Anda di halaman 1dari 16

Fakultas Psikologi Universitas Gadjah Mada

ISSN: 0215-8884

Jurnal Psikologi
Volume 32, No. 2, 112-127

Hubungan Kepemimpinan Transformasional dan


Transaksional dengan Motivasi Bawahan di Militer
Wagimo
PerwiraMiliterTNIAngkatanUdara

Djamaludin Ancok
FakultasPsikologiUniversitasGadjahMada

ABSTRACT
The aim of this research is to test the
correlationsbetweenleadershipvariableand
followersmotivationinmilitary.Thereare
severalhypothesistobetestedinthisresearch.
(1)Thereisasignificantandpositivecorrelation
betweenbothtransformationalleadershipand
transactional leadership with followers
motivation,(2)Thereisasignificantandpositive
correlationbetweentransformationalleadership
and followers motivation, (3) There is a
significantandpositivecorrelationbetween
transactional leadership and followers
motivation,and(4)Thecorrelationbetween
transformational leadership and followers
motivation is stronger than the correlation
betweentransactionalleadershipandfollowers
motivation.
The subjects of this research are 110
membersofIndonesianMilitary(Bintaraand
Tamtama) who followed the Setukpa and
SetukbaEducationinIndonesianNationalAir
Force.
Thisresearchused2kindsofquestionnaire.
Thefirstismotivationquestionnaire,andthe
second is the leadership questionnaire. The
resultssupportedallofhypothesesofthestudy;
(1)Freg=24,660;(2)r=0,559;(3)r=0,225;
(4)r=0,559.
Keywords: motivation, transactional
leadership,transformationalleadership.
112

Pendahuluan
Variabelkepemimpinanmerupakan
salahsatuvariabelyangsangatmenarik
danmenjadisalahsatupusatperhatian
dalamsuatuorganisasi.Olehkarenanya
dalamberbagaipenelitiandalambidang
sumberdayamanusiabanyaksekalikita
temukanpenelitianyangmemfokuskan
peranan faktor kepemimpinan dalam
organisasi.
Kepemimpinan
mempunyai
pengertian dan definisi yang berbeda.
Parapenelitidanpraktisimendefinisikan
kepemimpinansesuaidenganperspektif
perspektif individual dan aspek dari
fenomenayangpalingmenarikperhatian
mereka.SehinggamenurutpenelitianBass
&Stogdill (dalamYukl, 1998)mengenai
pengertian dan definisi kepemimpinan
menyimpulkan bahwa ...terdapat
hampirsamabanyaknyadefinisitentang
kepemimpinan dengan jumlah orang
yang telah mencoba mendefinisikan
konseptersebut.Pendapatinididukung
oleh penelitian yang dilakukan oleh
Hughes, et all (2002) bahwa perbedaan
definisikepemimpinankarenaperbedaan

Jurnal Psikologi

Hubungan Kepemimpinan...

cara meneliti, variasi alat ukur, dan


perbedaan aspek kepemimpinan itu
sendiri.SedangkanmenurutYukl(1998)
perbedaan tersebut disebabkan oleh
berbagaiaspek,antara lain:aspeksiapa
yang menggunakan pengaruh, sasaran
yang ingin diperoleh dari pengaruh
tersebut, cara bagaimana pengaruh
tersebutdigunakan,sertahasildariusaha
menggunakanpengaruhtersebut.
Demikianjugadalamkonteksmiliter,
definisi kepemimpinan juga memiliki
pengertian yang berbeda. Perbedaan
tersebutdisebabkanolehperbedaancara
pandang,perbedaanhubunganleaderdan
followers serta situasi dan lingkungan
yang melatarbelakanginya. Dalam
konteks militer hubungan leader dan
followerdikenaldenganhubunganantara
komandan dan anak buah. Bentuk
hubunganyangterjalinbersifatkomando,
artinya perintah seorang komandan
adalahsesuatuyangharusdilaksanakan
tanpa harus menolak. Sehingga banyak
penulis dan praktisi kepemimpinan
menyimpulkanbahwakepemimpinandi
militer disebut sebagai kepemimpinan
yang bersifat diktator dan otokratik
(dictatorialandautocratic)(AlvinChan,2004).
Kepemimpinandenganpendekatan
baru sangat dibutuhkan untuk
menghadapi perubahan yang sangat
cepat,baikinternalTNImaupundiluar
institusi militer. Dengan demikian
dibutuhkankepemimpinanyangbersifat
transformatif,yaitukepemimpinanyang
mampu mengembangkan gerakan
inovatif, mampu memberdayakan staf

Jurnal Psikologi

dan organisasi ke dalam suatu


perubahancaraberpikir,pengembangan
visi,pengertiandanpemahamantentang
tujuan organisasi serta membawa ke
perubahan yang tidak hentihentinya
atauterusmenerusdenganpengolahan
aktivitas kerja dengan memanfaatkan
bakat, keahlian, kemampuan ide dan
pengalaman sehingga setiap pegawai
merasaterlibatdanbertanggungjawab
dalam m en yelesaikan peker jaan
(Mujiasih dan Sutrisno Hadi, 2003).
Gayakepemimpinanyangditampilkan
seor ang pemimpin yan g b ers ifat
tr an sformatif d iharapkan d ap at
meningkat kan motivas i bawah an
un tuk m en c ap ai hasil ker ja yang
optimal. Oleh karena itu dibutuhkan
gaya kepemimpinan transformasional
yang merupakan gaya kepemimpinan
yang mulai d iperh itungkan ke
gunaann ya dalam m en ghadapi
perubahan, baik perubahan internal
maupun eksternal (Bass, 1985,Avolio,
etall,1988,danBass,1996),demikian
juga untuk menumbuhkan motivasi
bawahan dalamrangka meningkatkan
kinerjanya (Bass, 1985; Hughes, et al,
2002).
Motivasidapatmemberikanenergi
yangdapatmenggerakkansegalapotensi
yangada,menciptakankeinginanyang
tinggi dan luhur serta meningkatkan
gairah kebersamaan. Oleh karena itu
kinerja seseorang tidak hanya
dipengaruhi oleh kepuasan kerja dan
moril (karyawan), tetapi motivasi
karyawan merupakan faktor yang

113

Wagimo dan Djamaludin Ancok

bahkanlebihpentingbagikeberhasilan
suatuorganisasi.MenurutPorter&Miles
(dalamSengkey,2003)motivasibawahan
dipengaruhi oleh tiga faktor yaitu:
karakteristik individu, karakteristik
pekerjaan,dankarakteristiklingkungan
kerja.
Salah satu faktor tersebut, yaitu
karakteristik lingkungan kerja sangat
terkait bagaimana hubungan seorang
bawahan dengan pemimpinnya.
Bagaimana seorang bawahan melihat
dan diperlakukan oleh seorang atasan
akan berpengaruh terhadap kinerja
mereka. Seorang bawahan akan
mempersepsikan gaya kepemimpinan
atasannya,sehinggamerekaakanmenilai
dan mewujudkan dalam bentuk
motivasikerja.Artinyaapabilapersepsi
gayakepemimpinanyangdiperlihatkan
dan dilakukan oleh atasannya ternyata
mendorongadanyapengembangandan
mempunyai pengaruh yang positip,
makamotivasibawahanakanmeningkat
secara signifikan. Tetapi sebaliknya

apabila gaya kepemimpinan yang


ditampilkan seorang atasan ternyata
memberikan kemungkinan untuk
mendapatkan hukuman dan pengaruh
yang negatif terhadap bawahan, maka
motivasibawahanakanmenurunsecara
signifikan. Penelitian ini akan melihat
hubungan antara kepemimpinan
transformasional dan transaksional
dengan motivasi bawahan di militer
dengan kerangka hubungan variabel
sepertipadagambar1.
TinjauanPustaka
MotivasiBawahan.
Menurut Gibson mengemukakan
bahwa motivasi adalah kekuatan
kekuatan yang bekerja pada seorang
karyawan yang menimbulkan dan
mengarahkanperilaku.Motivasiadalah
dorongan yang timbul di dalam diri
seseorang untuk menggerakkan dan
mengarahkan perilaku. Motivasi yang
ada pada diri seseorang akan
mewujudkan suatu perilaku yang

Gambar1.KerangkaHubunganVariabel

Gaya Kepemimpinan
Transformasional (X-1)
Motivasi Kerja Bawahan
(Y)
Gaya Kepemimpinan
Transaksional (X-2)

114

Jurnal Psikologi

Hubungan Kepemimpinan...

diarahkan pada tujuan menc apai


kepuasan (Gibson et al. 1997). Dari
pengertiantersebut, motivasi bukan
merupakan suatu hal yang dapat
diamati,melainkansuatuhalyangdapat
disimpulkan melalui perilaku yang
tampak.Setiapkegiatanyangdilakukan
oleh seseorang didorong oleh suatu
kekuatandaridalamdiriorangtersebut.
Kekuatan pendorong ini disebut
motivasi.
Motivasi merupakan masalah
kompleks dalam organisasi karena
kebutuhandankeinginansetiapanggota
organisasiberbeda. Halini disebabkan
setiap anggota organisasi adalah unik
secara biologis maupunpsikologis dan
berkembang atas dasar proses belajar
sebagaihasildaripengalaman.Pimpinan
suatuorganisasiatauperusahaanharus
mengetahuiapayangmenjadimotivasi
para karyawan atau bawahan karena
faktor ini akan menentukan jalannya
organisasidalampencapaiantujuan.
Motivasi dapat ditimbulkan oleh
faktor internal atau eksternal,
tergantung dari mana suatu kegiatan
dimulai. Motivasi internal berasal dari
diri pribadi seseorang yang akan
dijelaskanoleh teori hirarki kebutuhan
Maslow dan motif berprestasi
Mc Clelland. Motivasi eksternal
sebenarnya dibangun diatas motivasi
internaldantergantungpadaanggapan
anggapandanteknikteknikyangdipakai
oleh pimpinan organisasi atau para
manajerdalammemotivasibawahan.

Jurnal Psikologi

MenurutCampbell(dalamGibsonet
al. 1997) teori motivasi terbagi kedalam
duakategori,yaituTeoriKebutuhan(Need
Theories)danTeoriProses(ProcessTheories).
TeoriKebutuhan(NeedTheories)atauTeori
Isi (Content Theories) memusatkan
perhatian pada faktorfaktor di dalam
individuyangmendorong,mengarahkan,
mempertahankan dan menghentikan
perilaku. Teori ini menekankan
pentingnyapengertianakanfaktorfaktor
internalindividu,kebutuhanataumotif,
yang menyebabkan seseorang memilih
kegiatan, cara dan perilaku tertentu
untuk memuaskan kebutuhan yang
dirasakan. Beberapa ahli yang
mengemukakan
pandangannya
mengenai teori ini adalah Abraham
Maslow, Clayton Alderfer, Frederick
Herzberg,DavidMcClellanddanDouglas
McGregor.SedangkanteoriProses(Process
Theories) menjelaskan dan menganalisa
bagaimana perilaku didorong,
diarahkan,dipertahankandandihentikan.
Teori ini menekankan pada penyebab
adanya motivasi atau usaha dan lebih
pentinglagiadalahhubunganantarasatu
dengan yang lain. Beberapa ahli yang
mengemukakan teori ini adalah Victor
Vroom,B.F.Skinner,E.LockedanJ.Stacy
Adam.
Menurut Porter dan Miles (dalam
Sengkey, 2003) berpendapat bahwa
faktorfaktoryangmenimbulkanadanya
motivasi dari seorang bawahan dalam
melakukansuatukegiatanterbagidalam
tigakelompokvariabel,yaitu:

Karakteristikindividu,

115

Wagimo dan Djamaludin Ancok

Karakteristikpekerjaan,
Karakteristiklingkungankerja.
Karakteristik individu merupakan
perbedaan yang dipunyai setiap
individuberkaitandenganminat,sikap
dankebutuhannyakedalamsituasikerja,
sehingga motivasi kerja mereka juga
akan berbeda. Karakteristik pekerjaan
merupakan keadaan yang berkaitan
dengan apa yang dilakukan oleh
karyawan dalam bekerja beserta
konsekuensi yang diterimanya.
Sedangkan karakteristik lingkungan
kerja yaitu suatu kondisi atau suasana
kerja yang menjelaskan apa yang akan
terjadi pada karyawan dalam bekerja
dan berinteraksi dengan lingkungan
organisasinya.
KepemimpinanTransformasional.
Bass (1985) mendefinisikan
kepemimpinan transformasional
didasarkan pada pengaruh dan
hubungan pemimpin dengan pengikut
atau bawahan. Para pengikut merasa
perc aya, mengagumi, loyal dan
menghormatipemimpin,sertamemiliki
komitmen dan motivasi yang tinggi
untuk berprestasi dan berkinerja yang
lebih tinggi. Seorang pemimpin
transformasional dapat memotivasi
parapengikutnyadengantigacara(Yukl,
1998),yaitu:(1)membuat merekalebih
sadar mengenai pentingnya hasilhasil
suatupekerjaan,(2)mendorongmereka
untuk lebih mementingkan organisasi
atau tim daripada kepentingan diri
sendiri, dan (3) mengaktifkan

116

kebutuhankebutuhan mereka pada


yanglebihtinggi.
Bass(1985,1990),Avolio&Bass(1995)
mengemukakan bahwa kepemimpinan
transformasional memiliki empat
karakteristik,
yaitu:
karisma,
inspirasional, stimulasi intelektual dan
perhatian individual. Walaupun
seringkali Bass menambahkan satu
karakteristik lagi yang merupakan
perluasan dari karisma, yaitu idealized
influence (Bass 1991 dalam Alvin, Chan,
2004). Keempat karakteristik tersebut
lebih lanjut dijelaskan Bass (1985, 1990,
1998),Yulk(1998)danAvolio&Bass(1987
dalamMujiasihdanSutrisnoHadi,2003)
sebagaiberikut:
Karisma (Charisma):
memberikanvisidansenseofmission,
menanamkan
rasa
ban gga,
mend apatkan respect dan ke
percayaan (trust). Pemim pin
transformasional_terlihat
kharismatik oleh pengikutnya dan
mempunyai suatu kekuatan dan
pengaruh. Kharisma umumnya
berkenaan den gan tind akan
pengikut (follower) sebagai reaksi
atas peril aku pemimpin nya.
Pemim pin
tran sformasi onal
membangkitkan dan mem beri
seman gat pengi kutnya d engan
sebuahvisidansenseof mission yang
mend orong bawahan
untuk
melakukan usaha yang lebih (extra
effo rt) dalam mencapai tujuan.
Pengikutakanselaluberusahauntuk
menyamai pemimpinnya. Sehingga

Jurnal Psikologi

Hubungan Kepemimpinan...

pemimpin yang berkharisma akan


sepenuhn ya di horm ati, memil iki
referent power, sehingga layak ditiru,
memiliki standar yang tinggi dan
menetapkan tujuan yang menantang
bagi pengikutnya.
Inspirasional(Inspiration):
mengkomunikasikan ekspektasi yang
tinggi, menggunakan simbol untuk
memfokuskanupaya,mengekspresikan
tujuan dengan caracara yang
sederhana. Perilaku pemimpin
transformasional dapat merangsang
antusiasmepengikutnyaterhadaptugas
dandapatmenumbuhkankepercayaan
bawahanterhadapkemampuanuntuk
menyelesaikan tugas untuk mencapai
tujuan. Pemimpin transformasional
menggunakan simbolsimbol dan
seruanemosionalyangsederhanauntuk
meningkatkan kepedulian dan
pemahaman atas tujuan yang akan
dicapaibersama.
Stimulasi Intelektual (Intelectual
Stimulation): menghargai ideide
bawahan (promote intelegence),
mengembangkan rasionalitas dan
melakukanpemecahanmasalahsecara
cermat.Pemimpin transformasional
mendorong pengikutnya untuk me
mikirkankembalicaracaralamamereka
dalam melakukan sesuatu atau untuk
merubahmasa lalunya dengan ideide
danpemikirannya.Merekajugadidorong
pengembangan rasionalitas serta
didorong untuk mempertimbangkan
caracarayangkreatifdaninovatifuntuk
membangundirinya.

Jurnal Psikologi

Perhatian Individu (Individualized


Consideration):memberikanperhatian
padapribadi,menghargaiperbedaan
setiap individual, memberi nasehat
dan pengarahan. Pemimpin
transformasional memperlakukan
sec ara berbeda tetapi seimbang
terhadap pengikutnya untuk
memelihara kontak hubungan dan
komunikasi yang terbuka dengan
pengikutnya. Perhatian sec ara
individual merupakan identifikasi
awal terhadap potensi bawahan.
dan
Sedangkan monitoring
pengarahan merupakan bentuk
perhatian individual yang di
tunjukkan melalui tindakan
konsultasi, nasehat dan tuntunan
yang diberikan oleh pemimpin
transformasional.

KepemimpinanTransaksional
Menurut Bass (1985, 1990)
pemimpin transaksional memotivasi
pengikutnya dengan c ara menukar
imbalan untuk pekerjaan atau tugas
yang telah dilaksanakan misalnya
denganpenghargaan,menaikkanupah
terhadappengikutnyayangmelakukan
kinerja yang tinggi. Tetapi sebaliknya
akan memberikan penalti (punishment)
terhadappengikutnyayangmempunyai
kinerja yang rendah atau berada di
bawah target. Menurut Bass(1990) dan
Hughes, et al, (2002) imbalan akan
mempengaruhi motivasi bawahan dan
selanjutnyaakanmempengaruhikinerja
dan kepuasan bawahan. Pertukaran

117

Wagimo dan Djamaludin Ancok

mengenai imbalan didasarkan pada


kesepakatanmengenaitugasyangharus
dilaksanakan. Pemimpin transaksional
selalu mendorong pengikutnya untuk
mencapai tingkat kinerja yang telah
disepakatibersama.
Bass (1985, 1990), Avolio & Bass
(1995) mengemukakan bahwa
kepemimpinan transaksional memiliki
empat karakteristik, yaitu: imbalan
kontinjen, MBEAktif, MBEPasif dan
laissezfaire. Walaupun seringkali Bass
memisahkan satu karaketristik yang
merupakankarakteristikkepemimpinan
nontransaksional,yaitulaissezfaire(Bass
1991dalamAlvin,Chan,2004),sehingga
dalam beberapa kajian Bass hanya
mengemukakan tiga karakteristik
kepemimpinan transaksional. Ketiga
karakteristik tersebut lebih lanjut
dijelaskanBass(1985,1990),Yukl(1998)
danAvolio&Bass(1987dalamMujiasih
danSutrisnoHadi,2003)sebagaiberikut:
Imbalan Kontinjen ((Contingen
Reward):kontrakpertukaranimbalan
untuk suatu upaya, menjanjikan
imbalanbagimerekayangmelakukan
kinerja dengan baik, menghargai
prestasi kerja. Pada kepemimpinan
transaksional, pemberian imbalan
sesuai dengan upaya penyelesaian
pekerjaan yang dilakukan pengikut
atau bawahan. Bentuk kesepakatan
ini merupakan bentuk pertukaran
aktifantarapemimpindanpengikut,
yaitu bawahan akan menerima
imbalanatastargettujuantugasatau
pekerjaan yang diupayakan dan

118

target tersebut merupakan hasil


kesepakatanantarakeduanya.Selain
itu, pemimpin transaksional
bertransaksi dengan bawahan
dengan memfokuskan pada aspek
kesalahanyangdilakukanbawahan,
menunda keputusan, atau halhal
lain yang kemungkinan mem
pengaruhiterjadinyakesalahan.
MBEAktif(ManagementbyException
active): mengawasi dan mencari
kesenjangan atau penyimpangan
dari berbagai aturan standar,
malakukan tindakan korektif.
Pemimpintransaksionalmenekankan
fungsi manajemen sebagai kontrol.
PadaMBEAktifinipemimpinsecara
terus menerus melakukan peng
awasanterhadapbawahannyauntuk
mengantisipasi adanya kesalahan.
Namun demikian apabila terjadi
kesalahan
pemimpin
akan
melakukantindakankoreksi.
MBEPasif(ManagementbyException
pasive):melakukanintervensihanya
apabila standar hasil kerja tidak
tercapai.SedangkanpadaMBEPasif
pemimpin melakukan intervensi,
kritik dankoreksi setelah kesalahan
terjadi danstandaratautargetyang
telah disepakati tidak terc apai,
sehinggapemimpinhanyamenunggu
semua proses dalam tugas atau
pekerjaantelahselesai.

HipotesisPenelitian
Berdasarkan uraian teoritis tersebut
diatas, maka penelitian ini akan

Jurnal Psikologi

Hubungan Kepemimpinan...

menguji empat hipotesis sebagai


berikut:
Hipotesispertama(H1):
Diduga ada hubungan yang
positifdansignifikanantaragaya
kepemimpinantransformasional
dan gaya kepemimpinan
transaksional secara bersama
sama dengan motivasi kerja
bawahan.
Hipotesiskedua(H2):
Diduga ada hubungan yang
positifdansignifikanantaragaya
kepemimpinantransformasional
denganmotivasikerjabawahan.
Hipotesisketiga(H3):
Diduga ada hubungan yang
positifdansignifikanantaragaya
kepemimpinan transaksional
denganmotivasikerjabawahan.
Hipotesiskeempat(H4):
Diduga hubungan antara gaya
kepemimpinan transformasional
denganmotivasikerjabawahanlebih
kuat atau lebih erat daripada
hubunganantaragayakepemimpinan
transaksionaldenganmotivasikerja
bawahan.
MetodePenelitian
VariabelPenelitian
Variabel penelitian merupakan
variabelvariabel yangakan digunakan
dalam melakukan penelitian ilmiah.
Menurut Hagul, Manning dan
Singarimbun(SingarimbundanEffendi,
1989) pada dasarnya inti penelitian
ilmiahadalahmencarihubunganantara

Jurnal Psikologi

variabel. Hubungan yang paling dasar


adalah hubungan antara dua variabel,
yakni variabel pengaruh atau variabel
bebasdenganvariabelterpengaruhatau
variabel terikat.
Dalam penelitian ini kedua variabel
tersebutadalah:
1. Variabel terikat (dependent variable) :
motivasi kerja (Y), yang didasarkan
padatigafaktormotivasidariPorter
danMiles.
2. Variabel bebas (independent variable),
terdiri dari duavariabel yaitu: gaya
kepemimpinantransformasional(X
1) dankepemimpinantransaksional
(X2),yangdidasarkanpadakonsep
Bass.
TeknikPengambilanSampel,JenisSampeldan
JumlahSampelPenelitian
Teknik pengambilan sampel yang
digunakan oleh peneliti adalah
pengambilansampelyangbersifattidak
acak(nonrandomsampling),dimanasampel
dipilih berdasarkan pertimbangan
pertimbangan tertentu (Cooper dan
Emory, 1995). Sedangkan jenis sampel
yangdipakaidalampenelitianiniadalah
sampel bertujuan (purposive sampling),
yaitu sampel yang menyesuaikan diri
dengankriteriakriteriatertentu(Cooper
danEmory,1995).Olehkarenaitudalam
penerapannyakitaterlebihdahuluharus
mengetahui sifatsifat populasi yang
diperlukan agar populasi yang akan
dipakai sebagai sampel memiliki sifat
sifat populasi tersebut sehingga tujuan
dari penelitian ini akan terc apai

119

Wagimo dan Djamaludin Ancok

(Arikunto, 1996). Dalam penelitian ini


populasi yang akan diteliti adalah
anggota militer bintara dan tamtama
yang sedang mengikuti pendidikan
Setukpa danSetukba diTNI Angkatan
Udara dengan masa kerja antara 10
tahun sampai dengan 30 tahun serta
berpendidikanSLTPsampaidenganS1.
Responden dipilih berdasarkan
pertimbangan masa kerja dan tingkat
pendidikan yang dipunyai, yaitu
respondenyangmempunyaimasakerja
di atas 10 tahun dengan pendidikan
minimal SLTA. Oleh karena itu dalam
penelitian ini penulis tidak akan
memasukkan anggota militer yang
mempunyai masa kerja di bawah 10
tahundanberpendidikanSLTPsebagai
respondendalampenelitian.Responden
yang akan diteliti hanya yang
mempunyaimasakerjadiatas10tahun
dan berpendidikan minimal SLTA.
Pemilihan ini bertujuan untuk
menghindari bias dalam persepsi,
pemahaman dan penilaian terhadap
variabel yang diteliti, terutama
kepemimpinanseorangatasandanbias
terhadapkonstruksdarikuesioneryang
akandigunakan.
Jumlah sampel dalam suatu
penelitian yang menggunakan metode
survai, menurut Mantra dan Kasto
(Singarimbun dan Effendi, 1989),
tidaklah selalu perlu untuk meneliti
semuaindividudalampopulasi,karena
denganmenelitisebagianindividudari
populasi saja, gambaran sifat dari
populasi sec ara keseluruhan akan

120

didapat.Didalampenelitianini,populasi
yangakanditelitijumlahnyamencapai
kuranglebih397orangdandarijumlah
tersebut yang dijadikan sampel dalam
penelitiansebanyak115orang.Dari115
yang disebarkan hanya 110 yang bisa
digunakandandiolahdalampenelitian
ini.
TeknikPenilaianKuesioner
Penentuan skor dan kategori
kuesionerdidasarkanpadaSkalaLikert,
yaiturespondendimintauntukmemberi
responterhadapsetiappernyataanatau
pertanyaan dengan memilih salah satu
dari beberapa pilihan yang sesuai
(Cooper dan Emory, 1995: 194). Pada
penelitian ini setiap pertanyaan diberi
skor 1 sampai dengan 4 menggunakan
nilai terendah dan tertinggi untuk
kuesioner variabel terpengaruh atau
variabel terikat, sedangkan variabel
pengaruhatauvariabelbebasdiberiskor
0 sampai dengan4 menggunakan nilai
terendahdantertinggi.Kuesioneryang
dibuatolehpenelitidibagimenjadidua
bagian,yakni:
1.Kuesionerbagianpertama
Merupakan kuesioner yang
membahastentangmotivasikerja,yakni
motivasi bawahan pada saat akan
melakukansuatu pekerjaanatautugas.
Semua pertanyaan pada kuesioner
bagian pertama ini merupakan
pertanyaan positif dengan 4 alternatif
jawaban dengan skor secara berurutan
dari 4 sampai dengan 1. Materi dan
jumlah item yang disusun mengacu

Jurnal Psikologi

Hubungan Kepemimpinan...

kepada kuesioner tentangfaktorfaktor


motivasi yang disusun oleh Porter &
Miles(dalamSengkey,2003)
2.Kuesionerbagiankedua
Merupakan kuesioner yang berisi
tentanggayakepemimpinandanterbagi
menjadi dua bagian yaitu gaya
kepemimpinan transformasional dan
gaya kepemimpinan transaksional.
Semua pertanyaan pada kuesioner
bagiankeduainimerupakanpernyataan
positif dengan 5 alternatif jawaban
dengan skor secara berurutan dari 0
sampai dengan 4. Materi dan jumlah
item yang disusun mengacu kepada
kuesionerMLQdariAvolio&Bass(1991)
yangtelahdimodifikasipadatahun1995.
MetodePengolahanData
Pengolahandatadilakukanpeneliti
denganmenggunakanmetodekomputer
SPSS(StatisticalProgramforSocialScience)
11.0forWindows.
AnalisaDatadanPembahasan
UjiValiditas
Padapenelitianinisebelumkuesioner
disebarkan kepada seluruh responden,
penulismelakukanujicobaterhadap30
orang siswaSetukpa untuk mengetahui
tingkat validitas alat ukur sebelum
digunakan pada penelitian selanjutnya.
Teknikyangdigunakanolehpenelitiuntuk
uji validitas ini adalah dengan uji
signifikansi Cronbachs Alpha, yaitu
membandingkan nilai r hitung dengan
nilairtabeluntukdegreeoffreedom(df)=n
k. Padapenelitianinibesarnyadfdapat

Jurnal Psikologi

dihitung,yaitu:302ataudf28dengan
alpha0,05makadiperolehrtabelsebesar
0,361. Jika r hitung > 0,361 dan bernilai
positip, maka butir atau pernyataan
dalam variabel penelitian ini dapat
dikatakan valid dan dapat digunakan
padapenelitianselanjutnya.Tetapijikar
hitung < 0,361 dan bernilai positip atau
negatip, maka butir atau pernyataan
dalam variabel penelitian ini dapat
dikatakantidakvaliddangugur,sehingga
tidak bisa digunakan pada penelitian
selanjutnya.
Berdasarkan data Uji Validitas
Kuesioner seluruh butir pertanyaan
pada seluruh variabel yang diuji
memiliki nilai koefisien validitas (r
hitung)yanglebihbesardarikoefisienr
tabel (N = 30, = 0,05) sebesar 0,361.
Dengan demikian dapat dikatakan
bahwaseluruhbutirkuesionervariabel
Kepemimpinan Transaksional yang
disusun valid (sahih), sehingga dapat
digunakan untuk mengambil data
penelitianselanjutnya.
UjiReliabilitas
Pada penelitian ini sebelum
kuesioner disebarkan kepada seluruh
responden,penulismelakukanujicoba
terhadap30orangsiswaSetukpauntuk
mengetahuitingkatreliabilitasalatukur
sebelum digunakan pada penelitian
selanjutnya. Teknik yang digunakan
penelitidalamujireliabilitaspenelitian
ini adalah Cronbachs Alpha. Dimana
koefisien reliabilitas mendekati 1,0
semakin baik, kurang dari Alpha 0,6

121

Wagimo dan Djamaludin Ancok

buruk,0,7dapatditerimadanlebihdari
0,8dikatakanbaik(Sekaran,2003).
Berdasarkan data Uji Reliabilitas
Variabel menunjukkan bahwa semua
variabel yang diuji memiliki nilai
koefisienreliabilitasdiatas0,8000yaitu
reliabilitas variabel Motivasi Bawahan
sebesar0,8926,variabelKepemimpinan
Transformasional sebesar 0,9404, dan
variabelKepemimpinan Transaksional
sebesar0,8540.Dengandemikiandapat
dikatakan bahwa semua kuesioner
variabel yang digunakan dalam
penelitian ini mempunyai taraf
reliabilitasyangbaikatautinggi,karena
mempunyai tingkat kehandalan yang
tinggi(koefisien nilai Alphae 0,8000),
sehingga dapat digunakan untuk
mengambildatapenelitianselanjutnya.
PengujianHipotesisdanPembahasan.
HipotesisPertama(H1):
Diduga ada hubungan yang positif
dan signifikan antara gaya
kepemimpinantransformasionaldan
gaya kepemimpinan transaksional
secara bersamasama dengan
motivasikerjabawahan.
Data yang ditemukan berdasarkan
hasil analisis uji regresi, terutama uji F
(uji varians) menunjukkan bahwa
hipotesis tersebutditerima, sebabnilaiF
hitung variabel gaya kepemimpinan
transformasional(X1)dankepemimpinan
transaksional (X2) dengan motivasi
bawahan (Y) dapat diketahui sebesar
24,660dengankoefisiensignifikansebesar

122

0,000.SementaraituFtabeluntuktingkat
signifikan5%denganjumlahsampel110
diperolehnilaiFtabel=4,000(nilaiFtabel
untuksampelantara60120).Darihasil
tersebut,maka nilaiF hitunglebihbesar
dari F tabel (24,660 > 4,000). Dengan
demikian dapat disimpulkan bahwa
variabel
gaya
kepemimpinan
transformasional dan kepemimpinan
transaksional secara bersamasama
memiliki pengaruh yang signifikan
terhadapmotivasibawahan.
Temuaninikonsistendanmendukung
pendapat Bass (1985), bahwa perilaku
kepemimpinan transformasional dan
kepemimpinantransaksionalmerupakan
sesuatuyangberbedanamuntidaksebagai
proses yang mutually exclusive. Dengan
demikian dimungkinkan seorang
pemimpin menerapkan kedua gaya
tersebut pada situasi yang berbeda.
PendapatinidiperkuatolehHughes,etal
(2002) bahwa dalam prakteknya
kepemimpinan transformasional dan
transaksional dapat ditampilkan oleh
pemimpin yang sama, hanya kuantitas
perilaku dan intensitasnya saja yang
berbeda.Implikasinyaseorangkomandan
atau atasan di militer bisa menerapkan
atau menampilkan dua perilaku
kepemimpinan pada saat yang berbeda
sesuaisituasidankondisiyangdihadapi.
Artinyapada saatdansituasitertentu ia
harus menerapkan gaya kepemimpinan
transformasional, tetapi pada saat dan
situasiyanglainiaharusmenerapkangaya
kepemimpinantransaksional.

Jurnal Psikologi

Hubungan Kepemimpinan...

Hipotesiskedua(H2):
Didugaadahubunganyangpositif
dan signifikan antara gaya
kepemimpinan transformasional
denganmotivasikerjabawahan.
Data yang ditemukan berdasarkan
hasilanalisisujikorelasi,menunjukkan
bahwa hipotesis tersebut diterima,
karena hasil perhitungan SPSS nilai
koefisienkorelasi antara variabelgaya
kepemimpinan transformasional (X1)
dengan motivasi bawahan (Y) dapat
diketahui sebesar 0,559 dengan nilai
koefisien signifikansi sebesar 0,000.
Karena nilai koefisien signifikansi
sebesar 0,000 < 0,050 maka dapat
disimpulkanbahwaterdapathubungan
positif yang signifikan antara gaya
kepemimpinantransformasionaldengan
motivasi bawahan dengan taraf
signifikansiyangsangatkuat.
Sedangkan nilai koefisien korelasi
sebesar 0,559 maka dapat disimpulkan
bahwaterdapathubunganpositifyang
signifikan antara gaya kepemimpinan
transformasional dengan motivasi
bawahan dengan taraf hubungan yang
cukupkuat.
Hasil ini masih konsisten dan
mendukung pendapat Bass (1985) dan
Hughes,etal(2002)yangmendefinisikan
kepemimpinan transformasional
didasarkan pada pengaruh dan
hubungan pemimpin dengan pengikut
atau bawahan. Para pengikut merasa
perc aya, mengagumi, loyal dan
menghormatipemimpin,sertamemiliki

Jurnal Psikologi

komitmen dan motivasi yang tinggi


untuk berprestasi dan berkinerja yang
lebih tinggi. Seorang pemimpin
transformasional dapat memotivasi
parapengikutnyadengantigacara(Yukl,
1998),yaitu:(1)membuat merekalebih
sadar mengenai pentingnya hasilhasil
suatupekerjaan,(2)mendorongmereka
untuk lebih mementingkan organisasi
atau tim daripada kepentingan diri
sendiri, dan (3) mengaktifkan
kebutuhankebutuhan mereka pada
yanglebihtinggi.
Indikasitersebutjugamenunjukkan
bahwa anggota militer, terutama pada
pangkat bintara dan tamtama pada
penelitian ini sangat mengharapkan
perilakukepemimpinantransformasional
dari seorangkomandan atau atasannya
untuk meningkatkan motivasi kerja
bawahannya. Bawahan masih percaya,
mengagumi, loyal dan menghormati
atasannya atau komandannya di
kesatuannya masingmasing, walaupun
bukan satusatunya media atau sarana
untuk meningkatkan motivasi. Hal ini
terlihatdarinilaikoefisienkorelasiyang
cukuptinggidarivariabelkepemimpinan
transformasionaldalampenelitianini.
Hipotesisketiga(H3):
Didugaadahubunganyangpositif
dan signifikan antara gaya
kepemimpinan transaksional
denganmotivasikerjabawahan.
Data yang ditemukan berdasarkan
hasilanalisisujikorelasi,menunjukkan

123

Wagimo dan Djamaludin Ancok

bahwa hipotesis tersebut diterima,


karena hasil perhitungan SPSS nilai
koefisienkorelasi antara variabelgaya
kepemimpinan transaksional (X2)
dengan motivasi bawahan (Y) dapat
diketahui sebesar 0,225 dengan nilai
koefisien signifikansi sebesar 0,018.
Karena nilai koefisien signifikansi
sebesar 0,018 < 0,050 maka dapat
disimpulkanbahwaterdapathubungan
positif yang signifikan antara gaya
kepemimpinantransformasionaldengan
motivasi bawahan dengan taraf
signifikansiyangcukupkuat.
Sedangkan nilai koefisien korelasi
sebesar0,225makadapatdisimpulkan
bahwaterdapathubunganpositifyang
signifikan antara gaya kepemimpinan
transaksionaldenganmotivasibawahan
dengan taraf hubungan yang relatif
lemah.
Hasil ini masih konsisten dan
mendukungpendapatBass(1985,1990)
bahwa pemimpin transaksional
memotivasi pengikutnya dengan cara
menukarimbalanuntukpekerjaanatau
tugasyangtelahdilaksanakanmisalnya
denganpenghargaan,menaikkanupah
terhadappengikutnyayangmelakukan
kinerja yang tinggi. Tetapi sebaliknya
akan memberikan penalti (punishment)
terhadappengikutnyayangmempunyai
kinerja yang rendah atau berada di
bawah target. Menurut Bass(1990) dan
Hughes, et al, (2002) imbalan akan
mempengaruhi motivasi bawahan dan
selanjutnyaakanmempengaruhikinerja
dan kepuasan bawahan. Pertukaran

124

mengenai imbalan didasarkan pada


kesepakatanmengenaitugasyangharus
dilaksanakan. Pemimpin transaksional
selalu mendorong pengikutnya untuk
mencapai tingkat kinerja yang telah
disepakati bersama. Dengan kata lain
pemimpin transaksional memotivasi
bawahannya untuk berkinerja sesuai
denganyangdiharapkan.
Hasilinijugamenunjukkanbahwa
dimiliterkonseprewardandpunishment
akan memotivasi seorang bawahan
untuk berkinerja sesuai yang di
harapkan. Reward dalam militer tidak
hanyaberbentukmateritetapibisajuga
berbentuknonmateri.Namundemikian,
nilai koefisien korelasi variabel
kepemimpinantransaksionaltidaktinggi
dan lebih rendah dari variabel
kepemimpinan transformasional
disebabkan masih kuatnya pengaruh
budaya (culture) kolektivisme
masyarakatdiIndonesia,sehinggakerja
tidakhanyamengharapkanrewardsaja,
tetapi unsur menjalin kekeluargaan
masihcukupkuat
Hipotesiskeempat(H4):
Diduga hubungan antara gaya
kepemimpinan transformasional
dengan motivasi kerja bawahan
lebihkuatataulebih erat daripada
hubungan antara gaya ke
pemimpinantransaksionaldengan
motivasikerjabawahan.
Data yang ditemukan berdasarkan
hasilanalisisujikorelasi,menunjukkan

Jurnal Psikologi

Hubungan Kepemimpinan...

bahwa hipotesis tersebut diterima,


karena hasil perhitungan SPSS nilai
koefisienkorelasi antara variabelgaya
kepemimpinan transformasional (X1)
dengan motivasi bawahan (Y) dapat
diketahui sebesar 0,559 dengan nilai
koefisiensignifikansisebesar0,000.Nilai
tersebut lebih besar daripada nilai
koefisienkorelasi antara variabelgaya
kepemimpinan transaksional (X2)
dengan motivasi bawahan (Y) sebesar
0,225dengannilaikoefisiensignifikansi
sebesar0,018.
Dari hasil analisis tersebut dapat
disimpulkan bahwa hubungan antara
gaya kepemimpinan transformasional
dengan motivasi kerja bawahan lebih
kuatataulebiheratdaripadahubungan
antaragayakepemimpinantransaksional
denganmotivasikerjabawahan.
Hasil ini mendukung pendapat
Bass (1990) yang menganggap bahwa
kepemimpinantransformasionallebih
un ggul d ar ipad a kep emim p in an
t ran saksional. Un t uk men dukun g
keunggulan kepemimpinan transfor
masional daripada kepemimpinan
transaksional, dibuktikan oleh hasil
penelitianBassdanAvoliopadatahun
1990 (dalam Robbins, 1996) terhadap
sejumlah perwira militer Amerika
Serikat, Kan ada dan Jerman pada
semua tingkatan (level jabatan dan
kepan gkat an ), b ah wa pem imp in
transformasional dinilai lebih efektif
daripada pemimpin transaksional.
Dalam studistudi yang lain, Yukl
m enyim pulkan b ahwa p er ilaku

Jurnal Psikologi

p erilaku d ar i kep em im p in an
transformasionalbiasanyaberkorelasi
lebih kuat dengan kriteriakriteria
aspek lain yang d itelit i d ar ipad a
p erilakup er ilaku kep em im p in an
transaksional(Yukl,1998).
DaftarPustaka
Anonim,LintasanSejarahPangkalanUdara
AdiSoemarmo,DinasPenerangandan
Perpustakaan
Lanud
Adi
Soemarmo,Surakarta,2003.
Arikunto,Suharsimi,ProsedurPenelitian
Suatu pendekatan Praktek, Renika
Cipta,CetakanKesepuluh,Jakarta,
1996.
Aryani & Sugiarti, Pengaruh Perilaku
KepemimpinanTransformasionalTerhadap
KinerjaDitinjaudariPerspektifLearning
andGrowthdalamBalanceScorecard,
JurnalBisnisdanManajemen,Vol.2,
No.2,2002hal107118
Avolio, Bruce J, et all, Transformational
Leadership in a Management Game
Simulation, Group & Organization
Studies,Vol.13No.1,March1988.
Bass,B.M.,LeadershipandPerformanceBeyond
Expectations, The Free Press, New
York,1985.
Bass, B.M., From Transactional to
transformationalLeadership:Learningto
Share the Vision, Organizational
Dynamic,1990,dalamSteers,Porter
&Bigley,Motivationandleadershipat
Work,McGrawHillInternational6th
Edition,1996.

125

Wagimo dan Djamaludin Ancok

Bass,B.M.,TheEthics ofTransformational
Leadership,AcademyofLeadership
P r e s s , 1 9 9 7 ( d a la m
www.ac ademy.umd.edu,
6
Nopember2004)
Bass, B.M., Transformational Leadership:
Industrial, Military, and Educational
Impact, Lawrenc e Erlbaum
Associates, Publishers, Mahwah,
NewJersey,1998.
Bass,B.M.andAvolio,MultifactorLeadership
Questionnaire, Mind Garden, Inc,
California,1995.
Bass,B.M.andSteidlmeier,Paul,Ethics,
Character,andAuthentic
Transformational Leadership, Center for
Leadership Studies, Sc hool of
Management
Binghamton
University,Binghamton,NY13902
6015
(dalam
h t t p : //
cls.binghamton.edu/BassSteid.html
6November2004)
Bradley,Peter&Charbonneau,Danielle,
TransformationalLeadership:Something
New, Something Old, Canadian
MilitaryJournal,Volume5,2004.
Chan, Alvin, The Full Range Leadership
ModelandItsApplicationtotheSingapore
Armed
Forces,
(dalam
www.mindef.gov.sg, 6 Nopember
2004)
Cooper,DonaldR&Emory,CWilliam,
Metode Penelitian Bisnis, Erlangga,
Jakarta, 1995

126

Dessler,Gary,ManajemenPersonalia,Edisi
3, (terjemahan), Erlangga, Jakarta,
1986.
Ebert, R.J. & Griffin, R.W., Business
Essentials,FourthEditions,Prentice
Hall,2003.
Ghozali,Imam,AplikasiAnalisisMultivariate
DenganProgramSPSS,BadanPenerbit
Undip,Semarang,2001.
Gibson, J. L., Ivancevich, J. M., and
Donnely, Jr, J. H. , Organization:
Behavior,Structur, Processes, Ninth
Edition,Irwin,1997.
Gitosudarmo, Indriyo dan I. Nyoman
Sudita, Perilaku Keorganisasian,
Yogyakarta:BPFE.,1997.
Greenberg,JeraldandBaron,RobertA,
Behavior
in
Organizations,
International Edition, Pearson
Education,Inc.2003.
Hasibuan, Malayu S.P., Organisasi dan
Motivasi: Dasar Peningkatan
Produktivitas,BumiAksara,Jakarta,
1999.
Hasibuan, Malayu S.P., Organisasi dan
Motivasi, Penerbit Bumi Aksara,
Jakarta,1996.
Hughes, Richard L, et all, Leadership:
Enhancing the Lessons of Experience,
McGrawHill Companies Fourth
Edition,2002.
MacIsaac, J.R, Leadership During Peace
SupportOperations:MissionPossible,
CanadianMilitaryJournal,Volume
5,2004.

Jurnal Psikologi

Hubungan Kepemimpinan...

Mujiasih,Endah&Hadi,Sutrisno,Persepsi
Mengenai Gaya Kepemimpinan
TransformasionaldanTransaksionaldan
Pengaruhnya Terhadap Upaya Ekstra
(ExtraEffort)PegawaiDinasKesehatan
Kota (DKK) Semarang, Salatiga dan
KabupatenSemarangdiUngaran,Jurnal
BisnisdanEkonomi,Vol.10No.2,
September2003.
Popper,Micha,etall,TheIsraeliDefence
Force:AnExampleofTransformational
Leadership,
Leadership
&
Organizational Development
Journal,Vol.13No.I,1992
Sengkey,JesajaElisa,AnalisisHubungan
FaktorFaktorMotivasidanPrestasikerja
Karyawan, Tesis MM UGM (tidak
dipublikasikan),2003.
Sekaran, Uma., Research Methods For
Business, A SkillBuilding Approach
4thedition. John Wiley & Sons, Inc.,
2003.
Singarimbun, Masri & Effendi, Sofian,
MetodePenelitianSurvai,LP3ES,Jakarta,
1989.

Surat Keputusan Kepala Staf TNI AU


Nomor:Kep/5/III/2004tanggal1
Maret 2004 tentang PokokPokok
OrganisasidanProsedurPangkalanTNI
AUAdiSoemarmo(LanudSMO),Mabes
TNIAU,Jakarta,2004.
Terry, Larry D, Leadership of Public
Bureaucracies: The Administrator as
Conservator,SAGEPublications,Inc,
California,1995.
Tracey, J Bruce & Hinkin, Tymothy R,
TransformationalLeadershiporEffective
Managerial Practices?, Group &
OrganizationStudies,Vol.23No.3,
September1998.
Triyugara, Hubungan Antara Persepsi
KaryawanTerhadapGayaKepemimpinan
dengan Perubahan PT. Jasa Raharja
(Persero), Tesis MM UGM (tidak
dipublikasikan),2002.
UndangUndang(UU)Nomor:34Tahun
2004 tentang Tentara Nasional
Indonesia.
Yukl,Gary,KepemimpinanDalamOrganisasi,
Prenhallindo,Jakarta,1998.

Soegiyono,MetodePenelitianAdministrasi,
PenerbitAlfabeta,Bandung,1994.
Suradji, Agus, Analisis Kepemimpinan
TransformasionalManajerPT.TELKOM
DIVREIVJATENG&DIY,TesisMM
UGM(tidakdipublikasikan),2002.

Jurnal Psikologi

127