinacin. seguido a esto se
encuentra la recepcin del museo.

126.- Entrada principal del Museo y detector de metales.

Dentro del museo lo primero que se ve son corredores de 1,60 m. de ancho que
comunican al visitante con las primeras galeras de exposicin.

265

127-128.- Corredores de circulacin interna.


A continuacin se encuentran las salas de exposicin unidas por medio de pasillos
un poco angostos. Las salas de exposicin no permiten aglomeraciones de gente
debido a su escaso espacio de circulacin y a los grandes muebles en donde se
exhiben sus colecciones.

129.- Mueble para exhibicin de la coleccin.

130.- Espacio de Comunicacin entre salas de exposicin.


266

131.- Sala ms amplia del Museo.


Prontamente se encuentran ms corredores con paredes de piedra en donde se comunica
un poco de la temtica histrica del museo y sus personajes representativos; se debe
subir 2 gradas de 38 grados de inclinacin.

132-133.- Corredores internos del museo.

El corredor de la derecha es el mas angosto de todos mide 1,20 m.de ancho.


Se contina el recorrido y se debe bajar por 2 gradas de 37 grados de inclinacin.

267

134.- ltimo corredor.

135.- Prensa
En esta sala de exposicin los espacios son un poco reducidos, pero permiten un tipo de
circulacin lineal cuando hay pocos visitantes.

136.- Puerta de entrada a exposicin del papel moneda.

268

Para ingresar a esta galera se debe pasar por esta puerta de reducido tamao a lo
ancho.

137.- Detalle de montaje museogrfico.


Continuando el recorrido se encuentra una ltima sala de exposicin, la cual cuenta con
un amplio espacio para exponer la coleccin.

138.- Sala de exposicin.


Seguido a esto se encuentra un pequeo grupo de gradas de 38 grados de inclinacin
que conducen al visitante a la salida del museo.

139.- Entrada y Salida del museo.


269

Las bateras sanitarias con las que cuenta El Museo Numismtico son inadecuadas para
el ingreso de personas discapacitadas. EL museo no cuenta con ascensor.

140-141.- Baos

Recursos Humanos con los que cuenta el museo:


3 personas de planta, una mediadora, y de dos a cuatro pasantes.

270

2.2.7.- Fundacin Iglesia de la Compaa de Jess


Ubicacin: Garca Moreno y Sucre

142-143 Fachada de la Iglesia de la compaa de Jess.


Informacin General:
El Monumento ms representativo de la ciudad de Quito, La Compaa es el templo
barroco quiteo por excelencia y tres son los pilares de su belleza: la decoracin nica
en base a trazos mudjares, las tallas de retablos y esculturas en madera y la utilizacin
de pan de oro para cubrir tallas y muros. Su fachada es la obra colonial ms vistosa de la
ciudad e incluye a las imgenes de San Pedro y San Pablo, los principales santos
jesuitas, el corazn de Jess y de Mara, la Virgen Inmaculada, El Espritu Santo y el
Smbolo de la Eucarista con un mensaje religioso. Adems de su valor arquitectnico,
histrico y esttico, la iglesia de La Compaa tiene un enorme valor simblico para la
ciudad, pues fue en este templo donde la primera santa quitea, Santa Mariana de Jess
ofrend su vida a Cristo; y donde sucedi a inicios del siglo XIX el prodigio de la
Virgen Dolorosa: la imagen cerr sus ojos frente a 35 jvenes del colegio San Gabriel.

271

Tipologa de la edificacin.: Categora a: Conjuntos y edificios monumentales


Estas edificaciones por sus peculiares caractersticas estructurales formales y de
organizacin espacial debern orientar su utilizacin a las actividades colectivas a nivel
de ciudad, del centro histrico y de los barrios. Se posibilita el uso de una tecnologa de
punta que permita su adaptacin a los usos y funciones compatibles con las necesidades
de la ciudad y de los sectores poblacionales del centro, asimilando y profundizando su
valor simblico y su significacin en trminos urbanos. Los usos previstos son
bsicamente equipamientos y servicios colectivos, centros culturales, tursticos,
asistenciales y de la administracin pblica.
- Sistema constructivo: Colonial; Mixto Piedra, ladrillo y Adobe. (Arquitectura
Monumental Religiosa).
- Estado de la edificacin: bueno
- Grado de intervencin: Conservacin Restauracin.
- Usos de suelo posibles. Usos de tipo cultural y religioso, de recepcin, organizaciones
comunitarias y centros asistenciales.
ACCESIBILIDAD EXTERNA:

144.-Entrada a la Iglesia

145.- Entrada para personas en sillas de ruedas.

272

Para acceder al interior de la Iglesia se cruza 2 gradas (inclinacin 45 grados). Tambin


por el lado sur existe una entrada para personas con sillas de ruedas.
ACCESIBILIDAD INTERNA:
El Museo es la Iglesia misma y algunas de las salas del convento.
Para ingresar a la iglesia se debe pasar por una pequea grada ubicada en la puerta
principal del museo o por una puerta lateral con una barredera.

146.- Puerta Principal.

147.- Puerta Lateral

147.- Plano en planta de la Iglesia.

Entradas para ingresar al recorrido de la Iglesia.

Acto seguido se encuentra la recepcin donde se encuentran los guas.

273

148.- Recepcin.
Espacios de visita en la Iglesia. Nave Central, Crucero, Coro alto, Sacrista.

149.- Corredores.

150.-Nave Central.

274

151.-Sacrista.

152.- Corredor lateral.

153.- Espacio central.

Para acceder al coro alto es necesario subir por una escalinata en forma de caracol, es
espacio es imposible de acceder si se esta en una silla de ruedas.

Para Ingresar a los baos de uso del visitante es necesario cruzar la sacrista y subir un
pequeo conjunto de gradas de 40 grados de inclinacin.

275

154.- Salida de la sacrista

155.- Entrada a los baos

Las bateras sanitarias son inadecuadas para el uso de personas con discapacidad
psicomotriz.

Recursos Humanos con los que cuenta la Fundacin:

20 personas de planta y 15 pasantes.

276

2.2.8.- Museos Casa de la Cultura Ecuatoriana


Ubicacin: Av. 12 de Octubre N16-224 y Patria

Entrada
delos
Museos
dearte
Moderno
yMusical

156.- Casa de la Cultura Ecuatoriana.

157.- Entrada a los museos


Informacin General:
El 9 de agosto de 1944, el Presidente de la Republica del Ecuador, Doctor Jos Mara
Velasco Ibarra, promulg el decreto ejecutivo N 707, mediante el cual se crea la Casa
277

de la Cultura Ecuatoriana; Institucin orientada a fortalecer el devenir histrico de la


patria y cuyo fundamental propsito busca "...dirigir la cultura con espritu
esencialmente nacional, en todos los aspectos posibles a fin de crear y robustecer el
pensamiento cientfico, econmico, jurdico y la sensibilidad artstica de la colectividad
ecuatoriana".
La idea parti de la necesidad de devolverle al Ecuador la confianza perdida como
consecuencia de un grave quebranto territorial sufrido en 1941. De Mariano Picn
Salas, Arnold Toynbee y Keiserling tom Carrin los fundamentos filosficos sobre
cuya base apoyar la creacin de la Casa de la Cultura Ecuatoriana. La Casa de la
Cultura Ecuatoriana que lleva el nombre de su creador, Benjamn Carrin, uno de los
valores ms altos de las letras nacionales, escritor lcido ensayista y ferviente suscitador
de nuestro pensamiento nacional, durante muchos aos lucho para reivindicar la
dignidad del pas y bajo los imperativos de este compromiso asumi el desafo que la
ciencia, las letras y el desarrollo artstico cultural del Ecuador, le demandaba Benjamn
Carrin deca: Si no podemos ser una potencia militar y econmica, podemos ser, en
cambio, una potencia cultural nutrida de nuestras ms ricas tradiciones. Carrin
citaba el ejemplo de naciones pequeas como Grecia e Israel capaces, no obstante, de
figurar entre las ms civilizadas y cultas de toda la historia.
La teora de la nacin pequea, el smil del sauce podado y la fecundidad del
insuficiente demostraban que un cuerpo mutilado puede actuar en plenitud de
posibilidades fsicas y por ende espirituales, merced a fuerzas de compensacin por l
desarrolladas. La Casa de la Cultura Ecuatoriana, concebida como un verdadero hogar
de la cultura nacional, hara del Ecuador lo que las armas nunca podran lograr: la
expresin de una fuerza anmica bajo cuyo signo se enalteceran las artes y las letras.

- Tipologa de la edificacin.: Categora especial 1: Edificaciones de inters especial y


atpicas de importancia fuera del centro histrico.
- Sistema constructivo: Industrial; Mixto; Piedra, cemento, metal, espejos entre otros.
(Arquitectura monumental Civil).
- Estado de la edificacin: Muy bueno
- Grado de intervencin: Acondicionamiento
- Usos de suelo posibles. Usos de tipo cultural, comercio especializado, instalaciones
hoteleras y de recepcin, organizaciones comunitarias y centros asistenciales. Se
descarta los usos de vivienda y pequeos comercios para densificar las reas
subutilizadas y elevar el nivel de habitabilidad y servicios de la poblacin.

ACCESIBILIDAD EXTERNA:
Para ingresar a los museos de Arte Moderno y al de Instrumentos Musicales se puede
ingresar por la Av. Patria o por la Av. 12 de Octubre.
278

Recepcin del Museo

158.- Recepcin
ACCESIBILIDAD INTERNA:
Luego de la recepcin se encuentran 2 grupos de gradas de 38 grados de inclinacin
para llegar a la primera Sala Joaqun Pinto.

159- 160.- Gradas de ingreso al Museo.

279

Esta sala es bastante amplia y cuenta con iluminacin con sensores de movimiento
para activacin.

161.- Galera de exposicin


En la misma planta se encuentra la Sala de Retratos ubicada en unos de sus
corredores. Y a continuacin el Museo de Instrumentos musicales y el rea de
Etnografa.

163.- rea de Instrumentos Musicales.

162.- rea de Retratos.


280

163.- rea Etnogrfica


Para acceder a la planta Superior solo hay gradas:

164.- Gradas del lado oeste del Museo

165.- Gradas a la izquierda de la entrada de la sala


Joaqun Pinto.

281

166.- Gradas al final de la Sala de


Retratos.
En la planta superior se encuentran las salas de Arte Contemporneo y las salas de
Arte Moderno y de Grabado, todas las salas poseen un amplio espacio para
circulacin; incluso se han realizado actividades de danza y de teatro.

167.- Sala de Grabado.

168.-Sala de Arte Moderno


282

169.-Sala de Arte
Contemporneo.

283

2.2.9.- Museo Ecuatoriano de Ciencias Naturales


Ubicacin: Parque la Carolina, Rumipamba 341 y Av. de los Shyris

170.- Entrada Principal del Museo de Ciencias Naturales-

Informacin General:
Seis investigadores y amigos de la fauna y flora silvestre juntaron sus colecciones de
animales y plantas para abrir en 1978 el Museo Nacional de Ciencias Naturales. Este
generoso gesto ha sido imitado pos naturalistas de todo el mundo que han cedido
algunas de sus colecciones al museo. Entre ellas una de minerales y otra de conchas
y caracoles. La coleccin contiene ahora 7000 aves embalsamadas, de las cuales
1500 son endmicas del pas; 60 mil especies de insectos nativos; 1900 especies de
conchas y caracoles, 100 mamferos de todos los gneros; 100 especies de peces;
100 especies de reptiles; un orquideario y una coleccin de minerales, con una
subdivisin para las piedras fosforescentes. El Museo ofrece una sala de
paleontologa donde mora un mastodonte (haplomastodon Chimborazi) de 10 mil
aos de antigedad. Entre las piezas ms impactantes de la Sala de reptiles est un
caimn negro amaznico de 4,20 metros de largo y el esqueleto de una anaconda de
9 metros. La biblioteca rene 1238 libros y 57 revistas.

284

171.- Biblioteca

- Tipologa de la edificacin.: Categora especial 1: Edificaciones de inters especial y


atpicas de importancia fuera del centro histrico.
- Sistema constructivo: Industrial; Mixto Piedra, cemento, metal, entre otros.
(Arquitectura Civil).
- Estado de la edificacin: Muy bueno
- Grado de intervencin: Ninguno.
- Usos de suelo posibles. Usos de tipo cultural, comercio especializado y de recepcin,
organizaciones comunitarias y centros asistenciales. Se descarta los usos de vivienda y
pequeos comercios para densificar las reas subutilizadas y elevar el nivel de
habitabilidad y servicios de la poblacin.
ACCESIBILIDAD EXTERNA:

172.- Entrada a la recepcin del


Museo.
285

El Museo se encuentra en el parque de la Carolina, para ingresar al museo se debe pasar


por una grada de 12 cm. de altura; el museo no cuenta con rampa para personas en silla
de ruedas. Inmediatamente despus de la entrada, se encuentra al lado sur la recepcin
del museo y al lado norte oficinas de administracin.

173.- Recepcin del Museo.


El recorrido comienza hacia el lado oeste, donde se encuentran las primeras muestras de
animales disecados; el museo funciona solo en una planta, la segunda planta esta
dedicada al rea de investigacin en diferentes campos.

174.- Ingreso a las Salas de Exposicin

286

De frente se encuentra la sala de Anatoma comparada y a mano izquierda se encuentra


la Sala de los Invertebrados en la cual se encuentran tambin los baos.

175.- Entrada a la Sala Invertebrados.

176.- Interior de la Sala Invertebrados.

287

177.- Entrada a los baos


Los baos no estn adaptados para el uso de personas en sillas de ruedas.

178.- Baos
Saliendo de esta sala se encuentra la sala de Anatoma comparada.

179-180.- Sala de Anatoma comparada.

288

Para entrar a esta sala es necesario subir tres gradas de 30 grados de inclinacin. No hay
rampas ni pasamanos.

181.- Interior de la Sala de


exposicin.
Esta sala tiene un recorrido corto y estrecho con esqueletos a los lados de la circulacin
y libres de proteccin.
Continuando con el recorrido hacia el oeste se encuentra la Biblioteca y la sala de los
vertebrados.

182.- Biblioteca

183.- Sala de Vertebrados

La sala Vertebrados cuenta con un audio general.

289

184.- Entrada a la sala de vertebrados


El Interior de la Sala Vertebrados cuenta con espacio suficiente para la circulacin de
personas en silla de ruedas.

185.- Espacio de circulacin Sala de invertebrados

186-187.- Espacios de circulacin en el rea de vertebrados

290

Para finalizar la visita a museo se encuentra en un corredor una pequea muestra de


minerales fluorescentes, la sala de botnica en remodelacin y al final del corredor esta
la Sala de Paleontologa.

188-189.- rea de botnica

190-191.- Entrada y espacio de circulacin en sala de minerales fluorescentes.


Esta muestra de minerales fluorescentes esta ubicada en un corredor, es pequea de
espacio fsico. No permite el giro de una persona en silla de ruedas.
Despus de esta muestra se encuentra la Sala de Paleontologa; para acceder a esta sala
hay que subir hacia un desnivel de tres gradas de 30 grados de inclinacin y lugar bajas
tres gradas de la misma inclinacin para llegar a la exposicin de las obras fosilizadas.
Esta sala tirar un espacio angosto de recorrido donde se encuentran los soportes para los
huesos fosilizados y posee un espacio amplio donde se encuentran los diferentes
estratos de suelos en una vitrina.

291

192-193.- rea de paleontologa

194.- Detalle Vitrinas de clases de suelos y espacios de circulacin


Recursos Humanos con los que cuenta el museo:
15 personas de planta, de 1 hasta 8 pasantes y tesistas de diferentes campos
cuando hay presupuesto para pagar las investigaciones.

292

2.3.-Capilla del hombre


UBICACIN: Mariano Calbache y Lorenzo Chvez EA18-143

195.- Museo Capilla del hombre


Informacin General:
Oswaldo Guayasamn es uno de los ms grandes pintores ecuatorianos
contemporneos, y una voz muy fuerte en la plstica Iberoamericana del siglo XX.
Sus murales de enorme expresividad estn en la sede de la UNESCO en Pars, en el
Barajas, en Madrid; es un autor del mural principal de la sede permanente del
Parlamento Latinoamericano, del mural del edificio del Congreso Nacional del
Ecuador, y tiene una casa museo en la Habana, Cuba. La Capilla del Hombre fue su
ltimo gran proyecto y el ms ambicioso, construido a partir de 1996 con el apoyo
de la UNESCO. En palabras del artista, su visin sobre la capilla era pintar en la
Capilla del hombre toda la tragedia que hemos tenido a travs de nuestra vida y de
nuestra historia en Amrica Latina. La muerte le llego a la edad de 79 aos, tres
antes de que la capilla se pudiera inaugurar. El edificio de 3600 m2 de construccin
en dos niveles y una gran cpula contiene el mural que recorre la historia americana
desde las poderosas imgenes de Guayasamn, adems de numerosas obras de gran
formato. Se exhiben tambin los hallazgos arqueolgicos
de 14 tumbas
preincsicas, descubiertas por la misma poca de la muerte de Guayasamn en el
rea. All se encontraron 2284 vestigios entre fragmentos y vasijas, que son parte de
un museo de sitio. La Capilla del Hombre ha iniciado ya la segunda fase de
construccin.
- Tipologa de la edificacin.: Categora b: Edificaciones de inters especial y atpicas
de importancia.
- Sistema constructivo: Industrial (Arquitectura monumental Civil).
293

- Estado de la edificacin: Muy bueno


- Grado de intervencin: Ninguno
- Usos de suelo posibles. Usos de tipo cultural, comercio especializado.
ACCESIBILIDAD EXTERNA:
Para ingresar a la capilla es necesario pasar por unas rampas de acceso de 11 grados de
inclinacin, estas rampas son adecuadas para personas discapacitadas en sillas de
ruedas.

196- 197.- Rampa de acceso a la entrada del museo.


ACCESIBILIDAD INTERNA:
La capilla del hombre posee mucho espacio para circulacin interna de sus visitantes ya
que es un edificio creado especficamente para la funcin de museo.

198.- Entrada del museo

294

199.- Recepcin del Museo.

200.- Espacio de circulacin planta alta.


Amplios corredores en la primera planta, utilizados para exponer las obras del maestro
Guayasamn.

201.- Espacio de circulacin planta alta.


295

202.- Ascensores
Para acceder a la planta baja existen ascensores y gradas.

203-204.- Gradas de acceso a la planta baja.

205.-rea de ventas y recuerdos del museo.

296

Como se puede apreciar no existen problemas de accesibilidad para llegar a este sector.
A continuacin hay una rampa para ir a los dos lados de la siguiente galera de la capilla
del hombre, la cual es de un formato espacioso.

206.- Entrada a las galeras de la planta baja.


Las galeras y corredores donde se encuentra la exposicin de obras es bastante grande,
esto es debido a que se necesita un espacio considerable para apreciar las obras de gran
formato del maestro.

207.- Espacio interno de la planta baja.

208.-Espacio interno, planta baja.


297

209.- Murales de cermica (plantan


baja).

210.- Llama encendida en honor al


maestro Guayasamn.

211.-

Corredores

amplios

para

Circulacin.

298

212213.- Corredores
Corredores utilizados para exponer obras de formato mediano planos de construccin de
la capilla y pensamientos del maestro.

214-215.-

Sala de

audiovisuales, e informacin de la construccin de la capilla.


Aunque la capilla anuncie que sus baos son adaptados para personas discapacitadas,
estos no poseen barras de apoyo para utilizar el inodoro.

216-217.- Detalle baos.


299

Recursos humanos con los que cuenta el Museo:


14 Personas de planta y 7 pasantes.

300

2.3.1.-Fundacin Guayasamn
UBICACIN: Bosmediano 5543 y Jos Carbo. Bellavista

218.- Entrada a la Fundacin Guayasamn.


Informacin General:
Oswaldo Guayasamn, pintor que marc el arte contemporneo en Ecuador, fue tambin
un coleccionista incansable y un admirador del arte nacional. La fundacin Guayasamn
exhibe piezas de su coleccin personal que incluyen arqueologa, Arte Colonial, arte
contemporneo, y naturalmente obra del pintor Su coleccin Arqueolgica contiene
1500 piezas que son apenas la mitad de lo recolectado por Guayasamn durante 60 aos.
La coleccin de Arte colonial se especializa en la Escuela Quitea con obras de
Caspicara, Pampite, Vlez, Samaniego, Miguel de Santiago entre otros. Las pinturas y
esculturas con motivos religiosos suman 300 obras en total. Finalmente, est la
coleccin Guayasamn en pocas Huacayan (camino del llanto), La Edad de la Ira y
Mientras vivo siempre te recuerdo (la edad de la Ternura). Se exhiben tambin 1000
dibujos del artista, algunos elaborados en su infancia. En la Fundacin funciona la
biblioteca de arte y los talleres de serigrafa y restauracin.

- Tipologa de la edificacin.: Categora b: Edificaciones de inters especial y atpicas


de importancia.
- Sistema constructivo: Industrial (Arquitectura monumental Civil).
- Estado de la edificacin: Muy bueno
- Grado de intervencin: Ninguno
- Usos de suelo posibles. Usos de tipo cultural, comercio especializado.

301

ACCESIBILIDAD EXTERNA:
Se puede acceder a la Fundacin Guayasamn por la Calle Bosmediano este acceso no
presenta problemas mas grandes que la inclinacin de la calle misma.
La fundacin Guayasamn esta establecida en una casa tipo modelo de campo, con
varios espacios verdes y cuartos por separado en donde funcionan las galeras, a dems
cuenta con una biblioteca y una cafetera.

219.- Interior de la Fundacin.

Para acceder a la Sala de arqueologa se puede ir por estos dos lados.

220-221.- Gradas y rampa

302

222.- Sala de Arqueologa.

Tres gradas obstaculizan la entrada a esta sala, para una persona en silla de ruedas.

La otra entrada tambin posee una grada de 15 cm. de altura. Dentro de esta galera o
sala Arqueolgica en donde se encuentran las piezas que el maestro coleccionaba existe
un espacio reducido para la circulacin del visitante en silla de ruedas y ninguna cdula
en braille o Audio de la explicacin de las obras.

223-224.- Interior de la Sala de Arqueologa.

303

225-226.- Gradas y espacios de circulacin.


A continuacin en otra instalacin ubicada a pocos metros de la galera arqueolgica, se
encuentra el Museo Guayasamn de arte contemporneo.

227.- Entrada a la Sala de Arte Contemporneo.


Esta entrada posee dos gradas de 15 y 12 cm. que dificultan el acceso para un visitante
discapacitado visual en silla de ruedas; a continuacin existe un panel en donde se
anclan los cuadros que dificulte el giro y que no posee el espacio suficiente
reglamentario para dicho acto.

304

228-229.-Entrada a la sala de arte contemporneo

Entrada de la Galera.
Inicio del recorrido
El museo cuenta con cinco salas de exposicin; existes tres problemas de acceso hacia
ciertos sectores, todos son referentes a gradas.

230.- Primera Galera.

305

231.-Segunda Galera.

232.- Primera grada y problema de acceso mide 17


cm.de alto.
Este corredor nos comunica con la siguiente galera.

233.-Tienda

de

postales,

litografas y recuerdos.
306

234.-Gradas de acceso al rea de exposicin tres.

Tres gradas de 40 grados de inclinacin es el tercer problema, este camino nos conduce
hasta la siguiente y ultima rea de exposicin.

235.-Gradas para acceder a las ltimas obras.

236.-Salida.
307

Existen dos gradas para salir de la sala de exposicin.


La siguiente galera es el rea de arte Colonial, la cual se encontraba cerrada por
arreglos de mantenimiento. El primer inconveniente es la entrada, son un grupo de
10 gradas de 39 grados de inclinacin y un espacio reducido para un giro de una
silla de ruedas.

237.- Entrada a la Sala de Arte contemporneo.


Las bateras sanitarias con las que cuenta la fundacin son inadecuadas para el uso
de personas discapacitadas visuales y en silla de ruedas; los espacios son muy
reducidos y no cuenta con barandas de apoyo.
La fundacin cuenta con reas verdes y una cafetera los caminos estn trazados con
piedras planas en el piso lo que no dificulta la gua para una persona con
discapacidad visual avanzada de por donde se circula.

238.- Bao.

308

Recursos Humanos con los que cuenta la Fundacin:


18 personas de planta y de 6 a 8 pasantes.

309

2.3.2.-Fundacin Posada de las artes Kingman


Ubicacin: Av. Diego de Almagro 1550 y la Pradera; La casa de Kingman est en
San Rabel, Valle de los Chillos.

239-240.- Entrada a la Pasada de la artes Kingman.


Informacin General:
La posada de las Artes Kingman se fundo en 1989 como un espacio de difusin de la
obra del pintor ecuatoriano Eduardo Kingman: Adems de la muestra permanente del
artista, se realizan all exposiciones temporales de pintores nacionales e internacionales.
En la posada funciona un almacn de reproducciones de las obras de Eduardo Kingman,
as como de serigrafas, libros, catlogos, lienzo grafas, camisetas, jarros, entre otros.
En la Posada se realizan actividades culturales permanentemente.
Tipologa de la edificacin.: Categora especial 1: Edificaciones de inters especial y
atpicas de importancia fuera del centro histrico.
- Sistema constructivo: Industrial; Mixto Piedra, cemento, metal, entre otros.
(Arquitectura Civil).
- Estado de la edificacin: Muy bueno
- Grado de intervencin: Ninguno.
- Usos de suelo posibles. Usos de tipo cultural, comercio especializado y de recepcin,
organizaciones comunitarias y centros asistenciales. Se descarta los usos de vivienda y
pequeos comercios para densificar las reas subutilizadas y elevar el nivel de
habitabilidad y servicios de la poblacin.
ACCESIBILIDAD INTERNA:
Se encuentra mezanine del edificio, no hay ascensor.

310

241.- Primer Grupo de gradas.

242-243.- Segundo Grupo de gradas y entrada de la posada

Consta de una pequea galera, un lugar para eventos y reuniones, y un espacio donde
funciona la parte administrativa.

244-245.- Espacios para circulacin interna.

311

Sus bateras sanitarias son inadecuadas para personas parapljicas u otras que posean
discapacidades fsicas motrices.

246-247.- Baos

312

2.3.3.- Museo Amaznico


Ubicacin: Centro Cultural Abya-yala Av. 12 de Octubre 1430 y Wilson

248.- Entrada al edificio donde se encuentra el Museo.


Informacin General:
El Museo tiene tres reas: etnografa del Oriente, fauna de la cordillera oriental y
Amazona, y un rea fotogrfica que ilustra la destruccin de la regin amaznica
particularmente por la presencia de petroleras y madereras. En la seccin etnogrfica
existen piezas de siete nacionalidades indgenas amaznicas: Cofn, Zpara, SionaSecoya, Huoarani, Quichua, Shuar, Achuar. La coleccin de los Shuar de la provincia
de Morona Santiago es la ms importante y su pieza emblemtica es la tzanza, la cabeza
reducida del enemigo. Entre los objetos cotidianos se pueden ver tejidos, canastos,
instrumentos de cacera, instrumentos musicales, alfarera, camas, adornos corporales,
arte plumario, entre otros. En la seccin de fauna se exhiben animales disecados que
murieron en condiciones naturales (la coleccin muestra sobre todos animales
pequeos). Finalmente la coleccin fotogrfica contiene documentos visuales de fines
de la dcada del 90.

Tipologa de la edificacin.: Categora especial 1: Edificaciones de inters especial y


atpicas de importancia fuera del centro histrico.
- Sistema constructivo: Industrial; Mixto Piedra, cemento, metal, entre otros.
(Arquitectura Civil).
- Estado de la edificacin: Muy bueno
- Grado de intervencin: Ninguno.
313

- Usos de suelo posibles. Usos de tipo cultural, comercio especializado y de recepcin,


organizaciones comunitarias y centros asistenciales. Se descarta los usos de vivienda y
pequeos comercios para densificar las reas subutilizadas y elevar el nivel de
habitabilidad y servicios de la poblacin.
ACCESIBILIDAD EXTERNA:
El museo etnogrfico se encuentra en un segundo piso y el museo arqueolgico se
encuentra en el cuarto piso; no hay ascensor.

249-250.- Gradas para acceder a la entrada del museo y entrada al museo.


ACCESINILIDAD INTERNA:
INSTALACIONES
Cuenta con 2 amplias galeras en donde se exhiben objetos representativos de las
culturas aborgenes.

251.- rea de exposicin


314

Objetivos del Museo Amaznico


Presentar de manera didctica la cultura material de las etnias que habitan en la
amazonia tales como: Shuar Achuar, Corn, Kichwa, Huao, Siona Secoya Zampara
detallando su vivienda, caza, pesca, mitos, costumbres e ideologas.

Sensibilizar sobre los problemas humano ambientales de la amazonia, creando


conciencia y formando de esta manera opinin a favor de los pueblos indgenas
amaznicos para evitar a corto y largo plazo el deterioro irreversible de su hbitat, al
cual esta ligada su existencia.

Proporcionar informacin sobre os riesgos y desafos que actualmente enfrentan los


grupos naturales: colonizacin, degradacin del hbitat, destruccin del medio ambiente
explotacin agroindustrial y petrolera.

reas de atencin:
1.- La etnogrfica, donde se muestra la cultura material de siete etnias.
2.- Muestras de la fauna amaznica y de la cordillera oriental.
3.- Coleccin de fotografas histricas donde se muestra la destruccin de la amazona
por parte de las industrias petrolera y maderera.

Piezas de inters:
1.- Las cabezas reducidas: humana, animal y las que actualmente se utilizan en las
ceremonias.
2.- Representacin de una familia Shuar.
3.- Fauna de la amazonia, animales en extincin y de la cordillera oriental.
4.- Muestras de arte plumario de las etnias.

Servicios:
1.- Biblioteca con temas especficos de etnografa, antropologa, turismo, proyectos,
entre otro, de la amazonia ecuatoriana.
2- Videoteca con temas sobre las etnias de la amazona.
315

3.- Auditorio.

Proyectos en ejecucin:
1.- Museo Taller: Trabajo didctico que realiza con nios de 3 a 11 aos de edad,
provenientes de instituciones educativas.
2.- Museo Aula: Capacitacin a los estudiantes secundarios en el manejo de la
informacin de los museos para exposiciones a sus compaeros.

316

2.3.4.- Museo Artes


Ubicacin: Veintimilla E8-115 y Av. 6 de Diciembre

252.- Fachada del Museo Artes


Informacin General:
Un conjunto de artistas contemporneos encabezado por las tres hijas menores del
pintor Oswaldo Guayasamn muestran su obra en este museo escultura y pintura de
Shirma Guayasamn, pintura de Dayuma Guayasamn, bajo pedido se proyectan los
documentales de Yanara Guayasamn, se muestran fotografas sobre el Ecuador de
Olivier Auverlau y la Obra del pintor ecuatoriano contemporneo Miguel Varea. La
galera exhibe esculturas de la abuela de las artistas, Malvine Drherniak escultora y
pintora Rusa y la obra de la madre de las artistas, Luce de Pern.

Tipologa de la edificacin.: Categora especial 1: Edificaciones de inters especial y


atpicas de importancia fuera del centro histrico.
- Sistema constructivo: Industrial; Mixto Piedra, cemento, metal, entre otros.
(Arquitectura Civil).
- Estado de la edificacin: Muy bueno
- Grado de intervencin: Ninguno.
- Usos de suelo posibles. Usos de tipo cultural, comercio especializado y de recepcin,
organizaciones comunitarias y centros asistenciales. Se descarta los usos de vivienda y
pequeos comercios para densificar las reas subutilizadas y elevar el nivel de
habitabilidad y servicios de la poblacin.

317

ACCESIBILIDAD EXTERNA:

253.- Accesibilidad externa

En la entrada se encuentran tres gradas (elevacin 45 grados), para luego llegar a una
pequea puerta que conlleva a la recepcin de museo.

254.- Entrada al Museo.


Este museo ya no se encuentra en funcionamiento.

318

2.3.5.- Museo Nacional del Banco Central del Ecuador


Ubicacin: Casa de la Cultura Ecuatoriana, Av. Patria y 12 de Octubre

255.- Fachada Museo Nacional del Banco Central del Ecuador

Informacin General:
Este Museo contiene la coleccin Arqueolgica y arte ms importante del pas con las
salas de Oro Arqueolgico, Arqueologa Ecuatoriana, Arte Moderno-Contemporneo,
exposiciones temporales, auditorio y servicios didcticos. Los 14.000 aos de historia
ecuatoriana estn representados en sus colecciones y la pieza ms antigua data del ao
12.000 a.C.
La Sala de Arqueologa contiene a ms de 1.000 piezas de la mayora de las culturas
precolombinas y la Sala de Oro Arqueolgico contiene adornos corporales, objetos
rituales, armas, piedras finas, entre muchas otras piezas.
La Sala de Arte Colonial contiene una representativa coleccin de cuadros e imaginera
religiosa de los siglos XVI, XVII, XVIII, que se complementan con piezas elaboradas
en piedra, marfil, tagua, hueso, cermica y porcelana. Destacan en la coleccin los
artistas de la Escuela Quitea. El Arte Republicano tiene su espacio, al igual que el
expresionismo social e indigenista, tan importante en el pas. El Museo exhibe obras
emblemticas de las diversas corrientes artsticas desde los 60 hasta trabajos que
incorporan nuevas tecnologas provenientes de la Bienal de Arte de Cuenca realizada
desde 1987.
El Museo ofrece un completo panorama sobre las culturas prehispnicas del territorio
del Ecuador y el desarrollo de las artes plsticas en el pas desde la Colonia.

319

- Tipologa de la edificacin.: Categora especial 1: Edificaciones de inters especial y


atpicas de importancia fuera del centro histrico.
- Sistema constructivo: Industrial; Mixto; Piedra, cemento, metal, espejos entre otros.
(Arquitectura monumental Civil).
- Estado de la edificacin: Muy bueno
- Grado de intervencin: Acondicionamiento
- Usos de suelo posibles. Usos de tipo cultural, comercio especializado, instalaciones
hoteleras y de recepcin, organizaciones comunitarias y centros asistenciales. Se
descarta los usos de vivienda y pequeos comercios para densificar las reas
subutilizadas y elevar el nivel de habitabilidad y servicios de la poblacin.
ACCESIBILIDAD EXTERNA:

256.- Entrada Principal del Museo


Cuenta con una puerta giratoria, rampa de acceso desde la calzada y puertas para el
ingreso de personas en sillas de ruedas. Posee una rampa que va desde la calzada hasta
la entrada del museo.

257- 258.- Rampa de acceso.

320

259. Recepcin del Museo


A continuacin de la entrada se encuentra la recepcin del museo; a mano izquierda esta
la entrada a las salas de exposicin de arqueologa y a la derecha estn las salas de
exposiciones temporales.

260.- Entrada a la Sala de Arqueologa.

261.- Entrada a las galeras temporales.

El recorrido del museo comienza con salas de exposicin de las culturas prehistricas
del ecuador, el espacio es amplio y no presenta problemas de acceso.

262263 -264.- Espacios de circulacin y descanso.

321

A continuacin se encuentra el rea donde se exponen artefactos de oro para acceder a


esta rea existen rampas y gradas.

265-266.- Detalles de Accesos a la Sala de Oro.


Continuando con el recorrido se encuentra una gran agrupacin de gradas dividida en
tres secciones con tres descansos, cada seccin posee un grado de inclinacin de 35
grados. Estas gradas transportan al visitante hacia el rea de arte colonial y
republicano. Aunque tambin se puede acceder por el lado sur de la recepcin donde se
encuentra un ascensor.

267 268.- Accesos para las Salas de Arte Colonial y Arte Republicano.

269.- rea de circulacin en Sala de Arte


Colonial.
322

A continuacin se encuentra un corredor con diferentes muestras de vestimentas, el


cual comunica a un descanso para seguir a la segunda y tercera planta donde funcionan
las salas de Arte Contemporneo y Arte Moderno.

270 271 -272.- Corredor, Gradas, Entrada de Galera de Arte Contemporneo.


Para acceder a las Salas de Arte Contemporneo se puede ir por ascensor y por gradas;
el espacio que poseen estas reas es significativo. No existen problemas de circulacin
ni de acceso.

273.- Detalle ascensor

274.- Detalle entrada a la Sala de Exposicin.

275 276.- reas de circulacin


323

277 -278.- reas de circulacin

Recursos humanos con los que cuenta el Museo:


21 personas de planta y 12 pasantes.

Las bateras sanitarias con las que cuenta el museo son inadecuadas para el uso de
personas discapacitadas visuales y en silla de ruedas.

324

2.3.6.- Museo del colegio militar Eloy Alfaro


UBICACIN: Av. Orellana y Amazonas.

279.- Entrada al Colegio Militar Eloy Alfaro

Informacin General:
El museo del Colegio Militar Eloy Alfaro se encuentra funcionando dentro de un
antiguo inmueble donde funcionaba el colegio de nias Manuela Caizares; en este
museo se pueden apreciar objetos, fotografas, lienzos de algunos de los momentos
histricos ms importantes de ndole blica del pas y la regin.
Categora especial 1: Edificaciones de inters especial y atpico de importancia fuera del
centro histrico.
ACCESIBILIDAD EXTERNA:
Despus de pasar una garita de seguridad, se encuentra un grupo de 7 gradas de 38
grados de inclinacin, para ingresar al interior del edificio donde se encuentra
establecido el museo. No existen rampas de acceso, ni ascensores.

ACCESIBILIDAD INTERNA:

325

280.-Entrada del museo del Colegio militar Eloy Alfaro.


Dentro del edificio donde funciona el rea administrativa del colegio militar se
encuentra el museo. El Museo dispone en su recorrido de 7 salas de exposicin y tres
galeras.

281.- Inicio del recorrido


rea de recepcin del Museo.
En su sala introductoria hay un espacio considerable de circulacin para el visitante
discapacitado, esta sala no posee audio.

282 283.- Detalle del rea de circulacin.


326

A continuacin se encuentra la sala de exposicin del Alto Cenepa. Esta recreacin del
territorio no posee audio, y su espacio para circular es pequeo.

284 -285.- Sala de exposicin dedicada al Alto Cenepa.

286.- Detalle de Objetos de exposicin en la Sala del Alto Cenepa.


Siguiendo con el recorrido se encuentra la Sala Arqueolgica con ms de 300 piezas de
las diferentes culturas precolombinas del Ecuador.

287 288.- Entrada y espacio de circulacin en la Sala Arqueolgica.


327

Despus de la sala de arqueologa se encuentra este pasillo en donde se hallan pinturas


de caballete de diferentes personajes de la guerra; al final del pasillo est una urna con
posesiones del General Eloy Alfaro; no existen problemas de accesibilidad en el pasillo.

289.- Detalle del corredor.


A los lados de este corredor se encuentra tres salas didcticas de exposicin donde se
hallan representadas la Costa, La Sierra, la Amazonia, y Galpagos. Todas estas salas
cuentan con un espacio suficiente para la circulacin de una persona discapacitada, a
excepcin de un espacio donde se encuentra un puente colgante.

290 291.- Detalle entrada y rea de la sala Galpagos

328

292 293.- Detalle de cdula y Museografa de la Sala Costa

294 295.- Entrada a la Sala Sierra y rea de exposicin.

296.- Puente de madera.


Este puente de madera posee muy poca estabilidad y no es recomendado que una
persona en silla de ruedas pase por aqu. Se puede llegar a la sala de la Amazona dando
la vuelta por el corredor donde se encontraba la urna de objetos del General Eloy
Alfaro.

297 298.- Amazona


329

299.-Bateras sanitarias.
Las bateras sanitarias son inadecuadas para personas discapacitadas en sillas de ruedas,
por su reducido espacio.

Recursos humanos con los que cuenta el Museo:


1 director, 1 persona de mantenimiento de planta, 20 pasantes en temporada.

330

2.3.7 Museo Padre Francisco de Jess Bolaos


Ubicacin: Antigua recoleta mercedaria del Tejar, en la Iglesia del mismo nombre,
calle el Tejar.

300.- Fachada del Edificio


Informacin General:
El Museo se encuentra fuera de funcionamiento por arreglos y falta de presupuesto.
- Tipologa de la edificacin.: Categora b: Edificaciones de inters especial y atpicas
de importancia.
- Sistema constructivo: Colonial; Mixto Piedra, ladrillo y Adobe (Arquitectura
Monumental Religiosa).
- Estado de la edificacin: Bueno
- Grado de intervencin: Conservacin.
- Usos de suelo posibles. Usos de tipo cultural y religioso, de recepcin, organizaciones
comunitarias y centros asistenciales.

301-302.- Recepcin y entrada al museo.


331

Este museo se encuentra cerrado indefinidamente.

2.3.8.- Museo Camilo Egas


Ubicacin: Venezuela 1302 y Esmeraldas.
Informacin General:
332

El Banco Central del Ecuador crea en los ochenta el Museo Camilo Egas en honor a este
artista ecuatoriano del siglo XX. En el ao 2003 se renueva el museo y se incorporan
actividades educativas a dems de poner en valor la obra del artista Camilo Egas. La
exposicin permanente permite conocer las diferentes etapas en las que trabaj el
artista. Destacan el Indigenismo, el expresionismo, el surrealismo, el cubismo y la
abstraccin total de la figura.
- Tipologa de la edificacin.: Categora b: Edificaciones de inters especial y atpicas
de importancia.
- Sistema constructivo: Colonial; Mixto Piedra, ladrillo y Adobe (Arquitectura Civil).
- Estado de la edificacin: Muy bueno
- Grado de intervencin: Conservacin Restauracin.
- Usos de suelo posibles. Usos de tipo cultural, de recepcin, organizaciones
comunitarias y centros asistenciales.
Instalaciones:
El Museo Camilo Egas cuenta con dos plantas arquitectnicas; En la primera planta: un
rea de recepcin e informacin, 2 salas de exposicin, una sala de transito de obras con
una representacin del taller del maestro Camilo Egas, un patio central donde funcionan
talleres didcticos y a dems cuenta con bateras sanitarias. En la segunda planta: dos
salas de exposicin, una oficina de seguridad, y el rea de administracin.
ACCESIBILIDAD EXTERNA:
La entrada del museo se encuentra en la calle Venezuela como se puede apreciar es en
una subida y existe una grada con diferentes alturas.

303.- Entrada al edificio


ACCESIBILIDAD INTERNA:
333

Existen dos maneras de ingresar al Museo Camilo Egas la una es a la izquierda de la


entrada del edificio subiendo dos gradas de 39 grados de inclinacin y la otra entrada
para personas discapacitadas que se encuentra cruzando recto desde la entrada del
Inmueble donde se encuentra una reja de metal.

304.-Entrada 1.

305.- Entrada 2.

En el siguiente plano se tiene una idea ms clara de la estructura del museo.

306.- Plano Planta Baja del museo.

334

A continuacin de la entrada principal se encuentra la recepcin del museo y en la


misma galera se encuentra implantada la primera muestra de la coleccin del maestro.

307.- Recepcin del Museo

308 - 309.- Detalle de tipos de obras que se exponen.


Esta sala de exposicin es pequea de tamao considerando que esta unida a la
recepcin (6,40 X 4,22 m.).
Saliendo de la Sala nos encontramos con dos salidas la una conecta al visitante con otra
sala de exposicin y la otra con dos corredores y un patio, este ultimo utilizado como
espacio para talleres.

335

310.- Corredor

311.- Salida de la primera sala de exposicin

312.- Detalle del Patio y Pileta.

313.- Sala de exposicin que se une a la primera sala de exposicin.

336

Saliendo de la Sala de exposicin se encuentra en otro cuarto una recreacin del taller
del maestro y un pasillo con espejos metlicos; a continuacin de esto unas gradas de
madera con 45 grados de inclinacin que comunican al visitante hacia la segunda planta.

314.-Detalle del taller de Camilo Egas 315.- Detalle de Espejos, lminas de metal.

316.- Gradas para acceder a la segunda planta.


El museo no cuenta con ascensor; las gradas son la nica va para acceder a la segunda
planta.
En la segunda planta se encuentran dos salas de exposicin, el rea de administracin y
una oficia de seguridad.

337

317.-Corredor que comunica a las salas de exposicin.

318.-rea de Sala de exposicin de la segunda planta.

319.- Sala de exposicin (segunda planta)

338

320.-Plano Planta del segundo piso.

Las bateras sanitarias con las que cuenta el museo no son adaptadas para el uso de
personas discapacitadas.

321.- Baos

Recursos Humanos con los que cuenta el museo:


2 personas de planta, un mediador educativo, 2 personas de seguridad, 1 persona de
mantenimiento y 4 pasantes.

339

2.3.9.- Museo Fray Pedro Bedn.

322.- Entrada del edificio.

Ubicacin: Calle Flores entre Rocafuerte y Bolvar. Convento de Santo Domingo.

Informacin General:
Su Nombre es un homenaje al artista y religioso dominico de finales del siglo XVI
Pedro Bedon. El Museo ofrece lienzos y esculturas de los siglos XVI, XVII, XVIII
distribuidos en tres salas en las que destaca una escultura de San Juan, firmada por el
famoso escultor Bernardo de Legarda. La primera sala est dedicada a los patriarcas
dominicos como Santo Domingo de Guzmn, San Pedro de Verona, Santo Toms de
Aquino, entre otros. Las otras salas exhiben objetos de uso religioso, como las casullas
del clero bordadas en hilos de oro y de plata, los grandes libros Corales trabajados en
pergamino y cuero de oveja, los sagrarios, entre otros. La iglesia tiene su artesonado
original de estilo mudjar (caracterizado por la ornamentacin rabe) en excelente
estado de conservacin. Adems dentro del Convento se levanta una joya arquitectnica
con alardes urbansticos: la majestuosa Capilla del Rosario que forma el arco de Santo
Domingo, puerta de entrada al viejo barrio de la Loma Grande.
- Tipologa de la edificacin.: Categora b: Edificaciones de inters especial y atpicas
de importancia.
- Sistema constructivo: Colonial; Mixto Piedra, ladrillo y Adobe (Arquitectura
Monumental Religiosa).
- Estado de la edificacin: Bueno
340

- Grado de intervencin: Restauracin - Conservacin.


- Usos de suelo posibles. Usos de tipo cultural y religioso, de recepcin, organizaciones
comunitarias y centros asistenciales.
ACCESIBILIDAD EXTERNA:
Para entrar al museo se debe ingresar a la Plaza de Santo Domingo en primera instancia,
esta plaza tiene muchas entradas y varias rampas de acceso.
El Museo posee una entrada pequea con puertas de vidrio; luego se encuentra el rea
de la recepcin y bajando unas pocas gradas de 40 grados de inclinacin se encuentra el
claustro principal del convento.

323.- Entrada del museo (foto tomada desde la parte


interior del claustro hacia fuera).
ACCESIBILIDAD INTERNA:
Una vez dentro del claustro a unos pocos metros al norte se encuentra la entrada a las
salas de exposicin del museo.

324.- Detalle del Claustro y corredores


341

325.- Entrada a las salas de exposicin del museo.


Dos pequeas gradas de 35 grados de inclinacin, una puerta estrecha de madera y una
reja de metal nos dan la bienvenida a las salas de exposicin.

326.- Detalle del rea de circulacin.


En el interior de las salas de exposicin se encuentran espacios para circular de una
manera preplaneada y establecida para el pequeo lugar donde funciona la actividad
musestica.
El espacio consta de tres instancias:
1. Cuando los Dominicos aparecen.
2. Cuando los Dominicos llegan a Amrica.
3. Y los dominicos en Quito.
Segn el mismo personal del Museo, el lugar del museo fue improvisado; en el ao de
1965 el padre Jos Maria Vargas cre al museo y luego el Padre Valdivieso impulso el
apoyo para su restauracin en el ao de 1980 con la fundacin ecuatoriana belga
342

ECUABEL, La cual cre el orden y el diseo museogrfico con el que cuenta en la


actualidad dentro del poco espacio disponible.
Las bateras sanitarias con las que cuenta el museo no son apropiadas para el uso de
personas discapacitadas.
Recursos humanos con los que cuenta el museo:
2 personas de planta y 4 practicantes.

343

2.4.0.- Museo Monacal Santa Catalina de Siena.Ubicacin: Calle Espejo 779 y Flores.

327.- Entrada al Edificio


Informacin General:
Este monasterio femenino se fund en 1613 y en el ao 2005; sus puertas se abrieron
con la inauguracin del museo. La coleccin de Santa Catalina presenta pintura y
escultura de la Colonia, con obras muy importantes de la Escuela Quitea, pero su
particularidad son las piezas trabajadas en el mismo monasterio por las hbiles y
dedicadas religiosas. Por ejemplo estn las casullas bordadas con hilos de oro y plata,
los adornos de oropel, los trajes de novia que las religiosas vestan en su ceremonia de
toma de hbito. El visitante podr conocer tambin como eran las celdas de las
dominicas internas en tiempos pasados. El museo exhibe las reliquias llegadas a Santa
Catalina a partir del siglo XVII como por ejemplo una pequea parte de la osamenta de
Santa Cristina, mrtir cristiana de siglo XII. Desde el gran coro sur de la iglesia, se
puede apreciar este bello templo quiteo, que solamente se abre al pblico los domingos
durante la misa de las 08h00 AM.
- Tipologa de la edificacin.: Categora b: Edificaciones de inters especial y atpicas
de importancia.
- Sistema constructivo: Colonial; Mixto Piedra, ladrillo y Adobe (Arquitectura
Monumental Religiosa).
- Estado de la edificacin: Bueno
- Grado de intervencin: Restauracin - Conservacin.
- Usos de suelo posibles. Usos de tipo religioso.

344

ACCESIBILIDAD EXTERNA.La entrada al edificio en donde funciona el museo posee una inclinacin alta lo que
sera un problema para el visitante discapacitado visual y en sillas de ruedas.

328.- Entrada al Museo


ACCESIBILIDAD INTERNA:
Para entrar al museo hay que pasar por varias gradas de inclinaciones variables y
bastantes altas en espacios reducidos.
Primero para poder llegar a la recepcin del museo desde la calle Espejo; luego desde el
rea de la recepcin del museo hacia las galeras de exposicin, es todo un entramado de
varias gradas y direcciones. Esta entrada fue habilitada luego, ya que como es un
monasterio de claustro las visitas que pasaban por el interior de la iglesia y del
monasterio molestaban la meditacin de las hermanas.
Una vez que se pasan estos obstculos se llega a un amplio corredor y a sus lados se
encuentran las salas de exposicin.

345

329.- Detalle de Corredores de


circulacin interna

330.-Sala de exposicin (antigua sala donde preparaban el vino de consagracin).

331.- Gradas que conducen al coro alto.


346

Gradas con 45 grados de inclinacin que conducen al coro alto y luego un grupo de
gradas en espiral conducen al visitante hacia el campanario.
Las bateras sanitarias con las que cuenta el museo son inadecuadas para el uso de una
persona discapacitada visual y en silla de ruedas.

Recursos humanos con los que cuenta el museo :


3 personas de Planta y 6 practicantes.

347

2.4.1.-

Museo Histrico militar Casa de Sucre.-

Ubicacin: Venezuela 573 y Sucre.

332.- Edificio donde funciona el museo.

Informacin General:
Esta edificacin de inicios del siglo XVIII fue durante un corto tiempo el hogar del
Mariscal de Ayacucho, Antonio Jos de Sucre, lugarteniente del libertador Simn
Bolvar y esposo de la acaudalada Mariana Carceln Marquesa de Solanda. La casa se
divide en dos plantas y guarda los objetos personales, muebles enceres y recuerdos de la
pareja que vivi all entre 1828 y 1830, ao en que Sucre fue asesinado en su viaje de
vuelta a Quito. En los primeros aos de este siglo XX, el inmueble fue pintado con un
ail intenso, por lo que se lo conoci como la Casa Azul. El Ministerio de Defensa
compr la edificacin, la restaur y la abri para visitas del pblico en 1977.
- Tipologa de la edificacin.: Categora b: Edificaciones de inters especial y atpicas
de importancia.
- Sistema constructivo: Colonial; Mixto Piedra, ladrillo y Adobe (Arquitectura Civil).
- Estado de la edificacin: Bueno
- Grado de intervencin: Restauracin - Conservacin.
- Usos de suelo posibles. Usos de tipo cultural.
ACCESIBILIDAD EXTERNA.La entrada principal del museo se encuentra en la Calle Venezuela se debe subir una
grada de 15 cm. de altura
348

ACCESIBILIDAD INTERNA PRIMERA PLANTA:


En primera instancia en la entrada del museo se encuentra la recepcin, a los lados se
encuentran las entradas hacia 2 salas de exposicin conocidas como Sala de Prceres.

333.- Recepcin y entrada del museo.

Para entrar a estas dos salas de exposicin es necesario subir dos pequeas gradas en el
un caso, y una grada en el otro caso; las gradas miden de 10 a 16 cm.

334 335 Entradas de las Salas de exposicin


Existe un espacio suficiente para el ngulo de giro de una silla de ruedas en el Interior
de estas salas de exposicin.

349

336.- rea de circulacin dentro de la primera sala de exposicin.

337.- rea de circulacin dentro de la segunda sala de exposicin.

Para ingresar hacia el claustro o patio de esta Casa de tipo Republicana es necesario
subir por 2 gradas de medida entre 15 y 18 cm. de altura. Una vez dentro del patio se
puede acceder a las diferentes salas de exposicin: Auditorio, Sala de armas, Sala de
Prceres, y Sala de Imagen Institucional.

338.- Detalle de patio principal y pileta.

350

339.- Auditorio, detalle de pequea grada de 10 cm. de altura.

340.- auditorio
Dentro del auditorio el espacio de circulacin es muy reducido
Para entrar a la Sala de Armas es necesario subir por dos gradas de 13 cm. de altura y 20
grados de inclinacin.

341.- Entrada Sala de Armas.


351

342.- Espacios de circulacin en Sala Institucional

Sala de Imagen Institucional, posee poco espacio para circulacin adems para ingresar
a esta sala se debe pasar por dos gradas como en la Sala de Armas.
Todas estas salas se encuentran alrededor de los pasillos del patio.

343.- Detalle de entradas a Galeras de exposicin.


Para acceder hacia la segunda planta es necesario subir por 2 grupos de gradas de 33
grados de inclinacin. En este piso se encuentran El comedor, La alcoba, El Saln
Principal, El Saln de Invitados, El Oratorio, La cocina, El repostero y El horno, uno de
los lugares preferidos por el Mariscal para leer. Para acceder a cualquiera de estas salas
de exposicin es necesario subir una pequeas gradas de mximo 6 cm. de altura.

352

344 -345.- Gradas de acceso al segundo nivel.


El museo no cuenta con ascensor para poder acceder a la segunda planta.

346.- Segunda planta y corredores.

347.-Detalle del rea del Saln Principal.

353

Para entrar al Saln Principal es necesario subir una grada de 5 cm. de alto.

348.-Oratorio.
Existe muy poco espacio para la circulacin. Se puede apreciar esta sala en un espacio
mximo de 1,20 detrs de un cordn de seguridad.

349.-Alcoba.
Lo mismo que el caso del Oratorio.

350.- Cocina y repostero.


354

No se puede ingresar a estos lugares, solo se los puede ver desde el portal de la puerta.
Al comedor si se puede ingresar pero no posee de mucho espacio fsico para la
circulacin.

351.- Comedor.

352.-Horno.

Como se puede observar es de difcil acceso por su reducido espacio.


Posee bateras sanitarias inadecuadas para discapacitados visuales y en silla de ruedas.

355

353.- Baos

Recursos humanos con los que cuenta el Museo:


6 personas. 4 de planta y 2 practicantes.

356

357

3.GUINMUSEOLGICO

AREA

TEMAS

CONCEPTOS
BASICOS

SUBTEMAS

OBJETOSY
COLECCIONES

AUDIO

TEXTOS

INTRODUCTORIA

Historia

Queesun
discapacitado

Comoeranvistos
enlaantigedad

Todala
informacinen
sonidogeneraly
particular.

Braile

Obraspictricasy
elevacinenalto
relieve.

Lavistaysus
enfermedades

LOSMS
BRILLANTES

SalaTALLERY
CREACIN

Queesla
ceguera

Clasificacin

Bustoscon

sensores
localizados,para
explicacindetipos
deenfermedad.

Brailede
identificaci
encdulas
delos
objetos.

Obras
maestras

Quienessony
quehicieron

Comolohicieron

Bustos,esculturas
einventos.

Informacinen
audiogeneral

Computado
aconteclad
nbraile.

Apreciacin
artstica

Quescrear,
quienescrean.

Dctilopintura,
modelado,collage,
arteconceptual.

Personaloperativo
especializado.

Tcnicasy
tendencias

Lacoleccinconsta
de15obrasenun
inicioenaltosy
bajorelievescada
obracontexturas,
olorysabor
caractersticos.

Todala
informacinen
sonidogeneraly
particular.

Paneles
informativo
consensore
sobrelos
autores,
tcnicasy
tendencias.

Reglasdelos
juegos

Tcnicas
especiales
SALADEARTE
CONTEMPORANEO.

READE
INFORMACIN

SALA

SALADE
RECREACIN

Obrasguas

Arte
contemporneo
ecuatoriano.

recreacin

Ayudaal
visitante

Ques?

Sociedadesy
fundacionesque
trabajancon
personas
discapacitadas.

Programacinde
citas.

Folletosenbra
yaudiodelas
instituciones.

Creacinde
fichasdesalud.

358

Carns.

359

3.1.- DESARROLLO DEL GUION MUSEOLGICO


PLAN DIRECTOR

El museo Discart Mind Eyes Museum consta de consta de 4 salas de exposicin, un rea
de recreacin y un rea de consulta e informacin, un rea de recreacin y una
cafetera; adaptadas especialmente para todo tipo de visitantes. A dems de contar con
un personal operativo especializado.

Sala Introductoria.El motivo de esta sala es establecer un sentimiento de pertenencia e encasillamiento del
tipo de ceguera que posea el visitante y lograr una reaccin participativa.

TEMAS
HISTORIA
ENFERMEDADES DE LA VISTA
HISTORIA
QUIENES SON LAS PERSONAS DISCAPACITADAS? (braille y audio)
Son las personas que tienen impedida o entorpecida alguna de las actividades
cotidianas consideradas normales, por alteracin de sus funciones intelectuales o fsicas.

CMO ERAN VISTOS EN LA ANTIGEDAD?


En tiempos pasados, las personas discapacitadas iban frecuentemente a parar a
hospitales, asilos u otras instituciones que proporcionaban una formacin escasa, si es
que impartan alguna.
En la prehistoria, a medida que las distintas tribus y agrupaciones humanas se
movilizaban buscando mejores cotos de caza o despus mejores tierras para realizar sus
cultivos, decidan abandonar a su suerte a las personas discapacitadas, para no
entorpecer los desplazamientos del resto de la tribu. Durante la poca de las primeras
civilizaciones, los espartanos de la antigua Grecia, arrojaban desde el Monte Tai geto a
las personas con discapacidad, pues no queran que "en su bella y floreciente
civilizacin" existieran personas diferentes.

168

La historia de los discapacitados no ha sido nunca estable ni segura, lo cierto es que las
desviaciones de cualquier tipo siempre nos han parecido una amenaza, lo diferente nos
molesta, pero al mismo tiempo tenemos una fuerte curiosidad por aquello que nos
parece sobrenatural, desde considerarlos demonios hasta dioses, de lo mtico a lo vulgar.
En esa eterna bsqueda nos hemos encontrado con contrastes muy notables; as como
entre los animales hay quienes destruyen a sus cachorros imperfectos o simplemente los
dejan morir, existen animales que los protegen amorosamente.
Los hombres tambin a lo largo de la historia les han dado diferentes tratamientos a las
personas con algn tipo de discapacidad.

En la Grecia del siglo IV a.C. El eminente filsofo Aristteles trat de


interpretar algunas desviaciones, existen registros de estudios de las diferencias
fsicas y mentales realizadas por Digenes, Hipcrates y Galeno quienes
estudiaron la epilepsia, y la demencia, entre otras formas atpicas.
Los indios Masai asesinaban a sus nios discapacitados.
Los Chagga de frica Oriental utilizaban a sus discapacitados para ahuyentar al
demonio.
Los antiguos Hebreos crean que los defectos fsicos eran una marca del pecado.
Los Jukun de Sudan consideraban que eran obra de los malos espritus y los
abandonaban para que murieran.
Los Semang de Malasia empleaban a sus lisiados como hombres sabios.
Para los Nrdicos los discapacitados eran verdaderos Dioses.
En algunas sociedades antiguas, era normal el infanticidio cuando se observaban
anormalidades en los nios y nias; un ejemplo est en el pueblo de Esparta que,
por su carcter ofensivo, no permita miembros no vlidos.
Durante la Edad Media, principalmente en Francia, se construyeron verdaderas
fortalezas y ciudades amuralladas en donde se guardaban y escondan a
centenares de personas con algn tipo de discapacidad.
En el siglo XIV, los nacidos con alguna deficiencia ya sea fsica, sensorial o
mental, como la sordera, la ceguera, la parlisis, la cuadriplejia, entre otros, eran
confinados a grandes encierros, en los que eran exhibidos los fines de semana a
manera de espectculo circense o de gran zoolgico, para que las familias se
divirtieran un poco o bien, manejando la conciencia social, rectificaran los actos
cometidos en el pasado, por considerar a estos "monstruos" o "fenmenos" como
la ms grande seal de un castigo enviado por Dios.
Posteriormente, los "anormales", constituyeron un pretexto tambin de Dios para
despertar la caridad, el fin: la promesa de salvacin y vida eterna. Por lo menos,
ya no eran considerados "fenmenos", ahora eran llamados "miserables"; su
funcin ya no era la de divertir, ni la de solamente despertar el arrepentimiento,
sino que su funcin sufri un cambio aparentemente ms "digno": el de ser los
portadores del objetivo de Dios, liberar a los "normales" del pecado, por la
caridad.

Esto fue lo que en trminos generales la sociedad oblig a creer durante mucho tiempo a
las personas con alguna deficiencia: personas minusvlidas, sin valor, incapaces de
desarrollar una conciencia crtica, un sentimiento; seres por tanto, sin voz ni voto.

169

Tras la aparicin de la iglesia cristiana, se condena el infanticidio pero se alienta a


atribuirles el origen de cualquier suceso sobrenatural y se les denominan endemoniados
o endemoniadas, personas posedas por el demonio y otros espritus infernales,
sometindoles a prcticas exorcistas.
Como puede observarse, muchos han sido los papeles sociales y los conceptos que se
han manejado alrededor de las personas discapacitadas en las diferentes sociedades y
culturas, sin embargo en la gran mayora de los casos, no han sido justas ni favorables e
incluso la exclusin social se ha exacerbado durante algunas pocas.

Durante los siglos XVII y XVIII, a quien tena una discapacidad psquica se le
consideraba persona trastornada, que deba ser internada en orfanatos, manicomios sin
recibir ningn tipo de atencin especfica. Se les denominaba imbciles, amentes,
dbiles mentales, diferentes, locos o locas. A finales del siglo XVIII y principios del
XIX, se inicia la institucionalizacin, de modo especfico, de quienes tienen una
discapacidad psquica. Esto se debi a la idea de que haba que proteger a las personas
normales de la no-normal. La persona con discapacidad es separada, segregada,
discriminada. Aparece la terminologa nios y nias idiotas en el entorno de quienes
investigan la materia y, posteriormente desde el mbito mdico, oligofrnico u
oligofrnico.

Esta situacin se alarga hasta comienzos del siglo XX por ser considerados como seres
perturbados y perturbadores, antisociales y obsesos sexuales.
Por ejemplo, durante el siglo XX se cometieron grandes crmenes en Alemania, por el
ejrcito Nazi, durante la segunda guerra mundial, diversas atrocidades se realizaron, "en
busca de la raza perfecta" en la cmara de gases o con la ingestin de sustancias letales
que se proporcionaron en forma selectiva, antes que a nadie, a las personas con
discapacidad mental para aniquilarlas tratando de construir un supuesto mundo de "seres
perfectos".
El racismo, intolerancia y complejos de superioridad, imperaron en esa poca no solo
para exterminar a los judos, mujeres y ancianos; sino tambin a las personas con
discapacidad. En este mismo siglo, las personas con discapacidad dieron origen a una
industria floreciente en los pases ricos, en donde se construyeron enormes edificios,
llenos de seudo especialistas, algunas veces en condiciones precarias, otras veces con
todo el lujo posible. En donde han reunido a personas con discapacidad mental para que
vivan all para siempre, olvidados de sus familias y de la sociedad. Considerando que no
deban de molestar a las dems personas, ni tampoco constituir las manchas de las
ciudades, y otras consideraciones.

170

En Suecia, hasta mediados de los aos 70, se esterilizaba a las personas con
discapacidad, incluso, sin su consentimiento.

OBJETOS Y COLECCIONES
RECREACIN DE LA HISTORIA POR MEDIO DE ESCULTURAS Y
AMBIENTACIONES (ESCENA)

En el siglo XIV, los nacidos con alguna deficiencia ya sea fsica, sensorial o
mental, como la sordera, la ceguera, la parlisis, la cuadriplejia, entre otros, eran
confinados a grandes encierros, en los que eran exhibidos los fines de semana a
manera de espectculo circense o de gran zoolgico, para que las familias se
divirtieran un poco o bien, manejando la conciencia social, rectificaran los actos
cometidos en el pasado, por considerar a estos "monstruos" o "fenmenos" como
la ms grande seal de un castigo enviado por Dios.
Los Semang de Malasia empleaban a sus lisiados como hombres sabios.
Para los Nrdicos los discapacitados eran verdaderos Dioses.
En la Grecia del siglo IV a.C. El eminente filsofo Aristteles trat de
interpretar algunas desviaciones, existen registros de estudios de las diferencias
fsicas y mentales realizadas por Digenes, Hipcrates y Galeno quienes
estudiaron la epilepsia, y la demencia, entre otras formas atpicas.
Los indios Masai asesinaban a sus nios discapacitados.
Los Chagga de frica Oriental utilizaban a sus discapacitados para ahuyentar al
demonio.
Los antiguos Hebreos crean que los defectos fsicos eran una marca del pecado.
Los Jukun de Sudan consideraban que eran obra de los malos espritus y los
abandonaban para que murieran.
Durante el siglo XX se cometieron grandes crmenes en Alemania, por el
ejrcito Nazi, durante la segunda guerra mundial, diversas atrocidades se
realizaron, "en busca de la raza perfecta" en la cmara de gases o con la
ingestin de sustancias letales que se proporcionaron en forma selectiva, antes
que a nadie, a las personas con discapacidad mental para aniquilarlas tratando de
construir un supuesto mundo de "seres perfectos".

AUDIO GENERAL
En tiempos pasados, las personas discapacitadas iban frecuentemente a parar a
hospitales, asilos u otras instituciones que proporcionaban una formacin escasa, si es
que impartan alguna.
En la prehistoria, a medida que las distintas tribus y agrupaciones humanas se
movilizaban buscando mejores cotos de caza o despus mejores tierras para realizar sus
cultivos, decidan abandonar a su suerte a las personas discapacitadas, para no
entorpecer los desplazamientos del resto de la tribu. Durante la poca de las primeras
civilizaciones, los espartanos de la antigua Grecia, arrojaban desde el Monte Tai geto a
las personas con discapacidad, pues no queran que "en su bella y floreciente
civilizacin" existieran personas diferentes.
171

La historia de los discapacitados no ha sido nunca estable ni segura, lo cierto es que las
desviaciones de cualquier tipo siempre nos han parecido una amenaza, lo diferente nos
molesta, pero al mismo tiempo tenemos una fuerte curiosidad por aquello que nos
parece sobrenatural, desde considerarlos demonios hasta dioses, de lo mtico a lo vulgar.
En esa eterna bsqueda nos hemos encontrado con contrastes muy notables; as como
entre los animales hay quienes destruyen a sus cachorros imperfectos o simplemente los
dejan morir, existen animales que los protegen amorosamente.
Los hombres tambin a lo largo de la historia les han dado diferentes tratamientos a las
personas con algn tipo de discapacidad.
Como puede apreciarse, muchos han sido los papeles sociales y los conceptos que se
han manejado alrededor de las personas discapacitadas en las diferentes sociedades y
culturas, sin embargo en la gran mayora de los casos, no han sido justas ni favorables e
incluso la exclusin social se ha exacerbado durante algunas pocas.
Sin embargo desde hace muchos aos, han surgido personas que iniciaron un camino de
liderazgo para hacer que las personas con discapacidad puedan vivir mejor
AUDIO POR ESCENA

En la Grecia del siglo IV a.C. El eminente filsofo Aristteles trat de


interpretar algunas desviaciones, existen registros de estudios de las diferencias
fsicas y mentales realizadas por Digenes, Hipcrates y Galeno quienes
estudiaron la epilepsia, y la demencia, entre otras formas atpicas.
Para los Nrdicos los discapacitados eran verdaderos Dioses.
Los indios Masai asesinaban a sus nios discapacitados.
Los Chagga de frica Oriental utilizaban a sus discapacitados para ahuyentar al
demonio.
En el siglo XIV, los nacidos con alguna deficiencia ya sea fsica, sensorial o
mental, como la sordera, la ceguera, la parlisis, la cuadriplejia, entre otros, eran
confinados a grandes encierros, en los que eran exhibidos los fines de semana a
manera de espectculo circense o de gran zoolgico, para que las familias se
divirtieran un poco o bien, manejando la conciencia social, rectificaran los actos
cometidos en el pasado, por considerar a estos "monstruos" o "fenmenos" como
la ms grande seal de un castigo enviado por Dios.
Los Semang de Malasia empleaban a sus lisiados como hombres sabios.
Los antiguos Hebreos crean que los defectos fsicos eran una marca del pecado.
Los Jukun de Sudan consideraban que eran obra de los malos espritus y los
abandonaban para que murieran.
Durante el siglo XX se cometieron grandes crmenes en Alemania, por el
ejrcito Nazi, durante la segunda guerra mundial, diversas atrocidades se
realizaron, "en busca de la raza perfecta" en la cmara de gases o con la
ingestin de sustancias letales que se proporcionaron en forma selectiva, antes
que a nadie, a las personas con discapacidad mental para aniquilarlas tratando de
construir un supuesto mundo de "seres perfectos".

TEXTOS EN BRAILE
172

QUIENES SON LAS PERSONAS DISCAPACITADAS?


Son las personas que tienen impedida o entorpecida alguna de las actividades
cotidianas consideradas normales, por alteracin de sus funciones intelectuales o fsicas.

CEDULAS INFORMATIVAS DE CADA ESCENA.


En la Grecia del siglo IV ANTES DE CRISTO.
Para los Nrdicos. PUEBLOS ESCANDINAVOS E ISLANDS. NORTE DE
EUROPA.
Los indios Masai INDIOS DE UNA CULTURA DE AFRICA
Los Chagga de frica Oriental
En el siglo XIV EN EUROPA
Los Semang de Malasia
Los hebreos.

Los Jukun de Sudan, territorio africano entre el Sahara y la selva tropical.

En trminos generales la sociedad oblig a creer durante mucho tiempo a las personas
con alguna deficiencia: personas minusvlidas, sin valor, incapaces de desarrollar una
conciencia crtica, un sentimiento; seres por tanto, sin voz ni voto.

ENFERMEDADES DE LA VISTA

173

Panel informativo en braille.


Optometra
La Optometra es la ciencia libre e independiente en la asistencia de la salud visual y
atencin sanitaria primaria que estudia la prevencin, compensacin y tratamiento de las
anomalas visuales mediante tcnicas optomtricas. Comnmente la optometra se
centra en la medida del estado refractivo de ambos ojos mediante procedimientos como
la esquiascopa o retinoscopa, y sobre todo, mtodos de refraccin ocular. De esta
forma detectan, compensan y corrigen numerosas anomalas visuales como la miopa,
hipermetropa, queratoconos, estrabismos o astigmatismo entre otras

OBJETOS Y COLECCIONES.Bustos con explicacin en audio de la enfermedad visual correspondiente

CEDULAS EN BRAILLE
Ceguera
Discapacidad visual profunda
Discapacidad visual severa
Discapacidad visual moderada:

AUDIO POR BUSTO


Ceguera: Carencia de visin o slo percepcin de luz. Imposibilidad de realizar tareas
visuales. Puede ser causada por la presin del nervio ptico. Tambin por la separacin
de la retina desde el interior del globo ocular. Ceguera para los colores: es un defecto
congnito de la retina, est relacionada con el exceso del consumo de drogas, alcohol,
tabaco, entre otros. Glaucoma: aumento de la presin interna del ojo, por acumulacin
174

de un lquido que se produce dentro del ojo, llamado humor acuoso. Sin tratamiento
adecuado puede perder la vista. Retinopata diabtica es una complicacin de los
pacientes con diabetes, los desequilibrios de azcar afectan especialmente los vasos
de la retina. es la principal causa de ceguera en el mundo. es una enfermedad
silenciosa, los sntomas se presentan cuando ya esta avanzada la enfermedad. No
produce dolor pero la visin puede volverse paulatinamente ms borrosa. Si hay
hemorragia puede perderse totalmente la visin.
Discapacidad visual profunda: Dificultad para realizar tareas visuales gruesas.
Imposibilidad de hacer tareas que requieren visin de detalle Hipermetropa: el
cristalino funciona bien, pero el globo ocular es demasiado corto. La imagen de los
objetos cercanos se forma detrs de la retina. Es un defecto hereditario, donde el
paciente ve la imagen de cerca borrosa.
Discapacidad visual severa: Posibilidad de realizar tareas visuales con inexactitudes,
requiriendo adecuacin de tiempo, ayudas y modificaciones. Miopa: el cristalino
funciona bien, pero el globo ocular es demasiado largo. La imagen de los objetos
alejados se forma delante de la retina. Es un defecto visual donde se dificulta ver los
objetos lejanos. Los objetos cercanos se ven claramente Diplopa, visin doble,
estrabismo y bizquera: son causados por debilidad o parlisis de los msculos externos
del globo ocular. Desprendimiento de retina: es la separacin de una membrana llamada
retina (sensible a la luz), que esta situada en la parte posterior del ojo no hay dolor
puede ver sombras que vienen de arriba o de los lados del ojo. Perdida de la visin
parcial o total. Se presenta mas en hombres que en mujeres y si eres mayor de 40 aos.
Si tienes miopa, si sufres un traumatismo ocular. Si eres diabtico.
O TE HAN REALIZADO UNA CIRUGIA DE CATARATA O LASER
Discapacidad visual moderada: Posibilidad de realizar tareas visuales con el empleo
de ayudas especiales e iluminacin adecuada similares a las que realizan las personas de
visin normal. Hemeralopia: est causada por una incipiente opacidad en uno o ms de
los tejidos oculares. Astigmatismo: deformacin de la crnea o alteracin de la
curvatura de la lente ocular. Provoca una visin distorsionada debido a la imposibilidad
de que converjan los rayos luminosos en un solo punto de la retina.
La conjuntivitis: produce enrojecimiento, inflamacin, molestias y constante lagrimeo.
Durante el sueo, se produce una secrecin de pus que al secarse, hace que las pestaas
se peguen entre s. La prevencin de sta enfermedad se logra mediante la prctica de
medidas higinicas como lavarse regularmente bien los ojos, usar toallas limpias, no
frotar los ojos con las manos sucias, aplicar slo los medicamentos (colirios o cremas)
recetados por el mdico

2.- SALA LOS MS BRILLANTES


175

A lo largo de la historia no han sido pocos los personajes famosos que han padecido
algn tipo de discapacidad y eso no les ha frenado a la hora de destacar en sus oficios.
Bustos de los personajes considerados como los ms brillantes con descripcin de su
biografa y cuales fueron sus logros.
AREA DE EXPOSICIN, SALA LOS MS BRILLANTES.-

Ludwing Van Beethoven


Muchas son las personas discapacitadas que a lo largo de la historia de la humanidad
han aportado su valiosa contribucin heredndonos parte de su vida, como un ejemplo
de perseverancia y de espritu de lucha del ser humano, entre ellos destaca entre muchos
otros, el celebre Ludwing Van Beethoven, quien representa un genio de todos los
tiempos, pues a pesar de que empez a perder su audicin muy joven y posteriormente
qued completamente sordo. Esto no lo restringi para seguir creando sin lmites, pues
su talento era mucho ms grande que su discapacidad, Beethoven tambin ha sido
reconocido por su tenacidad, con su msica nos ha transportado a millones de seres
humanos dentro de ella, transmitindonos su valor, su vocacin, su constancia y el
espritu de lucha que el hombre requiere para poder vencer la adversidad.

Ray Charles
Msico estadounidense, de Albany, Georgia. Pianista y cantante, Ray Charles perdi la
vista durante su infancia por un glaucoma. Ray Charles fue un autodidacta del piano,
pero tambin recibi clases de msica en braille en la "St Augustine School", un centro
para invidentes. Paralelamente, tuvo que ganarse la vida como msico, cuando
fallecieron sus padres. A finales de la dcada de los cuarenta, Ray Charles consigue
colocar un disco en las listas de su pas, y en 1951 obtiene su primer Top Ten, gracias a
Baby, Let Me Hold Your Hand (beb djame agarrar tu mano) en 1951. Fue criticado
por cantar canciones gospel (palabra o canto a dios) con letras populares, aunque hay
una gran tradicin al poner letras religiosas a canciones y viceversa. En 1961, Charles
cancel un concierto programado en el Bell Auditrium en Augusta (Georgia) para
protestar por las ubicaciones segregadas.

176

Creo cincuenta y un discos durante su carrera como msico. Recibi cerca de 21


premios entre las categoras: lbum del ao, Mejor colaboracin, mejor lbum, Mejor
actuacin gospel, Mejor actuacin vocal masculina, Mejor lbum masculino, Mejor
actuacin masculina en solitario, Mejor cancin de do o grupo, entre otros.
En el ao 2004 se lanz una pelcula sobre la historia de Ray Charles, el papel de l fue
interpretado por . La cual cuenta en forma ms o menos completa la vida de esta estrella
del blus, su infancia, sus adicciones y lo que en verdad interesa, la historia de su exitosa
carrera como un haz del piano. Falleci a la edad de 73 aos, el 10 de junio de 2004 en
su casa de California. Sus restos se encuentran en el Cementerio Inglewood Park de Los
ngeles, California.

Sarah Bernhardt naci el 22 de octubre de 1845 en el n 5 de la calle cole de


Medecine, Pars. Su nombre real era Rosine Bernardt. Su madre era una juda de origen
holands y llamada Julie Bernardt, alias Youle. Se ganaba la vida como prostituta de
lujo junto con su hermana, Rosine Bernardt. Julie tuvo varias hijas ms: en Abril de
1843 tuvo dos nias gemelas que fallecieron a las dos semanas. Tras Sarah, tuvo a
Jeanne (fecha de nacimiento desconocida) y a Rgine en 1855, que falleci de
tuberculosis en 1873. Todas fueron hijas de padres distintos y desconocidos. Sarah
Bernhardt nunca supo quin era su padre biolgico.
Sarah pas los primeros 4 aos de su vida en Bretaa al cuidado de una ama de cra. La
primera lengua que Sarah conoci fue el bretn y es por esta razn que al iniciar su
carrera teatral, adopt la forma bretona de su apellido: Bernhardt. En esta poca sufri
un accidente que muchos aos despus le acarreara graves problemas de salud. Cay
177

por una ventana rompindose la rodilla derecha. Aunque san sin problemas, la rodilla
le qued delicada para siempre y en 1914 a causa de una dolorossima inflamacin de
esa misma rodilla tuvieron que amputarle la pierna derecha. Tras el accidente, su madre
la llev consigo a Pars donde permaneci dos aos. A punto de cumplir 7 aos ingres
en la Institucin Fressard un internado para seoritas prximo a Auteuil. Permaneci
all dos aos.
En 1853 ingres en el colegio conventual Grandchamp. Tras abandonar Grandchamp a
los 15 aos, su madre trat de introducirla en el mundo galante para que se ganara la
vida como prostituta de lujo. Pero Sarah, influenciada por su educacin conventual, se
neg repetidamente a ello. Julie Bernard tena un saln en su piso parisiense donde se
reunan sus clientes. Entre ellos estaba el hermanastro de Napolen III, el duque de
Morny. Morny aconsej que Sarah se inscribiera en el Conservatoire de Musique et
declamation. Gracias a los contactos del duque, Sarah entr sin dificultad en 1859. En
1861 gan un 2 premio en tragedia y una mencin honorfica en comedia. . El 22 de
Diciembre de 1864 dio a luz a su nico hijo, Maurice Bernhardt. Sin un oficio y
habiendo fracasado momentneamente en el mundo del teatro, sigui los pasos de su
madre convirtindose en una cortesana de lujo. Sarah no abandon su actividad como
cortesana hasta que su carrera teatral se hubo afianzado con xito y pudo mantenerse
slo con el trabajo que le reportaba el teatro.
Tres aos ms tarde, en 1867 debut en el Teatro del Odon con "Las sabihondas" ("Les
femmes savantes") de Molire. Aqu empez su verdadera carrera profesional. Particip
en muchos montajes teatrales, alternando la vida teatral con la vida galante. La fama le
lleg repentinamente en 1869 con "Le Passant" de Franois Coppe, una obra en verso
de un solo acto. Sarah, adems, hizo por primera vez en esta obra un papel masculino, el
del trovador Zanetto. Repetira ms veces haciendo de hombre en varias obras ms:
Lorenzaccio, Hamlet y LAiglon.
En 1870, durante la Guerra Franco-Prusiana, habilit el Oden como hospital para
convalecientes, donde cuid con dedicacin a los heridos de guerra. En 1871 el
improvisado hospital tuvo que ser cerrado por problemas de salubridad. Tras la derrota
francesa y la cada de Napolen III, muchos intelectuales exiliados por estar en contra
del emperador, pudieron regresar a Francia, entre ellos Vctor Hugo. El regreso de Hugo
fue trascendental en la vida de Bernhardt ya que el escritor la eligi para protagonizar el
reestreno de su obra Ruy Blas. Bernhardt adems protagoniz otra obra de Hugo,
Hernani. Ruy Blas la encumbr a cotas de xito inimaginables. Regres a la ComdieFranaise como una gran estrella y all afianz su repertorio y sus mltiples registros
como actriz.
A parte de su profesin de actriz, se interes por la escultura y la pintura, llegando a
exponer en el Saln de Pars varias veces, entre los aos 1874 y 1896. Recibi distintos
premios y menciones honorficas en ambas disciplinas. Escribi tambin tres libro: su
autobiografa titulada "Ma double vie", "Petite Idole" y "Lart du Thtre: la voix, la
geste, la pronontiation".
178

Sarah Bernhardt fue tambin la primera actriz-empresaria del mundo del espectculo. El
siglo XX empez con un gran xito, "L'Aiglon", de Edmond Rostand. La obra fue
estrenada el 15 de Marzo de 1900 y obtuvo un xito triunfal sin precedentes. Sarah hizo
250 representaciones de "L'Aiglon" y tras esto, hizo otra gira a Estados Unidos para
representarla. En Nueva York represent la obra en el Metropolitan Opera House y
cosech un enorme xito. Prob suerte tambin con el recin nacido cine. En 1900 film
"Le Duel d'Hamlet", haciendo ella de Hamlet. En 1906 rod "La Dame aux Camlies",
con Lou Tellegen, su amante de aquel momento, haciendo de Armand Duval. Bernhardt
cuando la vio se horroriz y mand destruir el negativo, que afortunadamente todava
existe. Rod tambin "Elisabeth, reine d'Anglaterre", dirigida por Louis Mercanton. En
1913 film "Jeanne Dor", dirigida por Tristan Bernard. Esta pelcula se considera la
mejor rodada por Bernhardt y donde se puede observar mejor su arte interpretativo. La
pelcula se conserva en la Cinmatque de Paris. El 15 de marzo de 1923, tras rodar una
escena, qued totalmente agotada hasta que se desmay. Nunca se recuper. Once das
ms tarde, el 23 de marzo, falleca en brazos de su hijo Maurice.
Su entierro fue multitudinario: unos 150.000 franceses acudieron a despedirla. Fue
inhumada en el cementerio parisino de Pre-Lachaise.
A pesar de ser llamada "La divina Sarah" por su carcter excntrico y caprichoso, Sarah
Bernhardt trabaj en innumerables proyectos teatrales demostrando un carcter
perseverante, una gran profesionalidad y dedicacin a su arte.

Esopo visto por el pintor Diego Velzquez.


179

Esopo (en griego Aisopos) fue un fabulista griego que vivi en el Siglo VII a C. Su
existencia es semilegendaria; estaba dotado de un ingenio brillante y mordaz; era
tartamudo y jorobado.
Esopo es el fabulista griego por excelencia, a da de hoy se siguen incluyendo sus
pequeos cuentos en los libros infantiles, enfatizando en la moraleja de cada uno de
ellos de una manera clara y sencilla. Se desconoce el ao de su nacimiento, as que se le
engloba en el siglo VI a.c., su lugar de nacimiento tambin establece ciertas dudas pero
la ms aceptada es la que naci en Frigia. Fue un esclavo manumitido, es decir fue
esclavo del filsofo Janto hasta que le dio la libertad, segn parece qued prendado de
la cultura y oratoria de Esopo. Esopo, ya como hombre libre, fue admirado por la
aristocracia de la poca, y segn parece el regente Creso le dio la oportunidad de
trabajar para l siendo enviado al orculo de Delfos, como encargado de dar dinero a los
sacerdotes para tener el beneplcito del dios Apolo. No obstante, y segn fuentes que no
son del todo seguras, Esopo qued desencantado de los sacerdotes a los que vea como
usurpadores de riquezas, por lo que aunque si bien ofreci las sacrificios al Dios, no les
entreg dinero a los sacerdotes.
stos indignados decidieron tenderle una trampa, ponindole en el equipaje una copa de
oro consagrada a Apolo, por lo que fue acusado de robo y lanzado desde una roca
Hiampa, dndole muerte. Segn la tradicin, Esopo antes de morir, anunci la venida
del fin de Delfos debido a su condena injusta, algo que efectivamente sucedi,
afianzando as la figura del propio Esopo.
Las fbulas de Esopo, son breves historias con moraleja, sus personajes son animales
que actan como los humanos, y donde la envidia, la desconfianza y el mal se describen
de una manera cercana. Se creen que eran de tradicin oral pero no fue hasta Esopo
hasta que no quedaron plasmadas, principalmente por posteriores versiones de otros
autores entre ellos el fabulista latino Fedro.
A modo de ejemplo pondremos una muestra de una de las fbulas de Esopo:
"Sorprendi un len a una liebre que dorma tranquilamente. Pero cuando estaba a
punto de devorarla, vio pasar a un ciervo. Dej entonces a la liebre por perseguir al
ciervo. Despert la liebre ante los ruidos de la persecucin, y no esperando ms,
emprendi su huda. Mientras tanto el len, que no pudo dar alcance al ciervo, ya
cansado, regres a tomar la liebre y se encontr con que tambin haba buscado su
camino a salvo. Entonces se dijo el len: Bien me lo merezco, pues teniendo ya una
presa en mis manos, la dej para ir tras la esperanza de obtener una mayor."
Moraleja: si no quieres perder ambas cosas, confrmate con una que ya tienes segura.

180

Robert Schumann (Zwickau, 8 de junio de 1810 - Endenich, Bonn, 29 de julio de


1856). Pianista, Compositor alemn de la poca del romanticismo y uno de los msicos
de mayor fama en la primera mitad del siglo XIX. Tanto en vida como en obra refleja en
su mxima expresin la naturaleza del romanticismo, siempre envuelta en la pasin, el
drama y, finalmente, la tragedia. Ana la ilustracin literaria con una gran complejidad
musical, creando obras de gran intensidad lrica. Su padre, de profesin editor, le apoy
y le procur un profesor de piano. A los 7 aos Schumann compuso sus primeras piezas
musicales. Su inters por la msica haba sido estimulado desde nio al escuchar tocar a
Ignaz Moscheles en Carlsbad, y en 1827 a travs de las obras de Franz Schubert y Felix
Mendelssohn.
Su padre, que tanto haba fomentado la educacin de Robert como pianista y escritor,
fallece en 1826; su madre no aprueba la dedicacin a la carrera musical y en 1828 le
enva a estudiar Derecho a la Universidad de Leipzig. Pero no tard en abandonar los
estudios para consagrase enteramente a la msica.
Existen varias fuentes que difieren respecto a cmo da Schumann su mano derecha en
1830, siendo la ms aceptada la de que para fortalecer el cuarto dedo ide un aparato
que de hecho lo inutiliz casi completamente (la musculatura del cuarto dedo est
conectada al tercer dedo, convirtindolo en el dedo ms dbil).

En paralelo a su nueva actividad como compositor, iniciaba su obra de crtico musical,


que gener una abundante produccin literaria. Su excepcional formacin y aptitud
literaria se plasmaban en crticas musicales, en las que, a travs de personajes
imaginarios, profundizaba en las obras de sus contemporneos. Un famoso ejemplo es

181

su ensayo sobre las variaciones de Chopin sobre un tema de Don Juan, que apareci en
el Allgemeine musikalische Zeitung en 1831.
Su Opus 2 Papillons (Fr., "Mariposas") escrito en 1831 es otro ejemplo excepcional de
la fusin entre literatura y composicin musical de Schumann. Se trata de una
composicin para piano, que consta de varias escenas de danza inspiradas en una fiesta
de disfraces. Cada danza trata de retratar a diferentes personajes y no guardan relacin
entre s, excepto la ltima. Segn escribira el propio Schumann, est inspirada en la
ltima escena de la obra Flegeljahre de Johann Paul Friedrich Richter y mezcla el
carcter festivo con un extraordinario sentimiento melanclico. La muerte en 1833 de su
cuada Rosalie y de su hermano Julius le causaron una crisis nerviosa e intent
suicidarse. Las crisis, depresiones, intentos de suicidio y periodos de reclusin completa
fueron frecuentes en la vida de Schumann y se acentuaron a partir de 1844, continuando
en aumento hasta su muerte (incluso llegando a escuchar voces y experimentar
alucinaciones). Este declive psquico se relacion inicialmente por los historiadores del
siglo XIX con la sfilis (o con el desastroso tratamiento mdico a base de mercurio,
habitual en la poca y casi peor que la enfermedad en s), pero la posibilidad ha sido
descartada debido a que los sntomas de desequilibrio mental de Robert Schumann ya
eran evidentes desde su juventud, antes de que cualquier sntoma de la sfilis pudiera
haberse manifestado. La teora ms aceptada actualmente es que padeca de trastorno
bipolar (enfermedad manaco-depresiva). Pero la gran intensidad creativa de Schumann
se concentraba en sus periodos de lucidez, de forma admirable. Tan pronto como se
restableca de un perodo de enfermedad, se entregaba frenticamente a la composicin,
trabajando de modo incansable. No slo escriba las melodas principales ni se limitaba
a las obras para piano, sino que pese a estar en un estado fsico y mental muy
degradado, escriba la instrumentacin sinfnica completa de todas sus obras, hasta la
extenuacin.
En 1844, tras un viaje a Rusia, atraves un nuevo periodo depresivo y abandon Leipzig
para instalarse en Dresde. Durante los aos siguientes su salud mental y fsica se iba
debilitando, lo cual no le impidi trabajar en multitud de obras, como sus dos Sonatas
para piano y violn, su Concierto para violonchelo y orquesta y su nica pera,
Genoveva (que no goz de xito). Incluso cuando, a partir de 1852, sus episodios de
locura le mantienen convaleciente casi todo el tiempo, consigue aprovechar sus
momentos de lucidez para completar su Misa, Requiem, Sinfona en Re menor y
Concierto para violn y orquesta.
El 27 de febrero de 1854, Schumann se arroja al Rin y es rescatado a tiempo, pero su
mente ya se ha perdido para siempre. Es internado en un sanatorio privado en Endenich
cerca de Bonn, Alemania, donde permanece hasta su muerte el 29 de julio de 1856.
Tena slo 46 aos. Muere vctima de la sfilis. Fue enterrado en Bonn, y en 1880 se
erige sobre su tumba una estatua de A. Donndorf.
Obras para piano
Papillons, Op. 2
182

Estudios sinfnicos Op. 13


Carnaval Op. 9
Sonatas (3)
Kinderszenen Op. 15
Fantasa Op.17
Toccata Op.7
Fantasiestcke Op. 12
Kreisleriana, op. 16
Humoresca Op. 20
Novelletten, Op. 21
Carnaval de Viena Op. 26
Arabeske, Op. 18
Davidsbndlertnze, Op. 6
lbum para la juventud Op. 68
Conciertos
Konzertstck para cuatro trompas
Introduccin y Allegro-Appassionato para piano
Concierto para violonchelo
Concierto para violn
Obras orquestales
Sinfonas (4)
Obertura
Msica de cmara
Cuartetos para cuerdas (3)
Cuarteto para piano
Quinteto para piano
Fantasas para piano, violn y violonchelo
183

Andante y variaciones para dos pianos


Tros para piano y cuerdas (3)
Fantasas para clarinete y piano
Cinco piezas en tono popular para piano y violonchelo
Romances para oboe y piano
Mrchenbilder para piano y viola
Sonatas para piano y violn (2)
Mrchenerzhlungen para clarinete, viola y piano
Msica vocal
Numerosas canciones y obras corales acompaadas de piano o de orquesta, entre las que
se encuentran:
Dichterliebe, Op. 48 (16)
Gedichte, Op 35 (12)
Myrten, Op. 25
Lieder-Album fr die Jugend, Op.79
Szenen aus Goethes Faust
Soulaiman kacha

Helen Adams Keller (1880-1968), escritora y conferenciante estadounidense que super


impedimentos fsicos importantes sirviendo de inspiracin a otras personas
minusvlidas. Naci en Tuscumbia (Alabama). A los 19 meses padeci una grave
enfermedad que la dej sorda y ciega (vase Sordera; Ceguera). Hasta los 7 aos no
pudo comenzar una educacin especial de lectura y escritura con Anne Mansfield
Sullivan, ms tarde Macy, del Instituto Perkins para ciegos. Aprendi rpidamente a
leer el sistema Braille y a escribir por medio de una mquina de escribir especialmente
184

fabricada para ella. En 1890 aprendi a hablar despus de slo un mes de preparacin.
Diez aos ms tarde ingres en la Universidad de Radcliffe, en la que se gradu con
todos los honores en 1904. Despus trabaj en la Comisin de ciegos de Massachusetts
y comenz a dar conferencias por todo el mundo. Al acabar la II Guerra Mundial, visit
a los veteranos heridos en los hospitales de Estados Unidos y dio conferencias en
Europa en apoyo de los disminuidos fsicos. Sus obras incluyen Historia de mi vida
(1903), El mundo en que vivo (1908), Salir de la oscuridad (1913), Mis aos
posteriores (1930), Tengamos fe (1940), Maestra: Ana Sullivan Macy (1955) y La
puerta abierta (1957). Su vida fue objeto de una pelcula, Lo inconquistable (1954), y
de una obra de teatro, El milagro de Ana Sullivan (1959, adaptada al cine en 1962), del
autor estadounidense William Gibson.

Francisco de Goya y Lucientes

185

Goya y Lucientes, Francisco de (1746-1828), pintor y grabador espaol considerado


uno de los grandes maestros de la pintura de su pas. Marcado por la obra de Velzquez,
habra de influir, a su vez, en Edouard Manet, Pablo Picasso y gran parte de la pintura
contempornea. Formado en un ambiente artstico rococ, evolucion a un estilo
personal y cre obras que, como la famosa El 3 de mayo de 1808: los fusilamientos en
la montaa del Prncipe Po (1814, Museo del Prado, Madrid), siguen causando, hoy
da, el mismo impacto que en el momento en que fueron realizadas. (Manquedad).

Miguel de Cervantes Saavedra es el ms destacado


escritor en espaol y una de las grandes figuras de la literatura de todos los tiempos. Sus
obras, entre las que destaca El ingenioso hidalgo don Quijote de la Mancha, marcan la
culminacin del Siglo de Oro en la literatura espaola y suponen el inicio de la novela
moderna. En la imagen, retrato de Cervantes realizado por Eduardo Balaca. No
podemos, sin embargo, confiar en la autenticidad de ninguno de los retratos que se
conservan.
(Sordoceguera)

3.- SALA TALLER Y CREACIN


Esta sala esta dirigida a formar y a cultivar diferentes apreciaciones de los visitantes
hacia el arte contemporneo ecuatoriano.

APRECIACIN ARTSTICA

AUDIO GENERAL
Qu lindo es apreciar algo bien hecho. Una cancin, un libro, una pintura, una
fotografa...
Realmente el arte se traduce en expresar sentimientos, no puede ser vaco, simplemente
186

porque s, sino que debe de mover alguna fibra de nuestro cuerpo. Pienso que es triste
que de cualquier forma nos cercenemos la capacidad de apreciar cualquier forma de
expresin.
CONSIDERADAS ARTES MAYORES
1. Arquitectura
2. Pintura
3. Escultura
4. (*Fotografa)
CONSIDERADAS ARTES MENORES
Las artesanas, como alfarera, cestera, tejido, orfebrera cermica, talabartera, etc.
Las artes plsticas implican el saber crear sobre la materia. Es decir, conformar y formar
ideas con distintos materiales mediante acciones como la pintura y el dibujo
(consideradas grficas), o la arquitectura y la escultura (consideradas plsticas).
En ellas se unen dos elementos llamados forma y contenido:
Forma
En la expresin artstica es la determinacin, distribucin y organizacin de los
elementos que percibimos al apreciar una obra de arte.
Contenido
Es el mensaje, la fuerza, el carcter, la historia o la esencia. Es lo que el artista quiso
comunicar con su obra. Implica tiempo, personajes, momento histrico, el discurso
implcito, la simbologa, etctera.

AUDIO ESPECFICO SI DESEAN MS INFORMACIN

*ELEMENTOS QUE INTERVIENEN EN LA FORMA.


En las artes plsticas hay dos elementos fundamentales que constituyen la base para
cualquier composicin. Estos son el punto y la lnea.
1.- El punto
Considerado como el sitio de interseccin entre dos lneas, es uno de los elementos
esenciales de la composicin. Se considera punto la marca dejada por un lpiz,
crayn, plumn o pincel.
2.- La lnea

187

Un punto en movimiento da como resultado una lnea, un trazo. As, una lnea est
formada por una sucesin de puntos unidos entre s, tan prximos que no los
alcanzamos a distinguir.
La lnea tambin sugiere volmenes, construye espacios y crea formas.
3.- El ritmo:
El ritmo es el movimiento que se imprime a la lnea. Es la repeticin y concordia entre
los elementos de la plstica y lo encontramos de diferentes tipos:
a) Repetitivo (Cuando los mismos elementos se presentan siempre de igual manera, sin
variaciones)
b) Alternado (Cuando se van turnando algunos o algunos de los elementos)
c) Progresivo (Cuando va de lo bajo a lo alto, de lo alto a lo bajo, de lo pequeo a lo
grande o de grande a pequeo)
Adems, el ritmo no solamente se logra con la lnea sino que es posible darlo con otros
elementos de la plstica.
4.- El equilibrio
En una composicin, el equilibrio se da cuando todos los elementos son necesarios unos
a los otros. Decimos que hay equilibrio cuando los elementos de una composicin estn
armonizados de tal manera que no podemos sustituirlos o desplazarlos sin alternar el
balance.
5.- Las formas:
a) Geomtricas
Las formas geomtricas bsicas son el tringulo, cuadrado y crculo.
b) Irregulares, tambin llamadas orgnicas
Son las que no tienen una estructura rgida y pueden ser realizadas premeditadamente,
como cuando recreamos la forma de un rbol o hacemos a pulso la silueta de un rostro;
o bien, estn tambin las que se hacen de modo accidental, empleando modos diferentes
de manchar el papel, goteando tinta o pintura diluida, dejando correr las gotas,
empleando colores en spray, salpicando el lienzo con la misma brocha, etctera. Aqu el
nico lmite es la imaginacin.
6.- Espacio
Todas las formas quedan plasmadas en alguna superficie. Esa superficie en la que se
mueven los elementos como puntos, lneas, colores, formas y texturas, es conocida
como el espacio, y tambin como plano bsico. Los espacios con figuras, imgenes,
etc. Son llamados espacios positivos. Y los vacos, espacios negativos.
188

7.- Composicin
Se refiere a la distribucin de los elementos en una obra: es el tipo de balance elegido
por el artista. Hay de varios tipos:
a) Composicin simtrica
Tiene un eje central y hacia un lado y otro de este eje, la composicin es igual: por
ejemplo, una mariposa o un rostro completamente de frente.
b) Composicin asimtrica:
En ella, la figura principal est de un lado o de otro. Despus se busca el equilibrio,
usando color, tamao o textura.
c) Composicin radial
En ella el foco de inters se encuentra en el centro y todo deriva de l o hacia l.
8.- Textura
La textura se refiere a la apariencia que deja ver la superficie del lienzo, ya sea real
sugerida. Es real cuando al tocarla descubrimos que en efecto es como la vemos, y
sugerida cuando slo es la apariencia la que logra el artista y la sentimos visualmente.
Entre otros ejemplos de textura estn lisa, rugosa, blanda, dura, spera, suave, etc., e
influyen en nuestra percepcin al observar determinada obra.
9.- Color
El color puede ser entendido de dos formas, como color-luz y como color-materia.
El color-luz parte del descubrimiento de Isaac Newton y su disco cromtico.
El color-materia es aquel cuya combinacin en forma de pigmentos utilizan los artistas.
Dos de las propiedades principales del color son el brillo y el matiz.
a) Brillo
Se refiere a la cantidad de luz u oscuridad que hay en un color (de ah decimos que es
plido o intenso)
b) Matiz, que se refiere a la variacin del color.
El color tiene el poder de transmitir diferentes estados de nimo y adems, la historia ha
atribuido diferente simbologa a cada color.
Clasificacin de los colores:
a) Colores primarios: Son el rojo, azul y amarillo, ya que no requieren de ninguna
combinacin.
189

b) Colores secundarios: Provienen de mezclas de los tres anteriores, de las que resultan
tonos como el verde, naranja y violeta.
c) Colores terciarios: Son los que combinan entre s a los primarios y secundarios y
dan como resultado el azul-verde, el amarillo-naranja, el azul-violeta etctera.
Los tonos
Se logran cuando mezclamos un color con mayor o menor cantidad de blanco o negro.
Los tonos ms claros se obtienen mezclando con blanco y los ms oscuros cuando
mezclamos con negro. Al conjunto de tonos que obtenemos se le llama gama de color.
Los matices
Estos se forman mezclando al color con sus vecinos en el crculo cromtico. Por
ejemplo, los matices de azul se logran al combinar mayor o menor cantidad de violeta o
verde.
La temperatura del color:
a) Colores clidos: Rojo, naranja y amarillo. Comunican luz y calor y se identifican
con sentimientos vivos como la euforia, alegra, enojo o ira.
b) Colores fros: Azul, verde y violeta. Se relacionan con los bosques, la nieve y el
agua; y se identifican con sentimientos relajantes y apacibles, con la meditacin, la
tranquilidad y la reflexin.
c) Colores neutros: Gris, caf, blanco y negro. Estos no estn en el arco iris y sirven
para balancear a los otros colores.
10.- Dimensiones
a) Un dimensionalidad.- Es como una lnea que slo tiene una dimensin: el largo.
b) Bidimensionalidad.- Est fomada por dos dimensiones: largo y alto.
c) Tridimensionalidad.- Se refiere a tres planos, alto largo y ancho. Esto da el
volumen, que puede ser simulado o real.
11.- El relieve (en escultura)
a) Alto relieve.- Cuando ms de la mitad de la figura se sale del fondo.
b) Medio relieve.- Cuando la mitad de la figura sale del fondo.
c) Bajo relieve.- Cuando menos de la mitad de la figura sale del fondo (*)
d) Hueco relieve.- Cuando la figura se hunde en la obra.
12.- Perspectiva

190

Es el punto de vista que el autor quiere ofrecer al espectador. Un buen desarrollo de la


perspectiva permite representar correctamente la profundidad sobre una superficie de
slo dos dimensiones. En la perspectiva paralela, la lnea del horizonte se encuentra
con un punto de fuga, en el que convergen todas las diagonales que sirven para
proyectar el dibujo. Mientras que en la perspectiva oblicua hay dos puntos de fuga y
una de las aristas del objeto est de frente a nosotros.

TECNICAS ARTISTICAS
1.- PINTURA Y DIBUJO:
Los conforman tres elementos bsicos:
a) Materiales colorantes:
+Dibujo: (Lpices de grafito, lpices de color, tinta, carboncillo, bolgrafos. Plumones,
marcadores, guises, estilgrafos).
+Pintura (de aceite: leo; de agua: acuarela, temple, gouache; tintas, anilinas y
pinturas acrlicas).
b) Instrumentos: Pinceles, esptula, lpices, manos, tubos (aplicacin directa).
c) Soportes: Lienzo (tela), papel, lmina galvanizada, madera, pared, etc.
2.- GRABADO: Puede ser en madera, linleo, piedra y serigrafa.
3.- ESCULTURA: Puede ser en bronce, piedra, barro, madera, yeso, acero inoxidable,
hierro, cermica, acrlicos, cristal, oro, plata, etc.
4.- ARQUITECTURA: Se utiliza materiales vigentes y tcnicas constructivas de
acuerdo con la poca y el medio.
5.- OTRAS TCNICAS: Collage, arte objeto, esculptopintura, land art, body art, arte
de procesos, instalacin (obra que se instala en un sitio para causar la sensacin de
entrar a la obra de arte y de alguna manera formar parte de ella) y otros.
4.- SALA DE ARTE CONTEMPORANEO ECUATORIANO
Todas las obras estn expresadas a dems de las pinturas, en altos y bajos relieves,
detalles de olores caractersticos de lo que contiene la obra, as como tambin cuentan
con una descripcin en audio de la tcnica empleada en cada obra y una descripcin
minuciosa de lo que transmite.

191

Obra nmero 1
Ttulo: Portn
Autor: Jorge Morales
Tamao: 120x100 centmetros
Tcnica utilizada: Mixta

Descripcin de la Obra.Es una imagen que representa el interior de un pasillo o corredor que tiene el piso de
piedra y conecta hacia un lugar con un balcn en el lado de arriba, una puerta del lado
izquierdo, un cuadro y dos plantas con sus respectivas masetas al lado derecho del
fondo. El ambiente es de una representacin de arquitectura civil colonial de interiores
y llevada a cabo con tonos calidos y terrosos asemejando una hora de la tarde antes del
ocaso.
En primer plano se encuentra un portal de piedra sostenido a ambos lados por paredes
que reflejan que no son nuevas, en segundo plano tras recorrer un espacio del pasillo de
piedra se encuentra un arco con dos columnas redondeadas a los lados; en el tercer
plano un destello de luz ilumina las piedras del suelo y en el fondo se encuentra la
fachada de una vivienda: un balcn un cuadro, una puerta y dos masetas con sus
respectivas plantas.

192

Obra nmero 2.Ttulo: Girasoles


Autor: Wilson Preciado Freire
Tamao: 110 x 70 centmetros
Tcnica utilizada: Mixta

Descripcin de la Obra:
Es una pintura de caballete que representa un bodegn, naturaleza muerta por espacios
de tiempo inanimados; este bodegn es un florero con tres girasoles con delicadas y
contadas ramas y sus respectivas hojas, todo esto esta contenido dentro de un soporte
calido que asemeja a un polgono de 6 lados, el que a su ves sirve de contraste para un
fondo de franjas gruesas horizontales 4 en total de colores calidos y terrosos
entrelazados.
En primer plano se encuentra un florero muy peculiar con lados pronunciados y diseos
de texturas suaves y crculos; del florero salen tres girasoles con sus respectivas ramas y
hojas. En segundo plano un espacio de color calido limitado en forma de un polgono de
6 lados y como fondo cuatro franjas horizontales con diseos y texturas de flores y
hojas.

193

Obra nmero 3.Ttulo: Bosque Rosa


Autor: Gabriel Buenao Rugel
Tamao: 150 x 50 centmetros
Tcnica utilizada:

Descripcin de la Obra:
Esta pintura de caballete representa a un pequeo bosque inanimado, sus hojas son de
carcter clido fuerte al igual que los troncos, como fondo un tono general claro en el
centro, el mismo que va oscurecindose mientras llega a las esquinas de la obra.

El primer plano de la obra esta dirigido hacia el rbol del centro del cual salen los
dems rboles hacia los lados en diagonal que van para el fondo. En segundo plano se
encuentra el fondo de tonos clidos que van oscurecindose o manchndose ms hasta
llegar a las esquinas del cuadro.

194

Obra nmero 4
Titulo: Rito del sol, rito de la Luna
Autor: Oswaldo Viteri
Tamao: 65 X 81, cm.
Tcnica: Ensamblaje
1986
Descripcin de la Obra:
Esta obra refleja una tcnica diferente, el ensamblaje se trata de la utilizacin de
materiales informales dentro de los cnones establecidos de lo que se considera como
una pintura de caballete.
La obra esta confeccionada con 71 muecos de tela; de tonos clidos fuertes 66 y de
tonos fros 5. Los muecos representan la forma o la silueta individual de indgenas con
sombrero organizados en 4 filas. En la fila ms alta se encuentran situados los muecos
de tonos fros en el centro de la fila, por sobre ellos se encuentra una representacin
abstracta de un sol dentro de un marco de tonos clidos fuertes como fondo y

195

enmarcado con madera limitando el espacio de los muecos de tela y el espacio del sol /
luna de la obra.

196

Obra nmero 5.Autor: Marcelo Aguirre


Titulo: Manos Limpias y sin sangre
Tamao: 2,90 X 3,90
Tcnica: Acrlico

Descripcin de la Obra:
Esta pintura de caballete es la representacin de un rostro y unas manos en posicin de
basta. Existen solo dos planos; en el primer plano se encuentra un sujeto, se aprecia su
rostro desfigurado y un poco amorfo, muestra las palmas de sus manos en seal de
acusacin. En segundo plano esta el fondo de la pintura que es de tono fro. En s la
mayor parte de la obra se encuentra dominada por tonos fros, y cuenta con un carcter
fuerte expresionista.

197

Obra nmero 6.Ttulo: Bodegn


Tcnica: leo.
Autor: Orlando Vera
Tamao: 120 x 60 centmetros

Descripcin de la Obra:
Esta Pintura de caballete representa a un bodegn; en el cual se encuentran dispuestas
dos botellas y una jarra de cristal, verduras, un meln y un aguacate partidos por la
mitad, un limn, 2 granadillas, un racimo de uvas, y lo que parece ser una manzana;
todo esta sobre una mesa que tiene un mantel de lana. La Luz viene desde el lado
izquierdo con fuerza hasta que desaparece por completo del lado derecho del cuadro.

En primer plano se encuentran las frutas: el meln y el aguacate cortados, las uvas, el
limn y las granadillas, en segundo plano los tres objetos o botellas de vidrio y las
verduras acompaadas de la manzana en una esquina; como tercer plano se encuentra la
mesa con su mantel de lana, y en el fondo una pared baada por luz desde la izquierda
hasta encontrar las sombras a la derecha del cuadro.

198

Obra nmero 7.Carolina Alfonso de la Paz


Titulo: FEUILLAGE
Tcnica: ACRILICO SOBRE LIENZO
Tamao: 150 X150 cm.

Descripcin de la obra:
Esta pintura de caballete representa mucha fuerza y movimiento tanto en matices como
en la forma de las pinceladas, no se puede hablar de planos por que no existen objetos
claros que diferencien las direcciones de adelante y atrs, es como si todo estuviera en
todos los planos y en ninguno. Esta es una obra que expresa ms emociones que formas,
se la considera expresionista por esa razn.

La obra tiene un movimiento que predomina el cual es circular u ovoide y abarca casi
todo el crculo cromtico en tonos; hacia el centro de la obra se encuentra una diferente
pincelada mucho ms cargada de pintura, pero ms sutil y entorchada.

199

Obra nmero 8.Autor: Miguel Betancourt


Titulo: "Quito con montaa azul"
Tcnica: leo-camo
Tamao: 50 x 180 cm
Ao: 2007
Descripcin de la obra:
Esta pintura de caballete representa a una ciudad, a Quito; se aprecian algunas casas que
se unen con otras edificaciones geomtricas (cuadrados, tringulos, rectngulos,
rombos, hexgonos, entre otras); la realizacin de las edificaciones y de las casas hacen
referencia al cubismo, que es la formacin de una misma realidad vista desde diferentes
puntos de partida. Como fondo se encuentran unas montaas de colores fros fuertes, y
tambin alrededor de la mayora de la obra cruzan espacios de colores fros pero ms
suaves.
En primer plano se encuentra la ciudad de Quito representada por construcciones
geomtricas en tonos clidos y tambin en tonos explosivos, como detalles de la obra
se aprecian las diferencias de nivel en el soporte de camo y fragmentos de un famoso
diario del pas. Como fondo estn unas montaas de tonos fros fuertes y entre el primer
plano y el fondo se encuentran tonos fros suaves que entrelazan algunos espacios de la
ciudad y todo el cielo.

200

Obra nmero 9.Autor: Roberto Carrera


Titulo: "Tnel"
Tcnica: Arte digital sobre canvas.
Tamao: 120 x 120 cm.
Descripcin de la obra:
Esta obra representa a un espacio de trfico automovilstico dentro de la ciudad, los
carros provienen desde la salida de un tnel, es de noche y se aprecian las luces de los
carros yendo a una velocidad moderada; rodeando a este trfico se encuentran edificios
de colores muy vivos y el tnel desde donde salen los carros poseen tonos ms fros.
La obra transporta nuestros sentidos hacia el centro de ella misma, aqu es en de donde
salen todos los carros, el tnel y las edificaciones que lo rodean solo acentan la
direccin de los carros, que como punto de fuga tienden a salir por la parte inferior
izquierda del cuadro.

201

Obra nmero 10.-

Titulo: Susy.
Tcnica: Temple sobre cartn
Autor: WASHINGTON MOSQUERA
Tamao: 120 x 80 cm.
Descripcin de la obra:
Esta obra es la representacin de una mujer que esta de pie, ella posa de espaldas
arrimando sus brazos y codos sobre un soporte horizontal, ella lleva puesto un vestido
de tonos clidos fuertes, los cuales sobresaltan por el fondo fro del soporte en donde
ella esta arrimada. Ella se encuentra regresando la atencin hacia el lado derecho del
cuadro.
En el primer plano se encuentra una mujer de pie, posando de espaldas, y con la
atencin fija hacia el lado derecho de la obra, la mujer lleva puesto un vestido de tonos
calidos fuertes, como segundo plano se encuentra un barandal que hace de soporte a la
inclinacin que ella ejerce sobre sus codos y brazos para mantener el equilibrio, este
barandal tiene un mango como de madera y va hasta el suelo contrastando con los tonos
del vestido , el barandal es de tonos fros, como fondo tonos clidos fuertes a manera de
manchas.

202

Obra nmero 11.-Autor: Dolores Andrade


Ttulo: Extensas, vlidas memorias del lugar
Tcnica utilizada: Madera y piedra
250 X 75 X 35cm
Descripcin de la Obra:
Son dos columnas de madera; la una sobrepasa a la otra en 20 de altura, la otra posee
una roca o piedra de ro de 30 X 18 cm.
Las columnas de madera son paralelas y se encuentran separadas por 50 cm.
Aproximadamente, a la altura de 1,20 m. se encuentra una pieza rectangular de madera
que forma la nica unin de estas dos columnas.
Cada columna posee tres caras lizas en las partes externas, y una sola cara estriada,
asemejando a una persiana de posicin horizontal, la direccin de las franjas esta dada
hacia el centro, hasta la pieza de madera que sirve de unin de las dos columnas. Todo
el conjunto asemeja a una gran H. En su obra se hace presente la contradiccin de
cuanto existe. Ataduras que duelen, nuestros antepasados. Fusin de arcaicas formas en
secretas esculturas preincaicas.
203

Obra nmero 12.-

Autor: Hernn Illescas Coronel


Ttulo: Fantasmagora
Tcnica: leo s/lienzo
Tamao: 85 X 65 cm.
Descripcin de la obra:
Esta pintura de caballete es una representacin que involucra festejo, alegra; los tonos
que se emplean en su mayora son tonos calientes, fuertes y explosivos; como
personajes principales estn un hombre y una mujer, la mujer se encuentra jugando con
una cometa que por poco se la lleva a ella por los aires, el hombre sujeta con sus manos
el hilo que iza a la cometa desde una motocicleta amorfa y sin motor, que se encuentra
sobre un carro o carroza que contiene a un msico tocando el saxofn dentro de un
espacio amoblado. En el fondo se encuentran un sin nmero de texturas y ambientes
geomtricos y amorfos que comunican hacia ms direcciones y ambientes; es un trabajo
muy minucioso logar que todos los ambientes comuniquen una armona entre tonos y
equilibrio, y esta obra lo consigui.

204

Como primer plano se encuentra un tipo de marco situado en la parte inferior del
cuadro, luego avanzando hacia el segundo plano, se encuentra la pareja que esta
jugando con una cometa sobre una moto la cual esta encima de una carroza que
contiene a su vez a un msico tocando el saxofn en su interior. Este interior cambia de
ambiente tornndose en un espacio amoblado y con espacios luminosos que parecen
ventanas. Como tercer plano se aprecia a una persona acostada en el piso relajadamente,
esta persona esta representada en tonos clidos moderados. En cuarto plano se encuentra
la representacin de un sol con un centro calido y con rayos solares lineales de tonos
fros que enmarcan al astro. Como fondo se encuentran un sin numero de formas y
texturas logradas por el artista de tonos calientes y con salidas clidas y fras.

205

Obra nmero 13.-

Autor: Enrique Dvila Cobos


Titulo: Memorias
Tcnica: Acrlico s/lienzo
Tamao: 120 X 90 cm.

Descripcin de la obra:

Esta obra es considerada como abstraccionista, consiste en la ausencia de la figuracin


para representar las cosas, a cambio de esto se pueden utilizar smbolos.
Hacia el lado superior derecho se encuentra un crculo con una semiluna, el uno bordea
al otro, los dos smbolos son de tonos clidos; a su alrededor una superficie dividida de
tonos fros y lneas que sugieren direcciones de tonos fros, y en la parte baja derecha
una figura rectangular de tono calido. En esta superficie en el lado superior izquierdo, se
encuentran distribuidas 7 plumas de tonos fros y en la parte baja izquierda de esta
superficie se hallan dos plumas una de tono clido y la otra de tono fro. A manera de
marco de ventana se encuentran tonos clidos encerrando a la superficie del centro; en
la parte inferior de la obra se encuentran diferentes tipos de siluetas de tonos fros
dentro del marco de tonos clidos.
206

Obra nmero 14.Autor: Francisco Coello


Ttulo: Sueos
Tcnica: leo / Tela
tamao: 100 X 120 cm.
Descripcin de la obra:
Esta obra contiene a la representacin de una mujer que parece estar sentada, reposa su
cabeza sobre uno de sus brazos como primer plano. La mujer tiene un vestido de
manchas con tonos frescos y terrosos, la piel de su cara y de sus manos es tersa; posee
un sombrero con un adorno pequeo de una pera con hojas. En la esquina superior
izquierda se encuentra la figura de otra mujer de menor tamao flotando en el aire y
posando con las manos en los bolsillos. En la esquina inferior derecha se encuentra tres
personas paradas como manteniendo una conversacin de algo. El fondo es de tonos
terrosos y fros suaves.

207

Obra nmero 15.Ttulo: Amor Eterno


Autor: Alfonso Vsquez
Tamao: 90x110 centmetros
Tcnica utilizada: Mixta
Descripcin de la obra:
Es una pintura de caballete que ilustra a una mujer con un nio dentro del horizonte de
un paisaje de ciudad y de montaas en la noche; dentro del primer plano se encuentra un
pjaro que parece ser un colibr volando sobre una ciudad con una flor de forma
estrellada en su pico; Compartiendo el primer plano resaltan las cabezas de la mujer y
del nio con su largos cuellos, cobijados por una misma mantilla o tul, los rostros de
los personajes son de tonos clidos no poseen globos oculares solo oquedades, su boca
es viva y su expresin es impvida vista singularmente, pero en conjunto expresa
ternura.
En segundo plano se encuentra una ciudad conformada por destellos de luz en la noche
y algunas montaas a lo lejos. Como fondo esta el espacio oscuro y destellos que
asemejan a las estrellas.

208

Obra nmero 16.Ttulo: rbol con zapatos rojos


Autor: Tabara
Tamao: 130 x 120 centmetros
Tcnica utilizada: mixta
Descripcin de la obra:
Esta obra es la representacin: en primer plano de un gran rbol frondoso con ramas
delgadas, posee muchas hojas pequeas de tonos clidos y frescos; de algunas ramas
del rbol y del tronco cuelgan zapatos de tonos calientes, botas y piernas. Adems
existen en la copa del rbol unas formas calidas que parecen labios o vainas abiertas. En
segundo plano se encuentran ms rboles nueve en total algunos se asemejan al primero
y otros no, los rboles se encuentran en una amplia llanura hasta que en esta llega a
formarse la forma de las montaas. Como fondo se encuentra un cielo claro del da.

209

AREA DE RECREACIN

Introduccin al deporte para ciegos:


En todo el mundo, existen federaciones de deportes para ciegos, lo que facilita la
organizacin de competiciones nacionales e internacionales y cuyo mayor exponente se
ve en las paraolimpiadas que se celebran cada 4 aos, coincidiendo con la celebracin
de los juegos olmpicos.
Un aspecto importante a destacar en los deportes para ciegos, radica en la clasificacin
de los deportistas, no slo segn su edad y sexo, sino tambin por su grado de visin,
clasificndose en tres categoras:
Categora B1: Deportistas ciegos.
Categora B2: Deportistas con baja visin.
Categora B3: Deportistas con deficiencias visuales leves.
Los deportes para ciegos, pueden clasificarse esencialmente en dos categoras: los
deportes adaptados, para cuya prctica se modifican aspectos tales como el
equipamiento, el campo o las normas de juego, y aquellos deportes especficos, creados
especialmente para su prctica por parte de personas con problemas de visin.

Atletismo:
Los atletas ciegos y deficientes visuales compiten en las mismas pruebas que los atletas
videntes, en algunos casos sin modificaciones relevantes y en otros con los leves
cambios que obviamente un ciego puede necesitar como es la ayuda de un gua o del
entrenador para darle las instrucciones pertinentes a la hora de colocarse en las zonas de
lanzamiento o salto, siendo el atletismo, el deporte en donde ms se acercan las marcas
conseguidas por los deportistas ciegos y videntes.
Los atletas compiten dentro de su categora en cada una de las pruebas de atletismo, a
excepcin de las pruebas de relevos en las que se combinan todas las categoras B1, B2
y B3.

Ciclismo:

210

Ya sea para su recreo, con sus familias, entre amigos o en competiciones, los atletas
deficientes visuales practican el ciclismo desde hace aos gracias al uso del tandem, una
bicicleta de dos plazas, en la que un vidente ocupa la posicin delantera.
Aquellos que practican el ciclismo deportivo, tienen posibilidades de hacerlo en
diversas modalidades, tanto en carreras al aire libre como en pruebas en veldromo.
Existen carreras contra reloj, individuales o por equipos de tres tndems, competiciones
en veldromo como las de velocidad entre dos tndems, persecucin individual y
contra-reloj.
Para los hombres existe tambin una persecucin denominada olmpica en la que dos
equipos de tres tndems se enfrentan en una distancia de 4 km.

Ftbol sala:
El ftbol para ciegos lleva practicndose en los colegios desde los aos 20. La prctica
de este deporte en grandes superficies implica para los invidentes problemas tanto de
orientacin y seguridad como de prdida del ritmo del partido al perderse la pelota, por
lo que se opt por la prctica del ftbol-sala.
Este deporte, con las adaptaciones necesarias aporta mayor dinamismo al juego por sus
reducidas dimensiones y por las vallas laterales que adems de permitir jugar
ininterrumpidamente sin tanto saque de banda, son un elemento de orientacin y
seguridad para el jugador El portero es vidente y tiene limitada su maniobrabilidad a
una pequea zona dentro del rea de penalti. Un gua detrs de la portera orienta a los
jugadores.
El ftbol-sala de ciegos, con un reglamento pulido y elaborado, no es un deporte
peligroso. Esta es una idea que se disipa cuando se presencia un partido de ftbol sala
de ciegos con la estructura adecuada. Existen choques pero no ms que en un partido de
videntes, teniendo en cuenta que es un deporte en donde el contacto con el rival es
constante y ocho jugadores disputan un baln (al que se le ponen cascabeles u otros
elementos que lo hagan sonar) en unas dimensiones de veinte por cuarenta metros.
Al hablar de ftbol sala de ciegos, hablamos de habilidad para manejar el baln,
coordinacin para el regateo, el disparo a puerta y para no perder el orden tctico, lo que
requiere tcnica, orientacin, dominio espacial y corporal, siendo uno de los juegos para
ciegos ms extendidos en todo el mundo.
Ftbol o Goalball:

211

El Goalball es un deporte de equipo especfico para deficientes visuales en el que juegan


2 equipos de tres jugadores. Todos los jugadores llevan los ojos tapados para posibilitar
que tanto ciegos, deficientes visuales y deportistas videntes puedan competir juntos
(aunque para poder jugar en la seleccin nacional los jugadores deben ser legalmente
ciegos)
El Goalball consta de 14 minutos de juego, dividido en 2 partes de 7 minutos. La pelota
utilizada (denominada goalball), pesa 1,25 kilogramos y contiene cascabeles en su
interior. El objeto del juego es hacer rodar la bola a travs de la lnea de gol de tus
oponentes mediante un lanzamiento similar al utilizado en el juego de bolos.

Halterofilia:
La Halterofilia es un deporte joven. Naci hacia 1950 en Inglaterra, con el nombre de
Strenght Lifting (levantamiento de peso), contando con tres modalidades: Sentadillas,
Press de Banca y Curl de Bceps. Posteriormente consigui un mayor asentamiento en
Estados Unidos, donde adopt su actual terminologa y se cambi la modalidad de Curl
de Bceps por la de Peso Muerto.
En los campeonatos para ciegos, no se tiene en cuenta el sistema de categoras;
compitiendo juntos, como en goalball o lucha, los ciegos totales con los que tienen resto
visual, siendo las nicas divisiones por sexos y edad.

Judo:
Pocos deportes se ajustan tan bien como el Judo para permitir que los ciegos compitan
en las mismas condiciones contra atletas videntes.
Un buen judoka debe guiarse por lo que siente y no por lo que ve. Los ciegos tienen
ventaja, tienen ms sentido para el judo que los deportistas videntes. Un ciego aprende
las tcnicas sintindolas en su propio cuerpo, son capaces de sentir un ataque antes que
ningn vidente lo hara.
El Judo desarrolla autodisciplina y respeto por uno mismo y por los dems, facilitando
los medios para aprender auto confianza, concentracin y conductas de liderazgo, as
como coordinacin fsica, fuerza y flexibilidad. Como deporte que ha evolucionado de
las artes marciales, desarrolla control completo del cuerpo, equilibrio y giles reflejos.
Sobre todo desarrolla una reaccin mental bien coordinada. El entrenamiento da a la
persona un sistema efectivo de autodefensa si llegara la ocasin.

212

Cada atleta deficiente visual es diferente y los competidores pueden necesitar diferentes
grados de asistencia dependiendo de su agudeza visual, experiencia, edad, etc.. Los
procedimientos bsicos son que el entrenador o ayudante guen al competidor hasta su
rincn en el tatami cuando sea llamado y asegurarse que el participante sabe si es shiro
o akai (rojo o blanco). El juez de esquina gua a los competidores a sus marcas. Despus
los jueces se sientas y el rbitro anunciar la palabra "rei".
En el inicio del combate, el rbitro colocar a los dos competidores en posicin de
"kumi-kata", luego los contendientes bajarn los brazos a ambos lados del cuerpo y el
rbitro anunciar "hajime", para dar comienzo al combate. Durante todo el combate, el
rbitro deber asegurar que los contendientes estn siempre al alcance de sus
respectivos brazos.

Lucha libre:
La lucha es un deporte natural, divertido y estimulante para los nios visualmente
deficientes, lo mismo que para los dems.
En Estados Unidos, la lucha ha sido probablemente el deporte ms ampliamente
practicado y popular entre los nios en edad escolar visualmente deficientes del pas.
Uno de los verdaderos beneficios que el deporte ofrece es que permite a los luchadores
ciegos aprovechar la oportunidad de medir sus fuerzas, tanto con contrincantes
invidentes como con videntes.
La modificacin del reglamento que permite a los luchadores con deficiencia visual
participar al mismo nivel en la lucha con contrincantes "normales" es muy simple:
La principal modificacin exige un contacto constante entre los luchadores ciegos para
estar en igualdad de condiciones frente a los luchadores que s ven. El propsito
evidente de esta regla de contacto es permitir a los luchadores con dificultades de visin
saber dnde estn sus oponentes.
Si el contacto se interrumpe, el rbitro para el combate y pone a cada contrincante en
liza de nuevo. Tambin se entiende que los luchadores tienen derecho a renunciar a la
regla de contacto y sin ningn tipo de adaptacin. En el caso de que los dos sean
visualmente deficientes, debes estar de acuerdo los dos para que la regla de la que
hablamos sea ignorada.
Muchas veces, los participantes son superiores a sus contrincantes videntes. Eso se
puede atribuir generalmente al hecho de que la persona ciega se entrena duramente y
trabaja para ser tcnicamente competente. Es interesante comprobar que la alegra que
siente el luchador deficiente al derrotar a un oponente que ve perfectamente parece
mayor que cuando vence a competidores invidentes. Parece que cuando los ciegos
213

saltan al cuadriltero para agarrar a un luchador vidente, en condiciones de igualdad, se


puede presenciar la forma ms pura de integracin y aceptacin.
Hay unos pocos luchadores cuya habilidad es suficientemente avanzada como para tener
xitos constantes frente a oponentes videntes, al mximo nivel de competicin. Por ello,
en buena medida, no toman parte en competiciones que estn organizadas para
deportistas con dificultades de visin exclusivamente.

Natacin:
La natacin para las personas deficientes visuales es un deporte que est siendo
practicado desde hace muchos aos. La natacin ofrece muchos beneficios dado que
puede ser disfrutado y practicado tanto por personas jvenes como por personas
mayores.
La natacin de competicin sigue las reglas de la FINA con algunas concesiones para la
falta de visin. La categora B1, nadadores totalmente ciegos, requieren mayores
consideraciones que los nadadores de las categoras B2 y B3. El golpe suave es la ms
importante.
Este es un mtodo para informar al nadador cuando est alcanzando el final de la
piscina y debe ejecutar el giro o hacer el ltimo toque. Los compaeros videntes
(tappers) se colocan al final de cada extremo de la piscina y usando una varilla con un
extremo firme y grueso, con una punta segura tocan o dan una leve seal al nadador.
Las concesiones que se dan a los nadadores B1 es que puedan estar demasiado cerca de
las lneas de las calles para as poder realizar mejor las brazadas en mariposa o los
toques en braza o mariposa. Un entrenador dirige cuando tomar el relevo en las carreras
por equipos.
Mientras que muchos de los nadadores con visin eligen la posibilidad de llevar gafas
especiales para competicin, los nadadores de la categora B1 estn obligados a llevar
gafas que imposibiliten la entrada de la luz. Los nadadores B2 y los B3 pueden competir
bajo las reglas de la FINA sin otras adaptaciones, sin embargo debido a que las
condiciones de luz pueden cambiar tienen la posibilidad de utilizar la varilla para
mejorar los giros y poder ser avisados como los B1.

Showdown:
El Showdown es un juego de movimientos rpidos especficamente diseado para
personas con problemas de visin, aunque no hay que ser necesariamente ciego para
jugar.
214

A veces, equivocadamente, es llamado tenis de mesa para ciegos porque es un juego de


mesa. Sin embargo, no tiene marcas en la mesa, por tanto los puntos se consiguen
introduciendo la bola en una portera pequea.
El nico equipo que se requiere para jugar al showdown es la mesa especialmente
diseada, 2 palas, una bola especial que contiene unas piezas de metal en su interior, y
quizs un guante para la mano con la que se juega. El sonido que producen las piezas de
metal rodando dentro de la bola indica la localizacin de la bola durante el juego.
El Showdown es muy fcil de aprender. El objetivo del juego es golpear la bola a travs
de la mesa e introducirla en la portera del contrario. El jugador que primero consigue
11 puntos es el ganador. Cada jugador sirve 5 veces seguidas al igual que ocurre en el
ping pong. El jugador consigue 2 puntos por gol y un punto cuando su oponente golpea
la bola dentro de la pantalla, golpea la bola fuera de la mesa o toca la bola con cualquier
otra cosa que no sea la pala.

Torball:
Desarrollado en los aos 70, el Torball es un juego de pelota por equipos especialmente
diseado para ciegos y deficientes visuales.
El Torball se juega en una cancha rectangular de 16 metros de largo por 7 metros de
ancho. En la pista hay 2 equipos y 6 jugadores (3 por equipo). La portera se coloca en
cada extremo de la cancha. El juego se practica con una pelota que contiene cascabeles
en su interior y debe ser lanzada por debajo de cuerdas tensadas a lo ancho de la pista.
El objeto del juego es que cada equipo lance la pelota y conseguir que cruce la lnea de
gol contraria mientras que el otro equipo debe evitar que esto ocurra. El equipo que
defenda anteriormente se convierte en atacante y los antiguos atacantes deben evitar
encajar el gol. Una particularidad de este juego es la pelota, que pesa solamente 500
gramos y est inflada con aire. Las cualidades de la bola permiten practicar el juego a
mucha velocidad y la posibilidad de lanzarla con efectos. El Torball requiere mucha
habilidad y concentracin por parte de los jugadores.
JUEGO DE NAIPES
Hay naipes con relieve en el sistema Braille permitiendo a los discapacitados visuales
poder practicar estos juegos. Este tipo de baraja tambin admite pequeas diferencias en
las figuras y en los motivos grficos.

215

SUBTEMAS

GUIONMUSEOGRFICO

CONTENIDO
TEMTICO

Como eran vistos Historia


en la antigedad discapacitados

Clasificacin

AREA

MATERIAL
EXPOSITIVO

TEXTOS Y
AUDIO

TEXTOS

MONTAJE

Introductoria

Esculturas de
Obras
pictricas,
relieves,
texturas.

Toda la
informacin en
sonido general y
particular.

Braile

Se realizan
esculturas de
tamao natural con
texturas, para
asemejar lo ms
real posible el tem
en cuestin a trata
tambin con olore

La vista y sus
enfermedades

Introductoria

Como lo hicieron Obras maestras

Sala los ms
brillantes

Dctilo-pintura,
modelado,
collage, arte
conceptual.

Apreciacin
artstica

Tcnicas y
tendencias

Obras guas

Braile de
identificac
in en
cdulas
fabricadas
en
acrlico,
de los
objetos a
exponerse
.

Bustos con
sensores
localizados,
para
explicacin de
tipos de
enfermedad.

Bustos,
esculturas e
inventos.

Talleres

Informacin en
audio general
Cdulas en
braille.
Audio en general
de las tcnicas.
Braile de
identificacin
para los
materiales.

rea de Arte
contemporn
eo
ecuatoriano.

La coleccin
consta de 15
obras en un
inicio en altos
y bajo relieves
cada obra con
texturas, olor y
sabor

Toda la
informacin en
sonido general y
particular.

Computad
ora con
teclado en
braile.

Se realiza un busto
por cada personaje
y su invento al lad
para tocarlo o
apreciarlo.

Personal
operativo
especializ
ado.

Se ofrecen los
materiales para
realizar las obras y
el espacio para
hacerlo

Paneles
informativ
os con
sensores,
sobre los
autores,
tcnicas y
tendencias

Elevaciones en
relieves de las
obras, tendrn
texturas, olores y
temperatura.

216

caractersticos.

Juegos

recreacin

rea
recreativa

Programacin de
citas.

Creacin de
fichas de salud

Sociedades y
rea de
fundaciones que informacin
trabajan con
personas
discapacitadas.

COSTA

recreacin

rea
recreativa

.
Reglas de los
juegos

Se utilizan las rea


verdes del museo.

Folletos
en braile
y audio
de las
institucio
nes.
Simulacin de
una playa con
mar.

Sonidos del mar.

Se utilizan las rea


verdes del museo
donde se encuentr
el domo.

Las obras de exposicin no se encuentran dentro de ningn tipo de vitrina ya que todas
tienen que ser tocadas.
SEALETICA.Para la circulacin de los visitantes existen pasamanos ubicados alrededor de las obras
expuestas, estos pasamanos sirven para que los visitantes sepan la ubicacin exacta de
cada una de estas obras. Los tubos de los pasamanos poseen seales en braille que
indican direcciones y una cdula de identificacin de la obra que se encuentra en frente
elaborada en fibra acrlica.

217

5.3.DESARROLLODELGUINMUSEOGRFICO

Como eran vistos Historia


en la antigedad discapacitados

Clasificacin

La vista y sus
enfermedades

Introductoria

Esculturas de
Obras
pictricas,
relieves,
texturas.

Introductoria
Bustos con
sensores
localizados,
para
explicacin de
tipos de
enfermedad.

Toda la
informacin en
sonido general y
particular.

Braile

Braile de
identificaci
n en cdulas
de los
objetos.

218

Se realizan
esculturas de
tamao natural
con texturas, pa
asemejar lo m
real posible el
tema en cuesti
a tratar, tambi
con olores.

5.3.1. PLAN DIRECTOR


COMO ERAN VISTOS EN LA ANTIGEDAD.Esta sala de exposicin conocida como Sala Introductoria, cuenta con esculturas de
tamao natural en un total de nueve grupos escultricos, los cuales tendrn dispositivos
de audio individuales, adems de texturas y olores caractersticos dependiendo del tema
escogido; estos grupos escultricos transmitirn momentos en la historia de cmo eran
vistos los discapacitados en general. Cada grupo escultrico esta sobre una plataforma
pequea con ruedas para que tenga movilidad.
Ejemplo de grupo Escultrico de la Sala Introductoria de Historia.

Audio General: Esta Sala introductoria es una muestra de las diferentes maneras del
trato hacia las personas con discapacidad alrededor de la historia.
Informacin en audio de cada grupo escultrico:

A) En la Grecia del siglo IV a.C. El eminente filsofo Aristteles trat de


interpretar algunas desviaciones, existen registros de estudios de las diferencias
fsicas y mentales realizadas por Digenes, Hipcrates y Galeno quienes
estudiaron la epilepsia, y la demencia, entre otras formas atpicas.
B) Durante la Edad Media, principalmente en Francia, se construyeron
verdaderas fortalezas y ciudades amuralladas en donde se guardaban y escondan
a centenares de personas con algn tipo de discapacidad.
219

C) En el siglo XIV en Europa, los nacidos con alguna deficiencia ya sea fsica,
sensorial o mental, como la sordera, la ceguera, la parlisis, la cuadriplejia, entre
otros, eran confinados a grandes encierros, en los que eran exhibidos los fines de
semana a manera de espectculo circense o de gran zoolgico, para que las
familias se divirtieran un poco o bien, manejando la conciencia social,
rectificaran los actos cometidos en el pasado, por considerar a estos "monstruos"
o "fenmenos" como la ms grande seal de un castigo enviado por Dios.
D) Posteriormente, los "anormales", constituyeron un pretexto tambin de Dios
para despertar la caridad, el fin: la promesa de salvacin y vida eterna. Por lo
menos, ya no eran considerados "fenmenos", ahora eran llamados "miserables";
su funcin ya no era la de divertir, ni la de solamente despertar el
arrepentimiento, sino que su funcin sufri un cambio aparentemente ms
"digno": el de ser los portadores del objetivo de Dios, liberar a los "normales"
del pecado, por la caridad. Esto fue lo que en trminos generales la sociedad
oblig a creer durante mucho tiempo a las personas con alguna deficiencia:
personas minusvlidas, sin valor, incapaces de desarrollar una conciencia crtica,
un sentimiento; seres por tanto, sin voz ni voto. Tras la aparicin de la iglesia
cristiana, se condena el infanticidio pero se alienta a atribuirles el origen de
cualquier suceso sobrenatural y se les denominan endemoniados o
endemoniadas, personas posedas por el demonio y otros espritus infernales,
sometindoles a prcticas exorcistas.
E) Los indios Masai asesinaban a sus nios discapacitados. Los masai son un
pueblo estimado en unos 883.000 individuos, alrededor del 1% de la poblacin
keniata, que viven en Kenia meridional, entre las ciudades de Narok y Namanga,
y en Tanzania septentrional. Hablan maa, que es una lengua niltica oriental, si
bien muchos de ellos son capaces de expresarse correctamente en suajili e
ingls. La mayora de los masais mantienen su religin tradicional, aunque
algunos han adoptado alguna forma de cristianismo. Los masais (o "maasai",
como ellos mismo lo deletrean) son pastores nmadas que viven hoy, como
siempre han hecho, en las llanuras abiertas del sudeste de Kenia y el nordeste de
Tanzania. Su vida y su cultura tradicionales giran en torno a su ganado vacuno,
en el cual cifran exclusivamente la riqueza, y se trasladan a dondequiera que las
condiciones sean mejores para sus reses. Tambin cazan ocasionalmente y
recolectan algunas especies vegetales autctonas como el aloe vera, que emplean
para las "quemaduras fras" pero por lo general no se dedican a la agricultura.
Antes de que los britnicos subyugaran Kenia en los comienzos del siglo XX,
los masais vagaban libremente en pos de los pastizales. La creacin de fronteras
y de lmites territoriales impuestos forz un cambio en su estilo de vida, aunque
no tan drstico como en el caso de otros pueblos nmadas.
F) Durante los siglos XVII y XVIII, a quien tena una discapacidad psquica se
le consideraba persona trastornada, que deba ser internada en orfanatos,
manicomios sin recibir ningn tipo de atencin especfica. Se les denominaba
imbciles, amentes, dbiles mentales, diferentes, locos o locas. A finales del
siglo XVIII y principios del XIX, se inicia la institucionalizacin, de modo
especfico, de quienes tienen una discapacidad psquica. Esto se debi a la idea
de que haba que proteger a las personas normales de la no-normal. La persona
con discapacidad es separada, segregada, discriminada. Aparece la terminologa
nios y nias idiotas en el entorno de quienes investigan la materia y,
posteriormente desde el mbito mdico, oligofrnico u oligofrnico. Esta
situacin se alarga hasta comienzos del siglo XX por ser considerados como
220

seres perturbados y perturbadores, antisociales y obsesos sexuales. Por ejemplo,


durante el siglo XX se cometieron grandes crmenes en Alemania, por el ejrcito
Nazi, durante la segunda guerra mundial, diversas atrocidades se realizaron, "en
busca de la raza perfecta" en la cmara de gases o con la ingestin de sustancias
letales que se proporcionaron en forma selectiva, antes que a nadie, a las
personas con discapacidad mental para aniquilarlas tratando de construir un
supuesto mundo de "seres perfectos".
G) Los Chagga de frica Oriental en el pas de Tanzania, utilizaban a sus
discapacitados para ahuyentar al demonio. Su establecimiento en los territorios
que actualmente ocupan es anterior a la llegada de los pueblos nilticos. Durante
los enfrentamientos interclnicos del pueblo maasai entre los aos 1830 y 1875
diversos grupos Masai fueron absorbidos por los Chagga al igual que sucedia en
los pueblos Tabeta, Kamba, Meru y Kikuyu.
H) Los Jukun de Sudan consideraban que eran obra de los malos espritus y los
abandonaban para que murieran. La Repblica de Sudn o Repblica del Sudn
es el pas ms grande de frica, situado al noreste del continente. Su capital es
Jartum. Limita con Egipto al norte, el Mar Rojo al noreste, Eritrea y Etiopa al
este, Kenia y Uganda al sureste, la Repblica Democrtica del Congo y la
Repblica Centroafricana al sudoeste, Chad al oeste y con Libia al noroeste.
I) Los Semang de Malasia empleaban a sus lisiados como hombres sabios. Los
Semang son un pueblo de cazadores-recolectores nmadas que habitan en los
bosques hmedos tropicales de la pennsula Malaya, especialmente en los
estados de Kedah, Kelentan y Perak, en Malasia.

221

TEXTOS Y CDULAS EN BRAILE.UBICADAS EN EL PASAMANOS:


Sala Introductoria.
1. En la Grecia del siglo IV antes de Cristo.
2. Durante la Edad Media.
3. En el siglo XIV en Europa.
4. La Caridad.
5. Los indios Masai.
6. Durante los siglos XVII y XVIII.
7. Los Chagga de frica Oriental.
8. Los Jukun de Sudan.
9. Los Semang de Malasia.
Textos en Braille

9
222

CLASIFICACION.Dentro de la Sala Introductoria se encuentran 4 bustos en los cuales est descrito un tipo
de clasificacin de las enfermedades de la vista de una manera entendible y prctica;
adems de un panel en altos relieves y en braille con las partes del ojo humano.

Ejemplo de Busto

LA VISTA Y SUS ENFERMEDADES:


Panel inclinado en alto relieve y letras en braille.Partes de un ojo.

223

Corte vertical del panel.

AUDIO POR BUSTO


Ceguera: Carencia de visin o slo percepcin de luz. Imposibilidad de realizar tareas
visuales. Puede ser causada por la presin del nervio ptico. Tambin por la separacin
de la retina desde el interior del globo ocular. Ceguera para los colores: es un defecto
congnito de la retina, est relacionada con el exceso del consumo de drogas, alcohol,
tabaco, entre otros. Glaucoma: aumento de la presin interna del ojo, por acumulacin
de un lquido que se produce dentro del ojo, llamado humor acuoso. Sin tratamiento
adecuado puede perder la vista. Retinopata diabtica es una complicacin de los
pacientes con diabetes, los desequilibrios de azcar afectan especialmente los vasos
de la retina. Es la principal causa de ceguera en el mundo. Es una enfermedad
silenciosa, los sntomas se presentan cuando ya esta avanzada la enfermedad. No
produce dolor pero la visin puede volverse paulatinamente ms borrosa. Si hay
hemorragia puede perderse totalmente la visin.
Discapacidad visual profunda: Dificultad para realizar tareas visuales gruesas.
Imposibilidad de hacer tareas que requieren visin de detalle Hipermetropa: el
cristalino funciona bien, pero el globo ocular es demasiado corto. La imagen de los
objetos cercanos se forma detrs de la retina. Es un defecto hereditario, donde el
paciente ve la imagen de cerca borrosa.
Discapacidad visual severa: Posibilidad de realizar tareas visuales con inexactitudes,
requiriendo adecuacin de tiempo, ayudas y modificaciones. Miopa: el cristalino
224

funciona bien, pero el globo ocular es demasiado largo. La imagen de los objetos
alejados se forma delante de la retina. Es un defecto visual donde se dificulta ver los
objetos lejanos. Los objetos cercanos se ven claramente Diplopa, visin doble,
estrabismo y bizquera: son causados por debilidad o parlisis de los msculos externos
del globo ocular. Desprendimiento de retina: es la separacin de una membrana llamada
retina (sensible a la luz), que esta situada en la parte posterior del ojo no hay dolor
puede ver sombras que vienen de arriba o de los lados del ojo. Perdida de la visin
parcial o total. Se presenta mas en hombres que en mujeres y si eres mayor de 40 aos.
Si tienes miopa, si sufres un traumatismo ocular. Si eres diabtico.
Discapacidad visual moderada: Posibilidad de realizar tareas visuales con el empleo
de ayudas especiales e iluminacin adecuada similares a las que realizan las personas de
visin normal. Hemeralopia: est causada por una incipiente opacidad en uno o ms de
los tejidos oculares. Astigmatismo: deformacin de la crnea o alteracin de la
curvatura de la lente ocular. Provoca una visin distorsionada debido a la imposibilidad
de que converjan los rayos luminosos en un solo punto de la retina.
La conjuntivitis: produce enrojecimiento, inflamacin, molestias y constante lagrimeo.
Durante el sueo, se produce una secrecin de pus que al secarse, hace que las pestaas
se peguen entre s. La prevencin de sta enfermedad se logra mediante la prctica de
medidas higinicas como lavarse regularmente bien los ojos, usar toallas limpias, no
frotar los ojos con las manos sucias, aplicar slo los medicamentos (colirios o cremas)
recetados por el mdico

TEXTOS Y CDULAS EN BRAILE.UBICADAS EN EL PASAMANOS:


1. Ceguera.
2. Discapacidad visual profunda.
3. Discapacidad visual severa.
4. Discapacidad visual moderada.

2
3
4

225

Como lo hicieron Obras maestras

Sala los ms
brillantes

Bustos,
esculturas e
inventos.

Informacin en
audio general
Cdulas en
braille.

Computadora con
teclado en braile.

Se realiza un
busto por
cada
personaje y
su invento al
lado para
tocarlo o
apreciarlo.

226

COMO LO HICIERON.AUDIO GENERAL:


Esta Sala de exposicin esta dedicada al talento de muchas personas a la voluntad de ser
mejores cada da superando sus propias limitaciones y siendo un ejemplo de vida a
seguir para los dems.
AUDIO ESPECFICO POR CADA BUSTO O ESCULTURA DEPENDIENDO
DEL CASO:

J)
Ludwing Van Beethoven (busto)
Muchas son las personas discapacitadas que a lo largo de la historia de la humanidad
han aportado su valiosa contribucin heredndonos parte de su vida, como un ejemplo
de perseverancia y de espritu de lucha del ser humano, entre ellos destaca entre muchos
otros, el celebre Ludwing Van Beethoven, quien representa un genio de todos los
tiempos, pues a pesar de que empez a perder su audicin muy joven y posteriormente
qued completamente sordo. Esto no lo restringi para seguir creando sin lmites, pues
su talento era mucho ms grande que su discapacidad, Beethoven tambin ha sido
reconocido por su tenacidad, con su msica nos ha transportado a millones de seres
humanos dentro de ella, transmitindonos su valor, su vocacin, su constancia y el
espritu de lucha que el hombre requiere para poder vencer la adversidad.
Como fondo musical esta sonando algunas de sus ms reconocidas composiciones
musicales.

227

K)
(Escultura)

Ray

Charles

Msico estadounidense, de Albany, Georgia. Pianista y cantante, Ray Charles perdi la


vista durante su infancia por un glaucoma. Ray Charles fue un autodidacta del piano,
pero tambin recibi clases de msica en braille en la "St Augustine School", un centro
para invidentes. Paralelamente, tuvo que ganarse la vida como msico, cuando
fallecieron sus padres. A finales de la dcada de los cuarenta, Ray Charles consigue
colocar un disco en las listas de su pas, y en 1951 obtiene su primer Top Ten, gracias a
Baby, Let Me Hold Your Hand (beb djame agarrar tu mano) en 1951. Fue criticado
por cantar canciones gospel (palabra o canto a dios) con letras populares, aunque hay
una gran tradicin al poner letras religiosas a canciones y viceversa. En 1961, Charles
cancel un concierto programado en el Bell Auditrium en Augusta (Georgia) para
protestar por las ubicaciones segregadas.
Creo cincuenta y un discos durante su carrera como msico. Recibi cerca de 21
premios entre las categoras: lbum del ao, Mejor colaboracin, mejor lbum, Mejor
actuacin gospel, Mejor actuacin vocal masculina, Mejor lbum masculino, Mejor
actuacin masculina en solitario, Mejor cancin de do o grupo, entre otros.
En el ao 2004 se lanz una pelcula sobre la historia de Ray Charles, el papel de l fue
interpretado por . La cual cuenta en forma ms o menos completa la vida de esta estrella
del blus, su infancia, sus adicciones y lo que en verdad interesa, la historia de su exitosa
carrera como un haz del piano. Falleci a la edad de 73 aos, el 10 de junio de 2004 en
su casa de California. Sus restos se encuentran en el Cementerio Inglewood Park de Los
ngeles, California.
Como fondo musical esta sonando algunas de sus ms reconocidas composiciones
musicales.

228

L)
Sarah Bernhardt (busto)
Naci el 22 de octubre de 1845 en el n 5 de la calle cole de Medecine, Pars. Su
nombre real era Rosine Bernardt. Su madre era una juda de origen holands y llamada
Julie Bernardt, alias Youle. Se ganaba la vida como prostituta de lujo junto con su
hermana, Rosine Bernardt. Julie tuvo varias hijas ms: en Abril de 1843 tuvo dos nias
gemelas que fallecieron a las dos semanas. Tras Sarah, tuvo a Jeanne (fecha de
nacimiento desconocida) y a Rgine en 1855, que falleci de tuberculosis en 1873.
Todas fueron hijas de padres distintos y desconocidos. Sarah Bernhardt nunca supo
quin era su padre biolgico.
Sarah pas los primeros 4 aos de su vida en Bretaa al cuidado de un ama de cra. La
primera lengua que Sarah conoci fue el bretn y es por esta razn que al iniciar su
carrera teatral, adopt la forma bretona de su apellido: Bernhardt. En esta poca sufri
un accidente que muchos aos despus le acarreara graves problemas de salud. Cay
por una ventana rompindose la rodilla derecha. Aunque san sin problemas, la rodilla
le qued delicada para siempre y en 1914 a causa de una dolorossima inflamacin de
esa misma rodilla tuvieron que amputarle la pierna derecha. Tras el accidente, su madre
la llev consigo a Pars donde permaneci dos aos. A punto de cumplir 7 aos ingres
en la Institucin Fressard un internado para seoritas prximo a Auteuil. Permaneci
all dos aos.
En 1853 ingres en el colegio conventual Grandchamp. Tras abandonar Grandchamp a
los 15 aos, su madre trat de introducirla en el mundo galante para que se ganara la
vida como prostituta de lujo. Pero Sarah, influenciada por su educacin conventual, se
neg repetidamente a ello. Julie Bernard tena un saln en su piso parisiense donde se
reunan sus clientes. Entre ellos estaba el hermanastro de Napolen III, el duque de
Morny. Morny aconsej que Sarah se inscribiera en el Conservatoire de Musique et
declamation. Gracias a los contactos del duque, Sarah entr sin dificultad en 1859. En
1861 gan un 2 premio en tragedia y una mencin honorfica en comedia. . El 22 de
Diciembre de 1864 dio a luz a su nico hijo, Maurice Bernhardt. Sin un oficio y
habiendo fracasado momentneamente en el mundo del teatro, sigui los pasos de su
madre convirtindose en una cortesana de lujo. Sarah no abandon su actividad como
cortesana hasta que su carrera teatral se hubo afianzado con xito y pudo mantenerse
slo con el trabajo que le reportaba el teatro.
Tres aos ms tarde, en 1867 debut en el Teatro del Odon con "Las sabihondas" ("Les
femmes savantes") de Molire. Aqu empez su verdadera carrera profesional. Particip
en muchos montajes teatrales, alternando la vida teatral con la vida galante. La fama le
lleg repentinamente en 1869 con "Le Passant" de Franois Coppe, una obra en verso
229

de un solo acto. Sarah, adems, hizo por primera vez en esta obra un papel masculino, el
del trovador Zanetto. Repetira ms veces haciendo de hombre en varias obras ms:
Lorenzaccio, Hamlet y LAiglon.
En 1870, durante la Guerra Franco-Prusiana, habilit el Oden como hospital para
convalecientes, donde cuid con dedicacin a los heridos de guerra. En 1871 el
improvisado hospital tuvo que ser cerrado por problemas de salubridad. Tras la derrota
francesa y la cada de Napolen III, muchos intelectuales exiliados por estar en contra
del emperador, pudieron regresar a Francia, entre ellos Vctor Hugo. El regreso de Hugo
fue trascendental en la vida de Bernhardt ya que el escritor la eligi para protagonizar el
reestreno de su obra Ruy Blas. Bernhardt adems protagoniz otra obra de Hugo,
Hernani. Ruy Blas la encumbr a cotas de xito inimaginables. Regres a la ComdieFranaise como una gran estrella y all afianz su repertorio y sus mltiples registros
como actriz.
A parte de su profesin de actriz, se interes por la escultura y la pintura, llegando a
exponer en el Saln de Pars varias veces, entre los aos 1874 y 1896. Recibi distintos
premios y menciones honorficas en ambas disciplinas. Escribi tambin tres libro: su
autobiografa titulada "Ma double vie", "Petite Idole" y "Lart du Thtre: la voix, la
geste, la pronontiation".
Sarah Bernhardt fue tambin la primera actriz-empresaria del mundo del espectculo. El
siglo XX empez con un gran xito, "L'Aiglon", de Edmond Rostand. La obra fue
estrenada el 15 de Marzo de 1900 y obtuvo un xito triunfal sin precedentes. Sarah hizo
250 representaciones de "L'Aiglon" y tras esto, hizo otra gira a Estados Unidos para
representarla. En Nueva York represent la obra en el Metropolitan Opera House y
cosech un enorme xito. Prob suerte tambin con el recin nacido cine. En 1900 film
"Le Duel d'Hamlet", haciendo ella de Hamlet. En 1906 rod "La Dame aux Camlies",
con Lou Tellegen, su amante de aquel momento, haciendo de Armand Duval. Bernhardt
cuando la vio se horroriz y mand destruir el negativo, que afortunadamente todava
existe. Rod tambin "Elisabeth, reine d'Anglaterre", dirigida por Louis Mercanton. En
1913 film "Jeanne Dor", dirigida por Tristan Bernard. Esta pelcula se considera la
mejor rodada por Bernhardt y donde se puede observar mejor su arte interpretativo. La
pelcula se conserva en la Cinmatque de Paris. El 15 de marzo de 1923, tras rodar una
escena, qued totalmente agotada hasta que se desmay. Nunca se recuper. Once das
ms tarde, el 23 de marzo, falleca en brazos de su hijo Maurice.
Su entierro fue multitudinario: unos 150.000 franceses acudieron a despedirla. Fue
inhumada en el cementerio parisino de Pre-Lachaise.
A pesar de ser llamada "La divina Sarah" por su carcter excntrico y caprichoso, Sarah
Bernhardt trabaj en innumerables proyectos teatrales demostrando un carcter
perseverante, una gran profesionalidad y dedicacin a su arte.

230

M)
Esopo (escultura)
Esopo fue un fabulista griego que vivi en el Siglo VII a C. Su existencia es
semilegendaria; estaba dotado de un ingenio brillante y mordaz; era tartamudo y
jorobado.
Esopo es el fabulista griego por excelencia, a da de hoy se siguen incluyendo sus
pequeos cuentos en los libros infantiles, enfatizando en la moraleja de cada uno de
ellos de una manera clara y sencilla. Se desconoce el ao de su nacimiento, as que se le
engloba en el siglo VI a.c., su lugar de nacimiento tambin establece ciertas dudas pero
la ms aceptada es la que naci en Frigia. Fue un esclavo manumitido, es decir fue
esclavo del filsofo Janto hasta que le dio la libertad, segn parece qued prendado de
la cultura y oratoria de Esopo. Esopo, ya como hombre libre, fue admirado por la
aristocracia de la poca, y segn parece el regente Creso le dio la oportunidad de
trabajar para l siendo enviado al orculo de Delfos, como encargado de dar dinero a los
sacerdotes para tener el beneplcito del dios Apolo. No obstante, y segn fuentes que no
son del todo seguras, Esopo qued desencantado de los sacerdotes a los que vea como
usurpadores de riquezas, por lo que aunque si bien ofreci las sacrificios al Dios, no les
entreg dinero a los sacerdotes.
stos indignados decidieron tenderle una trampa, ponindole en el equipaje una copa de
oro consagrada a Apolo, por lo que fue acusado de robo y lanzado desde una roca
Hiampa, dndole muerte. Segn la tradicin, Esopo antes de morir, anunci la venida
del fin de Delfos debido a su condena injusta, algo que efectivamente sucedi,
afianzando as la figura del propio Esopo.
Las fbulas de Esopo, son breves historias con moraleja, sus personajes son animales
que actan como los humanos, y donde la envidia, la desconfianza y el mal se describen
de una manera cercana. Se creen que eran de tradicin oral pero no fue hasta Esopo
hasta que no quedaron plasmadas, principalmente por posteriores versiones de otros
autores entre ellos el fabulista latino Fedro.
A modo de ejemplo pondremos una muestra de una de las fbulas de Esopo:
"Sorprendi un len a una liebre que dorma tranquilamente. Pero cuando estaba a
punto de devorarla, vio pasar a un ciervo. Dej entonces a la liebre por perseguir al
ciervo. Despert la liebre ante los ruidos de la persecucin, y no esperando ms,
231

emprendi su huda. Mientras tanto el len, que no pudo dar alcance al ciervo, ya
cansado, regres a tomar la liebre y se encontr con que tambin haba buscado su
camino a salvo. Entonces se dijo el len: Bien me lo merezco, pues teniendo ya una
presa en mis manos, la dej para ir tras la esperanza de obtener una mayor."
Moraleja: si no quieres perder ambas cosas, confrmate con una que ya tienes segura.

N)
Robert Schumann (busto)
Robert Schumann (Zwickau, 8 de junio de 1810 - Endenich, Bonn, 29 de julio de
1856). Pianista, Compositor alemn de la poca del romanticismo y uno de los msicos
de mayor fama en la primera mitad del siglo XIX. Tanto en vida como en obra refleja en
su mxima expresin la naturaleza del romanticismo, siempre envuelta en la pasin, el
drama y, finalmente, la tragedia. Ana la ilustracin literaria con una gran complejidad
musical, creando obras de gran intensidad lrica. Su padre, de profesin editor, le apoy
y le procur un profesor de piano. A los 7 aos Schumann compuso sus primeras piezas
musicales. Su inters por la msica haba sido estimulado desde nio al escuchar tocar a
Ignaz Moscheles en Carlsbad, y en 1827 a travs de las obras de Franz Schubert y Felix
Mendelssohn.
Su padre, que tanto haba fomentado la educacin de Robert como pianista y escritor,
fallece en 1826; su madre no aprueba la dedicacin a la carrera musical y en 1828 le
enva a estudiar Derecho a la Universidad de Leipzig. Pero no tard en abandonar los
estudios para consagrase enteramente a la msica.
Existen varias fuentes que difieren respecto a cmo da Schumann su mano derecha en
1830, siendo la ms aceptada la de que para fortalecer el cuarto dedo ide un aparato
que de hecho lo inutiliz casi completamente (la musculatura del cuarto dedo est
conectada al tercer dedo, convirtindolo en el dedo ms dbil).
En paralelo a su nueva actividad como compositor, iniciaba su obra de crtico musical,
que gener una abundante produccin literaria. Su excepcional formacin y aptitud
literaria se plasmaban en crticas musicales, en las que, a travs de personajes
imaginarios, profundizaba en las obras de sus contemporneos. Un famoso ejemplo es
su ensayo sobre las variaciones de Chopin sobre un tema de Don Juan, que apareci en
el Allgemeine musikalische Zeitung en 1831.
232

Su Opus 2 Papillons (Fr., "Mariposas") escrito en 1831 es otro ejemplo excepcional de


la fusin entre literatura y composicin musical de Schumann. Se trata de una
composicin para piano, que consta de varias escenas de danza inspiradas en una fiesta
de disfraces. Cada danza trata de retratar a diferentes personajes y no guardan relacin
entre s, excepto la ltima. Segn escribira el propio Schumann, est inspirada en la
ltima escena de la obra Flegeljahre de Johann Paul Friedrich Richter y mezcla el
carcter festivo con un extraordinario sentimiento melanclico. La muerte en 1833 de su
cuada Rosalie y de su hermano Julius le causaron una crisis nerviosa e intent
suicidarse. Las crisis, depresiones, intentos de suicidio y periodos de reclusin completa
fueron frecuentes en la vida de Schumann y se acentuaron a partir de 1844, continuando
en aumento hasta su muerte (incluso llegando a escuchar voces y experimentar
alucinaciones). Este declive psquico se relacion inicialmente por los historiadores del
siglo XIX con la sfilis (o con el desastroso tratamiento mdico a base de mercurio,
habitual en la poca y casi peor que la enfermedad en s), pero la posibilidad ha sido
descartada debido a que los sntomas de desequilibrio mental de Robert Schumann ya
eran evidentes desde su juventud, antes de que cualquier sntoma de la sfilis pudiera
haberse manifestado. La teora ms aceptada actualmente es que padeca de trastorno
bipolar (enfermedad manaco-depresiva). Pero la gran intensidad creativa de Schumann
se concentraba en sus periodos de lucidez, de forma admirable. Tan pronto como se
restableca de un perodo de enfermedad, se entregaba frenticamente a la composicin,
trabajando de modo incansable. No slo escriba las melodas principales ni se limitaba
a las obras para piano, sino que pese a estar en un estado fsico y mental muy
degradado, escriba la instrumentacin sinfnica completa de todas sus obras, hasta la
extenuacin. El 27 de febrero de 1854, Schumann se arroja al Rin y es rescatado a
tiempo, pero su mente ya se ha perdido para siempre. Es internado en un sanatorio
privado en Endenich cerca de Bonn, Alemania, donde permanece hasta su muerte el 29
de julio de 1856. Tena slo 46 aos. Muere vctima de la sfilis. Fue enterrado en Bonn,
y en 1880 se erige sobre su tumba una estatua de A. Donndorf.
Como fondo musical esta sonando algunas de sus ms reconocidas composiciones
musicales.

O)
Helen Adams Keller (busto)
Helen Adams Keller (1880-1968), escritora y conferenciante estadounidense que super
impedimentos fsicos importantes sirviendo de inspiracin a otras personas
minusvlidas. Naci en Tuscumbia (Alabama). A los 19 meses padeci una grave
enfermedad que la dej sorda y ciega. Hasta los 7 aos no pudo comenzar una
233

educacin especial de lectura y escritura con Anne Mansfield Sullivan, ms tarde Macy,
del Instituto Perkins para ciegos. Aprendi rpidamente a leer el sistema Braille y a
escribir por medio de una mquina de escribir especialmente fabricada para ella. En
1890 aprendi a hablar despus de slo un mes de preparacin. Diez aos ms tarde
ingres en la Universidad de Radcliffe, en la que se gradu con todos los honores en
1904. Despus trabaj en la Comisin de ciegos de Massachusetts y comenz a dar
conferencias por todo el mundo. Al acabar la II Guerra Mundial, visit a los veteranos
heridos en los hospitales de Estados Unidos y dio conferencias en Europa en apoyo de
los disminuidos fsicos. Sus obras incluyen Historia de mi vida (1903), El mundo en que
vivo (1908), Salir de la oscuridad (1913), Mis aos posteriores (1930), Tengamos fe
(1940), Maestra: Ana Sullivan Macy (1955) y La puerta abierta (1957). Su vida fue
objeto de una pelcula, Lo inconquistable (1954), y de una obra de teatro, El milagro de
Ana Sullivan (1959, adaptada al cine en 1962), del autor estadounidense William
Gibson.
Algunas frases de Helen Adams:
1. Por qu contentarnos con vivir a rastras cuando sentimos el anhelo de volar?
2. Mantn tu rostro hacia la luz del sol y no vers la sombra.
3. Las cosas ms bellas y mejores en el mundo, no pueden verse ni tocarse pero se
sienten en el corazn.
4. No hay rey que no haya tenido un esclavo entre sus antepasados, ni esclavo que
no haya tenido un rey entre los suyos.

P)

Francisco de Goya y Lucientes (busto)

234

Goya y Lucientes, Francisco de (1746-1828), pintor y grabador espaol considerado


uno de los grandes maestros de la pintura de su pas. Marcado por la obra de Velzquez,
habra de influir, a su vez, en Edouard Manet, Pablo Picasso y gran parte de la pintura
contempornea. Formado en un ambiente artstico rococ, evolucion a un estilo
personal y cre obras que, como la famosa El 3 de mayo de 1808: los fusilamientos en
la montaa del Prncipe Po (1814, Museo del Prado, Madrid), siguen causando, hoy
da, el mismo impacto que en el momento en que fueron realizadas. Se atribua que
tena manquedad.
Relieve de un ejemplar de su obra:

El 3 de mayo de 1808.
leo sobre tela .1814
266 345 cm
Museo del Prado

235

Q)
Miguel de Cervantes (busto)

Saavedra es el ms destacado escritor en espaol y una de las grandes figuras de la


literatura de todos los tiempos. Sus obras, entre las que destaca El ingenioso hidalgo
don Quijote de la Mancha, marcan la culminacin del Siglo de Oro en la literatura
espaola y suponen el inicio de la novela moderna. En la imagen, retrato de Cervantes
realizado por Eduardo Balaca. No podemos, sin embargo, confiar en la autenticidad de
ninguno de los retratos que se conservan. Se le atribua que padeca Sordoceguera.
Don Quijote de la Mancha Es la novela cumbre de la literatura en lengua espaola. Su
primera parte apareci en 1605 y obtuvo una gran acogida pblica. Pronto se tradujo a
las principales lenguas europeas y es una de las obras con ms traducciones del mundo.
En un principio, la pretensin de Cervantes fue combatir el auge que haban alcanzado
los libros de caballeras, satirizndolos con la historia de un hidalgo manchego que
perdi la cordura por leerlos, creyndose caballero andante. Para Cervantes, el estilo de
las novelas de caballeras era psimo, y las historias que contaba eran disparatadas. A
pesar de ello, a medida que iba avanzando el propsito inicial fue superado, y lleg a
construir una obra que reflejaba la sociedad de su tiempo y el comportamiento humano.
Es probable que Cervantes se inspirara en el Entrems de los romances, en el que un
labrador pierde el juicio por su aficin a los hroes del Romancero viejo.
Aun lado del Busto un ejemplar de su obra.

236

Dctilo-pintura,
modelado,
collage, arte
conceptual.

Apreciacin
artstica

Talleres

Audio en general
de las tcnicas.
Braile de
identificacin
para los
materiales.

Personal
operativo
especializado.

Se ofrecen
los
materiales
para realizar
las obras y
el espacio
para hacerlo

Arcilla, madera,
papel, lienzos,
pintura, plstico,
entre otros.

237

APRECIACIN ARTSTICA:
AUDIO GENERAL
Qu lindo es apreciar algo bien hecho. Una cancin, un libro, una pintura, una
fotografa...
Realmente el arte se traduce en expresar sentimientos, no puede ser vaco, simplemente
porque s, sino que debe de mover alguna fibra de nuestro cuerpo. Pienso que es triste
que de cualquier forma nos cercenemos la capacidad de apreciar cualquier forma de
expresin.
CONSIDERADAS ARTES MAYORES
5. Arquitectura
6. Pintura
7. Escultura
8. (*Fotografa)
CONSIDERADAS ARTES MENORES
Las artesanas, como alfarera, cestera, tejido, orfebrera cermica, talabartera, etc.
Las artes plsticas implican el saber crear sobre la materia. Es decir, conformar y formar
ideas con distintos materiales mediante acciones como la pintura y el dibujo
(consideradas grficas), o la arquitectura y la escultura (consideradas plsticas).
En ellas se unen dos elementos llamados forma y contenido:
Forma
En la expresin artstica es la determinacin, distribucin y organizacin de los
elementos que percibimos al apreciar una obra de arte.
Contenido
Es el mensaje, la fuerza, el carcter, la historia o la esencia. Es lo que el artista quiso
comunicar con su obra. Implica tiempo, personajes, momento histrico, el discurso
implcito, la simbologa, etctera.
TECNICAS ARTISTICAS
1.- PINTURA Y DIBUJO:
Los conforman tres elementos bsicos:
a) Materiales colorantes:
+Dibujo: (Lpices de grafito, lpices de color, tinta, carboncillo, bolgrafos. Plumones,
marcadores, guises, estilgrafos).
+Pintura (de aceite: leo; de agua: acuarela, temple, gouache; tintas, anilinas y
pinturas acrlicas).
b) Instrumentos: Pinceles, esptula, lpices, manos, tubos (aplicacin directa).
c) Soportes: Lienzo (tela), papel, lmina galvanizada, madera, pared, etc.
2.- GRABADO: Puede ser en madera, linleo, piedra y serigrafa.
3.- ESCULTURA: Puede ser en bronce, piedra, barro, madera, yeso, acero inoxidable,
hierro, cermica, acrlicos, cristal, oro, plata, etc.
4.- ARQUITECTURA: Se utiliza materiales vigentes y tcnicas constructivas de
acuerdo con la poca y el medio.
5.- OTRAS TCNICAS: Collage, arte objeto, esculptopintura, land art, body art, arte
de procesos, instalacin (obra que se instala en un sitio para causar la sensacin de
entrar a la obra de arte y de alguna manera formar parte de ella) y otros.
DACTILO-PINTURA es aquella manifestacin artstica que se realiza con los dedos y
cualquier tipo de material imprimible como pintura, tintes, pigmentos, entre otros. Es un
tipo de pintura expresiva y ayuda al fortalecimiento de la psicomotricidad fina y motora.

238

El collage es una tcnica artstica que consiste en ensamblar elementos diversos en un


todo unificado. El trmino se aplica sobre todo a la pintura, pero por extensin se puede
referir a cualquier otra manifestacin artstica, como la msica, el cine, la literatura o el
video clip. Viene del francs coller, que significa pegar.
En pintura, un 'Kollaje' se puede componer enteramente o solo en parte de fotografas,
madera, piel, peridicos, revistas, objetos de uso cotidiano, etc. Aunque se considera
que fue Picasso quien invent el collage en 1912 con su pintura Naturaleza muerta con
silla de rejilla, est en discusin si fue primero Picasso o Georges Braque. El primero
haba pegado fotografas a sus dibujos en fechas tan tempranas como 1899, y en la
primavera de 1912 incorpor hule en forma de rejilla a su citada pintura Naturaleza
muerta con silla de rejilla.
El arte conceptual, tambin conocido como idea art, es un movimiento artstico en el
que las ideas dentro de una obra son un elemento ms importante que el objeto o el
sentido por el que la obra se cre. La idea de la obra prevalece sobre sus aspectos
formales, y en muchos casos la idea es la obra en s misma, quedando la resolucin final
de la obra como mero soporte. El artista Sol LeWitt likzae describi as el arte
conceptual: En el arte conceptual la idea o el concepto es la parte ms importante del
trabajo. Cuando un artista utiliza una forma conceptual de arte, significa que todo el
planteamiento y las decisiones estn hechos de antemano; la ejecucin es un asunto
superficial. La idea se convierte en una mquina que hace el arte.
PANEL EN BRAILLE
DACTILO-PINTURA es aquella manifestacin artstica que se realiza con los dedos y
cualquier tipo de material imprimible como pintura, tintes, pigmentos, entre otros. Es un
tipo de pintura expresiva y ayuda al fortalecimiento de la psicomotricidad fina y motora.
El collage es una tcnica artstica que consiste en ensamblar elementos diversos en un
todo unificado. El trmino se aplica sobre todo a la pintura, pero por extensin se puede
referir a cualquier otra manifestacin artstica, como la msica, el cine, la literatura o el
video clip. Viene del francs coller, que significa pegar.
El arte conceptual, tambin conocido como idea art, es un movimiento artstico en el
que las ideas dentro de una obra son un elemento ms importante que el objeto o el
sentido por el que la obra se cre. La idea de la obra prevalece sobre sus aspectos
formales, y en muchos casos la idea es la obra en s misma, quedando la resolucin final
de la obra como mero soporte.

239

El collage

Arte Conceptual

Dctilo Pintura

240

ADEMAS DE UNA COMPUTADORA CON TECLADO EN BRAILLE QUE


CONTIENE MS INFORMACIN SOBRE LOS PARAMETROS DE
APRECIACIN ARTSTICA.
*ELEMENTOS QUE INTERVIENEN EN LA FORMA.
En las artes plsticas hay dos elementos fundamentales que constituyen la base para
cualquier composicin. Estos son el punto y la lnea.
1.- El punto
Considerado como el sitio de interseccin entre dos lneas, es uno de los elementos
esenciales de la composicin. Se considera punto la marca dejada por un lpiz,
crayn, plumn o pincel.
2.- La lnea
Un punto en movimiento da como resultado una lnea, un trazo. As, una lnea est
formada por una sucesin de puntos unidos entre s, tan prximos que no los
alcanzamos a distinguir.
La lnea tambin sugiere volmenes, construye espacios y crea formas.
3.- El ritmo:
El ritmo es el movimiento que se imprime a la lnea. Es la repeticin y concordia entre
los elementos de la plstica y lo encontramos de diferentes tipos:
a) Repetitivo (Cuando los mismos elementos se presentan siempre de igual manera, sin
variaciones)
b) Alternado (Cuando se van turnando algunos o algunos de los elementos)
c) Progresivo (Cuando va de lo bajo a lo alto, de lo alto a lo bajo, de lo pequeo a lo
grande o de grande a pequeo)
Adems, el ritmo no solamente se logra con la lnea sino que es posible darlo con otros
elementos de la plstica.
4.- El equilibrio
En una composicin, el equilibrio se da cuando todos los elementos son necesarios unos
a los otros. Decimos que hay equilibrio cuando los elementos de una composicin estn
armonizados de tal manera que no podemos sustituirlos o desplazarlos sin alternar el
balance.
5.- Las formas:
a) Geomtricas
Las formas geomtricas bsicas son el tringulo, cuadrado y crculo.
b) Irregulares, tambin llamadas orgnicas
Son las que no tienen una estructura rgida y pueden ser realizadas premeditadamente,
como cuando recreamos la forma de un rbol o hacemos a pulso la silueta de un rostro;
o bien, estn tambin las que se hacen de modo accidental, empleando modos diferentes
de manchar el papel, goteando tinta o pintura diluida, dejando correr las gotas,
empleando colores en spray, salpicando el lienzo con la misma brocha, etctera. Aqu el
nico lmite es la imaginacin.
6.- Espacio
Todas las formas quedan plasmadas en alguna superficie. Esa superficie en la que se
mueven los elementos como puntos, lneas, colores, formas y texturas, es conocida
como el espacio, y tambin como plano bsico. Los espacios con figuras, imgenes,
etc. Son llamados espacios positivos. Y los vacos, espacios negativos.
7.- Composicin
Se refiere a la distribucin de los elementos en una obra: es el tipo de balance elegido
por el artista. Hay de varios tipos:
a) Composicin simtrica
241

Tiene un eje central y hacia un lado y otro de este eje, la composicin es igual: por
ejemplo, una mariposa o un rostro completamente de frente.
b) Composicin asimtrica:
En ella, la figura principal est de un lado o de otro. Despus se busca el equilibrio,
usando color, tamao o textura.
c) Composicin radial
En ella el foco de inters se encuentra en el centro y todo deriva de l o hacia l.
8.- Textura
La textura se refiere a la apariencia que deja ver la superficie del lienzo, ya sea real
sugerida. Es real cuando al tocarla descubrimos que en efecto es como la vemos, y
sugerida cuando slo es la apariencia la que logra el artista y la sentimos visualmente.
Entre otros ejemplos de textura estn lisa, rugosa, blanda, dura, spera, suave, etc., e
influyen en nuestra percepcin al observar determinada obra.
9.- Color
El color puede ser entendido de dos formas, como color-luz y como color-materia.
El color-luz parte del descubrimiento de Isaac Newton y su disco cromtico.
El color-materia es aquel cuya combinacin en forma de pigmentos utilizan los artistas.
Dos de las propiedades principales del color son el brillo y el matiz.
a) Brillo
Se refiere a la cantidad de luz u oscuridad que hay en un color (de ah decimos que es
plido o intenso)
b) Matiz, que se refiere a la variacin del color.
El color tiene el poder de transmitir diferentes estados de nimo y adems, la historia ha
atribuido diferente simbologa a cada color.
Clasificacin de los colores:
a) Colores primarios: Son el rojo, azul y amarillo, ya que no requieren de ninguna
combinacin.
b) Colores secundarios: Provienen de mezclas de los tres anteriores, de las que resultan
tonos como el verde, naranja y violeta.
c) Colores terciarios: Son los que combinan entre s a los primarios y secundarios y
dan como resultado el azul-verde, el amarillo-naranja, el azul-violeta etctera.
Los tonos
Se logran cuando mezclamos un color con mayor o menor cantidad de blanco o negro.
Los tonos ms claros se obtienen mezclando con blanco y los ms oscuros cuando
mezclamos con negro. Al conjunto de tonos que obtenemos se le llama gama de color.
Los matices
Estos se forman mezclando al color con sus vecinos en el crculo cromtico. Por
ejemplo, los matices de azul se logran al combinar mayor o menor cantidad de violeta o
verde.
La temperatura del color:
a) Colores clidos: Rojo, naranja y amarillo. Comunican luz y calor y se identifican
con sentimientos vivos como la euforia, alegra, enojo o ira.
b) Colores fros: Azul, verde y violeta. Se relacionan con los bosques, la nieve y el
agua; y se identifican con sentimientos relajantes y apacibles, con la meditacin, la
tranquilidad y la reflexin.
c) Colores neutros: Gris, caf, blanco y negro. Estos no estn en el arco iris y sirven
para balancear a los otros colores.
10.- Dimensiones
a) Un dimensionalidad.- Es como una lnea que slo tiene una dimensin: el largo.
b) Bidimensionalidad.- Est fomada por dos dimensiones: largo y alto.
242

c) Tridimensionalidad.- Se refiere a tres planos, alto largo y ancho. Esto da el


volumen, que puede ser simulado o real.
11.- El relieve (en escultura)
a) Alto relieve.- Cuando ms de la mitad de la figura se sale del fondo.
b) Medio relieve.- Cuando la mitad de la figura sale del fondo.
c) Bajo relieve.- Cuando menos de la mitad de la figura sale del fondo
d) Hueco relieve.- Cuando la figura se hunde en la obra.
12.- Perspectiva
Es el punto de vista que el autor quiere ofrecer al espectador. Un buen desarrollo de la
perspectiva permite representar correctamente la profundidad sobre una superficie de
slo dos dimensiones. En la perspectiva paralela, la lnea del horizonte se encuentra
con un punto de fuga, en el que convergen todas las diagonales que sirven para
proyectar el dibujo. Mientras que en la perspectiva oblicua hay dos puntos de fuga y
una de las aristas del objeto est de frente a nosotros.

Existir una repisa para la ubicacin de los materiales con etiquetas para cada cubculo
o contenedor de los materiales a utilizar.

243

Tcnicas y
tendencias

Obras guas

rea de Arte
contemporneo
ecuatoriano.

La coleccin
consta de 15
obras en un
inicio en altos
y bajo relieves
cada obra con
texturas, olor y
sabor
caractersticos.

Toda la
informacin en
sonido general y
particular.

Paneles
informativos con
sensores, sobre
los autores,
tcnicas y
tendencias.

Elevaciones
en relieves
de las obras,
tendrn
texturas,
olores y
temperatura.

CD de audio
con la
informacin de
la sala de arte
contemporneo
cada autor por
individual.

Ejemplo de alto Relieve.

Todas las estructuras de las representaciones de las obras de arte contemporneo tendrn movilidad mediante ruedas para cambiar su posicin
segn amerite la ocasin.

244

245

TECNICAS Y TENDENCIAS.OBRAS GUAS.-

INFORMACIN EN BRAILLE
Obra nmero 1
Ttulo: Portn
Autor: Jorge Morales
Tamao: 120x100 centmetros
Tcnica utilizada: Mixta

INFORMACIN EN AUDIO
Descripcin de la Obra.Es una imagen que representa el interior de un pasillo o corredor que tiene el piso de
piedra y conecta hacia un lugar con un balcn en el lado de arriba, una puerta del lado
izquierdo, un cuadro y dos plantas con sus respectivas masetas al lado derecho del
fondo. El ambiente es de una representacin de arquitectura civil colonial de interiores
246

y llevada a cabo con tonos calidos y terrosos asemejando una hora de la tarde antes del
ocaso.
En primer plano se encuentra un portal de piedra sostenido a ambos lados por paredes
que reflejan que no son nuevas, en segundo plano tras recorrer un espacio del pasillo de
piedra se encuentra un arco con dos columnas redondeadas a los lados; en el tercer
plano un destello de luz ilumina las piedras del suelo y en el fondo se encuentra la
fachada de una vivienda: un balcn un cuadro, una puerta y dos masetas con sus
respectivas plantas.
MATERIALES A UTILIZAR EN LA ELEVACIN A RELIEVES: arena, piedra,
adobe, agua, plantas, entre otras.

247

INFORMACIN EN BRAILLE
Obra nmero 2.Ttulo: Girasoles
Autor: Wilson Preciado Freire
Tamao: 110 x 70 centmetros
Tcnica utilizada: Mixta
INFORMACIN EN AUDIO
Descripcin de la Obra:
Es una pintura de caballete que representa un bodegn, naturaleza muerta por espacios
de tiempo inanimados; este bodegn es un florero con tres girasoles con delicadas y
contadas ramas y sus respectivas hojas, todo esto esta contenido dentro de un soporte
calido que asemeja a un polgono de 6 lados, el que a su ves sirve de contraste para un
fondo de franjas gruesas horizontales 4 en total de colores calidos y terrosos
entrelazados.
En primer plano se encuentra un florero muy peculiar con lados pronunciados y diseos
de texturas suaves y crculos; del florero salen tres girasoles con sus respectivas ramas y
hojas. En segundo plano un espacio de color calido limitado en forma de un polgono de
6 lados y como fondo cuatro franjas horizontales con diseos y texturas de flores y
hojas.
MATERIALES A UTILIZAR EN LA ELEVACIN A RELIEVES: Girasoles, Vidrio,
hojas secas, ramas, temperatura, entre otras.

248

INFORMACIN EN BRAILLE
Obra nmero 3.Ttulo: Bosque Rosa
Autor: Gabriel Buenao Rugel
Tamao: 150 x 50 centmetros
Tcnica utilizada:
INFORMACIN EN AUDIO
Descripcin de la Obra:
Esta pintura de caballete representa a un pequeo bosque inanimado, sus hojas son de
carcter clido fuerte al igual que los troncos, como fondo un tono general claro en el
centro, el mismo que va oscurecindose mientras llega a las esquinas de la obra.
El primer plano de la obra esta dirigido hacia el rbol del centro del cual salen los
dems rboles hacia los lados en diagonal que van para el fondo. En segundo plano se
encuentra el fondo de tonos clidos que van oscurecindose o manchndose ms hasta
llegar a las esquinas del cuadro.

MATERIALES A UTILIZAR EN LA ELEVACIN A RELIEVES: Hojas, ramas,


temperaturas, telas, arena, entre otros.

249

INFORMACIN EN BRAILLE
Obra nmero 4
Titulo: Rito del sol, rito de la Luna
Autor: Oswaldo Viteri
Tamao: 65 X 81, cm.
Tcnica: Ensamblaje
1986
INFORMACIN EN AUDIO
Descripcin de la Obra:
Esta obra refleja una tcnica diferente, el ensamblaje se trata de la utilizacin de
materiales informales dentro de los cnones establecidos de lo que se considera como
una pintura de caballete.
La obra esta confeccionada con 71 muecos de tela; de tonos clidos fuertes 66 y de
tonos fros 5. Los muecos representan la forma o la silueta individual de indgenas con
sombrero organizados en 4 filas. En la fila ms alta se encuentran situados los muecos
de tonos fros en el centro de la fila, por sobre ellos se encuentra una representacin
abstracta de un sol dentro de un marco de tonos clidos fuertes como fondo y
enmarcado con madera limitando el espacio de los muecos de tela y el espacio del sol /
luna de la obra.
MATERIALES A UTILIZAR EN LA ELEVACIN A RELIEVES: tela, metal,
madera, entre otros.

250

INFORMACIN EN BRAILLE
Obra nmero 5.Autor: Marcelo Aguirre
Titulo: Manos Limpias y sin sangre
Tamao: 2,90 X 3,90
Tcnica: Acrlico
INFORMACIN EN AUDIO
Descripcin de la Obra:
Esta pintura de caballete es la representacin de un rostro y unas manos en posicin de
basta. Existen solo dos planos; en el primer plano se encuentra un sujeto, se aprecia su
rostro desfigurado y un poco amorfo, muestra las palmas de sus manos en seal de
acusacin. En segundo plano esta el fondo de la pintura que es de tono fro. En s la
mayor parte de la obra se encuentra dominada por tonos fros, y cuenta con un carcter
fuerte expresionista.

MATERIALES A UTILIZAR EN LA ELEVACIN A RELIEVES: tela, metal, agua,


ventilador, cobre, ltex, entre otros.

251

INFORMACIN EN BRAILLE
Obra nmero 6.Ttulo: Bodegn
Tcnica: leo.
Autor: Orlando Vera
Tamao: 120 x 60 centmetros
INFORMACIN EN AUDIO
Descripcin de la Obra:
Esta Pintura de caballete representa a un bodegn; en el cual se encuentran dispuestas
dos botellas y una jarra de cristal, verduras, un meln y un aguacate partidos por la
mitad, un limn, 2 granadillas, un racimo de uvas, y lo que parece ser una manzana;
todo esta sobre una mesa que tiene un mantel de lana. La Luz viene desde el lado
izquierdo con fuerza hasta que desaparece por completo del lado derecho del cuadro.
En primer plano se encuentran las frutas: el meln y el aguacate cortados, las uvas, el
limn y las granadillas, en segundo plano los tres objetos o botellas de vidrio y las
verduras acompaadas de la manzana en una esquina; como tercer plano se encuentra la
mesa con su mantel de lana, y en el fondo una pared baada por luz desde la izquierda
hasta encontrar las sombras a la derecha del cuadro.
MATERIALES A UTILIZAR EN LA ELEVACIN A RELIEVES: Frutas, recipientes
de vidrio, manteles, lmpara, olores, entre otros.

252

INFORMACIN EN BRAILLE
Obra nmero 7.Carolina Alfonso de la Paz
Titulo: FEUILLAGE
Tcnica: ACRILICO SOBRE LIENZO
Tamao: 150 X150 cm.
INFORMACIN EN AUDIO
Descripcin de la obra:
Esta pintura de caballete representa mucha fuerza y movimiento tanto en matices como
en la forma de las pinceladas, no se puede hablar de planos por que no existen objetos
claros que diferencien las direcciones de adelante y atrs, es como si todo estuviera en
todos los planos y en ninguno. Esta es una obra que expresa ms emociones que formas,
se la considera expresionista por esa razn.
La obra tiene un movimiento que predomina el cual es circular u ovoide y abarca casi
todo el crculo cromtico en tonos; hacia el centro de la obra se encuentra una diferente
pincelada mucho ms cargada de pintura, pero ms sutil y entorchada.
MATERIALES A UTILIZAR EN LA ELEVACIN A RELIEVES: Cobre, un
ventilador, agua, un dimmer, entre otros.

253

INFORMACIN EN BRAILLE
Obra nmero 8.Autor: Miguel Betancourt
Titulo: "Quito con montaa azul"
Tcnica: leo-camo
Tamao: 50 x 180 cm.
Ao: 2007
INFORMACIN EN AUDIO
Descripcin de la obra:
Esta pintura de caballete representa a una ciudad, a Quito; se aprecian algunas casas que
se unen con otras edificaciones geomtricas (cuadrados, tringulos, rectngulos,
rombos, hexgonos, entre otras); la realizacin de las edificaciones y de las casas hacen
referencia al cubismo, que es la formacin de una misma realidad vista desde diferentes
puntos de partida. Como fondo se encuentran unas montaas de colores fros fuertes, y
tambin alrededor de la mayora de la obra cruzan espacios de colores fros pero ms
suaves.
En primer plano se encuentra la ciudad de Quito representada por construcciones
geomtricas en tonos calidos y tambin en tonos explosivos, como detalles de la obra
se aprecian las diferencias de nivel en el soporte de camo y fragmentos de un famoso
diario del pas. Como fondo estn unas montaas de tonos fros fuertes y entre el primer
plano y el fondo se encuentran tonos fros suaves que entrelazan algunos espacios de la
ciudad y todo el cielo.
MATERIALES A UTILIZAR EN LA ELEVACIN A RELIEVES: Tela, papel,
ventilador, agua, metal, arena, entre otros.

254

INFORMACIN EN BRAILLE
Obra nmero 9.Autor: Roberto Carrera
Titulo: "Tnel"
Tcnica: Arte digital sobre canvas.
Tamao: 120 x 120 cm.
INFORMACIN EN AUDIO
Descripcin de la obra:
Esta obra representa a un espacio de trfico automovilstico dentro de la ciudad, los
carros provienen desde la salida de un tnel, es de noche y se aprecian las luces de los
carros yendo a una velocidad moderada; rodeando a este trfico se encuentran edificios
de colores muy vivos y el tnel desde donde salen los carros poseen tonos ms fros.
La obra transporta nuestros sentidos hacia el centro de ella misma, aqu es en de donde
salen todos los carros, el tnel y las edificaciones que lo rodean solo acentan la
direccin de los carros, que como punto de fuga tienden a salir por la parte inferior
izquierda del cuadro.
MATERIALES A UTILIZAR EN LA ELEVACIN A RELIEVES: carros de plstico,
telas, olores, agua, entre otros.

255

INFORMACIN EN BRAILLE
Obra nmero 10.Titulo: Susy.
Tcnica: Temple sobre cartn
Autor: WASHINGTON MOSQUERA
Tamao: 120 x 80 cm.
INFORMACIN EN AUDIO
Descripcin de la obra:
Esta obra es la representacin de una mujer que esta de pie, ella posa de espaldas
arrimando sus brazos y codos sobre un soporte horizontal, ella lleva puesto un vestido
de tonos clidos fuertes, los cuales sobresaltan por el fondo fro del soporte en donde
ella esta arrimada. Ella se encuentra regresando la atencin hacia el lado derecho del
cuadro.
En el primer plano se encuentra una mujer de pie, posando de espaldas, y con la
atencin fija hacia el lado derecho de la obra, la mujer lleva puesto un vestido de tonos
calidos fuertes, como segundo plano se encuentra un barandal que hace de soporte a la
inclinacin que ella ejerce sobre sus codos y brazos para mantener el equilibrio, este
barandal tiene un mango como de madera y va hasta el suelo contrastando con los tonos
del vestido , el barandal es de tonos fros, como fondo tonos clidos fuertes a manera de
manchas.
MATERIALES A UTILIZAR EN LA ELEVACIN A RELIEVES: Tela, cola
sinttica, cobre, pelo, un dimmer, olor, entre otros.

256

Obra nmero 11.Autor: Dolores Andrade


Ttulo: Extensas, vlidas memorias del lugar
Tcnica utilizada: Madera y piedra
250 X 75 X 35cm
Descripcin de la Obra:
Son dos columnas de madera; la una sobrepasa a la otra en 20 de altura, la otra posee
una roca o piedra de ro de 30 X 18 cm.
Las columnas de madera son paralelas y se encuentran separadas por 50 cm.
Aproximadamente, a la altura de 1,20 m. se encuentra una pieza rectangular de madera
que forma la nica unin de estas dos columnas.
Cada columna posee tres caras lizas en las partes externas, y una sola cara estriada,
asemejando a una persiana de posicin horizontal, la direccin de las franjas esta dada
hacia el centro, hasta la pieza de madera que sirve de unin de las dos columnas. Todo
el conjunto asemeja a una gran H. En su obra se hace presente la contradiccin de
cuanto existe. Ataduras que duelen, nuestros antepasados y Fusin de arcaicas formas
en secretas formas preincaicas.
MATERIALES A UTILIZAR EN LA ELEVACIN A RELIEVES: madera, piedra,
aerosol, entre otros.

257

INFORMACION EN BRAILLE
Obra nmero 12.Autor: Hernn Illescas Coronel
Ttulo: Fantasmagora
Tcnica: leo s/lienzo
Tamao: 85 X 65 cm.
INFORMACIN EN AUDIO
Descripcin de la obra:
Esta pintura de caballete es una representacin que involucra festejo, alegra; los tonos
que se emplean en su mayora son tonos calientes, fuertes y explosivos; como
personajes principales estn un hombre y una mujer, la mujer se encuentra jugando con
una cometa que por poco se la lleva a ella por los aires, el hombre sujeta con sus manos
el hilo que iza a la cometa desde una motocicleta amorfa y sin motor, que se encuentra
sobre un carro o carroza que contiene a un msico tocando el saxofn dentro de un
espacio amoblado. En el fondo se encuentran un sin nmero de texturas y ambientes
geomtricos y amorfos que comunican hacia ms direcciones y ambientes; es un trabajo
muy minucioso logar que todos los ambientes comuniquen una armona entre tonos y
equilibrio, y esta obra lo consigui.
Como primer plano se encuentra un tipo de marco situado en la parte inferior del
cuadro, luego avanzando hacia el segundo plano, se encuentra la pareja que esta
jugando con una cometa sobre una moto la cual esta encima de una carroza que
contiene a su vez a un msico tocando el saxofn en su interior. Este interior cambia de
ambiente tornndose en un espacio amoblado y con espacios luminosos que parecen
ventanas. Como tercer plano se aprecia a una persona acostada en el piso relajadamente,
esta persona esta representada en tonos clidos moderados. En cuarto plano se encuentra
la representacin de un sol con un centro calido y con rayos solares lineales de tonos
fros que enmarcan al astro. Como fondo se encuentran un sin numero de formas y
texturas logradas por el artista de tonos calientes y con salidas clidas y fras.
MATERIALES A UTILIZAR EN LA ELEVACIN A RELIEVES: metales, telas,
papel, madera, un ventilador, cobre, un dimmer, olores, entre otros.
258

INFORMACIN EN BRAILLE
Obra nmero 13.Autor: Enrique Dvila Cobos
Titulo: Memorias
Tcnica: Acrlico s/lienzo
Tamao: 120 X 90 cm.
INFORMACIN EN AUDIO
Descripcin de la obra:
Esta obra es considerada como abstraccionista, consiste en la ausencia de la figuracin
para representar las cosas, a cambio de esto se pueden utilizar smbolos.
Hacia el lado superior derecho se encuentra un crculo con una semiluna, el uno bordea
al otro, los dos smbolos son de tonos clidos; a su alrededor una superficie dividida de
tonos fros y lneas que sugieren direcciones de tonos fros, y en la parte baja derecha
una figura rectangular de tono calido. En esta superficie en el lado superior izquierdo, se
encuentran distribuidas 7 plumas de tonos fros y en la parte baja izquierda de esta
superficie se hallan dos plumas una de tono clido y la otra de tono fro. A manera de
marco de ventana se encuentran tonos clidos encerrando a la superficie del centro; en
la parte inferior de la obra se encuentran diferentes tipos de siluetas de tonos fros
dentro del marco de tonos clidos.

MATERIALES A UTILIZAR EN LA ELEVACIN A RELIEVES: metales, telas,


agua, un ventilador, plumas, arena, entre otros.

259

INFORMACIN EN BRAILLE
Obra nmero 14.Autor: Francisco Coello
Ttulo: Sueos
Tcnica: leo / Tela
tamao: 100 X 120 cm.
INFORMACIN EN AUDIO
Descripcin de la obra:
Esta obra contiene a la representacin de una mujer que parece estar sentada, reposa su
cabeza sobre uno de sus brazos como primer plano. La mujer tiene un vestido de
manchas con tonos frescos y terrosos, la piel de su cara y de sus manos es tersa; posee
un sombrero con un adorno pequeo de una pera con hojas. En la esquina superior
izquierda se encuentra la figura de otra mujer de menor tamao flotando en el aire y
posando con las manos en los bolsillos. En la esquina inferior derecha se encuentra tres
personas paradas como manteniendo una conversacin de algo. El fondo es de tonos
terrosos y fros suaves.
MATERIALES A UTILIZAR EN LA ELEVACIN A RELIEVES: telas, yeso,
porcelana, muecos de humanos a escala, un sombrero, un maniqu, un pera de plstico,
olores, entre otros.

260

INFORMACIN EN BRAILLE
Obra nmero 15.Ttulo: Amor Eterno
Autor: Alfonso Vsquez
Tamao: 90x110 centmetros
Tcnica utilizada: Mixta
INFORMACIN EN AUDIO
Descripcin de la obra:
Es una pintura de caballete que ilustra a una mujer con un nio dentro del horizonte de
un paisaje de ciudad y de montaas en la noche; dentro del primer plano se encuentra un
pjaro que parece ser un colibr volando sobre una ciudad con una flor de forma
estrellada en su pico; Compartiendo el primer plano resaltan las cabezas de la mujer y
del nio con su largos cuellos, cobijados por una misma mantilla o tul, los rostros de
los personajes son de tonos clidos no poseen globos oculares solo oquedades, su boca
es viva y su expresin es impvida vista singularmente, pero en conjunto expresa
ternura.
En segundo plano se encuentra una ciudad conformada por destellos de luz en la noche
y algunas montaas a lo lejos. Como fondo esta el espacio oscuro y destellos que
asemejan a las estrellas.
MATERIALES A UTILIZAR EN LA ELEVACIN A RELIEVES: madera, arcilla,
metales, un ventilador, plumas, tela, entre otros.

261

262

Juegos

recreacin

rea
recreativa

Reglas de los
juegos

Se utilizan
las reas
verdes del
museo.

Piscina de
pelotas, ftbol,
cartas, entre
otros.

JUEOS Y RECREACIN.Para acceder a las reas recreativas solo se tiene que seguir con el recorrido de la exposicin, una vez afuera se puede escoger hacia que parte en
particular se quiere ir a las canchas de ftbol, a una plaza, a caminar por el bosque, a la cafetera, o a una piscina de pelotas, en toda el rea de
recreacin hay personal correctamente preparado para prestar los servicios adecuados al visitante.

263

Programacin de
citas.
Creacin de
fichas de salud

Sociedades y
rea de
fundaciones que informacin
trabajan con
personas
discapacitadas.

COSTA

recreacin

rea
recreativa

Folletos en braile
y audio de las
instituciones.

Simulacin de
una playa con
mar.

Sonidos del mar.

Se trabajar en
conjunto con
personal
operativo de las
instituciones
implicadas.

Se utilizan
las reas
verdes del
museo
donde se
encuentra el
domo.

264

INFORMACION AL VISITANTE:
En esta rea del museo se trabajar especialmente con gente del C.O.N.A.D.I.S.
(Concejo Nacional de Discapacidades) para llevar un trabajo de interaccin en conjunto
con el Gobierno Nacional, se necesitar de esta manera las bases de datos de las
personas con carn, para crear el programa de citas entre personas con discapacidad
visual. As como tambin se trabajar con sus folletos de avance y programas en
ejecucin para el desarrollo social de las personas con discapacidad visual.

COSTA:
Esta rea ubicada en la parte recreativa del museo esta dirigida a las personas que por
razones diferentes no conocen el mar o la regin de la costa; esta es un simulacin de
los ambientes y climas que se producen en la costa ecuatoriana con sonidos del mar, la
gente, la fauna, entre otros; existir agua salada y arena. Todo esto cubierto por un
domo traslucido de considerable formato.

212

COSTOS DE LAS REPRESENTACIONES ESCULTRICAS Y REPLICAS


Los materiales a ser utilizados en la creacin de las replicas son:
MATERIAL
COSTO
Madera
20
Yeso
5
Arena
2
2 Laminas de Cobre 20 x 20 cm
40
Ventilador redondo de 10 cm de dimetro
80
1 dimmer (regulador de voltaje)
110
Esencias aromticas
20
1 Tela m2
10
Niquelinas
8
Resinas Acrlicas
80
Dispositivo de audio y audfonos
100
TOTAL
475 USD
A esto se le debe sumar lo que cobrara un artista por realizar la replica; esto depende
de la calidad del artista; un costo mnimo de 400 dlares.
En total una rplica de 1 x 0,80 metros costara 875 dlares.
Cabe mencionar que de acuerdo al tamao de la obra original el gasto y la utilizacin de
los materiales cambia, lo mismo sucedera con el precio. Se tomo como estndar y solo
para dar una idea del costo una replica de 1 X 0,80 metros. Con representacin de
colores clidos y fros.
Los materiales que se utilizarn para la creacin de las representaciones escultricas
son:
MATERIAL
Madera
Cera
Resinas Acrlicas
Fibra de vidrio
Tela 2m2
Pelo
Niquelinas
30 laminas de cobre de 20 x 20 cm
Ruedas
Dispositivo de audio y audfonos
Esencias aromticas
Plumas

COSTO
40
120
150
60
20
30
120
600
20
100
20
10

TOTAL

1290 USD

A esto se le debe sumar lo que cobrara un artista por realizar una escultura de 1,80 m
de alto; esto depende de la calidad del artista; un costo mnimo de 2000 dlares.
En total una representacin escultrica de 1,80 metros costara 3290 dlares.

213

El costo y la cantidad de materiales a utilizarse esta resuelto solo para una


representacin escultrica, la cual esta constituida por un solo cuerpo de tamao natural
con restos humanos a su alrededor.

214

3.4.- PROPUESTA DE ADECUACIN PARA NO VIDENTES EN EL MUSEO


CAMILO EGAS
La siguiente propuesta de adecuacin y adaptacin del museo Camilo Egas para
visitantes con discapacidades visuales y en silla de ruedas, est realizada para superar
ciertas barreras fsicas que posee el inmueble as como tambin para implementar
nuevos elementos museogrficos que alcancen ms lenguajes y escrituras para ampliar
la comunicacin y difusin de las obras del museo hacia ms personas, en este caso en
particular la comunidad con discapacidad visual.
Justificacin: Se escogi el Museo Camilo Egas por que posee una serie de barreras
fsicas y museolgicas consideradas como el comn denominador dentro de los museos
de la ciudad de San Francisco de Quito para un visitante discapacitado visual.
Viabilidad.- La propuesta de adecuacin para el museo cuesta alrededor de $ 31500
dlares si se mantienen los precios de lo requerido en el mercado local.
Otra alternativa es tomar partes de la propuesta y no la totalidad segn el inters del
museo. Por lo tanto se considera de bastante viabilidad para ser ejecutada.
Objetivos:
Fomentar el inters del arte aplicado al desarrollo del sistema social.
Lograr que el museo tenga las facilidades de acceso para el pblico
discapacitado en General.
Recontextualizar los elementos Museogrficos, para el uso de visitantes
que posean cualquier tipo de discapacidad visual.
Expandir los alcances del Museo.
Informacin General:
El Banco Central del Ecuador crea en los ochenta el Museo Camilo Egas en honor a este
artista ecuatoriano del siglo XX. En el ao 2003 se renueva el museo y se incorporan
actividades educativas a dems de poner en valor la obra del artista Camilo Egas. La
exposicin permanente permite conocer las diferentes etapas en las que trabaj el
artista. Destacan el Indigenismo, el expresionismo, el surrealismo, el cubismo y la
abstraccin total de la figura.

Ubicacin: Venezuela 1302 y Esmeraldas.

273

- Tipologa de la edificacin.: Categora b: Edificaciones de inters especial y atpicas


de importancia.
- Sistema constructivo: Colonial; Mixto Piedra, ladrillo y Adobe (Arquitectura Civil).
- Estado de la edificacin: Muy bueno
- Grado de intervencin: Conservacin Restauracin.
- Usos de suelo posibles. Usos de tipo cultural, de recepcin, organizaciones
comunitarias.

Servicios que Ofrece:

Talleres gratuitos y didcticos de grabado y artes manuales.


Actividad llamada Extramuros, la cual lleva fuera del museo la obra de Camilo Egas.

Instalaciones:
El Museo Camilo Egas cuenta con dos plantas arquitectnicas; En la primera planta se
encuentra: un rea de recepcin e informacin, 2 salas de exposicin, una sala de
transito de obras con una representacin del taller del maestro Camilo Egas, un patio
central donde funcionan talleres didcticos y bateras sanitarias. En la segunda planta se
encuentra: dos salas de exposicin, una oficina de seguridad, y el rea de
administracin.

274

Planta Baja

Segunda Planta.
Inconvenientes actuales:
ACCESIBILIDAD EXTERNA:
La entrada del museo se encuentra en la calle Venezuela como se puede apreciar es en
una subida y existe una grada con diferentes alturas.

275

ACCESIBILIDAD INTERNA:
Existen dos maneras de ingresar al Museo Camilo Egas la una es a la izquierda de la
entrada del edificio subiendo dos gradas de 39 grados de inclinacin y la otra entrada
para personas discapacitadas que se encuentra cruzando recto desde la entrada del
Inmueble donde se encuentra una reja de metal . Esta entrada sabe estar obstaculizada
por paneles informativos.

276

.
Entrada 1

Entrada 2.

A continuacin de la entrada principal se encuentra la recepcin del museo y en la


misma galera se encuentra implantada la primera muestra de la coleccin del maestro.

Esta sala de exposicin es pequea de tamao considerando que esta unida a la


recepcin (6,40 X 4,22 m.).
277

Saliendo de la Sala nos encontramos con dos salidas la una conecta al visitante con otra
sala de exposicin y la otra con dos corredores y un patio, este ultimo utilizado como
espacio para talleres.

Corredor del patio central y salida de la primera rea de exposicin.

Patio y fuente.

Sala de exposicin.
Saliendo de la Sala de exposicin se encuentra en otro cuarto una recreacin del taller
del maestro y un pasillo con espejos metlicos muy angosto imposible la entrada de
278

una persona en silla de ruedas; a continuacin de esto unas gradas de madera con 45
grados de inclinacin que comunican al visitante hacia la segunda planta.

Taller

Espejos o lminas de metal

Gradas para acceder a la segunda planta.


El museo no cuenta con ascensor; las gradas son la nica va para acceder a la segunda
planta.
En la segunda planta se encuentran dos salas de exposicin, el rea de administracin y
una oficia de seguridad.

279

Corredor que comunica a las salas de exposicin.

Salas de exposicin.

Sala de exposicin
CIRCULACIN:
Para la Circulacin dentro del Museo existe un ritmo, el cual nunca va a ser conocido
por los discapacitados visuales a menos que los guen del brazo, dentro de las salas de
exposicin de la planta baja no hay muchos inconvenientes, pese al reducido espacio
disponible se pueden realizar giros en sillas de ruedas; saliendo de las salas existe un
280

patio central con mesas para talleres didcticos al cual se accede al bajar una grada de
13 cm., para llegar a la segunda planta hay problemas con las gradas en el caso de ser
una persona en silla de ruedas.

Obras en Exposicin:
Ya que por normativas del Museo esta prohibido tocar las obras, el visitante
discapacitado visual nunca va a poder encontrar una evocacin entre lo que escucha de
los guas del museo y el objeto en exposicin como tal.
Esto crea un desnivel involuntario por parte del museo hacia su transmisin de
informacin a los visitantes.
El Museo cuenta con bateras sanitarias inadecuadas para discapacitados fsicos con un
grado de discapacidad avanzada.

SOLUCIONES PLANTEADAS:
Accesibilidad Externa:
1. Despejar la otra entrada para el ingreso de personas con sillas de ruedas.
2. Hacer una rampa desde la calle a la entrada del edificio. O realizar una rampa
mvil de madera y caucho.
Para la Circulacin en las salas de exposicin se recomienda unos pasamanos que vayan
circunvalando frente a todas las obras y que los lleve a las siguientes salas, cuando el
visitante pase por cada obra encontrara un dispositivo de accin, el cual al oprimirse ira
describiendo detalladamente la obra que esta frente a el. Este dispositivo de audio
permite adelantar y retroceder al gusto del visitante.

Dispositivo

Pasamanos para guiar la circulacin.

Para las personas en sillas de ruedas y con discapacidad visual que no puedan acceder a
los pasamanos, existirn dispositivos de audio a la altura de 1,20 m. en el rea de
recepcin que sern entregados al inicio de la exposicin. Estos dispositivos a dems de
281

ser porttiles tienen la ventaja de poseer sensores de reconocimiento para cuado estn en
frente de las obras desplegar la informacin de la obra que este en frente.
Los dispositivos de audio que maneja el visitante recibirn una seal de cada una de las
obras las cuales tendrn un circuito emisor por singular que se activa a 1, 00 m. de
distancia del dispositivo de audio con integrales (receptor-emisor) el cual despliega la
informacin de la obra en cuestin al visitante.

obra 1
Dispositivo
deaudio
porttil

3m.
obra 2

obra 3
1m.

Para los accesos a la segunda planta ser necesaria la implementacin de un pequeo


ascensor que funciona con electricidad y un motor del combustible a convenir, con la
entrada en direccin al patio central, el lugar se da a eleccin del personal
administrativo del museo; la intencin esta bien lograda cuando se hace de la manera
ms discreta sin que signifique una distraccin u obstculo para los dems visitantes
del museo. La plataforma en cuestin mide 1,50 X 1,00 m. su instalacin necesita una
perforacin de 1,30 por debajo del nivel normal, y cuesta alrededor de 12.000 USD.

282

Una vez que los primeros inconvenientes de circulacin han sido resueltos ahora si se
proceder a actuar dentro del campo museogrfico del museo:
1. Se realizarn cedulas informativas en Braile a la altura de 1,20 m. de preferencia
cercanas a la obra en cuestin. Y as en todas las obras de la exposicin. Las
cdulas sern construidas en fibras acrlicas.
2. Los paneles informativos tendrn su equivalente en audio general y particular
segn sea el caso.

3. Ya que dentro de las temticas y estilos del pintor ecuatoriano se encuentra


contextualizadas ideas generales, se proponen hacer una representacin por
estilo en altos y bajos relieves que puedan ser mviles para mayor bienestar
tanto de los visitantes como del personal operativo del museo. son 5 estilos en
total: el Indigenismo, el expresionismo, el surrealismo, el cubismo y la
abstraccin total de la figura. Existen varios tipos de movilidad de las replicas:
El uno de arriba hacia abajo y viceversa, otro de izquierda a derecha siempre
dentro de ejes suspendidos de las paredes. Otro tipo de replica de la obra que va
asentada en el suelo pero con ruedas para el uso de personas en sillas de ruedas.

283

Movimientos

Motor

Motor

Obraen
relieve.

Tipo de obra 1

Ruedas

Tipo de obra 2

4. Los talleres de grabado que da el museo permanecern de la misma manera, pero


con pequeos cambios de informacin acerca de la estimulacin tctil en los
diferentes procesos de grabado.
5. Las bateras sanitarias sern readecuadas en el espacio disponible, y tendrn
pasamanos para el uso de discapacitados fsicos.
284

COSTOS DE LA PROPUESTA DE ADECUACIN


Dispositivos de audio y audfonos
Dispositivos de audio porttiles
Circuitos emisores
Circuitos Integrados
Pasamanos
Rplicas de obras mviles (3)
Rplicas de obras en relieve (2)
Montaje Museogrfico
Bateras Sanitarias
Ascensor

2000
1000
400
800
1400
2700
2500
5000
3700
12000

Total

31500 USD

285

CONCLUSIONES

La historia personal de una persona con discapacidad, denota una lucha continua
contra la adversidad, con una confrontacin social constante, a todas las edades
y a todos los niveles. De ah la importancia de poder establecer programas de
servicios dentro de los museos de acuerdo a los recursos tcnicos y al avance
cientfico, de propiciar mayores opciones y oportunidades educativas. Para
lograr el cambio de actitud de la misma de la sociedad en su conjunto para que
esta sea ms justa y ms comprensiva, fomentando una cultura de apoyo al
discapacitado, comprometida moralmente con las personas discapacitadas para
ayudarlas, respetando y defendiendo los derechos humanos como seres humanos
que somos todos.

El porcentaje de los visitantes discapacitados en general a los museos es mnimo,


el 2% del nmero total de visitantes al ao (de 1 a 10 personas); este hecho
produce un pensamiento de balanza de intereses, en el cual los museos privados
de Quito prefieren no hacer los gastos necesarios para adecuar sus instalaciones
y elementos museogrficos para un correcto trato a los visitantes discapacitados
dado que la inversin no equivale al valor recuperado, lo que seria una perdida
econmica indudable.
El acercamiento del pblico discapacitado visual al museo depende del museo,
de las capacidades de este para dar al visitante discapacitado visual los
adecuados servicios y trato, como el que se da al pblico en general. Adems de
una publicidad acertada y especfica.
Los museos de Quito, en particular la mayora que se hallan en el centro
histrico poseen grandes barreras fsicas y limitaciones de accesibilidad, algunas
de estas barreras son imposibles de alterarse o cambiar si se considera el valor
intrnseco e inalterable de los inmuebles. Pero tambin se debe pensar en que si
no se preserva al creador de cultura, el hombre; no habr objetos ni creaciones
que preservar luego.
La experimentacin museogrfica es un reflejo de las realidades sociales y
culturales de nuestro pas y un medio importante para el desarrollo de los
museos de Quito.
Segn los estudios realizados en esta tesis el personal o los recursos humanos de
planta con los que cuentan los museos no son suficientes para abastecer las
necesidades de los visitantes discapacitados en referencia al manejo de sistemas
alternativos de lenguajes y transmisin de la informacin; la capacitacin y el
aumento del personal operativo es necesaria para afrontar este hecho.

286

El 95,45 % de los museos e instituciones participantes en este estudio, no


incluyen a los discapacitados visuales dentro de sus planes y guiones
museolgicos. Esto significa sencillamente que; estos visitantes no pueden
aprovechar la informacin brindada por los museos de una manera ptima. (ver
anexo 3)
El 95,45 % de los museos e instituciones participantes en este estudio, no
incluyen a los discapacitados visuales dentro de sus planes y guiones
museogrficos. Esto significa que: los visitantes discapacitados visuales no
podrn aprovechar la informacin brindada por estas instituciones de una
manera ptima. (ver anexo 3)
El 60 % de las instituciones participantes en este estudio, no presentan
problemas, en cuanto al acceso de una persona discapacitada visual y en silla de
ruedas al edifico en donde funciona el museo. (ver anexo 3)
El 31 % de las instituciones participantes en este estudio, si presentan
problemas, en cuanto al acceso de una persona discapacitada visual y en silla de
ruedas al edificio en donde funciona el museo. (ver anexo 3)
El 95 % de los museos participantes en este estudio no poseen una
infraestructura adecuada para la circulacin interna de un visitante discapacitado
visual y en silla de ruedas; dentro este 95 %, el 50 % poseen problemas para la
circulacin como gradas con un gran ngulo de inclinacin y espacios de
exposicin muy angostos los cuales impiden un giro de una persona en silla de
ruedas. Para el 36 % de las instituciones es imposible el acceso de una persona
discapacitada visual y en silla de ruedas a ciertos lugares como campanarios y
coros altos en iglesias y conventos. (ver anexo 3).
El 95,45 % de las instituciones participantes en este estudio no poseen unas
bateras sanitarias adecuadas para el uso de un visitante discapacitado visual y en
silla de ruedas.
La Creacin del Museo Discart Mind Eyes Museum apoyar con un gran avance
cultural para los visitantes discapacitados, y los encaminar hacia un mejor
dialogo e insercin social con el entorno Contemporneo de los ecuatorianos por
medio del arte.
La Creacin del Museo Discart Mind Eyes Museum impulsara la realizacin de
investigaciones y apoyara en la coordinacin de las labores de los organismos y
entidades de los sectores pblicos y privado a los que compete la prevencin o
atencin de discapacidades o la integracin social de las personas con
discapacidad en actividades culturales.

La Creacin del Museo Discart Mind Eyes Museum afirmara lazos y estara
respaldada por el Ministerio de Educacin en cuanto a Incorporaciones al
287

Sistema de educacin integrada y especial con actividades relacionadas con el


ocio, recreacin, tiempo libre, arte, deporte y cultura.

Las siguientes leyes y derechos de los discapacitados no son cumplidas en los


museos de Quito:
LEY SOBRE DISCAPACIDADES
De los deberes y los derechos
ART. 19
Literal a) Accesibilidad.- Se garantiza a las personas con discapacidad la accesibilidad y
utilizacin de bienes y servicios de la sociedad, evitando y suprimiendo barreras que
impidan o dificulten el normal desenvolvimiento e integracin social. En toda obra
pblica que se destine a actividades que supongan el acceso de pblico, debern
preverse accesos, medios de circulacin, informacin e instalaciones adecuadas para
personas con discapacidad. La misma previsin deber efectuarse en los edificios
destinados a empresas privadas de servicio pblico, en los que exhiban espectculos
pblicos y en las unidades sociales y recreativas para su uso comunitario, que en
adelante se construyan reformen o modifiquen.
Los municipios, con asesora del Consejo Nacional de Discapacidades y el Instituto
Ecuatoriano de Normalizacin (INEN), dictarn las ordenanzas respectivas que
permitan el cumplimiento de este derecho; las que establecern sanciones y multas por
la inobservancia de estas normas. Adicionalmente, los municipios establecern un
porcentaje en sus presupuestos anuales para eliminar las barreras existentes.

Literal f) Accesibilidad a la comunicacin.


LEY SOBRE DISCAPACIDADES N 180
Art. 6. INTEGRACION SOCIAL.- Se orienta a la equiparacin de oportunidades para
satisfacer las necesidades sociales de las personas con discapacidad, a travs de medidas
como las siguientes:
a) Sensibilizacin a la familia y la comunidad sobre los derechos de las personas con
discapacidades,
b) Eliminacin de barreras fsicas, psicolgicas, sociales y comunicacionales:
k) Fomento de las actividades culturales, deportivas, recreacionales, de las personas con
discapacidades.

288

RECOMENDACIONES

Al momento de escoger un rea para la creacin fsica del museo se recomienda


un parque grande en una zona central de la ciudad o los espacios del aeropuerto
cuando este se cambie a la localidad de Tababela.
El material del cual deben ser fabricadas las cdulas debe ser resistente a usos
repetitivos y de presin moderada, se recomienda: acrlico, policarbonato, y en
ciertos casos metal suave como cobre, aluminio, entre otros.
Cuando estemos frente a frente con una persona con discapacidad visual, se debe
abordarlo con normalidad y justicia para evitar distanciamientos y vacos en la
comunicacin.
Se recomienda a los directores de los museos de la Ciudad de Quito implementar
cdulas en Braille en la informacin de sus Colecciones.
Se recomienda durante visita a este museo hacerlo mximo en grupos de 6
personas por recorrido para evitar caos y aglomeraciones.

289

Anexo 1

Este anexo comprende artculos y normativas, deberes y derechos de una persona


discapacitada y su estrecha relacin con la educacin, facilidades de acceso en
edificios pblicos y privados, reinsercin social y laboral, as como tambin
organismos que intervienen en la planificacin desarrollo y control de proyectos.
Se incluyen cdigos, leyes y reformas hasta el ao 2006, previamente depuradas en
relacin a la tesis propuesta como apoyo a la organizacin social.
CODIGOS, LEYES Y ESTATUTOS EN TORNO A LAS PERSONAS CON DISCAPACIDAD.
CONGRESO NACIONAL DE ECUADOR:
EL PLENARIO DE LAS COMISIONES LEGISLATIVAS
Considerando:
Que es obligacin del Estado ejecutar acciones tendentes a prevenir y atender los problemas de discapacidades y
procurar la integracin social de las personas con discapacidad
Que para ello es necesario actualizar la legislacin vigente en materia de discapacidades;
Que se requiere coordinar las acciones que los organismos y entidades de los sectores pblicos y privados realizan
para atender los problemas relacionados con las discapacidades; y,
En ejercicio de sus atribuciones constitucionales expide la siguiente
LEY SOBRE DISCAPACIDADES N 180
Art. 1.- El objetivo de la presente Ley establece un sistema de prevencin de las discapacidades, de atencin e
integracin de las personas con discapacidades, que les permita equiparar las oportunidades para desempear en la
comunidad un rol equivalente que ejercen las dems personas.
Art. 2. PERSONAS AMPARADAS- Esta ley ampara a todas las discapacidades sensoriales fsicas y mentales sea por
causa gentica, congnita o adquirida, quienes gozarn de sus beneficios.
Art. 3. ALCANCE.- La presente Ley abarca todo lo relativo a prevencin, Atencin a la integracin social de las
personas con discapacidad.
Art. 4. PREVECION- La prevencin de discapacidades est relacionada con todas las medidas preventivas destinadas
a:
a) Reducir la aparicin de deficiencias (prevencin primaria);
b) Limitar o anular la incapacidad producida por la deficiencia (prevencin secundaria)-. y,
c) Prevenir la transicin a discapacidad o minusvalidez (prevencin terciaria).
Art. 5. ATENCION- La atencin comprende todas las medidas de salud, educacin y bienestar social, orientadas a
reducir los efectos de las afecciones que producen discapacidad, para facilitar a las personas con discapacidades su
integracin social a travs de:
a) Deteccin oportuna;

168

b) Atencin precoz y eficaz:


e) Rehabilitacin mdico-psicopedaggica, institucional y/o comunitaria:
d) Educacin regular y especial a travs de sus diferentes modalidades: y,
e) Formacin, capacitacin y perfeccionamiento de personal especializado para la prevencin y atencin de las
discapacidades.
Art. 6. INTEGRACION SOCIAL.- Se orienta a la equiparacin de oportunidades para satisfacer las necesidades
sociales de las personas con discapacidad, a travs de medidas como las siguientes:
a) Sensibilizacin a la familia y la comunidad sobre los derechos de las personas con discapacidades,
b) Eliminacin de barreras fsicas, psicolgicas, sociales y comunicacionales:
e) Formacin, readaptacin, capacitacin, restitucin o reubicacin ocupacional en relacin al mercado laboral formal
o informal:
Art. 7. CONSEJO NACIONAL DE DISCAPACIDADES. Crase con sede en la ciudad de Quito el Consejo
Nacional de Discapacidades, como persona jurdica de derecho pblico con autonoma operativa, patrimonio propio y
presupuesto especial.
El Consejo ejerce sus atribuciones a nivel nacional y se encarga de dictar las polticas generales en materia de
discapacidades, impulsar y realizar investigaciones y coordinar las labores de los organismos y entidades de los
sectores pblico y privado a los que compete la prevencin o atencin de discapacidades o la integracin social de las
personas con discapacidad.
Art.- 10. FUNCIONES Y ATIRIBUCIONES DEL DIRECTORIO.- El Directorio ejercer las siguientes funciones y
atribuciones:
f) Requerir a las entidades u organismos de los sectores pblico o privado la entrega de informacin y la colaboracin
en la ejecucin de actividades relativas a discapacidades;
Art. 12. FUNCIONES Y ATRIBUCIONES DEL DIRECTOR EJECUTIVO.- Son funciones y atribuciones del
Director Ejecutivo:
e) Coordinar y supervisar las actividades de Prevencin, atencin e integracin social que se realicen a nivel nacional
para verificar la ejecucin del Plan Nacional de Discapacidades y del Plan Operativo Anual;
d) Mantener registros a nivel nacional de personas con discapacidad y de instituciones pblicas y privadas dedicadas
al trabajo en el rea de las discapacidades:
Art. 14. CENTRO DE INFORMACION.- El Consejo Nacional de Discapacidades mantendr, para el cumplimiento
de sus fines y para servicio al pblico, un centro de informacin y documentacin en materia de discapacidades.
Art. 15. PATRIMONIO.- Integran el patrimonio del Consejo:
a) Las asignaciones que se harn constar obligatoriamente en el Presupuesto General del Estado;
b) El cinco por ciento del Porcentaje contemplado en la letra b) del artculo 98 del Cdigo del Trabajo:
e) El veinticinco por ciento de las multas que se impusieren por falta de medidas de seguridad e higiene laboral; y,
d) Los dems bienes y recursos que adquiera, en el futuro, a cualquier ttulo.
Art. 16. CALIFICACION DE DISCAPACIDADES.- Para efectos de esta Ley, la calificacin de las discapacidades la
realizar el Ministerio de Salud, a travs de sus unidades autorizadas. En el caso de afiliados y jubilados del Instituto
Ecuatoriano de Seguridad Social y de miembros de las Fuerzas Armadas, la calificacin la harn las unidades

169

autorizadas del Instituto de Seguridad Social y del Instituto de Seguridad Social de las Fuerzas Armadas,
respectivamente.
En el Reglamento de esta Ley se establecern las normas que deben seguirse para la calificacin, as como los
requisitos necesarios para que las personas con discapacidad puedan acogerse a los beneficios que se les concede.
El certificado de discapacidad, ser documento nico y suficiente para acreditar la discapacidad en los casos en que
sea necesario invocarla.
Art. 17. FACILIDADES EN EL TRANSPORTE.- Las empresas de transportes debern contar con unidades libres de
barreras y obstculos para garantizar el fcil acceso y circulacin en su interior de las personas con discapacidad. Se
conceder tarifas especiales o la gratuidad de la transportacin de personas con discapacidades, y se reglamentar las
comodidades que deben otorgarse. Solo se requerir el certificado al que se refiere el artculo anterior para acceder a
este beneficio.
Art. 18. FACILIDADES EN CONSTRUCCION DE OBRAS.- En toda obra pblica que se destine a actividades que
supongan el acceso de pblico y que se ejecute con posterioridad a la vigencia de la presente Ley, debern proveerse
accesos, medios de circulacin e instalaciones adecuadas para personas con discapacidad. La misma previsin deber
efectuarse en los edificios destinados a empresas privadas de servicios pblicos y en los que exhiban espectculos
pblicos, que en adelante se construyan, reformen o modifiquen. De la misma manera se tomarn en cuenta estas
medidas de proteccin en la construccin y adecuaciones de unidades sociales y recreativas para uso comunitario. La
reglamentacin establecer el alcance de la obligacin impuesta en este artculo, atendiendo a las caractersticas y
destino de las construcciones referidas.
Art. 26. REFORMA A LA LEY DE CONTRATACION PUBLICA.- Al final de la letra g) del artculo 17 de la Ley
de Contratacin Pblica, en lugar del punto y coma pngase punto y agrguese el siguiente texto: "En el caso de
obras pblicas que se destinen actividades que supongan el acceso de pblico, en el diseo definitivo deber
contemplarse la existencia de accesos, medios de circulacin e instalaciones adecuadas para personas con
discapacidad.
Art. 28. DEROGATORIA: Derogase todas las normas legales que se opongan a lo previsto en esta Ley: y,
expresamente la Ley de Proteccin del Minusvlido, publicada en el Registro Oficial N 301 del 5 de agosto de 1982,
y todas sus reformas.
ARTICULO FINAL.
La presente Ley entrar en vigencia de la fecha de su publicacin en el Registro Oficial.
Dado en la ciudad de Quito, en la sala de sesiones del Plenario de las Comisiones Legislativas, a los veintinueve das
del mes de julio de mil novecientos noventa dos
f.) Dr. Fabin Alarcn Rivera. Presidente, del H. Congreso Nacional.

Cdigo de Trabajo
Ley Reformatoria al Cdigo del Trabajo
Articulo 42
"33.- El empleador pblico o privado, que cuente con un nmero mnimo de veinticinco trabajadores, est obligado a
contratar, al menos, a una persona con discapacidad, en labores permanentes que se consideren apropiadas en relacin
con sus conocimientos, condicin fsica y aptitudes individuales, observndose los principios de equidad de gnero y
diversidad de discapacidad, en el primer ao de vigencia de esta Ley, contado desde la fecha de su publicacin en el
Registro
Oficial.
(...)
Esta obligacin se hace extensiva a las empresas legalmente autorizadas para la tercerizacin de servicios o
intermediacin laboral.

170


CODIFICACINDELALEYVIGENTESOBREDISCAPACIDADESENELECUADOR
viernes6deabrilde2001

LeysobreDiscapacidadesdelEcuador

PrincipiosyObjetivos

ElConsejoNacionaldeDiscapacidades
DelPatrimonio,RentasyDestinodelosFondos

DelaCobertura

DelosDerechosyBeneficios

DelosProcedimientosySanciones

H. CONGRESO NACIONAL
LA COMISIN DE LEGISLACIN Y CODIFICACIN
En ejercicio de la facultad que le confiere el numeral 2 del artculo 139 de la Constitucin Poltica de la Repblica,
Resuelve:
EXPEDIR LA CODIFICACIN DE LA LEY SOBRE DISCAPACIDADES
PRINCIPIOS Y OBJETIVOS
Art. 1. - MBITO. - La presente ley protege a las personas con discapacidad; establece un sistema de prevencin de
discapacidades, atencin e integracin de personas con discapacidad que garantice su desarrollo y evite que sufran
toda clase de discriminacin, incluida la de gnero.
Art. 2. - PRINCIPIOS. - Esta ley se fundamente en el principio constitucional de igualdad ante la ley, y en lo
establecido en los artculos 23, 47, 53 y 102 de la Constitucin Poltica de la Repblica.
Art. 3. - OBJETIVOS. - Son objetivos de esta ley:
a) Reconocimiento pleno de los derechos que corresponden a las personas con discapacidad;
b) Eliminar toda forma de discriminacin por razones de discapacidad y sancionar a quienes incurrieren en esta
prohibicin;
c) Establecer un sistema de prevencin de discapacidades;
d) Crear mecanismos para la atencin e integracin social de las personas con discapacidad atendiendo las
necesidades particulares de cada sexo; y,

171

e) Garantizar la igualdad de oportunidades para desempear un rol equivalente al que ejercen las dems personas y la
participacin equitativa de hombres y mujeres en las instancias de decisin y direccin.
Art. 4. - INTEGRACIN SOCIAL - El Estado a travs de sus organismos y entidades garantiza el pleno ejercicio
de los derechos que la Constitucin y las leyes reconocen a todas las personas con discapacidad, mediante las
siguientes acciones:
a)Sensibilizacinyconcientizacindelasociedadylafamiliasobrelasdiscapacidades,losderechosydeberesdelas
personascondiscapacidad;
b)Eliminacindebarrerasfsicas,psicolgicas,socialesycomunicacionales;
c)Formacin,capacitacineinsercinenelsectorlaboralformaleinformal;ascomo,otrasmodalidadesde
trabajo,pequeaindustriaymicroempresa,talleresprotegidos,trabajoeneldomicilio,autoempleo,etc.;
d)Adaptacin,readaptacin,restitucinyreubicacinlaboraldelostrabajadoresqueadquieranladiscapacidad
comoproductodeenfermedadesprofesionales,accidentesdetrabajouotrascausas,tantoenelsectorpblico
comoprivado;
e)Concesindebecasparaeducacin,formacinprofesionalycapacitacin;
f)Concesindesubsidiosparaaccedera:serviciosdesalud,vivienda,asistenciatcnicayprovisindeayudas
tcnicasytecnolgicas,atravsdelosorganismospblicosyprivadosresponsablesdelasreasindicadas;
g)Tratamientopreferenteenlaobtencindecrditosatravsdelasinstitucionesdelsistemafinanciero;
h)Elaboracinyaplicacindelanormativasobreaccesibilidadalmediofsicoenlasedificacionespblicasy
privadasdeusopblico,acargodelosmunicipios;
i)Impulsoalosservicios(necesarios)paraladotacin,fabricacin,mantenimientoodistribucindertesis,prtesis
yotrasayudastcnicasytecnolgicas,quesuplanocompensenlasdeficiencias.Lasayudastcnicasytecnolgicas
sernentregadasobligatoriamenteporelEstadoylasinstitucionesdeseguridadsocial,directamente,bajo
convenioocontratoconotrasinstitucionespblicasoprivadas;
j)Disponer,atravsdelMinisteriodeSaludPblica,laproduccinydistribucindemedicamentosgenricosy
esenciales,ademsdelosinsumosquesenecesitenparalaatencindedeficienciasydiscapacidadesquerequieran
deuntratamientoprolongado;
k)Fomento,cooperacinyapoyoalasactividadesculturales,deportivasyrecreacionalesdelaspersonascon
discapacidad,atravsdeprogramasdeintegracinyotrosespecficosaquehubierelugar;
l)Crearresidenciasparapersonascondiscapacidadquenopuedenvalerseporsimismas;y,
m)Fortalecimientoyapoyoalasorganizacionesdeyparapersonascondiscapacidad.

EL CONSEJO NACIONAL DE DISCAPACIDADES


Art. 5. - CONSEJO NACIONAL DE DISCAPACIDADES. - El Consejo Nacional de Discapacidades CONADIS - , con domicilio principal en la ciudad de Quito, es una persona jurdica de derecho pblico, autnoma,
con patrimonio y presupuesto propio.
Art. 6. - FUNCIONES DEL CONADIS. - Compete al CONADIS:
b) Planificar acciones que permitan el fortalecimiento de los programas de prevencin de discapacidades, atencin e
integracin de las personas con discapacidad,

172

d) Realizar investigaciones y coordinar las acciones que, en relacin con las discapacidades, realicen organismos y
entidades de los sectores pblico y privado; y,
e) Vigilar por el eficaz cumplimiento de esta ley y exigir la aplicacin de la sancin a quienes la incumplan.
Art. 13. - FUNCIONES Y ATRIBUCIONES DE LA COMISIN TCNICA. - Son funciones y atribuciones de
la Comisin Tcnica:
c) Proponer mecanismos y estrategias de coordinacin entre el CONADIS y los sectores pblico y privado en el
mbito de las discapacidades;
d) Apoyar el diseo de planes operativos, programas y proyectos que deben desarrollar las entidades que conforman
la Comisin Tcnica y otras entidades pblicas y privadas, en el rea de discapacidad; y,
Art. 15. - DEPARTAMENTO DE RELACIONES PUBLICAS Y COMUNICACIN SOCIAL - El Consejo
Nacional de Discapacidades, crear el Departamento de Relaciones Pblicas y Comunicacin Social que tendr a su
cargo la informacin y sensibilizacin a la comunidad. Sus funciones y organizacin se determinarn en el respectivo
reglamento.
DEL PATRIMONIO, RENTAS Y DESTINO DE LOS FONDOS
Art. 16. - PATRIMONIO DEL CONSEJO NACIONAL DE DISCAPACIDADES. - El Patrimonio del Consejo
Nacional de Discapacidades est constituido por:
a) Las asignaciones que se harn constar obligatoriamente en el Presupuesto General del Estado;
b) El 25% de las multas que se impusieran por la falta de medidas de seguridad e higiene laboral, conforme a los
artculos 442 y 626 del Cdigo del Trabajo;
c) El 50% de las multas que se recauden por violacin a los derechos que esta ley consagra para las personas con
discapacidad;
d) El 50% de las multas que los municipios del pas recauden por la inobservancia de las normas de accesibilidad que
sus ordenanzas establezcan, las mismas que debern ser depositadas en la cuenta del Consejo Nacional de
Discapacidades dentro de los primeros quince das del mes siguiente a aquel en que se efectu la recaudacin;
e) Los bienes muebles e inmuebles de su propiedad;
f) Los recursos que obtenga provenientes de la autogestin, tales como ingresos por la prestacin de sus servicios a
entidades pblicas y privadas as como de franquicias concedidas y de otros derechos;
g) Los crditos no reembolsables, provenientes de instituciones pblicas y privadas, nacionales y extranjeras; y,
h) Los legados y donaciones.
Los recursos a los que se refiere el presente artculo se administrarn dentro del rgimen descentralizado previsto en
esta ley y sern transferidos automticamente al CONADIS, a la cuenta especial que se abrir en una de las
instituciones del sistema financiero.
Los recursos previstos en los literales: b), c), d), e) y f), sern considerados recursos de autogestin y se sometern a
las normas sobre la utilizacin de recursos de autogestin que tiene el Ministerio de Economa y Finanzas. El
reglamento de la presente ley determinar los mecanismos para efectivizar la participacin del CONADIS en las
recaudaciones establecidas en estos literales.
DE LA COBERTURA
Art. 17. - PERSONAS AMPARADAS. - Estn amparadas por esta ley:
a) Las personas naturales, nacionales o extranjeras residentes en el Ecuador, con discapacidad, causada por una
deficiencia, prdida o anormalidad de una estructura o funcin psicolgica o anatmica, de carcter permanente, que

173

tengan restringida total o parcialmente, por su situacin de desventaja, la capacidad para realizar una actividad que se
considere normal;
b) Los padres, madres o representantes legales que tengan bajo su responsabilidad y/o dependencia econmica a una
persona con discapacidad; y,
c) Las instituciones pblicas y las personas jurdicas de derecho privado sin fines de lucro que trabajan en el campo
de las discapacidades.
DE LOS DERECHOS Y BENEFICIOS
Art. 19. - Sin perjuicio de los derechos establecidos en la Constitucin, en las leyes y en convenios internacionales, el
Estado reconocer y garantizar a las personas con discapacidad los siguientes:
a) Accesibilidad. - Se garantiza a las personas con discapacidad la accesibilidad y utilizacin de bienes y servicios de
la sociedad, evitando y suprimiendo barreras que impidan o dificulten su normal desenvolvimiento e integracin
social. En toda obra pblica que se destine a actividades que supongan el acceso de pblico, debern preverse
accesos, medios de circulacin, informacin e instalaciones adecuadas para personas con discapacidad. La misma
previsin deber efectuarse en los edificios destinados a empresas privadas de servicio pblico, en los que exhiban
espectculos pblicos y en las unidades sociales y recreativas para uso comunitario, que en adelante se construyan,
reformen o modifiquen.
Los municipios, con asesora del Consejo Nacional de Discapacidades y el Instituto Ecuatoriano de Normalizacin
(INEN), dictarn las ordenanzas respectivas que permitan el cumplimiento de este derecho; las que establecern
sanciones y multas por la inobservancia de estas normas. Adicionalmente, los municipios establecern un porcentaje
en sus presupuestos anuales para eliminar las barreras existentes;
c) Acceso a la Educacin. - Acceso a la educacin regular en establecimientos pblicos y privados, en todos los
niveles del sistema educativo nacional, con los apoyos necesarios, o en servicios de educacin especial y especfica
para aquellos que no puedan asistir a establecimientos regulares de educacin, en razn del grado y caractersticas de
su discapacidad;
d) Accesibilidad al Empleo. - Las personas con discapacidad tienen derecho a no ser discriminadas, por su condicin,
en todas las prcticas relativas al empleo, incluyendo los procedimientos para la aplicacin, seleccin, contratacin,
capacitacin, despido e indemnizacin de personal y en cuanto a todos los dems trminos, condiciones y privilegios,
de los trabajadores;
e) Accesibilidad en el Transporte. - Las personas con discapacidad tienen derecho a la utilizacin normal del
transporte pblico, para lo cual las compaas, empresas o cooperativas de transporte progresivamente implementarn
unidades libres de barreras y obstculos que garanticen el fcil acceso, y circulacin en su interior de personas con
movilidad reducida y debern contar en todas sus unidades, con dos asientos identificados con el smbolo
internacional de discapacidad.
f) Accesibilidad a la Comunicacin. - Las personas con discapacidad tienen derecho a acceder, de acuerdo a las
circunstancias, a la informacin emitida a travs de los medios de comunicacin colectiva nacional, para lo cual la
Superintendencia de Telecomunicaciones, en coordinacin con las asociaciones de medios de comunicacin nacional
y el Consejo Nacional de Discapacidades, promover la eliminacin de barreras en la comunicacin, respecto a la
difusin de informacin, y la incorporacin de recursos tecnolgicos y humanos que permitan la recepcin de los
mensajes y el acceso a los sistemas de comunicacin y sealizacin, como lengua de seas ecuatorianas, generacin
de caracteres, sistema Braile, u otros, que permitan a las personas con discapacidad el derecho a la informacin y
comunicacin. Los medios de comunicacin social televisivos debern progresivamente incorporar en sus noticieros
la interpretacin de lengua de seas ecuatoriana o generacin de caracteres, para que las personas sordas tengan
acceso a la informacin, al igual que los programas producidos por las entidades pblicas.
El Estado reconoce el derecho de las personas sordas al uso de la "Lengua de Seas Ecuatoriana", a la educacin,
bilinge u oralista y auspicia la investigacin y difusin de las mismas.
Las instituciones pblicas, privadas y mixtas estn obligadas a adecuar sus requisitos y mecanismos de seleccin de
empleo, para facilitar la participacin de las personas con discapacidad en igualdad de oportunidades y equidad de
gnero. El Servicio de Capacitacin Profesional (SECAP) y ms entidades de capacitacin debern incorporar
personas con discapacidad a sus programas regulares de formacin y capacitacin; y establecern, en coordinacin
con el Ministerio de Trabajo y la Asesora del Consejo Nacional de Discapacidades, programas especiales en casos

174

que as lo justifiquen. Los servicios pblicos de colocaciones del Ministerio de Trabajo fomentarn la insercin
laboral de las personas con discapacidades.
Art. 20. - TARIFAS PREFERENCIALES. - Las personas con discapacidades que cuenten con carn o registro del
.Consejo Nacional de Discapacidades pagarn una tarifa preferencial del 50% en el transporte terrestre (urbano,
parroquial o interprovincial; pblico o privado), as como servicios areos en rutas nacionales, fluvial, martimo y
ferroviario, los cuales sern prestados en las mismas condiciones que los dems pasajeros que pagan la tarifa
completa.
En el caso del transporte areo en rutas internacionales, la tarifa ser conforme a lo establecido en los convenios
internacionales respectivos, ratificados por el Ecuador.
Las personas con discapacidades tendrn una exoneracin del 50% en las tarifas de los espectculos pblicos.
DE LOS PROCEDIMIENTOS Y SANCIONES
Art. 21. - PROTECCIN DE DERECHOS. - Toda persona que sufra discriminacin por su condicin de persona
con discapacidad o amenaza en el ejercicio de sus derechos y beneficios consagrados en esta ley, podr, antes de
presentar su demanda y en cualquier etapa del juicio, demandar ante un Juez de lo Civil, las providencias preventivas
y cautelares, las mismas que se tramitarn, en lo que sea aplicable, de conformidad con la Seccin Vigsima Sptima,
Ttulo II, Libro II del Cdigo de Procedimiento Civil:
a) El cese inmediato de la accin discriminatoria; y,
b) Cualquier otra que evite la continuacin de la violacin a los derechos.
El Juez ordenar la medida al avocar conocimiento de la demanda, siempre que se acompaen pruebas sobre indicios
precisos y concordantes que permitan, razonablemente, presumir la violacin actual o inminente de los derechos
reconocidos en esta ley a las personas con discapacidad. El Juez deber comprobar si el peticionario es una persona
amparada por esta ley, para cuyo efecto se estar a las normas contenidas en la misma.
En esta accin, no se podr demandar la indemnizacin de daos y perjuicios. Sin embargo, el pago de las costas
judiciales y un honorario razonable del abogado patrocinador si podr ser ordenado.
En los procesos que se sustancien por esta materia, de verificarse la discriminacin o la violacin de los derechos de
las personas con discapacidad, el Juez de lo Civil podr imponer una malta de doscientos cincuenta a cinco mil
dlares de los Estados Unidos de Norteamrica, en la sentencia respectiva.
LEY REFORMATORIA A LA LEY SOBRE DISCAPACIDADES, CODIFICADA
Art. 25. - NORMAS SUPLETORIAS. - En todo lo que no estuviere previsto expresamente en esta ley, se aplicarn
como supletorias las disposiciones vigentes en otras leyes.
Art. 26. - TRANSFERENCIA DE ATRIBUCIONES. - Todas las atribuciones que tuvieren los organismos y
entidades del sector pblico en relacin con el diseo y puesta en vigencia de polticas generales en materia de
discapacidades se transfieren en virtud de esta ley, al Consejo Nacional de Discapacidades.
En el reglamento de esta ley se delimitar las competencias de los ministerios de Estado en el rea de discapacidades.
Art. 27. - Se mantendr la Direccin Nacional de Discapacidades del Ministerio de Bienestar Social y, en los
ministerios del Frente Social que no existan direcciones. Divisiones o departamentos se los crear en el plazo de un
ao.
En el Ministerio de Trabajo deber crearse la Direccin Nacional de Rehabilitacin Profesional, en el Ministerio de
Salud deber restituirse la Direccin Nacional de Rehabilitacin y se elevar a Direccin Nacional a la actual
Divisin de Educacin Especial del Ministerio de Educacin y Cultura.
Art. 28. - DIA DE LAS PERSONAS CON DISCAPACIDAD. - Se establece el 3 de diciembre de cada ao como
da clsico de las personas con discapacidad, en el cual se desarrollarn acciones de sensibilizacin a la sociedad.

175

Art. 29. - Las instituciones pblicas y privadas que trabajen en el rea de discapacidades deben desarrollar acciones
coordinadas, por el CONADIS tendientes a la operativizacin de las polticas nacionales y sectoriales sobre
discapacidades. Sus planes y programas se enmarcarn dentro de los lineamientos estratgicos del Plan Nacional de
Discapacidades.
Las instituciones del sector, pblico coordinarn obligatoriamente con el CONADIS, en todo lo relacionado a su
programacin y presupuestacin.
El Estado a travs del Consejo Nacional de Discapacidades deber vigilar el cumplimiento de las disposiciones
constitucionales, la presente ley y su reglamento, al igual que los convenios internacionales suscritos por el Gobierno
ecuatoriano con organismos internacionales sobre el tema de discapacidades.
Art. 30. - DEROGATORIA. - Derogase todas las normas legales que se opongan a lo previsto en esta ley; y,
expresamente la Ley de Proteccin del Minusvlido, publicada en el Registro Oficial No. 301 cumplimiento de lo
dispuesto en el literal a) del artculo 19 de la presente ley, en lo relacionado a las edificaciones pblicas y privadas de
uso pblico existentes, debern en el plazo mximo de tres aos adecuar sus edificaciones adoptando las medidas de
accesibilidad.
TERCERA. - En el reglamento a esta ley se definir las atribuciones, competencias y responsabilidades de los
ministerios de Estado que cumplan actividades relacionadas con la discapacidad, a fin de coordinar acciones que
deban desarrollarse en esta rea.
CERTIFICO: Esta codificacin fue elaborada por la Comisin de Legislacin y Codificacin, de acuerdo con lo
dispuesto en el numeral 2 del artculo 139 de la Constitucin Poltica de la Repblica.
f) Abg. Xavier Flores Marn, Secretario.

*REGLAMENTOGENERALALALEYDEDISCAPACIDADES

TomadodelRegistroOficialN27
GustavoNoboaBejarano
PresidenteConstitucionaldelaRepblica
Considerando:
Que, mediante Ley N 2000-25, publicada en el Registro Oficial N 171 del 26 de Septiembre del 2000, se expide la
Ley Reformatoria a la ley de discapacidades, publicada en el Registro oficial N 996 del 10 de agosto de 1992.
Que, es indispensable expedir normas requeridas para la aplicacin de esa Ley; y, en ejercicio de la facultad que le
confiere el numeral 5 del Art. 171 de La Constitucin Poltica de la Repblica;
Decreta:
El Reglamento General de la Ley Reformatoria de la Ley de Discapacidades.
Estructura del Reglamento
CAPITULOI
DELAMBITODEAPLICACIONDEESTEREGLAMENTO
Art.1.ParaefectosdelaaplicacindelpresenteReglamentodelaLeysobreDiscapacidades,seconsiderarcomo
rgano responsable al Consejo Nacional de Discapacidades, el que actuar como coordinador de las entidades
pblicasyprivadas,quetienenrelacinconelmbitodelasdiscapacidades.

176

Art. 2. Los organismos pblicos y privados deben observar obligatoriamente las disposiciones de la ley y este
reglamentoenlorelacionadoconlanecesariacoordinacinentodoslosniveles.
CAPITULOII
DELAPERSONACONDISCAPACIDAD
Art.3.PERSONACONDISCAPACIDAD:Paraefectosdelcumplimientodelasdisposicionesdelaleyyelreglamento,
seconsiderarpersonacondiscapacidadatodapersonaque,comoconsecuenciadeunaomsdeficienciasfsicas,
mentalesy/osensoriales,congnitasoadquiridas,previsiblementedecarcterpermanenteseverestringidaenal
menos un treinta por ciento de su capacidad para realizar una actividad dentro del margen que se considera
normal,eneldesempeodesusfuncionesoactividadeshabituales.
TITULOII
DE LAS COMPETENCIAS DE LOS MINISTERIOS DE ESTADO Y OTROS ORGANISMOS PUBLICOS Y PRIVADOS EN
RELACIONCONLASDISCAPACIDADES
Art.4.MINISTERIODESALUD:AlMinisteriodeSaludlecorrespondeasumirlassiguientesresponsabilidades:
3.Establecerunsistemadeconsejeragenticaparaevitarelaparecimientodediscapacidades.
5.Establecerprogramasparaeldiseo,produccinydistribucindertesisyprtesisyotrasayudastcnicas,que
reemplacen o compensen las deficiencias y que permitan a las personas con discapacidad tener facilidades para
adquirirymantenerlosmismos,ascomolafijacindetarifariosynormativasdefuncionamiento.
7.Ejecutarprogramasdeprevencindeaccidentesdetrnsito,hogar,laboralesyotros.
8.Adoptarmedidasdecontrolcontraelusoindebidodedrogas,estupefacientesypsicotrpicos,alcohol,tabaco,
medicamentos,afindeprevenirladiscapacidad.
10. Establecer un sistema de atencin oportuna para la deteccin, diagnstico, intervencin temprana y
rehabilitacinmdicofuncional,medianteprogramasqueponganalalcancedelaspersonascondiscapacidadlos
recursos y servicios, de manera que reciban una atencin integral, individualizada, apropiada y continua
preferentementeensupropiocontextosociocultural.
11.Crearyfortalecerlosprogramasyserviciosanivelnacional,regional,provincialylocaldeserviciosdedeteccin,
diagnstico y tratamiento de las deficiencias, con participacin de la comunidad, como un componente de los
serviciosgenerales.
14.Disearyejecutarprogramasqueincluyancontenidossobrediscapacidadesenlacapacitacindelpersonalde
salud, que realiza prcticas o actividades especialmente en los sectores rural y urbanomarginal a fin de que se
conviertanenagentesmultiplicadoresparalacapacitacindelderesenlacomunidadyenlafamilia,conelobjeto
de reducir la incidencia de las discapacidades, de acuerdo a las estrategias del modelo de rehabilitacin en base
comunitariaR.B.C.
18.Ampliaryreforzarlosprogramasdeintervencinyestimulacintempranaconparticipacindelafamiliayla
comunidad,especialmenteengrupospoblacionalesderiesgo,conelapoyodelMinisteriodeEducacinyCultura,
Ministerio de Bienestar Social, Instituto Nacional del Nio y la Familia, los institutos de Seguridad Social y
organizacionesnogubernamentales.
20.Implementarestrategiasdederivacinparaaccionesderehabilitacinprofesionaleintegracinsocial,familiar
ylaboralqueseejecutenenbeneficiodelaspersonascondiscapacidad.
21. Fortalecer y ampliar los programas de salud escolar para prevenir la salud y detectar precozmente
enfermedades,deficienciaseinadaptacionesenalumnosescolarizados,quepuedenprovocardiscapacidades.
Art. 5. MINISTERIO DE EDUCACION: Al Ministerio de Educacin y Cultura le corresponde asumir las siguientes
responsabilidades:

177

1. Establecer un sistema educativo inclusive para que los nios y jvenes con discapacidad se integren a la
educacingeneral.Enloscasosquenoseanposibles,suintegracin,porsugradoytipodediscapacidad,recibirn
laeducacineninstitucionesespecializadas,quecuentenconlosrecursoshumanos,materialesytcnicosajustados
asusnecesidadesparafavorecerelmximodesarrolloposibleysuinclusinsociolaboral.
2.DisearyejecutarunPlanNacionaldeIntegracinEducativaparalosprximoscuatroaos,quecontempleun
ajustedelmarconormativodelaeducacinparaquefacilitelaeducacindelosniosyjvenesconnecesidades
educativas especiales en el sistema general y las acciones necesarias para la capacitacin de los docentes del
sistema general y especial para la integracin, el replanteamiento de la formacin inicial de los maestros y la
reorientacindelaeducacinenlasinstitucionesdeeducacinespecialacordeconlosobjetivosdeesteprograma.
3. Ampliar progresivamente los programas y acciones de integracin en la educacin general bsica, media y
superior.
4.Desarrollarprogramasdetransicinalavidaadultaylaboral,enlasescuelasdeeducacinespecial.
5.Organizarprogramaseducativosbasadosenunaevaluacinintegral,quepermitaidentificarlaspotencialidades,
aptitudesvocacionalesylimitacionesparaplanificarlarespuestaeducativa.
6.Disearyejecutarprogramasdeeducacinnoformalparalaspersonascondiscapacidadquelorequieran.La
educacin no formal ser impartida tambin a las personas con discapacidades cuya estancia hospitalaria sea
prolongada,conelfindepreveniryevitarsumarginacindelprocesoeducativo.
7. Controlar el funcionamiento de las instituciones de la educacin formal y no formal en el mbito de las
discapacidades, tanto de los sectores pblico como privado; brindando asesora, capacitacin y recursos para
optimizarsufuncin.
8.Disearycapacitaralasinstitucioneseducativasdetodoelpassobrelasadaptacionescurriculares,mtodos,
tcnicas y sistemas de evaluacin para aplicarse en la educacin integrada en los diferentes niveles del sistema
educativo y especial de los nios, jvenes con necesidades especiales y facilitar la utilizacin de recursos
tecnolgicosyayudastcnicas.
9.Impulsarlacreacindecolegiostcnicosoadaptarlosexistentes,segnelcaso,paralaformacinocupacional
delosjvenescondiscapacidad.
10. Incorporar al Sistema de educacin integrada y especial actividades relacionadas con el ocio, recreacin,
tiempolibre,arte,deporteycultura.
11. Desarrollar programas educativos de prevencin primariay secundaria, encoordinacin con el Ministerio de
SaludPblica.
12. Desarrollar programas de deteccin, diagnstico e intervencin temprana, en la poblacin escolar, en
coordinacinconelMinisteriodeSalud.
13.FortalecerlosprogramasdecapacitacinocupacionalenelsistemaeducativoencoordinacinconelMinisterio
deTrabajo.
14.CoordinaraccionesconlaDireccinencargadadeRecreacinyDeportesparalaorganizacindeprogramasy
actividadesdeportivasparalaspersonascondiscapacidadycontrolarlasaccionesqueenestembitorealicenotras
organizaciones.
15. Preparar, de conformidad con la Ley Orgnica de Responsabilidad, Estabilizacin y Transparencia Fiscal, las
accionesqueserealizarnypresupuestarlosrecursosnecesariosparalaejecucindelasmismas,afindequestos
puedan incorporarse oportunamente en la proforma presupuestaria del Ministerio de Educacin. Previamente
deberserconocidaydiscutidaenlaComisinTcnicadelCONADIS.
16.Defenderlosderechosalaeducacindelaspersonas

condiscapacidad.

178

Art.6.MINISTERIODEBIENESTARSOCIAL:AlMinisteriodeBienestarSociallecorrespondeasumirlassiguientes
responsabilidades:
1.Ejecutarlaspolticassocialesenbeneficiodelaspersonascondiscapacidad,paralograrsumximodesarrollo
humano.
2. Ejecutar programas de arte, recreacin, deportivos, culturales, de ocio y tiempo libre para personas con
discapacidad,procurandoqueserealicenenlasinstalacionesregularesdelacomunidad.
3.Establecerprogramasdeinformacin,sensibilizacinycapacitacinalacomunidad,quepromuevanunmayor
conocimiento sobre discapacidades, respeto y apoyo a las personas con discapacidad y a los programas que se
desarrollanparaellos.
4.Crearprogramastendientesaasegurarelderechodelaspersonascondiscapacidadavivirenfamiliaobrindarle
alternativasmedianteredesdefamiliasacogientes,centrosdecuidadodiario,casasresidencialesparapersonascon
discapacidadgravementeafectadasoensituacindeabandono,orfandadeindigencia.
5. Organizar y realizar investigaciones sobre aspectos sociales, econmicos, jurdicos, y de participacin
comunitaria,queinfluyanenlavidadelaspersonascondiscapacidadysusfamilias.Dichasinvestigacionesdeben
incluir la oportunidad y eficacia de los programas existentes y la necesidad de desarrollar servicios y medidas de
apoyo.
6.Disearyejecutarprogramasdecapacitacinyapoyoalasfamiliasyalacomunidadenelmanejodepersonas
condiscapacidad.
7.Disearydesarrollarprogramasdeasistencialegal,paralaspersonascondiscapacidadysusrepresentantes.
8.Disear,organizaryejecutarsistemasalternativosdeproteccinsocialespecial.
9.Proporcionarasistenciatcnicayrecursosparalacreacinyelfortalecimientodelasorganizacionesdepersonas
condiscapacidad.
10.Apoyarprogramasquefacilitenlaintegracinsociolaboraldelaspersonascondiscapacidadconparticipacin
activadelacomunidadydelusuario,encoordinacinconelMinisteriodelTrabajo.
11.Procurarayudasybeneficiossocialesyeconmicosparalaspersonascondiscapacidaddelimitadosrecursos
econmicosygarantizarlaproteccinsocialalaspersonasensituacindeabandono.
12.Promoveryfinanciarproyectosdeautogestinlideradosporpersonascondiscapacidadyorganizacionesque
trabajenenelreadelasdiscapacidades.
13.Impulsarprogramasparapromoverelrespetodelosderechosylaproteccinjurdicadelaspersonasybienes,
delaspersonascondiscapacidad.
14.Impulsarlaparticipacinciudadanayelvoluntariadoenelreadelasdiscapacidades.
15.Organizarprogramasdeapoyoyasistenciaalasfamiliasdepersonascondiscapacidadesgravesydeescasos
recursoseconmicos.
16.ElMinisteriodeBienestarSocial,deconformidadconlaley,financiarlosserviciosdeintrpretesde"Lengua
de Seas Ecuatoriana" para las personas sordas que lo soliciten, para defensa de sus derechos, asuntos legales,
eventosyotrosdeproteccinalosmismosysusfamiliaresencondicionesdifcilesyladifusindedocumentosen
Brailleparapersonasciegas.
17. Preparar, de conformidad con la Ley Orgnica de Responsabilidad, Estabilizacin y Transparencia Fiscal, las
accionesqueserealizarnypresupuestarlosrecursosnecesariosparalaejecucindelasmismas,afindequestos
puedanincorporarseoportunamenteenlaproformapresupuestariadelMinisteriodeBienestarSocial.Previamente
deberserconocidaydiscutidaenlaComisinTcnicadelCONADIS.

179

18.Defenderlosderechosalbienestarsocialdelaspersonascondiscapacidad.
Art.7.MINISTERIODETRABAJOYRECURSOSHUMANOS:ElMinisteriodeTrabajoyRecursosHumanosobservar
yharcumpliralasentidadesyorganismosdesucompetencialasresolucionesadoptadasenlosconveniosl11,142
y159ylasrecomendaciones99y168delasNormasdeOrganizacinInternacionaldelTrabajoOIT,ratificadaspor
elEcuadorsobrelaReadaptacinProfesionalparalaspersonascondiscapacidad.Adems,asumirlassiguientes
responsabilidades:
1. Crear servicios de rehabilitacin profesional, formacin y capacitacin profesional para personas con
discapacidad,deconformidadconsusnecesidades,aptitudesydestrezasyconlosrequerimientosyposibilidades
delmercadodetrabajo.
2.Desarrollarprogramasyserviciosdeintermediacinlaboralparapersonascondiscapacidad,teniendoencuenta
lascapacidades,preparacin,realidaddelentornoeinteresesdelbeneficiario.
3.Establecermedidasespecialesdeapoyoquefacilitenlaintegracinlaboral;podrnconsistirensubvencioneso
prstamosparaadaptacindelospuestosdetrabajo,eliminacindebarrerasarquitectnicasydelacomunicacin,
establecersecomotrabajadoresautnomos,promocindemicroempresas,decooperativasyotrasalternativas.
4. El Ministerio de Trabajo, el SECAP y el Consejo Nacional de Capacitacin, debern adoptar medidas para
proporcionar servicios de capacitacin, formacin profesional y otros, para que las personas con discapacidad
puedanobtener,conservarunempleoypromoverseenelmismo.Enloposible,seutilizarnlosserviciosexistentes
paralostrabajadoresengeneralconlasadaptacionesnecesarias.
5. Desarrollar programas para aquellas personas con discapacidad que no pueden de manera provisional o
definitiva, ejercer una actividad laboral en condiciones habituales; para dicho efecto implementarn centros
especialesdeempleo.
6. Realizar investigaciones destinadas a evaluar los resultados obtenidos por los servicios de rehabilitacin
profesional,capacitacinyempleo,ascomotrabajosobrelasdiferentestcnicasymtodosqueseutilicenenel
procesoderehabilitacinprofesional.
7.Organizarserviciosderehabilitacinprofesionaleinsercinlaboralanivelurbano,urbanomarginalyrural,que
serealizarcon laparticipacin delacomunidad,yenparticularconlos representantesdelasorganizacionesde
empleadores, de trabajadores y de las personas con discapacidad, sus familiares y las organizaciones de y para
personascondiscapacidad.
8. Capacitar al personal involucrado en programas de rehabilitacin profesional y de formacin y capacitacin
laboralregular.
9.IncorporarenlospermisosdefuncionamientoqueelMinisteriodeTrabajootorgaaempresasdeintermediacin
laboral y de tercerizacin de la contratacin de personal, la inclusin de la poblacin con discapacidad a sus
servicios.
10. Organizar y desarrollar programas de empleo protegido, empleo con apoyo, talleres de produccin
autogestionarios, microempresas, cooperativas y otras similares para personas con discapacidad que no puedan
obteneroconservarunempleoenunmedioordinariodetrabajo,ocomoetapapreviaalaintegracinlaboral.
14. Fomentar y apoyar la participacin de las organizaciones empresariales, sindicales y las organizaciones no
gubernamentalesdeyparapersonascondiscapacidadenmateriaderehabilitacineinsercinlaboral.
15.Realizarcampaasdeinformacinysensibilizacinparaempresarios,sindicatos,ONG'sypoblacinengeneral
relativaalempleodelaspersonascondiscapacidad.

16. Coordinar con la Divisin de Educacin Especial para realizar las acciones en formacin ocupacional en las
institucionesdeeducacinespecial.

17. Establecer peridicamente las posibles fuentes de trabajo a travs de las gestiones propias o de terceros y
determinarlosperfilesdecapacitacin.

180

18. Preparar, de conformidad con la Ley Orgnica de Responsabilidad, Estabilizacin y Transparencia Fiscal, las
accionesqueserealizarnypresupuestarlosrecursosnecesariosparalaejecucindelasmismas,afindequestos
puedan incorporarse oportunamenteen la proforma presupuestaria del Ministerio de Salud. Previamente deber
serconocidaydiscutidaenlaComisinTcnicadelCONADIS.
19.Defenderlosderechosaltrabajodelaspersonascondiscapacidad.
Art.9.ENTIDADOFICIALDECOMUNICACIONDELESTADO:Lecorresponde:
1. Facilitar la utilizacin de espacios en medios de comunicacin social para difundir temas de prevencin de la
discapacidad,derechosyproteccinsocialdelaspersonascondiscapacidad.
2.Desarrollarcampaasperidicasyprogramassistemticosdesensibilizacinyeducacinalacomunidad,sobre
prevencindediscapacidades,derechosydeberesdelaspersonascondiscapacidadatravsdelosmediosmasivos
decomunicacin.
3. Asegurar el acceso a la informacin que emiten los medios de comunicacin masiva convencionales y
alternativasdecomunicacin, medianteelusodeelementostecnolgicosparaelaccesoyla comprensindelas
personas con deficiencias sensoriales, prioritariamente de informacin noticiosa y programas educativos
impulsadospororganizacionespblicas.
Art.10.MINISTERIODETURISMO:Lecorresponde:
1.Establecerdisposicionesparaqueloslugaresdeinterstursticoyhoteles,hosteras,residenciales,restaurantes
y sitios de recreacin, observen las normativas para la accesibilidad de las personas con discapacidad al medio
fsico,transporteeinformacin.
2.Promoverelturismoparapersonascondiscapacidadnacionalesyextranjerosencondicionespreferenciales.
4. Obligatoriamente deber publicar informativos de todos los lugares que son accesibles para las personas con
discapacidad.
Art.13.MINISTERIODEDEFENSANACIONAL:Lecorresponde:
3. Desarrollar programas de servicio social, dirigidos a los miembros activos y pasivos y familiares con
discapacidad.
5.Capacitaralpersonalsobrelosdeberesyderechosdelaspersonascondiscapacidad.
6.Capacitarasupersonalycrearfacilidadesdeatencinparalaspersonascondiscapacidad.
Art.16.INSTITUTONACIONALDELNIOYLAFAMILIA:Lecorresponde:
1. Ejecutar y apoyar programas de prevencin primaria, secundaria y terciaria de discapacidades, a travs de
acciones de deteccin, diagnstico, intervencin temprana, rehabilitacin funcional, capacitacin, rehabilitacin
profesionaleinvestigacin,encoordinacinconlasinstanciascorrespondientes.
2.OrganizarelserviciodecalificacindeladiscapacidadconformealasdisposicionesdelCONADIS.
Art.17.ORGANIZACIONESDEPERSONASCONDISCAPACIDAD:Lecorresponde:
1.InscribirseenelRegistroNacionaldeDiscapacidades.
2. Fortalecimiento organizacional, desarrollo de acciones de defensa de derechos, integracin familiar,
capacitacin, insercin laboral, actividades culturales, sociales, recreacionales, utilizacin del tiempo libre,
sensibilizacinyotrasrelacionadasconeltema.
7.ImpulsarlainscripcindelaspersonascondiscapacidadenelRegistroNacionaldeDiscapacidadesdelCONADIS.

181

Art.18.INSTITUTOSDESEGURIDADSOCIALECUATORIANO:
1.LosinstitutosdeSeguridadSocial,existentes(IESS,ISSFAeISSPOL)ylosquesecrearendebernobservarlaLey
deDiscapacidades,sureglamentogeneralylaspolticasdelCONADIS,enlaejecucindeprogramasyaccionesde
prevencin de discapacidades, atencin e integracin de personas con discapacidad y de aquellas que adquieren
estacondicindurantesuactividadlaboral.
Art.19.ORGANIZACIONESNOGUBERNAMENTALESQUETRABAJANENDISCAPACIDADES:
1.TodaslasONG'squetrabajanenelreadediscapacidadtienenlaobligacinderegistrarseenelCONADIS.
2.EjecutarproyectosyaccionesenmarcadasenlasdisposicionesdelaLeydeDiscapacidadesysureglamento,Plan
Nacional de Discapacidades y las polticas generales y sectoriales del CONADIS, en relacin a prevencin de las
discapacidadesyatencineintegracinsocialdelaspersonascondiscapacidades.
3.HastaelmesdefebrerodecadaaodebernpresentaralCONADISsusplanesoperativos.
4.Enelmesdediciembredecadaao,presentarelinformeanualalConsejoNacionaldeDiscapacidadessobrelas
actividadestcnicasyeconmicas,cumplidasdeacuerdoalosobjetivosparalosquefueroncreados.
5. Para obtener recursos del Estado y de fuentes externas, las organizaciones no gubernamentales creadas
especficamente para atender a personas con discapacidad, debern estar inscritas en el Registro Nacional de
Discapacidadesyobtenersuregistrodefuncionamiento.

DELCONSEJONACIONALDEDISCAPACIDADES
CAPITULOI
DELAORGANIZACIONYFUNCIONAMIENTO
Art.20.ELCONADISeselmximoorganismodelEstadoenmateriadediscapacidades,tienepersonerajurdicade
derecho pblico, es autnoma, conforme lo establece el Art. 5 de la ley y estar constituido por los siguientes
rganos:
a.ElDirectorio;
b.LaDireccinEjecutiva;y,
c.LaComisinTcnica.
Art. 21. El Consejo Nacional de Discapacidades es el organismo encargado de emitir las polticas nacionales y
sectoriales y coordinar las actividades que, en el campo de las discapacidades desarrollan las entidades y
organismosdelossectorespblicoyprivadoeimpulsarlainvestigacinenestecampo.
Art.22.ATRIBUCIONESDELCONSEJONACIONALDEDISCAPACIDADES:
1.Coordinarlasaccionesque,enrelacinconlasdiscapacidades,realicenorganismosyentidadesdelossectores
pblicoyprivado;eimpulsaryrealizarinvestigaciones,ascomocanalizarrecursosparaproyectosdeinversinen
elreadelasdiscapacidadesconformedisposicinalrespecto.
2.Conocerlosplanesyprogramasdeaccin,delasentidadesyorganismosdelossectorespblicoyprivadoen
materiadediscapacidades,ascomolosresultadosdestos,segnlasnormasqueelDirectoriodestedictepara
elefecto.

182

Art. 25. Las instituciones de los sectores pblico y privado que trabajan en el rea de las discapacidades se
sujetarnaloslineamientosestablecidosenelPlanNacionaldeDiscapacidadesformuladoporelConsejoNacional
deDiscapacidades.
Art.39.DELASCOMISIONESPROVINCIALESDEDISCAPACIDADES:
SoninstanciastcnicoadministrativasdelCONADIS,quetienencomopropsitoefectuaruntrabajocoordinadoy
efectivo, con participacin comunitaria, en beneficio de las discapacidades en cada provincia. Para su
funcionamientotendrtresnivelesdegestin;Directivo,CoordinadoryComunitario.
Art.40.OBJETIVOSDELASCOMISIONESPROVINCIALESDEDISCAPACIDADES:
Lascomisionesprovincialesdediscapacidadestienencomoobjetivosfundamentales:
Coordinaraccionesdelossectorespblicoyprivadoenmateriadediscapacidadesdentrodesuprovincia.
Impulsar,apoyar,ejecutarydifundiraccionesenbeneficiodelaspersonascondiscapacidad,enmarcadasenelPlan
NacionaldeDiscapacidades,laspolticasgeneralessectorialesyotrasdisposicionesemitidasporelCONADIS.
Velar por la defensa de los derechos de las personas con discapacidad, en los trminos que determina este
reglamento.
VelarporlaaplicacindelaLeysobreDiscapacidadesysureglamento.
Art.41.FUNCIONESDELACOMISIONPROVINCIALDEDISCAPACIDADES:
a.Coordinaraccionesdelossectorespblicoyprivadoenmateriadediscapacidadesdentrodesuprovincia;
b.ImpulsarlaaplicacindelaLeysobreDiscapacidadesyelreglamentogeneralalamisma;
c.Coordinar,planificar,ejecutarysupervisarlosplanes,programas,proyectosyaccionesqueserealicenensu
jurisdiccin;
d.Impulsar,apoyar,ejecutarydifundirproyectosyaccionesenbeneficiodelaspersonascondiscapacidad,
desarrolladosenlasmunicipalidadesyqueestnenmarcadasenlaspolticasgenerales,sectorialesyotras
disposicionesemitidasporelCONADIS;
Art.43.CENTRODEINFORMACION:ElCentrodeInformacinestarbajoladireccindelaDireccinEjecutiva,a
msdelasresponsabilidadesasignadasenlaley,deberrealizarlosiguiente:
1.Larecopilacindedocumentosactualizadadedatosestadsticossobrelossiguientesaspectos:
Prevencin,atencineintegracinsocialdelaspersonascondiscapacidad.
Personascondiscapacidad.
Organismosgubernamentalesynogubernamentalesquelaborenenelcampodelasdiscapacidades.
Legislacinynormasjurdicasvinculadasconelcampodelasdiscapacidades.
Organismosnacionaleseinternacionalesrelacionadosconelsectordediscapacidades.
Yotrotipodeinformacinydatosqueseannecesariosparaalcanzarlosfinesinstitucionales.
2.Organizar,elaborarydifundirperidicamentetablas,cuadros,grficoseinformacinconlosdatosdelcentro.
3.Mantenerunabibliotecaespecializadaparausopblico.
4.Establecerlosmecanismosnecesariosparaampliaryactualizarlabasededatosdelcentro.

183

Art. 44. DEPARTAMENTO DE COMUNICACION SOCIAL y RELACIONES PUBLICAS: El Departamento de


ComunicacinSocialyRelacionesPblicasdelCONADIS,serelencargadode:
a) Planificar, organizar y desarrollar acciones para la informacin y sensibilizacin a la comunidad sobre las
discapacidades, as como la difusin de las acciones que se desarrollen en este campo, en coordinacin con las
entidadespblicasyprivadas;
c)Disear,producirydifundirmaterialescomunicacionalessobrediscapacidades;y,
DELPATRIMONIODELCONSEJONACIONALDEDISCAPACIDADES
CAPITULOI
DELPRESUPUESTO
Art. 45. El Directorio del Consejo Nacional de Discapacidades, mediante la formulacin de reglamentos
determinar los servicios por los cuales la entidad debe cobrar, y fijar el valor de ellos, recursos que se
administrarnconformealasdisposicionesquedicteparaelefectoelMinisteriodeEconomayFinanzas.
Art. 46. Un porcentaje del presupuesto del CONADIS, se destinar para el financiamiento de proyectos que
impulsenlasaccionesquerealicenlasentidadesdelsectorpblicoyprivadoylasorganizacionesdeyparapersonas
con discapacidad en los mbitos de prevencin de discapacidades, atencin e integracin de las personas con
discapacidad.
Cada ao el CONADIS convocar pblicamente a la presentacin de proyectos en las lneas que considere
pertinente,deacuerdoaunreglamentoespecficoparaelefecto.
Cada ao el CONADIS designar un porcentaje de su presupuesto para la capacitacin del personal de tcnicos y
empleadosdelainstitucin,yparamejorarlascondicionesdeltrabajodelosmismos.
CAPITULOII
DELAEDUCACION
Art. 65. La educacin de personas con discapacidad debe incluir la participacin de los padres, personal
profesional,familiaycomunidad.
Laeducacinparalaspersonascondiscapacidad,seproporcionaratravsde:

Programaseninstitucionesespeciales.
Programasdeeducacinintegrada.
Educacinnoformal.

Art. 66. Los establecimientos de educacin especial que se financien con recursos del Estado o reciban partidas
parapersonaluotrosaspectos,tantodelGobiernoCentral,comodelosgobiernosseccionalestienenlaobligacin
demantenerunsistemadebecasparalaeducacindepersonascondiscapacidaddebajosrecursoseconmicosen
almenoselcincoporcientodelnmerodeestudiantesdecadaplantel.
Art.68.ElMinisteriodeEducacinydeBienestarSocialdeberorganizarunprogramadebecasparalaeducacin
delaspersonascondiscapacidadentodoslosniveles.
ElIECEdeberestablecerunsistemaespecialdebecasparalaeducacindelaspersonascondiscapacidadqueser
el10%deloestimadocadaao.
CAPITULOIII
DELACAPACITACIONPROFESIONALEINCLUSIONLABORAL

184

Art. 69. Las instituciones pblicas y privadas responsables de la capacitacin para el trabajo, organizarn en sus
instituciones,programasdeinclusinapersonascondiscapacidad,enmarcadasenlaspolticasynormasdictadas
para defecto por el CONADIS, el Ministerio de Trabajo y Educacin debern contar con el personal tcnico, los
equiposyrecursosparaaplicarlasadaptacionesnecesarias.
Art.70.ElMinisteriodeTrabajoyRecursosHumanosyelConsejoNacionaldeCapacitacingarantizarnquelas
entidades de formacin profesional, capacitacin para el trabajo regular, en sus diferentes niveles, faciliten la
incorporacindepersonascondiscapacidad,aestasinstituciones,contarnconelementosdeaccesofsicoydela
comunicacin,conlasadaptacionesyapoyosnecesarios.(Adaptacionescurriculares,ayudastcnicas,presenciade
intrpretesdelalenguadeseasecuatoriana,etc.).
Art. 71. El Ministerio de Trabajo y el Consejo Nacional de Capacitacin debern organizar los servicios de
evaluacin y orientacin laboral y capacitacin laboral, de conformidad con los convenios 111, 142 y 159 y las
recomendaciones99y168delaOrganizacinInternacionaldelTrabajoOIT.
Art. 72. Las entidades del sector pblico darn prioridad a las solicitudes de capacitacin de las personas con
discapacidad,rehabilitadas,incluyndolesensusprogramas.
Art. 74. El Ministerio del Trabajo, de conformidad con sus planes plurianuales, crear centros estatales de
formacin ocupacional para personas con discapacidad que no puedan acceder a los centros de formacin
ocupacionalregulares.
CAPITULOIV
DELAACCESIBILIDADALMEDIOFISICOYALTRANSPORTE
Art. 78. Todo espacio pblico y privado de asistencia masiva, temporal o permanente de personas (estadios,
coliseos, hoteles, teatros, estacionamientos, parques, iglesias, etc.) deben contemplar en su diseo los espacios
vehicularesypeatonalesexclusivosparapersonascondiscapacidadymovilidadreducida,losmismosquedebern
estar sealizados horizontal y verticalmente de forma que puedan ser fcilmente identificados a distancia, de
acuerdo a la norma INEN correspondiente en una proporcin de uno, cada veinticinco plazas y debern estar
ubicadoslomsprximoposiblealosaccesosdelosespaciosoedificiosservidosporlosmismos,preferentemente
almismoniveldelosaccesos.
a)Permitirelaccesodelaspersonascondiscapacidadymovilidadreducidaysuubicacinfsicaexclusivadentrodel
mismo.
c)Cumplirconlasnormastcnicasestablecidasparaeldiseodelosespaciosfsicosdeaccesibilidadysuadecuada
sealizacin para informar al pblico que lo sealado es accesible, franqueable y utilizable por personas con
discapacidad,conlafinalidaddequeestaspersonaslogrenintegrarsedemaneraefectiva.
CAPITULOV
ACCESOALACOMUNICACION
Art.80.Losmediosdetelecomunicacinycomunicacinescritadelpas,debernutilizarlosrecursosnecesariosy
brindartodaslasfacilidadesparaquelaspersonascondiscapacidadtenganaccesoalainformacinparacontribuir
asuparticipacinsocial.
Loscanalesdetelevisindebernincorporarensusnoticieros,subtituladosointrpretesdela"LenguadeSeas
Ecuatoriana"parafacilitarlainformacinapersonassordas.
ParaelefectoelCONARTELreglamentarlasfacilidadesenloquetienerelacinaradiodifusinytelevisiny,el
CONATEL para las telecomunicaciones en general. La Superintendencia de Telecomunicaciones y el CONADIS se
encargarndecontrolarquesedcumplimientoalasnormasydisposicioneslegalesalrespecto.
Art. 81. Todas las instituciones debern implementar las facilidades del caso, para que las personas con
discapacidadpuedanestarinformadas,puedanejercersusderechosyaccederalosservicios.

185

ElEstadogarantizarlaparticipacinenlosactosdemocrticosyelectorales,implementandomecanismosparaque
laspersonascondiscapacidadpuedanejercersusderechosaelegiryserelegidos.
DISPOSICIONESFINALES
PRIMERA:DergaseelReglamentoGeneraldelaLeysobreDiscapacidades,publicadoenelRegistroOficial374de4
defebrerode1994ylasreformasalReglamentopublicadoenelSuplementodelRegistroOficialNo.357del10de
enerode2000.
SEGUNDA:DelaejecucindelpresentedecretoqueentrarenvigenciaapartirdesupublicacinenelRegistro
Oficial,encrgueselosministrosdeEconomayFinanzas,EducacinyCultura,BienestarSocial,TrabajoyRecursos
HumanosySaludPblica.
DadoenelPalacioNacional,enQuito,a14deenerode2003.
f.)GustavoNoboaBejarano,PresidenteConstitucionaldelaRepblica.

LASNORMASINENSOBREACCESIBILIDADALMEDIOFSICO,UNTRABAJOENEQUIPO
ElConsejoNacionaldeDiscapacidades,CONADIS,desdesucreacinhatenidoencuentaeltemadelaaccesibilidad
almediofsicocomounadesusprioridades,portantohasidopartcipeprotagnicodelosprincipaleslogrosqueen
estetemasehanconseguido.UnclaroejemplodeestapreocupacininstitucionalessuConvocatoriaalaPrimera
Reunin de Alcaldes, que se realiz en enero de 1994 en la ciudad de Quito y que cont con la presencia de
representantesde28Municipiosdelpas.Eltematratadofue"SupresindeBarrerasUrbansticas,Arquitectnicas
y deAccesibilidad al Transporte" dando comoresultado el documento denominado "CartadeQuito" que lleva la
firma de veinte y seis alcaldes de las ciudades ms importantes del Ecuador, no slo como un compromiso de
participacin, sino un plan de accin y una poltica sobre accesibilidad de las ciudades hacia las personas con
discapacidadymovilidadreducida.
Aconsecuenciadelosprincipiosesbozadosenla"CartadeQuito"yluegodeseminariosycursospatrocinadospor
elCONADISentodoelpasyunapermanentegestinantelosseoresalcaldesdediversasciudadescomo:Quito,
Guayaquil,Cuenca,Ambato,Ibarra,Baos,Tena,entreotras,hanemitidoordenanzassobreestamateriayEcuador
puedepreciarsedeestaravanzandoenestetema.
Endiciembrede1998,apeticindelCONADIS,elINENconvocaungrupodeprofesionalesdelpas,integrndose
enunacomisindetrabajointerdisciplinarioqueelaborveintidsnormastcnicasdeaccesibilidadalmediofsico,
entregndose este compendio en agosto del 2000, para su publicacin, realizada por el Consejo Nacional de
Discapacidades.
Laaplicacinobligatoriadeestasnormas,nohaceotracosaqueejercitarlaequidadquetodoslossereshumanos
tienen,haaccederenigualdaddecondicionesalosserviciospblicosyprivadosquebrindaelentornourbano;a
podercaminarytrasladarsesinobstculos,acircularenelmediofsico,apodercomunicarse,harecibirytransmitir
informacin.
La publicacin de las normas fue el primer paso. El Municipio de Quito incorpor las Normas INEN como Ley
Metropolitana de Accesibilidad al Medio Fsico en la Ordenanza 051 sobre Discapacidades el 7 de Junio del ao
2001;importanteaccinemuladaporlamayoradeMunicipiosdelpas.Ahoravienelomsimportantecomoessu
socializaciny cumplimientoenmarcadoenlosCdigosdeArquitectura,OrdenanzassobreConstruccionesenlos

186

Municipios,ReformasenelpensumUniversitarioenlaformacindeprofesionales,circunstanciasquepermitansu
efectivaaplicacin,ascomolasancinalosentespblicosyprivadosinfractoresdeestanormafundamentalde
convivenciaciudadanaarmnica.

NORMASTCNICASECUATORIANAS
ACCESIBILIDADDELASPERSONASALMEDIOFSICO
1.NTEINEN2239Sealizacin
2.NTEINEN2240SmboloGrfico,CaractersticasGenerales
3.NTEINEN2241Smbolodesorderaehipoacusiaodificultades
Sensoriales.
4.NTEINEN2242Smbolodenovidenteybajavisin
5.NTEINEN2243VasdeCirculacinpeatonal
6.NTEINEN2244Edificios.Agarraderas,BordillosyPasamanos
7.NTEINEN2245Edificios.Rampasfijas
8.NTEINEN2246CrucesPeatonalesaNivelyaDesnivel
9.NTEINEN2247Edificios.CorredoresyPasillos.Caractersticas
Generales
10.NTEINEN2248Estacionamientos
11.NTEINEN2249Edificios.Escaleras

ACCESIBILIDADDELASPERSONASCONDISCAPACIDADYMOVILIZACINREDUCIDAALMEDIOFSICO
12.NTEINEN2291TrnsitoySealizacin
13.NTEINEN2292Transporte
14.NTEINEN2293reaHiginicoSanitaria
15.NTEINEN2299Ascensores
16.NTEINEN2300Espacios,Dormitorios
17.NTEINEN2301Espacios,Pavimentos
18.NTEINEN2309EspaciosdeAcceso,Puertas
19.NTEINEN2312ElementosdeCierre,Ventanas
20.NTEINEN2313Espacios,Cocina

187

21.NTEINEN2314MobiliarioUrbano
22.NTEINEN2315Terminologa

LEYREFORMATORIAALCODIGODELTRABAJO

TomadodelRegistroOficialNo.19830deEnerodel2006.

ELCONGRESONACIONAL
Considerando:
Queelartculo53delaConstitucinPolticadelaRepblicadisponequeelEstado,conjuntamenteconlasociedad
ylafamilia,asumirlaresponsabilidaddelaintegracinsocialyequiparacindeoportunidadesdelaspersonascon
discapacidad;y,queessuobligacinestablecermedidasquegaranticenaestaspersonassuinsercinlaboral;Que
laLeydeDiscapacidades,enelarticulo4,establecelagarantadelEstadoparaelplenoejerciciodelosderechosde
laspersonascondiscapacidad,mediantelaformacin,capacitacineinsercinlaboral,entreotrasaccionesy,enel
articulo19garantizalaaccesibilidadalempleodelaspersonascondiscapacidad;QueelPlanNacionaldeDerechos
Humanos seala en el artculo 28, como obligacin del Estado, formular programas especiales de educacin y
capacitacin para fomentar la participacin social y laboral de las personas con discapacidad y, en el artculo 29
prescribe que se deben promover polticas pblicas de asistencia a estas personas que permitan su acceso a los
mercadoslaborales;QuelosConvenios111,142y159,ascomolasrecomendaciones99y168delaOrganizacin
InternacionaldelTrabajo,OIT,determinanquelasinstitucionespblicasdebenorganizarlosserviciosdeevaluacin
yorientacinlaboraldelaspersonascondiscapacidad,comounmecanismodecapacitacinparaeltrabajo;y,
Enejerciciodesusfacultadesconstitucionalesylegales,expidelasiguiente:
LEYREFORMATORIAALCODIGODELTRABAJO
Art.1.Reformaseelartculo42,delasiguientemanera:
1.Sustituyeseelnumeral2,porlosiguiente:
2. Instalar las fbricas, talleres, oficinas y dems lugares de trabajo, sujetndose a las medidas de prevencin,
seguridadehigienedeltrabajoydemsdisposicioneslegalesyreglamentarias,tomandoenconsideracin,adems,
lasnormasqueprecautelaneladecuadodesplazamientodelaspersonascondiscapacidad..
2.Sustituyeseelnumeral33,porlosiguiente:
33.Elempleadorpblicooprivado,quecuenteconunnmeromnimodeveinticincotrabajadores,estobligado
acontratar,almenos,aunapersonacondiscapacidad,enlaborespermanentesqueseconsiderenapropiadasen
relacinconsusconocimientos,condicinfsicayaptitudesindividuales,observndoselosprincipiosdeequidadde
gnero y diversidad de discapacidad, en el primer ao de vigencia de esta Ley, contado desde la fecha de su
publicacinenelRegistroOficial.Enelsegundoao,lacontratacinserdel1%deltotaldelostrabajadores,enel
terceraoel2%,enelcuartoaoel3%hastallegaralquintoaoendondelacontratacinserdel4%deltotalde
lostrabajadores,siendoeseelporcentajefijoqueseaplicarenlossucesivosaos.
Esta obligacin se hace extensiva a las empresas legalmente autorizadas para la tercerizacin de servicios o
intermediacinlaboral.

188

El contrato laboral deber ser escrito e inscrito en la Inspeccin del Trabajo correspondiente, que mantendr un
registro especfico para el caso. La persona con discapacidad impedida para suscribir un contrato de trabajo, lo
realizar por medio de su representante legal o tutor. Tal condicin se demostrar con el carn expedido por el
ConsejoNacionaldeDiscapacidades(CONADIS).
Elempleadorqueincumplaconlodispuestoenestenumeral,sersancionadoconunamultamensualequivalente
a diez remuneraciones bsicas mnimas unificadas del trabajador en general; y, en el caso de las empresas y
entidades del Estado, la respectiva autoridad nominadora, ser sancionada administrativa y pecuniariamente con
un sueldo bsico; multa y sancin que sern impuestas por el Director General del Trabajo, hasta que cumpla la
obligacin,lamismaqueingresarenuncincuentaporcientoalascuentasdelMinisteriodeTrabajoyEmpleoy
ser destinado a fortalecer los sistemas de supervisin y control de dicho portafolio a travs de su Unidad de
Discapacidades; y, el otro cincuenta por ciento al Consejo Nacional de Discapacidades (CONADIS) para dar
cumplimientoalosfinesespecficosprevistosenlaLeydeDiscapacidades..
3.Sustituyeseelnumeral35,porlosiguiente:
35.Lasempresaseinstituciones,pblicasoprivadas,parafacilitarlainclusindelaspersonascondiscapacidadal
empleo, harn las adaptaciones a los puestos de trabajo de conformidad con las disposiciones de la Ley de
Discapacidades, normas INEN sobre accesibilidad al medio fsico y los convenios, acuerdos, declaraciones
internacionaleslegalmentesuscritosporelpas..
Art.2.Acontinuacindelartculo352,adaseelsiguienteTtulo:
DELTRABAJOPARAPERSONASCONDISCAPACIDAD
Art....ElEstadogarantizarlainclusinaltrabajodelaspersonascondiscapacidad,entodaslasmodalidadescomo
empleoordinario,empleoprotegidooautoempleotantoenelsectorpblicocomoprivadoydentrodeesteltimo
enempresasnacionalesyextranjeras,comotambinenotrasmodalidadesdeproduccinanivelurbanoyrural.
ElMinistrodeTrabajoyEmpleodispondralaUnidaddeDiscapacidadesrealizarinspeccionespermanentesalas
empresas pblicas y privadas, nacionales y extranjeras sobre el cumplimiento de las obligaciones establecidas en
esta Ley. Los Directores, Subdirectores e Inspectores del Trabajo, impondrn las sanciones en caso de
incumplimiento.DeestasaccionesseinformaranualmentealCongresoNacional.
Art....Delaprevencin.Losempleadoresquepornoobservarlasnormasdeprevencin,seguridadehigienedel
trabajo, causaren que el trabajador sufra enfermedad profesional o accidente de trabajo que motive una
discapacidad o una lesin corporal o perturbacin funcional, sern sancionados con una multa de diez
remuneraciones bsicas mnimas unificadasdeltrabajador en general, impuesta por el Director o Subdirector del
Trabajo, la misma que ser depositada en una cuenta especial del CONADIS, sin perjuicio de otras sanciones
tipificadasenesteCdigoyotroscuerposlegalesvigentesatinentesalamateria.Asuvez,asumirnlasobligaciones
quesobrelaresponsabilidadpatronalporaccidentesdetrabajoyenfermedadesprofesionalesestableceelCdigo
delTrabajoencasodenoestarafiliadoalaseguridadsocialonotenerlasaportacionesmnimasparaaccedera
estosbeneficios.
Art....Lacontratacin,eldesempeo,elcumplimientoylasreclamacionesentreempleadoresytrabajadorescon
discapacidad,sesujetarnalasnormasyprocedimientosgeneralesdelaley..
Art.3.Sustityaseelartculo409,porelsiguiente:
"Art. 409. Prescripcin de las acciones. Las acciones provenientes de este Titulo prescribirn en tres aos,
contados desde que sobrevino el accidente o enfermedad. Mas, s las consecuencias daosas del accidente se
manifestarenconposterioridadaste,elplazoparalaprescripcincomenzaracorrerdesdelafechadelinforme
mdicoconferidoporunfacultativoautorizadodelIESS.

189

Para la comprobacin del particular ser indispensable el informe de la Comisin Calificadora en el que se
establezcaquelalesinoenfermedadhasidoconsecuenciadelaccidente.Peroenningncasopodrpresentarse
lareclamacindespusdecuatroaosdeproducidoelmismo..
DISPOSICIONTRANSITORIA
Las instituciones pblicas y privadas, en un plazo no mayor a seis meses, debern realizar las adecuaciones
respectivas que garanticen a las personas con discapacidad, un ambiente de trabajo de productividad y
permanencia.
"ArtculoFinal.LapresenteLeyReformatoria,entrarenvigenciaapartirdesupublicacinenelRegistroOficial.
Dada,enlaciudaddeSanFranciscodeQuito,DistritoMetropolitano,enlaSaladeSesionesdelCongresoNacional,
alosdieciochodasdelmesdeenerodelaodosmilseis.
f)Dr.WilfridoLuceroBolaos,PresidentedelCongresoNacional.
f)Dr.XavierBuitrnCarrera,SecretarioGeneral(E).

LEYREFORMATORIAALALEYSOBREDISCAPACIDADES,CODIFICADA

TomadodelRegistroOficialN250del13deAbrildel2006
Art.1.Sustituyeseelprimerincisodelartculo23,porelsiguientetexto:
"Art. 23. Vehculos ortopdicos y no ortopdicos. La importacin de vehculos ortopdicos y no ortopdicos
destinados al traslado de personas con discapacidad, sin consideracin de su edad, deber ser autorizada por el
ConsejoNacionaldeDiscapacidadesygozardelasexoneracionesalasqueserefiereelarticuloanterior,enlos
siguientescasos:
a)Encasodevehculosortopdicos,cundosedestinenyvayanaserconducidosporpersonascondiscapacidado
movilidadreducidaquenopuedenemplearotraclasedevehculos;
b) Cuando se destinen para el traslado de personas, sin consideracin de su edad, con discapacidad gravemente
afectadaodemovilidadreducida,quenopuedanconducirporsuspropiosmedios;vehculosquesernconducidos
exclusivamenteporpersonasdebidamenteautorizadasycertificadasporelConsejoNacionaldeDiscapacidades.El
vehculo a importarse podr ser de hasta 3 aos anteriores al modelo de la fecha de autorizacin. La persona
discapacitadabeneficiariadeestederecho,podrimportarporunasolavez,anoserquejustifiquedebidamentela
necesidaddebeneficiarsedeunanuevaimportacin;y,
c) Las personas que no sean padre o madre del beneficiario de la importacin del vehculo, ortopdico y no
ortopdico,sesujetarnalodispuestoenelTITULOXVII,DELASTUTELASY,CURADURASENGENERAL,delCdigo
Civilecuatoriano,vigente,observando,tambin,lodispuestoenelliteralanterior,.
Artculo final. Artculo Final. La presente Ley Reformatoria, entrar en vigencia a partir de su publicacin en el
RegistroOficial.
Dada,enlaciudaddeSanFranciscodeQuito,DistritoMetropolitano,enlaSaladeSesionesdelCongresoNacional,
elveintiochodemarzodelaodosmilseis.DadoenelPalacioNacional,enQuito,a4deenerodel2007.

190

f.)Dr.WilfridoLuceroBolaos,Presidente.
f.)Dr.JohnArgudoPesantez,SecretarioGeneral.

191

Anexo 2
INSTITUCIONES QUE TRABAJAN A FAVOR A DISCAPACITADOS ALREDEDOR DEL PAIS
Institucin/
Organizacin

Contacto

Direccin

Ciudad

Telfonos

correoelectrnico

FUNDACION
HERMANO
MIGUEL

MARIA
EUGENIA
PAREDESDE
SUAREZ

CALLECOLIMES
N41182YAV.RIO
COCA

QUITO

3341504 fhm@uio.satnet.net

FUNDACION
SONREIR

ANGELITA
VEINTIMILLA858Y
GUARDERAS JUANLEONMERA

QUITO

2827382 fundsonreir@hotmail.com

RED
IBEROAMERICANA
XAVIER
DEENTIDADESDE
TORRES
PERSONASCON
CORREA
DISCAPACIDAD
FISICA

AV.10DEAGOSTO
5070YNNUU

QUITO

2456088

INSTITUTODE
AUDICIONY
LENGUAJE
"ENRIQUETA
SANTILLAN"

DR.ROBERT
BARBA

CDLAMENA2
(JUNTOALA
REVISIONDE
TRANSITO)

QUITO

2629489

FEDERACION
NACIONALDE
SORDOSDEL
ECUADOR

AV.10DEAGOSTO
TNLG.VINICIO
5451Y
VAQUERO
CARONDELET

QUITO

IGLESIA
FUNDACION
ECUMENICA
JESUCRISTO
MISIONERO

MONS.
JUVENTINODEBENALCAZARN3
11YROCAFUERTE
JESUS
ESPINOSA

QUITO

2283955 juventino2000@yahoo.com

QUITO

2354766 fine@andinanet.net

FUNDACION
OE9BN2326Y
ECUATORIANADE
JUANCARLOS BENJAMINCHAVEZ
INTEGRACION
ARAUJO
SECTOR
SOCIAL"CORAZON
MIRAFLORES
ESPERANZA"

QUITO

2504568 jaraujo@andinanet.net

FUNDACIONDE
AV.10DEAGOSTO
DRA.AMPARO
DESARROLLO
N5070Y
LEON
SOCIALINTEGRAL
NACIONESUNIDAS

QUITO

2456389 fundesi_ec@andinanet.net

FUNDACIONPARA
LAINTEGRACION YOLANDA
DELNIO
ORTIZ
ESPECIAL

AV.CORDOVA
GALARZAKM9
BARRIOSANJOSE
DEPOMASQUI
LOTE9

lared_ecuador@interactive.n
et.ec

0382669682246
fenasec@ecuabox.com
577

192

FUNDACION
AMIGOS
BENEFACTORESDE
ENFERMOS
INCURABLES

SRA.GRACIELA
EGUIGUREN PASAJEMONACO
DE
E665YJAPON
VALDIVIESO

QUITO

2264645 fundabei@interactive.net.ec

FUNDACION
MELVINJONES

ELIZABETH
GRANIZO

CUENCAN865Y
MANABI

QUITO

2573627

FEDERACION
NACIONALDE
ECUATORIANOS
CON
DISCAPACIDAD
FISICA

XAVIER
TORRES
CORREA

AV.10DEAGOSTO
5070YNACIONES
UNIDAS,EDIFICIO
10DEAGOSTO3ER.
PISOOFICINA32

QUITO

2456088 fenedif1@interactive.net.ec

QUITO

2431663 info@fundem.org.ec

FUNDACION
MARIAISABEL JORGEDROMN37
ECUATORIANADE
MUOZDE 79YUNP,SECTOR
ESCLEROSIS
MONCAYO IAQUITO
MULTIPLE

fundmelvinjones@yahoo.com

ASOCIACIONDE
SR.RENZO
DISCAPACITADOS
YANEZ
FEYESPERANZA

CARLOSFREIRES/N
ANTIGUACASA
PARROQUIALDE
CHILLOGALLO

QUITO

2681129

ASOCIACIONDE
DISCAPACITADOS
DELASFUERZAS
ARMADAS

SARGENTO
GUIDO
VICENTE
ORDOEZ

CALLEGENERAL
PAZYMIOY
GRANCOLOMBIA
N5,TRASDEL
HOSPITALMILITAR

QUITO

2506218

ASOCIACIONDE
SORDOSDE
PICHINCHA

SR.LUIS
GUSTAVO
OROZCO
LUCANO

TOMEBAMBA430Y
LLANGANATES

QUITO

ASOCIACION
PARAPLEJICADE
PICHINCHA

LAARMENIA,CALLE
SR.MAURICIO
14,15
SALGADO
CONOCOTO

QUITO

2341632 appcepro@hotmail.com

PASAJEJERONIMO
CARRIONN22Y
CALLEENRIQUE
RITHER(FRENTE
CANCHASTENISDE
LAUNIVERSIDAD
CENTRAL

QUITO

3202768 sjuanimc@interactive.net.ec

FUNDACIONAMOR GABRIELE
TUMBACOSECTOR
YENERGIA
HEIDEPALIZ LAVIA

QUITO

2376153 amen@fundacionamen.org

QUITO

2472754

CENTRODE
EDUCACION
PATRICK
MOTRIZSANJUAN GENTET
DEJERUSALEM

FUNDACION
CAMPAMENTO
CRISTIANO

LCDA.
YAQUELINE
ALDAZ

AV.JUAN
BARREZUETAN
77298YJUANDE

0 galotor1@hotmail.com

administration@camphopeec
uador.org

193

ESPERANZA
FUNDACION
COMPARTIR

SELIS(CARCELEN)
MARIA
CRISTINA
MORENO

REPUBLICADEL
SALVADORN35Y
PORTUGAL

AvOrellana230y
FUNDACIONCON DR.JULIO
10deAgostoEd
CRISTO
RODRIGUEZ FcodeOrellanaOf
302

crismoreno@fundacioncomp
artir.org.ec

QUITO

2268503

QUITO

2902648 f.cristo@uio.satnnet.net

FUNDACION
ADAPALACIOS AV.DIEGOVASQUEZ
CULTURALEDGAR
QUITO
MENDIETA YCEPEDAN77530
PALACIOS

2476413

FUNDACIONDE
ENSEANZA
LILIANADE
INDIVIDUALIZADA
RUDICH
PARANIOSY
ADOLESCENTES

QUITO

2898532 eina@punto.net.ec

FUNDACION
DIAGNOSTICO,
ULLOAN34574
SILVIA
E/PEDROBEDONY
REHABILITACIONE
MALDONADO
INTEGRACIONDEL
AV.REPUBLICA
NIOESPECIAL

QUITO

2245143 fudrine@yahoo.es

CARAPUNGO,3ERA
FUNDACION
DR.NICOLAS ETAPA,FRENTEA
DOCTORAUGUSTO
SALTOS
LA
CESARSALTOS
PAREDES
SUPERMANZANA
JARRIN
C7,LOTEN3065

QUITO

2425020

FUNDACION
ECUATORIANADE SR.HECTOR
CUEVA
OLIMPIADAS
ESPECIALES

QUITO

2508327 olimpesp@hotmail.com

PANAMERICANA
NORTEKM91/2

BERLINN158Y
AV.9DEOCTUBRE.
EDIFICIOWINDSOR,
1ERPISO

sinamune@interactive.net.ec

FUNDACION
ECUATORIANA
PARAEL
DESARROLLO
INTEGRALY
SOLIDARIO

CALLEEDUARDO
AMPARODE SALAZARGOMEZ
PAEZ
151YAV.ELOY
ALFARO

QUITO

2271042

FUNDACION
GENERAL
ECUATORIANA

DR.JORGE
SANJAVIERN26
LUNA
63
MALDONADO

QUITO

2221930 fge1@fge.org.ec

FUNDACION
TIERRANUEVA

LCDA.
MERCEDES
SILVA

CDLA.QUITOSUR
AV.CARDENALDE
ATORRES11115Y
AJAVI

FUNDACION
NACIONALDE

LCDA.ELENA

MIDEROSYESPEJO
S/NSECTORLA

QUITO

QUITO

2636925338873

info@fundaciontierranueva.o
rg

2342563

194

PARALISIS
CEREBRAL

BUITRON

MOYA,CONOCOTO

FUNDACION
NUEVAVIDA

DR.JOSE
EGAS

ISLAISABELAN
4374E/RIOCOCAY
TOMASDE
BERLANGA

QUITO

2458426 fnv@uio.satnet.net

FUNDACIONPARA LCDA.
ELDESARROLLO
GRACIELA
INFANTIL
ORTEGA

CALLESODIRON
119E/RIOSY
VALPARAISO

QUITO

2233739

FUNDACION
PROINTEGRACION
DRA.PILAR
EDUCATIVAY
MERIZALDE
SOCIALDEL
ECUADOR

RAFAELCARVAJAL
N.80387

QUITO

INSTITUTO
ESPECIALPARA
SILVIACRESPO ISLASEYMOURN
NIOSSORDOSY
VEGA
4491YRIOCOCA
CIEGOSMARIANA
DEJESUS

QUITO

2440844

INSTITUTOFISCAL
DRA.NELLY
DEEDUCACION
INTEGRADAJOSE MIO
MARTI

MANUELLOPERA
N5160EIQUIQUE

QUITO

2571345

INSTITUTOFISCAL DR.RAUL
DEEDUCACION
TORRES
ESPECIAL
MONCAYO

ARCHERHARMAN
N141YJ.
STEPHERSON

QUITO

2655064 ifee_3@hotmail.com

QUITO

2469067

LOSOLIVOS991Y
SANISDRODEL
INCA

QUITO

2405240

CONOCOTO,AV.
FUNDACIONGAMA
DR.MARCELO CIUDADDELNIO
GRUPODEAYUDA
ESCOBAR
S/NFRENTEAL
MUTUA
OA
HOSPITALDEL
AVANZADA
INNFA

QUITO

2340724

FUNDACION
VIRGENDELA
MERCED

MARIA
GALARZADE X
MORALES

QUITO

FUNDACION
CATEQUA

LUISIGLESIAS
X
BARON

QUITO

INSTITUTO
NACIONALDE
AUDICIONY
LENGUAJE

MACHALAS/NY
DR.JOSE
AV.FLORIDAY
BENALCAZAR FERNANDO
DAVALOS

FUNDACION
ATENEO

RITA
ESPINOZA

280387 finesec@punto.net.ec

195

ASOCIACIONDE
FACULTADES
DR.CESAR
ECUATORIANASDE HERMIDA
CIENCIASMEDICAS BUSTOS
YSALUD

QUITO

FUNDACION
ECUATORIANADE
LADISTROFIA
MUSCULARY
DR.JOHN
OTRAS
VELA
ENFERMEDADES
NEUROMUSCULAR
ESJUANCARLOS
VELA

ISLASEYMUR4461
YRIOCOCA

QUITO

2451076

CENTRODE
ERRADICACIONDEL
P.JAIME
BOCIOY
ALVAREZ
CAPACITACIONDE
MINUSVALIDOS

QUITO

ASOCIACIONDE
JUANMARIA
PERSONAS
AUXILIANTESDE BAUTISTA
X
MONENTE
NIOS
DISCAPACITADOS
HANDICAP
DR.JUAN
AMERICALATINA
CUEVA
CAPITULO
JARAMILLO
ECUADOR

QUITO

CENTRO
EDUCATIVO
FAMILIAFELIZ

QUITO

FUNDACIONPADRELUISANTONIO
ANGELMARIA
SERRANO
X
IGLESIAS
RODAS

QUITO

FUNDACIONREINA
SOFIAARTETA IAQUITON37236
DEQUITO
DECUEVA
YVILLALENGUA
PROYECTOAPOYO

QUITO

ANGEL
JACOME
MENA

FUNDACIONVALLE ING.ODDE
INTEROCEANICO HANSSEN

FUNDACION
FRATERNIDADDE
VICTOR
REHABILITACION
ANCHALUISA X
DE
COBA
DISCAPACITADOS
DELAPOLICIA
NACIONALDEL

2699939 frq@andinanet.net

QUITO

196

ECUADOR
FUNDACION
SAMMYSOSA

CARLOS
CARDENAS

FUNDACION
MOMENTUM
INTERNACIONAL

MANUEL
CARDENAS
CABRERA

FUNDACION
MACARA,PAZY
HUMANISMO

VICTOR
MANUEL
LOPEZ

ASOCIACIONDEEX
SGOS.
COMBATIENTES
CRISTOBAL
DISCAPACITADOS
MARTINEZ
ALTOCENEPA

AV.PEDROVICENTE
MALDONADO
QUITO
SECTORLA
RECOLETA

2280750 altocenepa95@yahoo.es

ASOCIACIONDE
ATAXIAS
ECUATORIANA

FERNANDO
XAVIER
ESCUDERO

HERNANDOCHICA
N5973YLUIS
TUFIO

QUITO

2475134

ASOCIACIONDE
PERSONASCON
DISCAPACIDAD
FISICADE
PICHINCHA

PATRICIO
GUAMAN

CUENCAN681Y
CHILE

QUITO

2666696 apdfipquito@yahoo.com

QUITO

INSTITUTODE
DR.FRANCO
EDUCACION
X
MACAS
ESPECIAL"KLEBER
GUAMAN
TINOCOPINEDA"

FUNDACION
MANOSUNIDAS
CENTRODE
RECUPERACION
INTEGRAL

LOURDES
VELASTEGUI
CARRASCO

ASOCIACIONDE
PADRESDE
FAMILIADE
PERSONASCON
DISCAPACIDAD

JHONSON
GERMAN
RAMON
HURTADO

FUNDACION
JOSE
ECUATORIANADE CONTRERAS
HEMOFILIA
CORDOVA

FUNDACIONDE
EDUCACION
ELENA
ESPECIALPARA
LANDETA
DEFICIENTES
PAZMIO
AUDITIVOS"LAVOZ
DELSILENCIO"

DeLosTulipanes
338yDeLos
RosalesPasajeA
CasaNo.5

QUITO

2432436

lavozdelsilencio1@hotmail.co
m

197

FUNDACIONDE
APOYOAL
DESARROLLO
COMUNITARIO
"POMASQUI"

RVDO.SEGUN
DO
X
JARAMILLO
ESPINOSA

ING.
SOCIEDAD
MAURICIO
PROTECTORADELA
CEVALLOS
INFANCIA
ESCALA

ASOCIACIONDEEX
BECARIOSYEX
SRA.JENNY
LUCIATORRES X
ESTUDIANTES
ECUATORIANOSEN DEDAVILA
FRANCIA

QUITO

ASOCIACIONDE
JOSEIVAN
DISCAPACITADOS
LLORILLORI
"10DEOCTUBRE"

COMUNIDAD
DR.GIANNI
INTERNACIONALDE
TARQUINI
CAPODARCO

QUITP

FUNDACION
MARIA
"MARIADOLORES DOLORES
BLASCHKE"
BLASCHKE

QUITO

FUNDACION
"ASISTENCIA
SOCIALPARALA LUISSANCHEZ
X
REHABILITACION ARCOS
NEUROPSIQUIATRI
CAYEPILEPTICA

QUITO

FUNDACIONDE
ACCION
COMUNITARIA

QUITO

UNIDAD
EDUCATIVABASICA HNA.ROSARIO
FISCOMISIONAL
SONGOR
X
GUAMAN
"PEDROPABLO
ANDRADE"

FUNDACION
EDUCATIVAAMA
/DEUS

LIC.SARA
RISSER

ESCUELAFISCALDE DR.VICTOR
DISCAPACIDAD
GUERRERO
MOTRIZ
YEPEZ

ARTURO
YEPEZ

SOCIEDAD
DR.HUGO
ECUATORIANADE

198

MEDICINAFISICAY LARARODAS
REHABILITACION
ASOCIACIONDE
INVIDENTES
"MILTON
BEDADO"

MANUEL
VINTIMILLAYJUAN
TAMAY
LEONMERA858
PALAGUACHI

FUNDACION
AYUDAMEA
TRABAJAR

NIXON
HERRERA
RIVAS

FUNDACIONDE
ALFONSO
VIDA,REALIDADY BLIECER
SERVICIO
MORALES

QUITO

2529962 tamay@andinanet.net

ESCUELAFISCALDE
DR.CLIMACO CALLEJOAQUIN
EDUCACION
VINUEZA
SOTON0E474Y
ESPECIALDEL
AMPUDIA
AV.OCCIDENTAL
NORTE

QUITO

2599966

CENTRODE
REHABILITACION
PARALISIS
CEREBRALY
RETARDO
PSICOMOTOR

AV.DELOS
NANCYFLOR FRESNOSYLOS
DEMADERA GUAYACANES(LOS
LAURELES)

QUITO

2412232

FUNDACION
HEMOFILICA
ECUATORIANA

PABLO
BOLIVAR
CONSTAIN
CHANG

AV.ELOYALFARO
N40348ENTRE
JOSEQUERIY
GRANADOS

QUITO

2459193 fabitamariz@hotmail.com

FUNDACION
AYUDEMOSA
VIVIR

ROSA
ROMERO

CALLEDELNIO
S/N
INSTALACIONES
INNFACONOCOTO

QUITO

FUNDACION
LOGROS

JORGE
EDUARDO
CARRERA

QUITO

QUITO

JEANPIERRE
X
MICHELET
HAURTFELD

QUITO

LOURDES
CATALINA
ENDARA
VENEGAS

QUITO

2652818

MARIADEL
FUNDACIONMARIA
CARMEN
JOSE
CABRERA
FUNDACION
NACIONALDEL
PERROGUIA
O.N.C.E
FUNDACION
CENTRO
EDUCATIVODE
PARALISIS

ANTONIODE
PRADO317Y
DIEGODE
VILLANUEVA

345143 ayudemosavivir@yahoo.com

199

CEREBRAL
FUNDACION
ECUATORIANADE
REHABILITACIONY MANUEL
CAPACITACIONDE PEREZ
NOVIDENTESY
RENDON
DEFICIENTES
VISUALES

QUITO

FUNDACION
"TODOSCONTRA
ELPARKINSON"

INESHIDALGO
X
DELOZANO

QUITO

ASOCIACIONDE
EGRESADOSDEL
INSITUTO
NACIONALPARA
CIEGOSDEL
ECUADOR

ECUADOR
TORRES
RENDON

QUITO

FEDERACION
ECUATORIANAPRO DRA.ANA
TERESA
ATENCIONALA
X
PERSONACON
RAMIREZDE
SUAREZ
DEFICIENCIA
MENTAL

QUITO

FUNDACIONDE
ROBERTO
INVESTIGACIONDE
RIVERA
ORTESISY
GARCIA
PROTESIS

QUITO

ASOCIACIONDE
PADRESDE
FAMILIADE
SANDRA
PERSONASCON
VAZQUEZDE X
DEFICIENCIA
PROAO
MENTALYCASOS
ESPECIALES

QUITO

FUNDACION
MERCEDESDE
DOCTOR
X
WENCESLAO
GUERRERO
OLLAGUELOAIZA

QUITO

FUNDACIONPARA ING.
ELDESARROLLODE EDUARDO
LAEDUCACION
CAICEDO
ESPECIAL
ANDINO

FUNDACIONDE
ISLASAN
HEYRAAYORA
EDUCACION
CRISTOBALY
ESPECIALY
DEVIRUES
YASUNIS/N
REHABILITACION
DIAGONALAL

QUITO

2257072

200

HOTELSAVOY,
DISPNSARIOSAN
AMICI
X
JUANDE
MACQUERON
JERUSALEM

QUITO

FUNDACIONDE
EDUCACIONY
PROTECCIONPARA
MACHALAN67152
BETTYARAUJO
PERSONASCON
E/CUICOCHAY
DESINCHE
RETARDOMENTAL
BELISARIOTORRES
SEVERO"GORRITAS
AZULES"

QUITO

CENTRODE
LIC.JOSE
PROTECCIONPARA
URANGAU.
DISCAPACITADOS

QUITO

RIOFRIOYJUAN
FUNDACION
DR.ROMULO LARREAESQUINA,
ECUATORIANADE
LOPEZ
EDIFCLINICA
NIOSDOWN
CENTRAL2DOPISO

QUITO

2560615

DRA.ESTHELA
FUNDACIONAMAR
X
FERAUDJ.

QUITO

FEDERACION
NACIONALDE
SRA.MARIA
ORGANISMOSNO
TERESA
GUBERNAMENTALE
DONOSO
SPARALA
DISCAPACIDAD

QUITO

2436709 fenodis@hotmail.com

AV.AMAZONAS
6401YAV.ELINCA

2295565 paidia@easynet.net.ec

ASOCIACIONDE
PADRESDE
PERSONASCON
DEFICIENCIA
MENTAL

ECO.RAFAEL SINDIRECCION
DELPOZO
NOTIENELOCAL

QUITO

2650350

FUNDACION
NUEVOS
SENDEROS

ING.OSCAR
CAMPI
GARCIA

QUITO

FUNDACION
NUEVAVIDA

ING.JULIO
VASCONEZ

AvenidaAmrica
N37125.yBarnde
Carondeleth

QUITO

CENTRODE
EDUCACION
ESPECIALY
TERAPIADE
LENGUAJE"MI
ESCUELITA"

LCDA.
MAGDALENA X
GUEVAR

CENTROINTEGRAL
LCDA.OLGA
DEEDUCACION

2458426

fundanuevavida@andinanet.
net

QUITO

QUITO

201

ESPECIALY
ESTIMULACION

MERIZALDE

ESCUELA
LIC.GLORIA
PARTICULAR
"BILINGUE
SANCHEZ
INTERAMERICANA" CEDILLO
SECCIONESPECIAL

QUITO

FUNDACION
"GRUPOTALLER
INTEGRAR"

ELIZABETH
ROMAN
SUAREZ

QUITO

INSTITUTODE
PARALISIS
CEREBRAL

DRA.NANCY RIOCOCAYSANTA
YANEZ
FE

QUITO

2440868

QUITO

2243258

FUNDACIONDE
ASESORAMIENTO
INFORMATICO
MORENOBELLIDO
ING.MARCELO
FINANCIERO
111YMARIANADE
CONTABLEPARAEL YUMICEBA
JESUS
DESARROLLO
TECNOLOGICO
SOCIAL

QUITO

2520778

JARDINDE
INFANTESY
ESCUELA
DRA.NELLY
PARTICULAR
BERMEOB.
"INTEGRACIONSIN
FRONTERAS"

QUITO

FUNDACION
ECUATORIANA
PARA
REHABILITACION
INTEGRALDEL
MINUSVALIDO

9DEOCTUBRE718
YRAMIREZ
DAVALOSOF201

QUITO

2540572

CECILIA
FUNDACION
LANDAZURI
AMOR,VIDAYLUZ
MORALES

DR.LUIS
ALEJANDRO
CIFUENTES
MARTINEZ

PSJEBATODANO
368YLOSPINOS.
CDLA
KENNEDY(FRENTE
ALCUARTEL
RUMIAHUI)

FUNDACION
EXPERIMENTALDE
EDUCACIONY
ING.VICTOR
X
CAPACITACIONEN PROAO
AREASTECNICASA
DISCAPACITADOS
FUNDACION

WILSON

QUITO

202

ECUATORIANADE ESTUARDODE
EDUCACIONY
LACRUZ
REHABILITACION
DE
DISCAPACITADOS
"MITADDEL
MUNDO"
FUNDACIONPARA INESYOLANDAPAEZ738Y
LAINTEGRACION CASTRO
RAMIREZDAVALOS
DELEXCEPCIONAL BARRAGAN PLANTABAJA

QUITO

CARLOSANDRADE
MARINN359Y
ABELARDO
MONTALVO(FRENT
REALCOUNTRY
CLUBDELAFAE)

QUITO

2403226

FUNDACION
GRACIELA
LEONARDOPONCE PONCEDE
POZO
CRESPO

AV.LAFLORIDAY
AV.OCCIDENTAL

2258452

FUNDACION
ECUATORIANA
PARAEL
DESARROLLO
INTEGRALEN
PARALISIS
CEREBRAL

AV.COLON535Y6
DEDICIEMBRE.
EDIFICIOCOLON
OFIC801

QUITO

2529132

FUNDACIONARTE
X
ESPECIAL
ECUADOR

QUITO

FUNDACIONPOR
COMUNIDADDE
VIDA

QUITO

AV.10DEAGOSTO
N39254

QUITO

FUNDACION
HUMANIDAD

RAFAEL
CARRERA
CUSTODE

ROSAMEJIA
DESANTOS

DR.DIEGO
FUNDACIONVISTA
MAURICIO
PARATODOS
NIETO

FUNDACION
AV.DIEGODE
ECUATORIANADE
VASQUEZN7516
LUCIATRAVEZ
OSTEOGENESIS
LOCAL#19C.C.
IMPERFECTA
INTEGRAL

QUITO

FUNDACION
ACCIONSOCIAL
CARITAS

SDR.
OBISPO
SANTO
LEONARDO
SHUMACHERN
DOMINGO
OVIEDO.DR
414YPADREMAYA
PAOLOFINK

FUNDACIONDE
INTEGRACION
PARALAS

PATRICIA
ALVEAR

JOSEMARIA
BORREROY10DE
AGOSTO8A

QUITO

2432520 fuvispt@porta.net

0224772356

2751870

feoi@osteogenesis.info
feoi@hotmail.com

fundacioncaritas@andinanet.
net

2410215

203

PERSONAS
AUTISTAS

VILLARROEL BLOQUED

ASOCIACIN
UNMONOS

AV.PATRIAY10DE
WILLIAM
AGOSTOEDF.
ANTNIODIAZ
BANCOD
PFEIL
EPRESTAMOS

QUITO

2546405

FUNDACIONEL
TRIANGULO

AV.DIEGODE
NANCYVASCO VASQUEZYPASAJE
DE
"C"LOTE21
MALDONADO SECTOR
PONCEANO

QUITO

2481073

QUITO

2295565 gracielalopez@latinmail.com

QUITO

2957785

FUNDACIONDE
PROTECCIONDE ING.EDGAR
JARRIN
PERSONASCON
RETARDOSEVEROYCEVALLOS
AUTISMO
ASOCIACIONDE
TELEFONISTAS
CIEGOS"9DE
MARZO"

MACHALAN67
152
ENTRECIUCOCHAY
BELISARIOTORRES

RAMON
BOLIVAR268Y
FLORES
VENEZUELA
COLLAHUAZO

fun@fundacioneltriangulo.or
g

FUNDACION
AYUDAME
CAMINEMOS
EDGARTACO
JUNTOSPARA
NIOSESPECIALES

LUISVACCARIS/N
BLOQUEHERMANO
PARRA(ENTRADA
PRINCIPALDE
CARAPUNGO)

QUITO

2423764

fundacionayudame1@hotmai
l.com

FUNDACIONJUAN FERNANDO
DIEGO,MASALLA VALENCIA
DELASESTRELLAS ALBORNOZ

JosMaraAyora
N39151

QUITO

2920159

ongjuandiego@panchonet.ne
t

CENTRODE
DR.OSCAR
PROTECCIONPARA
MORA
PERSONASCON
GALVEZ
DISCAPACIDAD

AV.25DEJULIOY
PERIMETRAL

QUITO

2633428 ceprodis_q@hotmail.com

CORPORACION
FEMENINA
ECUATORIANA

RodrigoMuozy
HernandoParedes

QUITO

2471164 iftem@andinanet.net

SRA.HILDA
EGUEZDE
JARAMILLO

MARIALETICIA
FUNDACIONUNA
FerroviariaAlta
ALAJO
LUZENELCAMINO
CasaParroquial
CADENA

QUITO

CALLEROCAFUERTE
ESCUELADE
VIAJUAN
EDUCACIN
LCDO.GALO
MONTALVO
CAYAMBE
MALDONADO
ESPECIAL
BARRIOLAS
GEOVANNYCALLE
ORQUIDEAS
ASOCIACION
NUEVAVIDADE

SR.PATRICIO

CALLEASCAZUBIY CAYAMBE
10DEAGOSTOS2

2110018

2363968

204

CAYAMBE

VILLOTA

55ESQUINA

INSTITUTODE
EDUCACION
ESPECIALFEY
ALEGRIA

MAGISTER
DIEGO
GARCIA

AV.LAPAZY
TIPUTINI

FUNDACION
ACCIONSOCIAL
CARITAS
PROGRAMAFEY
LUZ

COOP.20DE
PADREPAOLO OCTUBRECALLE
FINK
SANTAMARIAY
SANTACRUZ

SANTO
DOMINGO

3752377

SANTO
DOMINGO
DELOS
COLORADO
S

3709318

ASOCIACIONDE
DISCAPACITADOS
SRA.ROSA
DEPUERTOQUITO
AYORA
CAMINEMOS
JUNTOS

MERCADO
MUNICIPAL
PASAJES/NY
MARISCALSUCRE

PUERTO
QUITO

092213553

CLUBDEPORTIVO
DEDEPORTISTAS SR.JUAN
CARLOS
ESPECIALES
"PRIMOSY
ARAUJO
PRIMAS"

PABLOSOSA141Y
SUCRE
(CONOCOTO)

QUITO

2341035

CENTRONACIONAL DRGALO
DEEPILEPSIA
PESANTEZ

BERRUTIETAS/NY
ACEVEDO

QUITO

2905405 gpesantez@uio.telconet.net

CAICEDO
INSTITUTO
VALLADARES VENEZUELA131
NACIONALDEL
OE4YSUCRE
CARLOS
NIOYLAFAMILIA
EFRAIN

QUITO

2529858 lmaiza@innfa.org

FUNDACION
LUISGONZALOFRAYGREGORIO
INTEGRALDE
ARCEPADILLA ZUAZON66146
APOYOALSORDO

QUITO

2598548 fias_ec@hotmail.com

clubprimosyprimas@gmail.co
m

FUNDACION
DRA.ELENA
TERNURAYAMOR ROSERO

SANTO
DOMINGO
CALLESTA.MARIA
DELOS
YANILLOVIAL
COLORADO
S

2750340

INSTITUTO
CECILIA
EDUCATIVOY
BARRIGA
PSICOTERAPEUTIC
BAQUERO
ODELNIO

COCHAPATAE11
116ABASCAL

QUITO

2432959

QUITO

099831320

QUITO

2958999

FUNDACIONPARA
ELDESARROLLO
MAYASN45189Y
DRA.SILVANA
GUARUMOS,
DELMENORCON
VITERIRIERA
NECESIDADES
SECTORELINCA
ESPECIALES
FUNDACION
EQUINOCCIAL

DRA.IVONE

NUMAP.LLONA

fundacionternurayamor@yah
oo.com

205

PARAEL
VALAREZO
DESARROLLO,
TRABAJOY
PRODUCCIONDEL
DISCAPACITADO

N1402YAGUACHI

DesplieguedeCoordinacionesProvinciales:

PROVINCIA CAAR
CIUDAD AZOGUES
COORDINADOR Dra.PaolaJimbo
DIRECCION ASOCIACINDEDISCAPACIDADESFSICASDELCAAR(ADISFICA)
TELEFONOS (07)2242258
email
PROVINCIA AZUAY
CIUDAD CUENCA
COORDINADOR Lcdo.DanielVillavicencio
DIRECCION CalleLargayAv.HuaynaCapac,posterioraled.BancoCentral
TELEFONOS 072837200
email
PROVINCIA BOLIVAR
CIUDAD GUARANDA
COORDINADOR Dra.AdrianaTorres
DIRECCION HOSPITALPROVINCIALALFREDONOBOACALLESELVAALEGRE

206

TELEFONOS (03)2982840
email
PROVINCIA CARCHI
CIUDAD TULCAN
COORDINADOR Ing.AdaTez
DIRECCION CALLESUCRES/NYAYACUCHO:EDIFICIODELAGOBERNACINDELCARCHI
TELEFONOS (06)2983374
email aida_taez@hotmail.com
PROVINCIA CHIMBORAZO
CIUDAD RIOBAMBA
COORDINADOR Lcdo.RolandoGmez
DIRECCION Brasil2003yLuisAlbertoFalconINNFA
TELEFONOS 032951371
email
PROVINCIA COTOPAXI
CIUDAD LATACUNGA
COORDINADOR Lcdo.FlavioGutirrez
DIRECCION CALLEMARQUZDEMAENZAYQUITO(SECTORDESANAGUSTN)
TELEFONOS (03)2812831
email flavio031079@hotmail.com
PROVINCIA ELORO
CIUDAD MACHALA
COORDINADOR Lcda.BettyCeli

207

DIRECCION RocafuerteyGuayasesq.Edif..delBancoCentral,3do.piso
TELEFONOS 072936433
email
PROVINCIA ESMERALDAS
CIUDAD ESMERALDAS
COORDINADOR Ab.NubiaGalvn
DIRECCION Bolivar,entreJuanMontalvoyRocafuerte(INNFA)
TELEFONOS 062715742
email
PROVINCIA FRANCISCODEORELLANA
CIUDAD COCA
COORDINADOR Dra.SilviaVillacrs
DIRECCION
TELEFONOS 091556243
email silviaenrique_1@hotmail.com
PROVINCIA GALAPAGOS
CIUDAD GALAPAGOS
COORDINADOR Dr.RigobertoBenavidesRevelo
DIRECCION EscueladeEducacinEspecialPuertoAyoraIslaSantaCruz
TELEFONOS 05526145
email
PROVINCIA GUAYAS
CIUDAD GUAYAQUIL

208

COORDINADOR Dr.EfrenGaraicoa
DIRECCION CalleAlejoLascanoentreAv.QuitoyAv.Machala
TELEFONOS 042289880
email
PROVINCIA IMBABURA
CIUDAD IBARRA
COORDINADOR Srta.NoemTrejo
DIRECCION FloresyBolivar,Edf.DelTorren
TELEFONOS 062610690
email
PROVINCIA LOJA
CIUDAD LOJA
COORDINADOR Dra.LorenaReinoso

DIRECCION

calleValviezoyRiofrio,DispensarioMdicoyPromocinSocial,Sto.Domingode
Guzman,

TELEFONOS 072575625
email
PROVINCIA LOSRIOS
CIUDAD BABAHOYO
COORDINADOR Dra.CelesteSolarte
DIRECCION
TELEFONOS 091042292
email jsolarte68@hotmail.com

209

PROVINCIA MANABI
CIUDAD PORTOVIEJO
COORDINADOR Lcda.PatriciaVintimilla
DIRECCION Av.Manab,CentrodeRehabilitacindelINNFA
TELEFONOS 052634834
email
PROVINCIA MORONASANTIAGO
CIUDAD MACAS
COORDINADOR Lic.FannyPuma

DIRECCION

DIRECCINPROVINCIALDELMINISTERIODEBIENESTARSOCIALCALLEAMAZONAS
ENTRESUCREYBOLVAR

TELEFONOS (07)2700939
email fapumats@hotmail.com
PROVINCIA NAPO
CIUDAD TENA
COORDINADOR NOHAY
DIRECCION
TELEFONOS
email
PROVINCIA PASTAZA
CIUDAD PUYO
COORDINADOR NOHAY
DIRECCION

210

TELEFONOS
email
PROVINCIA SUCUMBIOS
CIUDAD LAGOAGRIO
COORDINADOR Lcda.MnicaQuiroga
DIRECCION
TELEFONOS 086220671
email mmquiroga@hotmail.com
PROVINCIA TUNGURAHUA
CIUDAD AMBATO
COORDINADOR Dr.DiegoVillacres
DIRECCION Valencia319ySaragozo
TELEFONOS 032400275
email
PROVINCIA ZAMORACHINCHIPE
CIUDAD ZAMORA
COORDINADOR Dra.DianaArmijos
DIRECCION EDIFICIODESOLCA,CALLEMANUELITACANIZARESYPASAJESINNOMBRE
TELEFONOS 094450690
email dianaarmijos57@latinmail.com

211


Anexo4.

INFORMACINPUNTUALDEINSTITUCIONESQUETRABAJANCONDISCAPACITADOS

FGE.(FUNDACIN GENERAL ECUATORIANA)


Historia
Su fundador Anthony Kennedy Shriver, se dio cuenta de la injustificada falta de oportunidades que
enfrentan las personas con discapacidad intelectual para socializar con los compaeros que no
tienen discapacidad.
Luego, observando el poder y el impacto que puede llegar a tener la amistad en el desarrollo de las
personascondiscapacidadintelectual,ensuautoestimayenelconceptoquetienendelasociedaden
que vivimos, al ser l un estudiante universitario, tambin se percat de la energa y del sentido de
compromisoquetienenlosestudiantesparalograrcambiospositivosensuscomunidades.
Desdesucreacinen1989,BestBuddieshaimpactadomsde250.000vidastantodevoluntarioscomo
desusmejoresamigosyaquellosrelacionadosconelprogramaentodaslascomunidadesalasqueha
llegado.
Ha dejado de ser una organizacin ms de estudiantes en la Universidad de Georgetown para
convertirseenunaorganizacinquetienemsde50,000participantesenloscampusdeuniversidadesy
preparatorias de los 50 estados de Estados Unidos de Norte Amrica; as como en Canad, Mxico,
Colombia, Cuba, Egipto, Irlanda, Filipinas y Suecia; se estn desarrollando programas en Austria,
Dinamarca,HongKong,NuevaZelanda,ArabiaSaudita,Sudfrica,Espaa,TurquaeInglaterra.

Una organizacin no gubernamental de cooperacin al desarrollo, sin fines de lucro, constituida en


1980, aprobada por el Ministerio de Bienestar Social, (Acuerdo No. 4333), e inscrita en el Consejo
NacionaldeDiscapacidades,(No.39).LapolticainstitucionaldelaFundacinGeneralEcuatorianaest
dentrodelmarcodelapolticaglobaldelestadoecuatorianosobreeldesarrolloylainclusinsocial.
En sus veinte y siete aos de funcionamiento se ha convertido en una de las organizaciones no
gubernamentales de mayor incidencia en las reas de: capacitacin, discapacidades e intervencin
social, a nivel nacional, como se advierte en la descripcin sinttica de los programas, servicios y
proyectos.

INSERCINLABORAL
Antecedentes
UnavezquelaReformaalCdigodeTrabajo,amparaalaspersonascondiscapacidadparaelaccesoal
empleo,yquelaFundacinGeneralEcuatoriana,pioneraeneltema,decidenoserobservadordeestos
eventostrascendentesparalaspersonascondiscapacidadysuintegracinaltrabajo;creael"Servicio
IntegraldeInsercinLaboralparaPersonasconDiscapacidad".

212


Objetivogeneral
Facilitar la integracin socio laboral de personas con discapacidad que cuenten con competencias
laborales, al mercado laboral formal de ciudad de Quito y sus alrededores, proveyendo apoyos
necesariosyposibilitandolaestabilidadlaboral
Objetivosespecficos
BrindarServiciodeAsesoraaempresasubicadasenQuitoysusalrededores.
Disponerdeperfilesaptitudinalesyexpectativaslaboralesdelaspersonascondiscapacidadusuariasdel
serviciodeInsercinLaboral.
Buscaryoposibilitarlacreacindepuestosdetrabajoenelmercadoformal.
Fomentar la confianza del empresario a travs de orientacin e informacin para favorecer la
contratacindepersonascondiscapacidadintelectual.
Facilitarlaestabilidadlaboraldelaspersonascondiscapacidadconlosqueseinterviene,atravsdel
desempeoptimoenlasfuncionesylafirmadecontratoslaborales.
Coordinaraccionesentre,laempresa,el"trabajador"ylafamilia.
Realizarelseguimientodelaspersonascondiscapacidadinsertadasenlospuestosdetrabajo.
Incidirenlasdiferentesaccionesquesedesarrollenconestetema,anivelpblicooprivado.
Posibilitarlacreacindeenclaves.

Actividades
AnlisisdelMercadoLaboral
BasedeDatosdeempresasqueinteresacontactar.(Capital,CmaraEcuatorianaNorteamericana).
Priorizacindeempresasavisitar.
Citasenempresasparaofrecerelservicio.
ConveniodeasesoraySeguimiento
Contactoconpersonascondiscapacidadparaatendersusrequerimientosdeintegracinlaboral
Coordinacin de acciones de evaluacin de personas con discapacidad, para obtencin del perfil
aptitudinal.
ElaboracindeAnlisisOcupacionalesyPerfilesdepuestosdetrabajoenlasempresas.
Charlas informativas y de sensibilizacin a empresarios y trabajadores de las empresas en las que se
integranpersonascondiscapacidad.
Seguimientodelprocesodelegalizacindecontratosdetrabajodepersonascondiscapacidad.

213

Definicindelasadaptacionesenlospuestosdetrabajoparaelptimodesempeodelaspersonascon
discapacidad.
Seguimiento del desempeo laboral de las personas con discapacidad (monitores) insertadas en el
mercadolaboral.(Comunicacinpermanenteconlapersonacondiscapacidad,sufamiliaylaempresa).
Participacin activa en reuniones de trabajo, a nivel pblico o privado, que involucren el tema de
integracinlaboraldepersonascondiscapacidad.
Recomendaciones y acciones con las empresas asesoradas para laproyeccin futura de conformacin
deenclaves

Beneficiosparalapersona

Beneficiosparalaempresa

Empleoestable

Contar con el apoyo de un Equipo Profesional


solventeyconexperiencia

Aporte econmico para sustento de si mismo y su


Contarcontrabajadoreseficientesycomprometidos
familia
ApoyodeprofesionalesqueorientanensuintegracinImagendeempresaconconcienciasocial
laboral,relacinsocialeindependencia
ApoyoenelcumplimientodelaLey
capacitacinposteriordesernecesario

ProcesodeInsercinLaboral
Visitaalaempresa
Estudiodepuestosdetrabajo
Orientacinycapacitacinalaempresa
Seleccindepersonascondiscapacidaddeacuerdoalosrequerimientosdelaempresa

214

Orientacinenadaptacinalpuestodetrabajo.
Seguimiento

Apoyos
Profesionalesconexperienciaenelrea.
Procesosadaptadosapersonascondiscapacidadyalmedioprobados.
Apoyosderefuerzoyseguimiento
Familia
Entornolaboralsocial
CdigodeTrabajo

LeyReformatoriaalCdigodelTrabajo

Articulo42

"33.Elempleadorpblicooprivado,quecuenteconunnmeromnimodeveinticincotrabajadores,
est obligadoa contratar, al menos, auna personacondiscapacidad,en laborespermanentesque se
consideren apropiadas en relacin con sus conocimientos, condicin fsica y aptitudes individuales,
observndose los principios de equidad de gnero y diversidad de discapacidad, en el primer ao de
vigenciadeestaLey,contadodesdelafechadesupublicacinenelRegistroOficial.

215

Esta obligacin se hace extensiva a las empresas legalmente autorizadas para la tercerizacin de
serviciosointermediacinlaboral.

LISTADEPROYECTOS

Proyecto Borrando Fronteras

Una oportunidad para fortalecer capacidades y destrezas, abrir espacios de aprendizaje, reflexin y
dilogo.ConauspiciodeFundacinDeWaal,sediseesteProyectodealcancenacional;en32mesesa
partirdemayode1996,seejecutaron24procesosdeformacin,obtenindoseenuncolectivode430
capacitadores,cambiosenlasconcepciones,actitudesycomportamientosrelativosalaspersonascon
discapacidad,ascomosutareaenrelacinconlasmismas,conelfindequeincrementenlacantidady
mejoren la calidad de respuestas a las personas con discapacidad en el Ecuador. Este proyecto ha
beneficiadoindirectamentea21.500personas.
Como continuidad de este proyecto y contando con el auspicio de la Fundacin ONCE de Espaa se
disearonlosmanualesde"GestindeOrganizacionesSociales",losmismosquefueronvalidadosen
uncursocondirectivoslderesdeONG's.
Con el fin de que este producto y otras iniciativas de capacitacin tengan un nivel diferente y sean
avalizadas por medio de las instituciones de educacin superior como son las universidades, en
asociacinconlaUniversidadTcnicaParticulardeLoja,seestejecutandoel"DiplomadoSuperiorde
CuartoNivelenIntervencinSocial",conmodalidadadistancia,medianteelcualseformaapersonas
delsectorsocialconcaractersticasflexibles,polivalentes,conconsistenteticapersonalyprofesional,
con una comprensin global de la situacin que nos rodea, que sean capaces de innovar, que estn
conscientesdelanecesidaddeformarse,queestnpermanentementeactualizadosyqueseancapaces
decrearyprogresarenequipo.

Difusincultural
Mediantelaentregadelibrosa400localesdelSistemaNacionaldeBibliotecas(SINAB)yanumerosas
bibliotecasmunicipaleseInstitutosdeEducacinEspecial,entodoelPas.(19891990)
Proyectodeviviendasocial
EjecutadoalSurdeQuito,enasociacinconlacompaaconstructoraCONVISAyconlaparticipacin
del departamento de MANDATO de la Mutualista Pichincha, compuesto por 105 viviendas y 8 locales
comerciales.(19901996)
Carpintera industrial
"D'ARTMONIA" desarrolla sus actividades en la infraestructura fsica de propiedad de la Fundacin
GeneralEcuatoriana,dondejuntoaartesanoscalificadostrabajanjvenescondiscapacidadintelectual.

216


Luchaporlosderechosdelaspersonascondiscapacidad

APOYOREFORMALEYDEDISCAPACIDADESYCDIGODETRABAJO:
LeydediscapacidadesA
Fundacin General Ecuatoriana, acogiendo el clamor de las cuatro Federaciones de Personas con
Discapacidad,delasONG'sdelsector,delasentidadespblicasrelacionadasconelreaydelConsejo
NacionaldeDiscapacidadessobrelanecesidaddeactualizarlaLey180sobreDiscapacidades,impulsla
elaboracindeunproyectodereformaaestaLey.Procesoqueseloejecutdemarzoajuniode1998.
El14dejuliode2000,selogrlaaprobacinenelCongresoNacional.

Cdigodetrabajo
LaFundacinGeneralEcuatoriana,atravsdelCaptuloEcuatorianodelGrupoLatinoamericanoparala
Participacin,laIntegracinylaInclusindePersonasconDiscapacidadvieneapoyandoelproyectode
reforma al Cdigo de Trabajo, mediante acciones de sensibilizacin especialmente con miembros del
CongresoNacionalysectoresproductivosysindicalesdelpas.
La Constitucin Poltica del Ecuador (Art. 53), la Ley de Discapacidades (Art. 4, numeral c) y el
Reglamento(Art.7)reconocenelderechoaltrabajoparalaspersonascondiscapacidad.
Por otro lado, el Art. 42 del actual Cdigo de Trabajo, numeral 33, dice textualmente: "Contratar
personas discapacitadas segn sus aptitudes y de acuerdo a las posibilidades y necesidades de
laempresa".
En vista de que este texto no constituye un sustento legal adecuado para la insercin laboral de
personas con discapacidad y ms bien puede ser interpretado por las empresas para rechazarlas, el
Conadis, Ministerio de Trabajo y las cinco Federaciones de y para la Discapacidad promovieron un
Proyecto de Reforma al Cdigo de Trabajo que fue ingresado al Congreso Nacional. Los puntos
esencialesdeesteproyectoson:

Que el 4% de la nmina laboral de una empresa se asigne a personas con discapacidad.

Estmulos tributarios a las empresas que den trabajo a las personas con discapacidad, al igual que
sancionesalasquenolohicieren.

ElProyectofueaprobadoafinalesdelao2007,duranteelgobiernodelpresidenteRafaelCorrea.

ProyectoPrevencindeDiscapacidades

Mediante convenio internacional entre Fundacin De Waal de Holanda y March of Dimes de Estados
Unidos, en Enero de 2000 Fundacin De Waal invit a Fundacin General Ecuatoriana y Fasinarm a
asociarseparadisearyelaborarlosManualesdeCapacitacindelProyectodePrevencinPrenatalde

217

Discapacidades.LaFundacinGeneralEcuatorianacoordinlaoficinaregionalPichincha,participando
en esta actividad hasta julio de 2000. Actualmente el programa es llevado a cabo por una entidad
independiente:laCorporacinPrenatal.
ProyectodeSensibilizacin

Desde1996,laFundacinhadesarrolladodiversasCampaasdeSensibilizacin,conundobleobjetivo:
prevenirlasdeficienciassiemprequeseaposibley,lograrunaactitudpositivadelaciudadanahacialas
personas con discapacidad. Los mensajes se han transmitido a nivel nacional, con la colaboracin de
mediosmasivosdecomunicacin:prensa,radioytelevisin,conapoyosolidariodeempresasprivadas
que han decidido vincular su imagen a la causa de las discapacidades. En 1998 se dise y edit el
ManualBsicosobreDiscapacidades(quichuaespaolyshuarespaol),conauspiciodelMinisteriode
SaludPblica.Describecadaunadelasdiscapacidades,suscausasymedidasdeprevencin.Sedifunde
a lderes comunitarios, promotores de salud y educadores de diversas comunidades indgenas,
constituyndoseenuninstrumentoinformativoenlasreasruralesyurbanomarginalesdelpas.
CampaadeSensibilizacinSobrelaLeyylosderechosdelaspersonascondiscapacidad

El 10 de junio de 2004, arranc la campaa de "Sensibilizacin sobre la Ley y los Derechos de las
Personas
con
Discapacidad", auspiciada por
el Gobierno de la
ProvinciadePichincha.

El proyecto se conform con dos componentes: el vivencial, a cargo de la Asociacin Parapljica de


Pichincha,mediantevisitasdeungrupodepersonascondiscapacidadadistintoscolegiosdelosocho
cantonesdelaprovincia:Quito,SantoDomingodelostsachilas,Cayambe,PedroMoncayo,Rumiahui,
PedroVicenteMaldonado,SanMigueldelosBancos,PuertoQuitoyMeja,conelfindemantenerun
dilogo directo con los estudiantes de cuartos y quintos cursos, para darles a conocer las dificultades

218

cotidianasquetienenqueenfrentaranteunasociedadquenosepreparparaposibilitarleselejercicio
desusderechos.SeeditlaGuadeDiscapacidadyDerechos.
El segundo componente, liderado por Fundacin General Ecuatoriana, contempl la difusin de diez
cuasderadio,conelaportede44emisorasdelaprovincia,conunaemisintotalde19.800mensajes

Proyecto Entrenamiento para el cuidado de nios con discapacidad intelectual

En asociacin con la Corporacin de Innovacin Educativa y con el auspicio de Kellogg Foundation,


CastroldelEcuadoryelInstitutoNacionaldelNioylaFamilia,laFundacinllevadelanteelproceso
de capacitacin a padres de familia de hijos con discapacidad intelectual, logrndose formar a mil
padresdefamilia,anivelnacional.EsteproyectofuepresentadoalInstitutoInteramericanodelNio,de
laOEA,obtenindoseel"PremioEloizadeLorenzoMencinEspecial".

Investigacin Diagnostico sobre la situacin ocupacional de las personas con discapacidad en el


Ecuador

Mediante concurso, la Fundacin General Ecuatoriana gan la convocatoria para realizar esta
investigacin, que la ejecut en asociacin con la empresa CEDATOS; mereciendo una felicitacin
especialporpartedelProgramadeNacionesUnidasparaelDesarrollo;ylaentregaaFundacinGeneral
Ecuatoriana del premio "Presea al Mrito 9495" por parte del Servicio Ecuatoriano de Capacitacin
Profesional(SECAP)..8

8Conadis,DirectorioNacionaldeInstitucionesquetrabajanenelmbitodelasdiscapacidades2007

CECADIS.CENTRO DE CAPACITACIN, DOCUMENTACIN E INVESTIGACIN SOCIAL.


Asesora
Este es un servicio que est dirigido a las organizaciones del sector social con el fin de procurar su
desarrolloinstitucionaly,lohacemediante:

El
diseo
y
la
implementacin
de
programas
y
Elaboracin e implementacin de proyectos de investigacin y
Mejoradelossistemasdegestin.

servicios.
desarrollo

Investigacin "Inclusin Sociolaboral de Jvenes con Discapacidad Intelectual" capacitados en la


FundacinGeneralEcuatorianayMejoramientodesuCalidaddeVida":ElBancoMundial,conelfinde

219

fomentar intervenciones estatales y privadas que tengan un impacto decisivo en los jvenes con
discapacidad intelectual, realiz un llamado a presentar proyectos de sistematizacin y anlisis en el
tema "Jvenes e Inclusin Social", en marzo de 2003. La Fundacin General Ecuatoriana fue
seleccionada para realizar la investigacin "Inclusin Sociolaboral de Jvenes con Discapacidad
IntelectualyMejoramientoenlaCalidaddeVida".LosresultadosfueronpresentadosalBancoMundial,
enfebrerode2004.

PRAM.PROGRAMA RAMN ARREGUI MONREAL

Historia
El programa "Ramn Arregui Monreal" de Capacitacin a Jvenes con Discapacidad Intelectual se inici
en 1985 y funciona en su Centro de Capacitacin, en el Valle de los Chillos. Es un proyecto modelo,
demostrativo, reconocido por el Ministerio de Educacin y Cultura, mediante convenio, desde mayo de
1989.

ANEXO4.

REGLAMENTODELMUSEODISCART

ARTICULO 1. El Museo Discart esta encaminado del acercamiento del arte y la cultura hacia los discapacitados
visualesyalpublicoengeneral.

220

ARTICULO 2. El Museo Discart se regir en primer lugar por la normas del presente reglamento y acuerdos
municipalesysubsidiariamenteporlasdecarcterquelefuesenaplicables.

ARTICULO 3. El Museo Discart de contenido Artstico e Informativo, es una institucin de carcter permanente,
abierta al pblico, orientada al inters general de la comunidad discapacitada, que recoge, adquiere, ordena,
conserva, estudia y exhibe de forma cientfica, didctica y esttica la cultura humana perteneciente de manera
preferentealahistoriaytranscursodelaspersonascondiscapacidadesalrededordelmundo,ysureinsercinsocial
pormediodelarte.

ARTCULO 4. El Museo estar ubicado en un edificio noble a ser posible de inters conveniente adaptado a las
necesidadesmuseolgicasymuseogrficasdeestetipodeinstituciones.

ARTCULO5.LainmediatadireccindelMuseoestarencomendadaalossiguientesrganos:
1.
2.

DirectordelMuseo.
Juntadirectiva.

ARTCULO 7. El director del museo deber cumplir con el requisito bsico de titulo superior en Museologa o
Museografa.

ARTCULO8.Sonfuncionesdeldirector:
1.

LadireccinfacultativadelMuseo,queseejerceratravsdepersonalasignadoalmismo.Lacustodiade
losfondosybienesdecualquierclasequeposeaelcentro.
2. Dirigirycoordinarlostrabajosderivadosdeltratamientoadministrativoytcnicodelosfondos,ascomo
procurarlaactualizacindelregistrodeentrada,InventariogeneralyCatlogosistemtico.
3. Dirigir, organizar y gestionar la prestacin de servicios del museo, fundamentalmente al servicio de los
discapacitadosvisuales.
4. dirigirycoordinarcualquierasuntoreferentealasdiscapacidadesvisualesentendidaestagestincomo
municipaloNacional.
5. Leelaboracinyejecucindeprogramasyactividadesdeinvestigaciny/odivulgacinenelmbitodela
especialidaddelmuseo.
6. Larevisinderedaccionesdepublicacionescientficasydivulgativasdelmbitotemticodelmuseo.
7. autorizarcualquiertipodereproduccin,fotogrficaono,delosobjetos,ascomoautorizarlostrabajos
ordinariosderestauracinyconservacin.
8. ElaboraryproponeralaJuntaDirectivaelPlananualdeactividades,ascomoelpresupuestoderivadode
estaprogramacin.
9. RedactarypresentaralaJuntaDirectivalamemoriaanualdeactividades.
10. LarepresentacindelMuseo.

ARTCULO 9. Las plazas de conservador sern ocupadas por titulados superiores, o en su defecto y
excepcionalmente,porpersonasqueacreditensuficientementesuexperienciayconocimientoencualquieradelas
reasdeconocimientointegradasenlasseccionesexistentesdelmuseo.

ARTCULO10.Escompetenciadelosconservadores:
1.
2.

El cumplimiento del libro de registro y las fichas de inventario genera y el catlogo sistemtico,
procurandoenloposible,suactualizacin.
Laordenacin,clasificacin,catalogacinyexposicincientficadelascoleccionespropiasdelmuseo.

221

3.
4.
5.
6.
7.

Cuidardelacorrectaconservacindelosfondosdelmuseo,ascomoproponerlasmedidasyactuaciones
oportunasque,ensentido,seconsiderannecesarias.
Eldesarrollodelasactividadeseducativasdelmuseoatodoslosniveles.
Laredaccindepublicacionescientficasydivulgativas.
Actualizaryordenarlosficherosdocumentalesdelmuseo.
Atenderlasnecesidadesderivadasdelmanejoymanipulacindelosfondosdelmuseo.

ARTCULO11.LaJuntaDirectivasernLosaccionistasdelmuseoysucomposicinserlasiguiente:
-

PRESIDENTE
VICEPRESIDENTE
VOCALES
DIRECTORDELMUSEO
UNMIEMBRODELAASOCIACINDEAMIGOSDELMUSEO
SECRETARIO:Eldelacorporacinofuncionarioenquiendelegue.

A las reuniones que celebre la Junta podrn ser invitadas otras personas, cuando por la ndole de los asuntos a
tratarseconsiderenecesariasupresenciayconcejo,quetendrnvozperonovoto.

ARTCULO12.SernfuncionesdelaJuntadirectiva:
1.
2.
3.
4.
5.

FomentarypromocionarelMuseo,ascomoestimularlasdonacionesydepsitosalmismo.
Establecerelhorarioydasdevisitadelmuseo.
Aprobarlaposiblecompredeobjetosqueincrementenlosfondosdelmuseo.
AprobarlamemoriaanualdelMuseo,yelplananualdeactividadesconsupresupuestocorrespondiente.
Ejercerderganoconsultivoyasesorenaquellascuestionesrelacionadasconelmuseoqueseconsideren
oportunas.

ARTCULO 13. La junta Directiva celebrar reunin ordinaria al menos una vez al ao para aprobar la memoria
anualdelmuseoyelplananualdeactividades,yaquellasqueconcarcterextraordinarioconsiderenecesariaspara
tratarcualquierasuntoconcernientealmuseo.
Losacuerdosseadoptarnpormayoradevotos,decidiendo,encasodeempate,elvotodecalidaddelpresidente
odequienlesustituya.

ARTCULO14.Laentradaalmuseonosergratuitasalvocasosexcepcionales;sereservalafacultaddeestablecery
regular las tasas que tenga por convenientes, tanto para la visita como para la obtencin de copias o
reproducciones.

ARTICULO15.ElMuseodispondrdelossiguientesrecursoseconmicos:
1.
2.
3.
4.

Losconsignadossenelpresupuestomunicipalparaestosfines.
LassubvencionesqueobtengadelEstadoyladireccinprovincial.
Losdonativosdeinstitucionesoparticulares.
Capitaldeentradadelossocios.

ARTCULO16.EnelMuseosedispondrlaexistenciadeunlibrodefirmasparaexponerobservacionesyarchivo
deaudioyvideo.

222

ARTCULO17.Constituirlosfondosdelmuseo:
Losdepsitosy/odonacionesdeparticulareseinstitucionesocolectivos.
Elcapitaldeentradadelossocios.
Elresultadodeadquisicinporcompra.

ARTCULO18.Elmuseodeberserdotadodelasinstalaciones,personalymediosdemantenimientoadecuados,
segnloquereglamentariamentedetermineelMinisteriodeCulturayelICOM.

ARTCULO19.ElmbitogeogrficopreferentedelascoleccionesdelMuseorespondealterritoriodelEcuador.

ARTCULO 20. En la medida de sus necesidades, el museo podr constituir secciones cientficas, taller de
restauracinylaboratorio,departamentodeinvestigacin,biblioteca,departamentopedaggicoyadministrativo,
todosaquellos,queensucaso,seconsiderennecesarios.

ARTCULO21.ConstituirpatrimoniomusesticodelMuseoDiscart
-

Eledificio.
Todomaterialdeconstruccin,ornamentacin,mobiliarioysobretodobienesmusesticosquecontenga
(histricos,artsticos,etnogrficosycientficos)
Tambinsonpatrimonialeslasdonacionesylegados.

ARTCULO 22. Los objetos depositados temporalmente pasarn a ser propiedad del Museo Discart si al cabo de
Diez aos no hayan sido retirados por los presciptivos propietarios, siempre que medie notificacin previa de los
depositantes.

ARTCULO 23. Los bienes de titularidad pblica no podrn ser alienados, ni hipotecados, ni empeados, ni
extradossinmotivo,yafuesenpropiedaddelmuseoodepositados,sinautorizacinexpresadelDirectordelMuseo
ylaJuntadirectivaysiempreporrazonesespeciales(restauracin,peticionesporpartedeotrasinstituciones,bien
paraexposiciones,entreotras).

ARTCULO 24. Pueden realizarse fotografas para uso privado; las fotografas de las piezas que facilite el museo
tendrnuncostequepodrmodificarseanualmentesiseestimaoportunoyenrelacinalincrementodelcostede
vida,msloqueelfotgrafoaadaporsurealizacinsifuesenecesario.

ARTICULO 25. Para la divulgacin, el museo Discart parte de la base que ha de proyectarse a la sociedad y
mantenerunnivelptimodeinformacindesusactividades.Ydentrodesusactividadesseharespecialinters
enladivulgacindelascoleccionesatravsdeexposicionestemporales,dinamizacindelasexistentes(ocuando
seproduzcannuevasadquisiciones)conactividadescomocharlassobrepiezasconcretas,publicacionesperidicas(
cuadernillos o revistas, libros, catlogos, entre otros) En las actividades de carcter gratuito (conferencias), las

223

publicaciones tendrn un precio que se determinar por el rgano correspondiente y que servirn para obtener
ingresosypararealizarintercambioconotrosmuseosoinstitucionesculturales.

ARTCULO26.Lospreciosdelosdemsobjetosalaventaenelmuseosernfijadosporelrganocorrespondiente,
tantolosdeproduccinpropiacomolosdeotrasempresasoparticularesquedejenendepsito.

ARTCULO27.ElMuseopuederegalarointercambiarlaspublicacionesuotroselementosdedifusinpropiacon
aquellosparticularesoinstitucionesqueestimeconveniente,manteniendosiempreuncdigodeontolgicocuyos
finesseanladivulgacin,elenriquecimientodelosfondosbibliogrficosytodoaquelloquesupongaunamejorade
laimagendelpropiomuseo.

ARTCULO28.Elespaciodelmuseopodrserutilizadoporasociaciones,entidadesoparticulares,preferentemente
su saln de actos como nico espacio disponible para la celebracin de estas actividades previa autorizacin del
directordelmuseoydeconformidadconlassiguientesreglas:
1.
2.

Lautilizacindeesteespacioestarreguladoporlastasasqueeldirectordelmuseoestimeoportunas.
LasolicitudseefectuarmedianteinstanciaquesefacilitarenelMuseoyqueserdirigidaaldirector
delmismo.
3. Sinoseprecisaraotracircunstancia,lasactividadessedesarrollarnfueradelhorariodevisitapblicadel
museo.
4. El maltrato en instalaciones o la falta de respeto a las normas del centro durante la celebracin de los
actos por parte de los organizadores podr ser causa suficiente para denegar en el futuro nuevas
autorizacionesalosresponsables,sinperjuiciodeexigirlasreparacionesoportunas.
5. El material necesario para los actos correr por cuenta de los organizadores y no podr reclamar
responsabilidadalgunaporlosdesperfectosodeteriorosqueseproduzcandurantesurealizacin.
6. Cuandosobreunamismasalaexistierandiferentespeticionesdeutilizacinconcoincidenciadehorario,
setendrencuentaelsiguienteordendeprioridades:
TendrnprioridadlosactosprogramadosporelEstadoEcuatoriano.
SielEstadonotuvieraactividadprevista,seatenderporordendeentradaalregistrogeneraldelmuseo.
7.Dadaslasdimensionesdelosespaciosdestinadosaactividades,seconcedernautorizacionesparaactos
organizados por los grupos polticos durante los periodos electorales con un costo a conveniencia de la
institucin.

ARTCULO 29. Tras la aprobacin definitiva del presente reglamento, se publicar su texto integro en el boletn
oficial de la provincia y entrar en vigor una vez transcurra el plazo legalmente previsto tras la recepcin de la
comunicacin.

224

ANEXO3
NOMBRE DE INSTITUCIONES
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22

FUNDACIN DE LA COMPAA DE JESUS


MUSEO DE LA CIUDAD
MUSEO DE SAN AGUSTN
CENTRO CULTURAL METROPOLITANO
MUSEO ALBERTO MENA CAAMAO
CASA MUSEO MARIA AGUSTA URRUTIA
MUSEO FRAY PEDRO GOCIAL CONVENTO DE SAN FRANCISCO
MUSEO NUMISMTICO DEL BANCO CENTRAL
MUSEOS CASA DE LA CULTURA ECUATORIANA
MUSEO ECUATORIANO DE CIENCIAS NATURALES
CAPILLA DEL HOMBRE
FUNDACIN GUAYASAMN
FUNDACIN POSADA DE LAS ARTES KINGMAN
MUSEO AMAZNICO
MUSEO ARTES
MUSEO DEL BANCO CENTRAL DEL ECUADOR
MUSEO DEL COLEGIO MILITAR ELOY ALFARO
MUSEO PADRE FRANSCISCO DE JESUS BOLAOS
MUSEO CAMILO EGAS
MUSEO FRAY PEDRO BEDON
MUSEO MONACAL SANTA CATALINA DE SIENA
MUSEO HISTRICO MILITAR CASA DE SUCRE

RECURSOS HUMANOS
PLANTA
PRACTICANTES
20
15
70
5
4
6
10
5
3
33
15
14
18
5
4
0
21
2
0
5
2
3
4

10
6
15
5
6
8
7
8
0
4
0
12
20
0
4
4
6
2

225

BATERIAS SANITARIAS
INADECUADAS
ADECUADOS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
0
INADECUADAS
INADECUADAS
0
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS

NOMBRE DE INSTITUCIONES

300
250
CANTIDAD

200
150
100
50
0

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22

FUNDACIN DE LA COMPAA DE JESUS


MUSEO DE LA CIUDAD
MUSEO DE SAN AGUSTN
CENTRO CULTURAL METROPOLITANO
MUSEO ALBERTO MENA CAAMAO
CASA MUSEO MARIA AGUSTA URRUTIA
MUSEO FRAY PEDRO GOCIAL CONVENTO DE SAN FRANCISCO
MUSEO NUMISMTICO DEL BANCO CENTRAL
MUSEOS CASA DE LA CULTURA ECUATORIANA
MUSEO ECUATORIANO DE CIENCIAS NATURALES
CAPILLA DEL HOMBRE
FUNDACIN GUAYASAMN
FUNDACIN POSADA DE LAS ARTES KINGMAN
MUSEO AMAZNICO
MUSEO
ARTES
RECURSOS
HUMANOS
MUSEO DEL BANCO CENTRAL DEL ECUADOR
MUSEO DEL COLEGIO MILITAR ELOY ALFARO
MUSEO PADRE FRANSCISCO DE JESUS BOLAOS
TRABAJADORES DE PLANTA
MUSEO CAMILO EGAS
PRACTICANTES
MUSEO FRAY PEDRO BEDON
MUSEO MONACAL SANTA CATALINA DE SIENA
MUSEO HISTRICO MILITAR CASA DE SUCRE

RECURSOS HUMANOS
PLANTA
PRACTICANTES
20
15
70
20
5
4
6
10
5
3
33
15
14
18
5
4
0
21
2
0
5
2
3
4

10
6
15
5
6
8
7
8
0
4
0
12
20
0
4
4
6
2

245

156

PERSONAS
1

TOTAL

En esta tabla de datos se puede apreciar que el nmero de personas que realizan practicas en las instituciones sobrepasan la mitad del nmero total de personas que
trabajan bajo nmina o contrato legal. Como conclusin las instituciones no poseen mucho presupuesto para contratar a ms personal y prefieren mantener a pasantes
rotando cada cierto periodo de tiempo y as ahorrar en presupuestos institucionales internos.

226

CONCLUSIONES DE LA CIRCULACIN DENTRO DE LAS INSTITUCIONES PARTICIPANTES

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22

NOMBRE DE INSTITUCIONES

CIRCULACIN INTERNA

FUNDACIN DE LA COMPAA DE JESUS


MUSEO DE LA CIUDAD
MUSEO DE SAN AGUSTN
CENTRO CULTURAL METROPOLITANO
MUSEO ALBERTO MENA CAAMAO
CASA MUSEO MARIA AGUSTA URRUTIA
MUSEO FRAY PEDRO GOCIAL CONVENTO DE SAN FRANCISCO
MUSEO NUMISMTICO DEL BANCO CENTRAL
MUSEOS CASA DE LA CULTURA ECUATORIANA
MUSEO ECUATORIANO DE CIENCIAS NATURALES
CAPILLA DEL HOMBRE
FUNDACIN GUAYASAMN
FUNDACIN POSADA DE LAS ARTES KINGMAN
MUSEO AMAZNICO
MUSEO ARTES
MUSEO DEL BANCO CENTRAL
DEL ECUADOR
5% CIRCULACIN INTERNA
9%
MUSEO DEL COLEGIO
MILITAR ELOY ALFARO
36%
MUSEO PADRE FRANSCISCO
DE JESUS
BOLAOS
1
50%
2
MUSEO CAMILO EGAS
3
MUSEO FRAY PEDRO BEDON
MUSEO MONACAL SANTA CATALINA DE SIENA
MUSEO HISTRICO MILITAR CASA DE SUCRE

NO HAY PROBLEMAS EXCEPTO PARA ACCEDER AL CORO ALTO


NO HAY PROBLEMAS EXCEPTO PARA ACCEDER AL CORO ALTO Y CAMPANARIO
SI HAY PROBLEMAS. GRADAS EN LA MAYORIA DE LOS TRAYECTOS.
NO HAY PROBLEMAS MAYORES
NO HAY PROBLEMAS MAYORES
SI HAY PROBLEMAS PARA SUBIR A LA SEGUNDA PLANTA
SI HAY PROBLEMAS. GRADAS EN LA MAYORIA DE LOS TRAYECTOS.
SI HAY PROBLEMAS. GRADAS EN LA MAYORIA DE LOS TRAYECTOS.Y ESPACIOS ANGOSTOS.
SI HAY PROBLEMAS. PARA ACCEDER INTERNAMENTE A LOS MUSEOS Y PARA ACCEDER A LA SEGUNDA PLANTA.
SI HAY PROBLEMAS, PARA ACCEDER A LA SALA DE PALEONTOLOGA Y A LA SALA DE ANATOMIA COMPARADA
NO HAY PROBLEMAS
SI HAY PROBLEMAS. GRADAS EN LA MAYORIA DE LOS TRAYECTOS.
NO HAY PROBLEMAS MAYORES
NO HAY PROBLEMAS MAYORES
FUERA DE FUNCIONAMIENTO
NO HAY PROBLEMAS MAYORES
NO HAY PROBLEMAS MAYORES
FUERA DE FUNCIONAMIENTO
SI HAY PROBLEMAS. GRADAS EN LA MAYORIA DE SUS TRAYECTOS. Y ESPACIOS ANOSTOS.
SI HAY PROBLEMAS . ESPACOS MUY ANGOSTOS Y GRADAS.
SI HAY PROBLEMAS . ESPACOS MUY ANGOSTOS Y GRADAS.
SI HAY PROBLEMAS . ESPACOS MUY ANGOSTOS Y GRADAS.

CANTIDAD DE INSTITUCIONES
RESUMEN

1
8
11
2

NO HAY PROBLEMAS
SI HAY PROBLEMAS PERO MENORES
SI HAY PROBLEMAS DE CIRCULACIN
FUERA DE FUNCIONAMIENTO.

5%
36%
50%
9%

EL 95 % DE LOS MUSEOS PARTICIPANTES EN ESTE ESTUDIO NO POSEEN UNA INFRAESTRUCTURA ADECUADA PARA LA CIRCULACIN INTERNA DE UN VISITANTE DISCAPACITADO VISUAL Y EN SILLA DE RUE
EL 50% DE LOS MUSEOS PARTICIPANTES EN ESTE ESTUDIO POSEEN PROBLEMAS ESTRUCTURALES COMO GRADAS DE ACCESO DE GRAN NGULO DE INCLINACIN Y ESPACIOS EXPOSITTIVOS ANGOSTOS
EL 36% DE LOS MUSEOS PARTICIPANTES EN ESTE ESTUDIO POSEEN PROBLEMAS DE ACCESO INTERNO A CIERTOS ESPACIOS COMO LO SON LOS CAMPANARIOS Y COROS ALTOS.
EL 9% DE LOS MUSEOS PARTICIPANTES EN ESTE ESTUDIO SE ENCUENTRAN FUERA DE FUNCIONAMIENTO.
CABE RECALCAR QUE SOLO LA CAPILLA DEL HOMBRE POSEE ESPACIOS FSICOS SUFICIENTES PARA LA CIRCULACIN DE UNA PERSONA DISCAPACITADA VISUAL Y EN SILLA DE RUEDAS.

227

CONCLUSIONES DE LAS DIFICULTADES DE ACCESO A LAS INSTITUCIONES PARTICIPANTES EN EL ESTUDIO

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22

NOMBRE DE INSTITUCIONES

ACCESIBILIDAD EXTERNA

FUNDACIN DE LA COMPAA DE JESUS


MUSEO DE LA CIUDAD
MUSEO DE SAN AGUSTN
CENTRO CULTURAL METROPOLITANO
MUSEO ALBERTO MENA CAAMAO
CASA MUSEO MARIA AGUSTA URRUTIA
MUSEO FRAY PEDRO GOCIAL CONVENTO DE SAN
FRANCISCO
MUSEO NUMISMTICO DEL BANCO CENTRAL
MUSEOS CASA DE LA CULTURA ECUATORIANA
MUSEO ECUATORIANO DE CIENCIAS NATURALES
CAPILLA DEL HOMBRE
FUNDACIN GUAYASAMN
FUNDACIN POSADA DE LAS ARTES KINGMAN
MUSEO AMAZNICO
MUSEO ARTES
MUSEO DEL BANCO CENTRAL DEL ECUADOR
MUSEO DEL COLEGIO MILITAR ELOY ALFARO
MUSEO PADRE FRANSCISCO DE JESUS BOLAOS
MUSEO CAMILO EGAS
MUSEO FRAY PEDRO BEDON
MUSEO MONACAL SANTA CATALINA DE SIENA
MUSEO HISTRICO MILITAR CASA DE SUCRE

NO HAY PROBLEMAS
NO HAY PROBLEMAS
SI HAY PROBLEMAS GRADAS DE ACCESO.
NO HAY PROBLEMAS
NO HAY PROBLEMAS
NO HAY PROBLEMAS
SI HAY PROBLEMAS GRADAS DE ACCESO.
SI HAY PROBLEMAS GRADAS DE ACCESO.
NO HAY PROBLEMAS
NO HAY PROBLEMAS
NO HAY PROBLEMAS
NO HAY PROBLEMAS
SI HAY PROBLEMAS GRADAS DE ACCESO.
SI HAY PROBLEMAS GRADAS DE ACCESO.
FUERA DE FUNCIONAMIENTO
NO HAY PROBLEMAS
SI HAY PROBLEMAS GRADAS DE ACCESO.
FUERA DE FUNCIONAMIENTO
NO HAY PROBLEMAS
NO HAY PROBLEMAS
SI HAY PROBLEMAS GRADAS DE ACCESO.
NO HAY PROBLEMAS

RESULTADOS

168

13 NO TIENEN PROBLEMA

7 SI TIENEN PROBLEMAS
FUERA DE
2 FUNCIONAMIENTO

EL 60% DE LAS INSTITUCIONES PARTICIPANTES EN EL ESTUDIO NO PRESENTAN PROBLEMAS PARA EL ACCESO DE UNA PERSONA CON DISCAPACIDAD VISUA
EL 31.% DE LAS INSTITUCIONES PARTICIPANTES EN EL ESTUDIO SI PRESENTAN PROBLEMAS PARA EL ACCESO DE UNA PERSONA CON DISCAPACIDAD VISUA
EL 9 % DE LAS INSTITUCIONES PARTICIPANTES EN EL ESTUDIO ESTAN FUERA DE SERVICIO.

169

CONCLUCIONES DE GUIONES Y PLANES MUSEOGRFICOS DE LAS INSTITUCIONES PARTICIPANTES EN ESTE ESTUDIO


NOMBRE DE INSTITUCIONES

PLAN MUSEOGRFICO

1
2
3
4
5
6
7
8
9
10
11
12
13

FUNDACIN DE LA COMPAA DE JESUS


MUSEO DE LA CIUDAD
MUSEO DE SAN AGUSTN
CENTRO CULTURAL METROPOLITANO
MUSEO ALBERTO MENA CAAMAO
CASA MUSEO MARIA AGUSTA URRUTIA
MUSEO FRAY PEDRO GOCIAL CONVENTO DE SAN FRANCISCO
MUSEO NUMISMTICO DEL BANCO CENTRAL
MUSEOS CASA DE LA CULTURA ECUATORIANA
MUSEO ECUATORIANO DE CIENCIAS NATURALES
CAPILLA DEL HOMBRE
FUNDACIN GUAYASAMN
FUNDACIN POSADA DE LAS ARTES KINGMAN

NO INCLUYE A DISCAPACITADOS VISUALES


NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
INCLUYE A DISCAPACITADOS VISUALES EN UNA DE SUS GALERAS
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES

14
15
16
17
18
19
20
21
22

MUSEO AMAZNICO
MUSEO ARTES
MUSEO DEL BANCO CENTRAL DEL ECUADOR
MUSEO DEL COLEGIO MILITAR ELOY ALFARO
MUSEO PADRE FRANSCISCO DE JESUS BOLAOS
MUSEO CAMILO EGAS
MUSEO FRAY PEDRO BEDON
MUSEO MONACAL SANTA CATALINA DE SIENA
MUSEO HISTRICO MILITAR CASA DE SUCRE

NO INCLUYE A DISCAPACITADOS VISUALES


NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES

RESULTADOS

21 NO ESTAN INCLUIDOS EN LA MUSEOGAFA


1 SI ESTAN INCLUIDOS EN LA MUSEOGRAFA

168

4,54545455

95,4545455

EL 95,45% DE LAS INSTITUCIONES PARTICIPANTES EN ESTE ESTUDIO NO INCLUYERON A LOS VISITANTES DISCAPACITADOS VISUALES DENTRO DE SUS PLANES MUSEOGR
EL 4,55 % DE LAS INSTITUCIONES PARTICIPANTES EN ESTE ESTUDIO SI INCLUYERON A LOS VISITANTES DISCAPACITADOS VOSUALES DENTRO DE SUS PLANES MUSEOGR

169

CONCLUCIONES DE GUIONES Y PLANES MUSEOLGICOS DE LAS INSTITUCIONES PARTICIPANTES EN ESTE ESTUDIO

1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22
RESULTADOS

NOMBRE DE INSTITUCIONES

PLAN MUSEOLGICO

FUNDACIN DE LA COMPAA DE JESUS


MUSEO DE LA CIUDAD
MUSEO DE SAN AGUSTN
CENTRO CULTURAL METROPOLITANO
MUSEO ALBERTO MENA CAAMAO
CASA MUSEO MARIA AGUSTA URRUTIA
MUSEO FRAY PEDRO GOCIAL CONVENTO DE SAN FRANCISCO
MUSEO NUMISMTICO DEL BANCO CENTRAL
MUSEOS CASA DE LA CULTURA ECUATORIANA
MUSEO ECUATORIANO DE CIENCIAS NATURALES
CAPILLA DEL HOMBRE
FUNDACIN GUAYASAMN
FUNDACIN POSADA DE LAS ARTES KINGMAN
MUSEO AMAZNICO
MUSEO ARTES
MUSEO DEL BANCO CENTRAL DEL ECUADOR
MUSEO DEL COLEGIO MILITAR ELOY ALFARO
MUSEO PADRE FRANSCISCO DE JESUS BOLAOS
MUSEO CAMILO EGAS
MUSEO FRAY PEDRO BEDON
MUSEO MONACAL SANTA CATALINA DE SIENA
MUSEO HISTRICO MILITAR CASA DE SUCRE

NO INCLUYE A DISCAPACITADOS VISUALES


NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
INCLUYE A DISCAPACITADOS VISUALES EN UNA DE SUS GALERAS
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES
NO INCLUYE A DISCAPACITADOS VISUALES

5%

21MUSEOLOGA
NO ESTAN INCLUIDOS EN LA MUSEOLOGA
1 SI ESTAN INCLUIDOS EN LA MUSEOLOGA
1

95%

170

EL 95,45% DE LAS INSTITUCIONES PARTICIPANTES EN ESTE ESTUDIO NO INCLUYERON A LOS VISITANTES DISCAPACITADOS VISUALES DENTRO DE SUS PLANES MUSEOLGICOS
EL 4,55 % DE LAS INSTITUCIONES PARTICIPANTES EN ESTE ESTUDIO SI INCLUYERON A LOS VISITANTES DISCAPACITADOS VOSUALES DENTRO DE SUS PLANES MUSEOLGICOS

CONCLUSIONES BATERIAS SANITARIAS


NOMBRE DE INSTITUCIONES

BATERIAS SANITARIAS

FUNDACIN DE LA COMPAA DE JESUS


MUSEO DE LA CIUDAD
MUSEO DE SAN AGUSTN
CENTRO CULTURAL METROPOLITANO
MUSEO ALBERTO MENA CAAMAO
CASA MUSEO MARIA AGUSTA URRUTIA
MUSEO FRAY PEDRO GOCIAL CONVENTO DE SAN FRANCISCO
MUSEO NUMISMTICO DEL BANCO CENTRAL
MUSEOS CASA DE LA CULTURA ECUATORIANA
MUSEO ECUATORIANO DE CIENCIAS NATURALES
CAPILLA DEL HOMBRE
FUNDACIN GUAYASAMN
FUNDACIN POSADA DE LAS ARTES KINGMAN
MUSEO AMAZNICO
MUSEO ARTES
MUSEO DEL BANCO CENTRAL DEL ECUADOR
SERVICIOS
BASICOS
MUSEO DEL COLEGIO
MILITAR
ELOY ALFARO
MUSEO PADRE FRANSCISCO DE JESUS BOLAOS
21
25
MUSEO CAMILO
EGAS
20
MUSEO FRAY
PEDRO BEDON
BATERIAS
15
MUSEO MONACAL
SANTA CATALINA DEINADECUAD
SIENA
10
AS
1
5
MUSEO HISTRICO MILITAR CASA DE SUCRE

INADECUADAS
ADECUADOS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS
INADECUADAS

TOTAL
1
2
3
4
5
6
7
8
9
10
11
12
13
14
15
16
17
18
19
20
21
22

21 BATERIAS INADECUADAS
1 ADECUADA

0
BATERIAS1SANITARIAS

EL 95,45% DE LAS INSTITUCIONES PARTICIPANTES EN ESTE ESTUDIO NO POSEEN BATERIAS SANITARIAS ADECUADAS PARA EL USO DE DISCAPACITADOS VISUALES Y EN SILLA DE RUEDAS
EL 4,55 % DE LAS INSTITUCIONES PARTICIPANTES EN ESTE ESTUDIO SI POSEEN BATERIAS SANITARIAS ADECUADAS PARA EL USO DE DISCAPACIATADOS VISUALES Y EN SILLA DE RUEDAS

171

ANEXO 4.REGLAMENTO PARA VISITANTES DEL DISCART BLIND EYES MUSEUM

1.

Todoslosvisitantesdebenseguirlasinstruccionesdelpersonaldelmuseo.

2.

Seprohbeintroducircualquiertipodearmasenlasinstalacionesdelmuseo.

3.

ELMUSEOSERESERVAELDERECHODEADMISIN.Asimismo,puederestringirelaccesoadeterminadasreasdesusinstalaciones.

4.

Para una mejor atencin a los colegios, se conformarn grupos de 30 alumnos como mximo. Cada grupo debe estar acompaado de un profesor. Para grupos de discapacitados el
mximoserde15alumnosporprofesor.

5.

Los profesores deben mantener unido a su grupo durante su permanencia en las instalaciones del museo. Es responsabilidad de los profesores coordinar la llegada y salida de sus
alumnos.

6.

Elmuseoofreceserviciodevisitasguiadasnicamenteagruposconreservacinprevia.Losgruposquetenganreservacindebernconfirmarsuasistenciahastaundaantes,ascomo
llegaralahoraexactadelacita.PASADOELHORARIOESTABLECIDO,ELMUSEOSERESERVARAELDERECHODEATENCIN,analizandoelcasoenparticularydependiendodelnmerode
reservacionesdelda.

7.

LareservacindevisitaserealizarsoloconlaDireccin,deacuerdoalaprogramacinylasposibilidadesdelmomentoytratandodeatenderlosolicitado.Elmuseonoestaobligadoa
cumplirconlaspeticionesamenosquesusposibilidadeslopermitan.

8.

Losbultos,paquetesymochilasdeberndepositarseenellugarquelosvigilantesasignenantesdeiniciarlavisita.Elmuseonosehaceresponsableporobjetosdevalordepositadosy
olvidadosensusinstalaciones.

9.

Estprohibidofumar,consumiralimentos,bebidas,golosinasychiclesdentrodelasgalerasosalasdeexposicindelmuseo.

172

10. Losvisitantespuedenusardentrodelmuseoequiposdevideoyfotografa.

11. Losvisitantesdebernusarlosequiposdelmuseocomoseindicaensusinstrucciones.Denorespetarestasindicaciones,elmuseosereservaelderechodesuspenderlavisitaysolicitar
elpagoporlosdaosocasionados.Asimismoelmuseonosehaceresponsableporaccidentesocasionadosporimprudenciaomalusodelosequipos.

173

GLOSARIO

Las palabras "deficiencia", "minusvala", "discapacidad" e "invalidez" representan comnmente un cierto grado de confusin e imprecisin en su
interpretacinyusoentrelapoblacingeneral,motivoporelcualconsideramosoportunopuntualizarcontodaprecisinsusignificado,lomismoqueel
conceptodelostrminos"readaptacinprofesional".

Ceguera
Cegueraoamaurosis,ausenciacompletaocasicompletadelsentidodelavista.Puedeestarcausadaporunobstculoqueimpidelallegadadelosrayosde
luzhastalasterminacionesdelnervioptico,porenfermedaddelnerviopticoodeltractoptico,oporenfermedadoalteracinenlasreascerebralesde
lavisin.Puedeserpermanenteotransitoria,completaoparcial,oaparecersloensituacionesambientalesdepocaluz(cegueranocturna).

Deficiencia:
Sedefinecomotodaprdidaoanormalidaddeunaestructuraofuncinpsicolgica,fisiolgicaoanatmica.
Discapacidad:
Algunas Organizaciones Internacionales de Discapacitados definen a la discapacidad, como ese gran nmero de diferentes limitaciones funcionales de
carctertemporalopermanentequeseregistraenlapoblacinmundialyquerevistenlaformadedeficienciasfsicas,intelectualesosensoriales,deuna
dolencia que requiera atencin mdica o incluso una enfermedad mental que limite la capacidad de ejercer una o ms actividades esenciales de la vida
diaria,quepuedesercausadaoagravadaporelentornoeconmicoysocial.

174

Donderesultaimportantesealarque esteconcepto,resultamscompletoqueelformuladoporlaOrganizacin MundialdelaSalud,envirtud deque


tomaenconsideracininclusolaslimitacionesqueincorporaelentornoeconmicoysocial.
Discapacitado, da. (Calco del ingles disabled). adj. Dicho de una persona: Que tiene impedida o entorpecida alguna de las actividades cotidianas
consideradasnormales,poralteracindesusfuncionesintelectualesofsicas.U.t.c.s.
Invalidez:
Elterminodesignaatodapersonacuyasposibilidadesdeobtener,conservaryprogresarenunempleoadecuadoseencuentrenreducidasdebidoauna
disminucindesucapacidadfsicaomentaldebidamentereconocidaporunaautoridadmdicacompetente.
Incapacidad.(Dellat.incapactas,tis).f.Faltadecapacidadparahacer,recibiroaprenderalgo.||2.Faltadeentendimientoointeligencia.||3.Faltade
preparacin,odemediospararealizarunacto.||4.Estadotransitorioopermanentedeunapersonaque,poraccidenteoenfermedad,quedamermadaen
sucapacidadlaboral.||5.Der.Carenciadeaptitudlegalparaejecutarvlidamentedeterminadosactos,oparaejercerdeterminadoscargospblicos.||~
laboral. f. Der. Situacin de enfermedad o de padecimiento fsico o psquico que impide a una persona, de manera transitoria o definitiva, realizar una
actividadprofesionalyquenormalmentedaderechoaunaprestacindelaseguridadsocial.
Incapacitado,da.adj.Faltodecapacidadoaptitudparahaceralgo.||2.Dichodeunapersona:Sujetaainterdiccincivil.U.t.c.s.

Otros trminos mal utilizados de una manera discriminatoria hacia las personas con discapacidades son:

Idiota
En su origen, la palabra idiota no tuvo el significado de menosprecio que tiene ahora. En la Grecia Clsica, "idiota" era el hombre que viva retirado, en
oposicinaquienllevabaunavidapblicaosededicabaalapoltica.

175

Comoamenudoquienviveapartadodelasylosdems,sevuelvehurao,rarooignorante,cuandolapalabraidiotapasdelgriegoallatn,yatomel
matizpeyorativoactual.

Durantelaedadmedia,idiotaservaparadesignaralmonjequenosabalatn.Alquehablabalatnolatinolollamabanladinooladina.

Imbcil
Imbcil,porsuorigen,noesningninsulto.Elimbcileralapersonaquenotenaapoyooinfluencia;lapersonadbilfrentealafuerteopoderosaque
contabaconbuenosapoyosoinfluencias.

Elbculoeraelbastnosignodepoder,deapoyo.Elobispotieneelbculo;elalcaldellevalavarademando.Puesbien,enlatn,alquenotenabculolo
llamaban"imbecilis",0sea,sinbastn,quesignificasinapoyo,sinvaledorquelodefendiera.

Despusimbcil,significaradbildemente.
Minusvala:
LaOrganizacinInternacionaldelTrabajodefinelaminusvalacomounasituacindesventajosaparaunapersonadeterminada,comoconsecuenciadeuna
deficienciaodeunadiscapacidadquelimitaoimpideeldesempeodeunpapelsocialqueesnormalensucasosegnsuedad,sexoyfactoressocialesy
culturales.
Ocurrecuandolaspersonasenfrentanbarrerasculturales,fsicasosociales,quelesimpidenelaccesoalosdiversossistemasdelasociedadqueestna
disposicindelosdemsciudadanos,constituyendounasituacindedesigualdad.

176

Minusvala.(Dellat.minus,menos,yvala).f.Detrimentoodisminucindelvalordealgo.||2.Discapacidadfsicaomentaldealguienporlesincongnita
oadquirida.
Minusvalidez.f.Cualidaddeminusvlido.
Minusvlido, da. (Del lat. minus, menos, y vlido). adj. Dicho de una persona: Incapacitada, por lesin congnita o adquirida, para ciertos trabajos,
movimientos,deportes,etc.U.t.c.s.

Otrostrminosasociadosson:

Optimetra.Graduacincientficadelavista,conelfindeprescribirlentes.

Glaucoma.Endurecimientodelgloboocular,debidoalaumentodepresindeloslquidosinteriores;puedellegaraproducirlaceguera.

Oftalmoscopio. Instrumento para examinar el interior del ojo. Consiste en un espejo que refleja la luz sobre el ojo y en cuyo centro tiene un pequeo
orificioparalaobservacin.

Miopa.Defectodelojoaconsecuenciadelcuallasimgenesseformanenelojodelantedelaretina.

177

Hipermetropa. Defecto visual por el que la imagen se forma ms halla de la retina, debido generalmente a la falta de convergencia del cristalino. Se
corrigeconlentesconvexasesfricas.

Estrabismo.Defectoqueconsisteenlafaltadeconcienciaenlosmovimientosdelosojos;dependeprincipalmentedealteracionesenlacontraccindelos
msculosoculares,coexistentescondefectospticosocausadosporalteracionesnerviosas.Vulgarmentellamadosbizcos.

Astigmatismo.Defectodelojoodeotrosistemaptico,debidoalacurvaturaimperfectadelacorneaodelaslentes,queprovocaunavisinirregularde
laslneasverticalesrespectoalashorizontalesyviceversa.

Oligofrenia.Insuficienciaeneldesarrollopsquico,engeneraldeorigencongnito.

178

BIBLIOGRAFIA
MicrosoftEncarta2006.19932005MicrosoftCorporation
BlancasA."CreandoEmpleos"
MemoriasdelTercerCongresoInternacional:"Ladiscapacidadenelao2000"
CiudaddeMxico14al16defebrerodelao2000.
BuerbaR."DiscapacidadyLiderazgo"
MemoriasdelTercerCongresoInternacional:"Ladiscapacidadenelao2000"
CiudaddeMxico14al16defebrerodelao2000.
CastroCueL."OpcionesLaborales"
MemoriasdelTercerCongresoInternacional:"Ladiscapacidadenelao2000"
CiudaddeMxico14al16defebrerodelao2000.
GuillenR.et.al."Laluchaporalcanzarlaintegracinsocial"
MemoriasdelTercerCongresoInternacional:"Ladiscapacidadenelao2000"
CiudaddeMxico14al16defebrerodelao2000.
LariosH."RetosLegislativossobrederechoshumanosendiscapacitados"
MemoriasdelTercerCongresoInternacional:"Ladiscapacidadenelao2000"
CiudaddeMxico14al16defebrerodelao2000.
LunaA.et.al."Logrosenlegislacindeapoyoaladiscapacidad"
MemoriasdelTercerCongresoInternacional:"Ladiscapacidadenelao2000"
CiudaddeMxico14al16defebrerodelao2000.
MayagoitiaR."TecnologadelaRehabilitacinenMxico"
MemoriasdelTercerCongresoInternacional:"Ladiscapacidadenelao2000"
CiudaddeMxico14al16defebrerodelao2000.
NavarroC."Desarrollolaboralenpersonascondiscapacidad"
MemoriasdelTercerCongresoInternacional:"Ladiscapacidadenelao2000"
CiudaddeMxico14al16defebrerodelao2000.
PelaezA."PerspectivasdeIntegracinLaboral"
MemoriasdelTercerCongresoInternacional:"Ladiscapacidadenelao2000"
CiudaddeMxico14al16defebrerodelao2000.

179

O.I.T."RecomendacinNo.99"
OrganizacinInternacionaldelTrabajo.GinebraSuiza,1955.
O.I.T."ConvenioNo.159"
OrganizacinInternacionaldelTrabajo.GinebraSuiza,1983.
O.I.T."ConvenioNo.168"
Conadis,DirectorioNacionaldeInstitucionesquetrabajanenelmbitodelasdiscapacidades2007.

RECURSOSENINTERNET
AmericanModifiedBrailleJoelSmith,verLibrosparalosCiegos(BooksfortheBlind)en:
http://www.perkins.org/museum/section.php?id=200
AmericanPrintingHousefortheBlind
TactileConnectionstactilesymbolskit:
http://www.aph.org/advisory/2005adv.10.html#P3
DavidAbraham,creadordelPerkinsBrailleWriter
http://www.perkins.org/museum/section.php?id=202
DuxburySystems
TraduccinaMoondelastablasdetraduccinenDux10.3ysuperior.SeincluyemsinformacindentrodelosarchivosdeAyudadeDuxburyenMoon
http://www.duxburysystems.com/lan_english_moon_no_capitals.asp
ConferenciaGettinginTouchWithLiteracy,2005
Haycopiasdelasactasdeestaconferenciadisponiblesenlnea.Busqueladiscusininformativasobrealfabetizacinysmbolostangiblesdelpersonalde
Perkinstitulada:LiteracyandTechnology:FacilitatingEmergentLiteracyforStudentswithVisualImpairmentsandAdditionalDisabilities(Alfabetizaciny
Tecnologa:FacilitandolaAlfabetizacinEmergenteparaEstudiantesconDiscapacidadesVisualesyDiscapacidadesAdicionales)
http://www.gettingintouchwithliteracy.org/program.htm
HistoriadelosCdigosdeLecturaparalosCiegos
http://www.nyise.org/blind/barbier2,htm
MaryIngallsandlifeattheIowaBrailleandSightSavingSchoolhttp://www.rootsweb.com/~iabenton/ibsss/ingalls.htm
MaxiAids
http://www.maxiaids.com

180

Dr.MoonPage
http://www.deafblind.com/moon.html
TheHistoryofMoon
http://www.rnib.org.uk/xpedio/groups/public/documents/PublicWebsite/public_moon.hesp
PerkinsSchoolfortheBlind
PginawebdelpatlogodellenguajeDeirdreWalshsobrecmohaceraccesibleslasexperienciasdealfabetizacinalosnioscondiscapacidadesvisualesy
discapacidadesadicionales
http://www.eadvisor.us/Deirdre/Titlepage.html
www.discapnet.es/Discapnet/Castellano/Accesibilidad/Lenguaje/Lenguaje_007.htm
QuantumTechnology
FabricantedelMounbattenBrailleryelJotADot
http://www.quantech.com.au/
RoyalNationalInstitutefortheBlind
MoonCats:CurrculumdelecturaenMoondisponibledeRNIB.Vayaalapginadeproductos,seleccionepublicaciones,aprendizajeycurrculum,Moon.O
useelsiguienteURL:
http://onlineshop.rnib.org.uk/browse.asp?n=11&c=477&sc=14&it=2&1=3
SamuelGridleyHoweyBostonlinetype
http://www.perkins.org/museum/subsection.php?id=122
TackTiles
http://www.tacktiles.com/
TexasSchoolfortheBlindandVisuallyImpaired
Directoriodesmbolostctilesconfotos:
http://www.tsbvi.edu/Education/vmi/tactile_symbols.htm
VisualImpairmentCentreforTeachingandResearch
DottedMoon.InvestigacinparacompararlasvelocidadesdelecturasdeestndarMoonaMoonproducidoconpuntosusandoungrabadorcomputacional
deBraille.
http://www.education.bham.ac.uk/research/victar/research/projects/DottedMoon.htm
WaroftheDots(HistoryofReadingCodesfortheBlind)deRobertIrwin
http://www.nyise.org/blind/irwin2.htm
WilliamBellWaitandNewYorkPointreadingcode:
http://www.nyise.org/text/wait.htm

181

OCHAITA.E.LecturaBrailleyProcesamientodelaInformacinTctil.ColeccinRehabilitacin,INSERSO,
Madrid1988
LUCERGAR.M.:Tomillo.MtododeIniciacinalaLecturaBraille.O.N.C.E.C.B.C.deBarcelona1987.
C.A.I.D.V.:IntervencinEducativaconNiosdeBajaVisin.ConsejeradeEducacinyCiencia,
DelegacinProvincialdeMlaga1989
C.A.I.D.V.:ElNioCiegoenlaEscuela.ConsejeradeEducacinyCiencia,DelegacinProvincialde
Mlaga,1997.
ESPEJO.B.:ElBrailleenlaEscuela.O.N.C.E.
SIMON.C.:ElDesarrollodelosProcesosBsicosenlaLecturaBraille.O.N.C.E.

VARIOS.:ActasdelCongresoEstatalSobrePrestacindeServicioParaPersonasCiegasyDeficientes
Visuales.Madrid,1994
BARRAGA,N.C.(1992):Desarrollosensoperceptivo.Crdoba(Argentina):ICEVH
.
BUENO,M.;ESPEJO,B.,yTORO,S(1995):Discapacidadesvisuales.EnBasesparalaintervencinpsicopedaggicaentrastornosdeldesarrollo.
Mlaga:UniversidaddeMlaga.
Manuales.
BUENO,M.,ESPEJO,B,,RODRGUEZ,F.,yTORO,S.(1999):Niosyniasconbajavisin.
Recomendacionesparalafamiliaylaescuela.Archidona:Aljibe.
BUENO,M.,yRUIZ,F.(1994).Visinsubnormal.EnDeficienciavisual.Aspectos
psicoevolutivosyeducativos.Archidona:Aljibe.
COLENBRANDER,A.(1977):CitadoporCrespo(1989)enUnoschicoscomonosotros.
Crdoba(Argentina):ICEVH.
CORN,A.(1989):Instruccinparaelusodelavisinparaniosyadultosconbajavisin:
Propuestadeunprogramamodelo.Crdoba(Argentina):ICEVH.
DICKMAN,I.R.(1988):Quhacerconlavisinlimitada?Crdoba(Argentina):ICEVH.
FAYE,E.E.(1972):Elenfermocondficitvisual.Experienciaclnicaenadultosynios.

182

Barcelona:CientficoMdica.
GARCAVISO,M.(1992):Diagnsticoyvaloracindediscapacidades.Documentos.22/90.
Madrid:RealPatronatodePrevencinyAtencinaPersonasconMinusvala.
MSC(1994):ClasificacinInternacionaldeEnfermedades,9revisin.ModificacinClnica.
Madrid:MinisteriodeSanidadyConsumo.
OMS(1994):Manejodelabajavisindelosnios.InformedeunaConsultadeOMS.Crdoba
lvarezSR.Temasdelamedicinageneralintegral.LaHabana:CienciasMdicas;2001;Vol1:Saludymedicina.
MinisteriodelTrabajoySeguridadSocial.Programanacionaldeatencinapersonassordociegas.LaHabana:MTSS;2002.
PelezMO.Elporqudelavigenciadelaprevencinenoftalmologa.RevCubanaOftalmol1998;1(3):13.
MillerSJH.EnfermedadesdelosojosdeParsons.16ed.Madrid:Interamericana;1980.
AlemayMJ,TejeiroFA.EncuestadeciegosyprincipalescausasdecegueraenlaANCI.RevCubanaOftalmol1994;(12):68.
PratsAV,RondnPN,PelezViladebolL.Pesquizajeoftalmolgico.RevCubanaOftalmol1995;1:42.
TurciosTristSE.Captulo30Afeccionesocularesmsfrecuentes.En:lvarezSR.Temasdemedicinageneralintegral.LaHabana:CienciasMdicas;
2001;Vol.2.p.88394.

183

184