DEFINITION: It is an abnormal condition of the placenta where there

are partly degenerative and partly proliferative changes in the

young chorionic villi.
These result in the formation of clusters of small cysts of varying
sizes. Because of its superficial resemblance to hydatid cyst, it is
named as hydatidiform mole. It is best regarded as a benign
neoplasia of the chorion with malignant potential.
INCIDENCE: There is wide range of geographical and ethnic variation
of the prevalence of the condition.
The molar pregnancy is common in Oriental countriesPhilippines,
China, Indonesia, Japan, India, Central and Latin America and Africa.
The highest incidence is in Philippines being 1 in 80 pregnancies and
lowest in European countries 1 in 752 and USA being about 1 in
2000. The incidence, in India, is about 1 in 400.
DEFINISI: Ini adalah kondisi abnormal dari plasenta mana ada
perubahan sebagian degeneratif dan sebagian proliferatif dalam villi
muda chorionic.
Ini mengakibatkan pembentukan kelompok kista kecil dari berbagai
ukuran. Karena kemiripan dangkal untuk kista hidatidosa, hal ini
dinamakan sebagai mola hidatidosa. Hal ini sebaiknya dianggap
sebagai neoplasia jinak dari korion dengan potensi ganas.
INSIDEN: Ada berbagai macam variasi geografis dan etnis dari
prevalensi kondisi.
Kehamilan molar adalah umum di negara-negara Filipina Oriental,
China, Indonesia, Jepang, India, Amerika Tengah dan Latin dan
Afrika. Insiden tertinggi adalah di Filipina menjadi 1 di 80 kehamilan
dan terendah di negara-negara Eropa 1 di 752 dan Amerika Serikat
menjadi sekitar 1 tahun 2000. Kejadian, di India, sekitar 1 dari 400.
ETIOLOGY:Thecauseisnotdefinitelyknown,butitappearstoberelatedtothe
ovulardefectasitsometimesaffectsoneovumofatwinpregnancy.However,the
followingfactorsandhypotheseshavebeenforwarded:
Itsprevalenceishighestinteenagepregnanciesandinthosewomenover
35yearsofage.
Theprevalenceappearstovarywithraceandethnicorigin.
Faultynutritioncausedbyinadequateintakeofprotein,animalfatcould
partlyexplainitsprevalenceintheOrientalCountries.Lowdietaryintakeofcarotene
isassociatedwithincreasedrisk.
Disturbedmaternalimmunemechanismssuggestedby(a)Risein

gammaglobulinlevelinabsenceofhepaticdisease(b)IncreasedassociationwithAB
bloodgroupwhichpossessesnoABOantibody.
CytogeneticabnormalityIngeneral,completemoleshavea46,XX
karyotype(85%),themolarchromosomesarederivedentirelyfromthefather.
Theovumnucleusmaybeeitherabsent(emptyovum)orinactivatedwhichhasbeen
fertilizedbyahaploidsperm.Itthenduplicatesitsownchromosomesaftermeiosis.
Thisphenomenonisknownasandrogenesis.Infrequently,thechromosomalpattern
maybe46,XYor45,X.
Thehighertheratioofpaternal:maternalchromosomes,thegreateristhe
molarchange.Completemolesshow2:0paternal/maternalratiowhereaspartialmole
shows2:1ratio.
4%).

Historyofpriorhydatidiformmoleincreasesthechanceofrecurrence(1to

ETIOLOGI:Penyebabnyatidakdiketahuipasti,tetapitampaknyaterkaitdengancacat
ovulumkarenakadangkadangmempengaruhisatuseltelurdarikehamilankembar.
Namun,faktorfaktordanhipotesisberikuttelahditeruskan:
Prevalensinyatertinggipadakehamilanremajadanwanitawanitadiatas35tahun.
Prevalensitampaknyaberbedadenganrasdanasaletnis.
Nutrisirusakdisebabkanolehkurangnyaasupanprotein,lemakhewansebagian
dapatmenjelaskannyaprevalencediNegaraOriental.asupanmakananrendahdari
karotenberhubungandenganpeningkatanrisiko.
Terganggumekanismekekebalantubuhibudisarankanoleh(a)Kenaikantingkat
gammaglobulindalamketiadaanpenyakithati(b)Peningkatanhubungandengan
golongandarahAByangmemilikitidakadaABOantibodi.
SitogenetikakelainanSecaraumum,
mollengkapmemiliki46,XXkariotipe
(85%),kromosommolarberasalsepenuhnyadariayah.Ovumintidapatberupaabsen
(ovumkosong)atautidakaktifyangtelahdibuahiolehspermahaploid.Kemudian
duplikatkromosomsendirisetelahmeiosis.Fenomenainidikenalsebagai
androgenesis.Jarang,polakromosommungkin46,XYatau45,X.
Semakintinggirasioayah:ibukromosom,semakinbesaradalahperubahanmolar.
molalengkapmenunjukkan2:0ayah/rasioibusedangkanmolaparsialmenunjukkan
rasio2:1.
Sejarahmolahidatidosasebelummeningkatkankemungkinankekambuhan(1
sampai4%).

Itisprincipallyadiseaseofthechorion.Deathoftheovumorfailureoftheembryoto
growisessentialtodevelopcomplete(classic)hydatidiformmole.Thesecretionfrom
thehyperplasticcellsandtransferredsubstancesfromthematernalbloodaccumulate
inthestromaofthevilliwhicharedevoidofbloodvessels.Thisresultsindistension
ofthevillitoformsmallvesicles.Thedistensionmayalsobeduetoedemaand
liquefactionofthestroma.Vesiclefluidisinterstitialfluidandisalmostsimilarto
asciticoredemafluid,butrichinhCG.
Nakedeyeappearance(Fig.15.14):Themassfillingtheuterusismadeofmultiple
chainsandclustersofcystsofvaryingsizes.

Thereisnotraceofembryoortheamnioticsac.Hemorrhage,ifoccurs,takesplacein
thedecidualspace.
Microscopicappearance(Fig.15.15):Thebasicfindingsare(1)Thereismarked
proliferationofthesyncitialandcytotrophoblasticepithelium
(2)Markedthinningofthestromaltissueduetohydropicdegeneration
(3)Thereisabsenceofbloodvesselsinthevilliwhichseemsprimaryratherthandue
topressureatrophy
(4)Thevilluspatternisdistinctlymaintained.

Ovarianchanges:Bilateralluteincystsarepresentinabout50%.Thesearedueto
excessiveproductionofchorionicgonadotropinandtheyarealsoobservedinmultiple
pregnancy.Theseregressspontaneouslywithintwomonthsafterexpulsionofmole.
Thecontainedfluidisrichinchorionicgonadotropin.Italsocontainsestrogenand
progesterone.

Haliniterutamapenyakitkorion.Kematianovumataukegagalanembriountuk
tumbuhadalahpentinguntukmengembangkanlengkap(klasik)molahidatidosa.
Sekresidariselhiperplastikdanzatditransferdaridarahibumenumpukdistroma
dariviliyangtanpapembuluhdarah.Hasildidistensidariviliiniuntukmembentuk
vesikelkecil.distensijugamungkinkarenaedemadanpencairanstroma.cairan
vesikelcairaninterstitialdanhampirmiripdenganasitesataucairanedema,tapikaya
hCG.
penampilanmatatelanjang(.Gambar15.14):Massamengisirahimterbuatdari
beberaparantaidankelompokkistadariberbagaiukuran.

Tidakadajejakdariembrioataukantungketuban.Perdarahan,jikaterjadi,

berlangsungdiruangdesidua.
penampilanmikroskopis(Gambar15.15.):Temuandasaradalah(1)Adaproliferasi
ditandaidarisyncitialdanepitelsitotrofoblas
(2)penipisanDitandaidarijaringanstromaakibatdegenerasihidropik
(3)Adatidakadanyapembuluhdarahdiviliyangtampaknyautamadaripadakarena
tekananatrofi
(4)Polavillusyangjelasdipertahankan.

Perubahanovarium:kistaluteinbilateralyanghadirdisekitar50%.Iniadalahkarena
produksiyangberlebihandarichorionicgonadotropindanmerekajugadiamatipada
kehamilanganda.Iniregresispontandalamwaktuduabulansetelahpengusiranmol.
cairanyangterkandungkayachorionicgonadotropin.Halinijugamengandung
estrogendanprogesteron.

Ageandparity:Itisprevalentamongstteenagedandelderlypatientswithhighparity.
Thepatientgiveshistoryofamenorrheaof812weekswithinitialfeaturessuggestive
ofnormalpregnancybutsubsequentlypresentswiththefollowingmanifestations
(oftenconfusedwithabortion).

SYMPTOMS
Vaginalbleeding:Vaginalbleedingisthecommonestpresentation(90%).Often
thesymptomsmimicanincompleteortheratenedabortion.Thebloodmaybemixed
withagelatinousfluidfromrupturedcystsgivingtheappearanceofdischargewhite
currantinredcurrantjuice.
Varyingdegreeoflowerabdominalpainmaybedueto(a)Overstretchingofthe
uterus(b)Concealedhemorrhage(c)Rarelyperforationoftheuterusbytheinvasive
mole(d)Infectionor(e)Uterinecontractionstoexpeloutthecontents.
Constitutionalsymptoms:(a)Thepatientbecomessickwithoutanyapparent
reason(b)Vomitingofpregnancybecomesexcessivetothestageofhyperemesisin
15%cases.Itisprobablyrelatedtoexcesschorionicgonadotropin(c)Breathlessness
duetopulmonaryembolizationofthetrophoblasticcells(2%)(d)Thyrotoxicfeatures
oftremorsortachycardiaarepresentonoccasion(2%).Itisprobablyduetoincreased
chorionicthyrotropin.
Expulsionofgrapelikevesiclespervaginamisdiagnosticofvesicularmole.
Actually,inapproximately50%ofcasesthemoleisnotsuspecteduntilit

isexpelledinpartorwhole.
Historyofquickeningisabsent.

SIGNS
Featuressuggestiveofearlymonthsofpregnancyareevident.
Thepatientlooksmoreillthancanbeaccountedfor.
Pallorispresentandmaybeunusuallyoutofproportiontothevisibleblood
loss.Thismaybeduetoconcealedhemorrhage.Itismostlyduetoiron
deficiencybutmaybemegaloblasticduetofolicaciddeficiency.

Usiadanparitas:Iniadalahlazimdiantarapasienremajadanorangtuadengan
paritastinggi.Pasienmemberikansejarahamenoredari812minggudenganfitur
awalsugestifdarikehamilannormaltetapikemudianmenyajikandenganmanifestasi
berikut(seringbingungdenganaborsi).

GEJALA
Perdarahanvagina:perdarahanvaginaadalahpresentasiumum(90%).Seringkali
gejalameniruaborsitidaklengkapatautheratened.darahdapatdicampurdengan
cairanagaragardarikistapecahmemberikanpenampilandebit"kismisputihdalam
juskismismerah".
Berbagaiderajatnyeriperutbagianbawahmungkinkarenake(a)Selama
pereganganrahim(b)dirahasiakanperdarahan(c)Jarangperforasirahimolehinvasif
mol(d)Infeksiatau(e)kontraksiuterusuntukmengusirkeluarisi.
Gejalakonstitusional:(a)Pasienmenjadisakittanpaalasanyangjelas(b)Muntah
kehamilanmenjadiberlebihanuntuktahaphiperemesisdi15%kasus.Halini
mungkinterkaitdengankelebihanchorionicgonadotropin(c)Sesaknapaskarena
embolisasiparuseltrofoblas(2%)(d)tirotoksikfiturtremoratautakikardiayang
hadirpadakesempatan(2%).Halinimungkinkarenapeningkatanthyrotropin
chorionic.
Pengusirananggursepertivesikelpervaginammerupakandiagnostikmolvesikular.
Sebenarnya,padasekitar50%kasusmoltidakdidugasampai
diusirsebagianataukeseluruhan.
Sejarahpercepatantidakada.

TANDATANDA
Fitursugestifdaribulanbulanawalkehamilanyangjelas.
Pasientampaklebihsakitdaripadayangdapatdipertanggungjawabkan.
Pucathadirdanmungkinluarbiasadariproporsikehilangandarahterlihat.Halini
mungkinkarenaperdarahantersembunyi.Halinisebagianbesardisebabkanoleh
kekuranganzatbesitetapimungkinmegaloblastikkarenakekuranganasamfolat.

Features of pre-eclampsia (hypertension, edema and/or proteinuria)

are present in about 50%. On rare
occasion, convulsion may occur.
Per abdomen:
The size of the uterus is more than that expected for the period of
amenorrhea in 70%, corresponds
with the period of amenorrhea in 20% and smaller than the period of
amenorrhea in 10%. The frequent findings of undue enlargement of
the uterus is due to exuberant growth of the vesicles and the
concealed hemorrhage.
The feel of the uterus is firm elastic (doughy). This is due to the
absence of the amniotic fluid sac.
Fetal parts are not felt, nor any fetal movements. External
ballottement cannot be elicited.
Absence of fetal heart sound which cannot be detected even by
the Doppler effect cardioscope.
The negative abdominal signs are of value when these signs should
have been present depending on the size of the uterus presented in
the particular case.
Vaginal examination:
Internal ballottement cannot be elicited.
Unilateral or bilateral enlargement (theca
lutein cyst) of the ovary may be palpable in 2550% of cases. The
enlarged ovary may not be palpable due to the enlarged uterus.
Finding of vesicles in the vaginal discharge is pathognomonic of
hydatidiform mole.
If the cervical os is open, instead of the mem-branes, blood clot
or the vesicles may be felt.
Investigations:
t Full blood count, ABO and Rh grouping.
t Hepatic, renal and thyroid function tests are carried out.
t Sonography: Characteristic features of
molar pregnancy is snowstorm appearance (Fig. 15.16). Sometimes
confusion arises with the missed abortion, partial mole or the
degenerated fibroid. Doppler USG, sonography of liver, kidneys and
spleen is also carried out.

t Quantitative estimation of chorionic gonadotropin: High hCG titre

in urine (positive pregnancy test) diluted up to 1 in 200 to 1 in 500
beyond 100 days of gestation is very much suggestive. Rapidly
increasing value of serum hCG (hCG > 100,000 mIU/mL), are usual
with molar pregnancies. Normal pregnancy value reaches a peak at
about 1014 weeks and rarely it is more than 100,000 mIU/mL.
Serum hCG value > 2 MOM for corresponding gestational age is of
value.
t Plain X-ray abdomen: If the uterine size is more than 16 weeks, a
negative fetal shadow may be of help. Straight X-ray of the chest
should also be carried out as a routine for evidence of pulmonary
embolization even in benign mole.
t CT and MRI: Routine use of computed tomography or magnetic
resonance imaging for diagnosis or to detect metastatic disease is
not recommended.
Definitive diagnosis is made by histological examination of the
products of conception (Fig. 15.15).
DIFFERENTIAL DIAGNOSIS: The following conditions are often
confused with molar pregnancy: Estimation of serum hCG and
ultrasonography are diagnostic.
Threatened abortion: Persistence of dark-colored vaginal bleeding
with mistaken date showing disproportionate increase in size of the
uterus is quite confusing on clinical examination.
Fibroid or ovarian tumor with pregnancy: Disproportionate
enlargement of the uterus is the confusing point.
Multiple pregnancy: Presence of pre-eclampsia in early months,
disproportionate enlargement of the uterus and unusually high hCG
titre in the urine are confusing features. Twin pregnancy with one
normal fetus and placenta and the other with complete mole is
differentiated from partial mole by cytogenetic and high resolution
USG studies.
Fitur pre-eklampsia (hipertensi, edema dan / atau proteinuria) yang
hadir di sekitar 50%. pada langka
kesempatan, kejang dapat terjadi.
Per perut:
- Ukuran rahim lebih dari itu diharapkan untuk periode amenore di
70%, berkorespondensi
dengan periode amenore di 20% dan lebih kecil dari periode
amenore di 10%. Temuan sering pembesaran yang tidak semestinya
dari rahim ini disebabkan pertumbuhan riang dari vesikel dan
perdarahan tersembunyi.
- Merasa rahim adalah perusahaan elastis (pucat). Hal ini
disebabkan tidak adanya kantung cairan ketuban.
- Bagian janin tidak dirasakan, atau gerakan janin apapun.
ballottement eksternal tidak dapat diperoleh.
- Tidak adanya bunyi jantung janin yang tidak dapat dideteksi
bahkan oleh efek Doppler cardioscope.

Tanda-tanda perut negatif dari nilai saat tanda-tanda ini seharusnya

hadir tergantung pada ukuran rahim yang disajikan dalam kasus
tertentu.
Pemeriksaan vagina:
- Ballottement internal tidak dapat diperoleh.
- Pembesaran unilateral atau bilateral (teka
lutein kista) dari ovarium dapat teraba di 25-50% kasus. Ovarium
membesar mungkin tidak teraba karena rahim yang membesar.
- Mencari vesikel dalam vagina adalah patognomonik dari mola
hidatidosa.
- Jika os serviks terbuka, bukan mem-brane, bekuan darah atau
vesikel dapat dirasakan.
investigasi:
t hitung darah lengkap, ABO dan Rh pengelompokan.
t hepatik, tes fungsi ginjal dan tiroid dilakukan.
t Sonografi: fitur Karakteristik
kehamilan mola adalah 'badai salju' penampilan (Gambar. 15.16).
Kadang-kadang kebingungan muncul dengan aborsi terjawab, mola
parsial atau fibroid merosot. Doppler USG, sonografi hati, ginjal dan
limpa juga dilakukan.
t estimasi kuantitatif dari chorionic gonadotropin: hCG titer tinggi
dalam urin (tes kehamilan positif) diencerkan sampai 1 dari 200 ke 1
di 500 melampaui 100 hari kehamilan sangat banyak sugestif. Cepat
meningkat nilai serum hCG (hCG> 100.000 mIU / ml), yang biasa
dengan kehamilan mola. Nilai kehamilan normal mencapai
puncaknya pada sekitar 10-14 minggu dan jarang lebih dari 100.000
mIU / mL. Serum nilai hCG> 2 MOM untuk sesuai usia kehamilan
adalah nilai.
t Plain X-ray perut: Jika ukuran uterus lebih dari 16 minggu,
bayangan janin negatif mungkin bisa membantu. Lurus X-ray dada
juga harus dilakukan sebagai rutinitas untuk bukti embolisasi paru
bahkan dalam mol jinak.
t CT dan MRI: penggunaan rutin computed tomography atau
magnetic resonance imaging untuk diagnosis atau untuk
mendeteksi penyakit metastasis tidak dianjurkan.
Diagnosis pasti dibuat dengan pemeriksaan histologi dari hasil
konsepsi (Gambar. 15.15).
DIAGNOSIS DIFERENSIAL: Kondisi berikut sering bingung dengan
kehamilan mola: Estimasi hCG serum dan USG diagnostik.
Terancam aborsi: Kegigihan perdarahan vagina berwarna gelap
dengan tanggal keliru menunjukkan peningkatan yang tidak
proporsional dalam ukuran rahim cukup membingungkan pada
pemeriksaan klinis.
Fibroid atau tumor ovarium dengan kehamilan: tidak proporsional
pembesaran rahim adalah titik membingungkan.
Kehamilan ganda: Kehadiran pre-eklampsia di bulan-bulan awal,
pembesaran yang tidak proporsional dari rahim dan titer hCG yang
sangat tinggi dalam urin adalah fitur membingungkan. Twin
kehamilan dengan satu janin normal dan plasenta dan yang lainnya

dengan mola sempurna dibedakan dari mola parsial oleh studi USG
sitogenetik dan resolusi tinggi.
Immediate: (1) Hemorrhage and shockThe causes of hemorrhage
are: (a) Separation of the vesicles from its attachment to the
decidua. The hemorrhage may be concealed or revealed. (b)
Massive intraperitoneal hemorrhage which may be the first feature
of a perforating mole. (c) During evacuation of the mole due to(i)
atonic uterus or (ii) uterine injury.
(2) Sepsis: The increased risk of sepsis is due to: (a) As there are no
protective membranes, the vaginal organisms can creep up into the
uterine cavity. (b) Presence of degenerated vesicles, sloughing
decidua and old blood favors nidation of bacterial growth. (c)
Increased operative interference.
(3) Perforation of the uterus: The uterus may be injured due to: (a)
Perforating molewhich may produce massive intraperitoneal
hemorrhage (b) During vaginal evacuation specially by conventional
(D & E) method or during curettage following suction evacuation.
(4) Pre-eclampsia with convulsion on rare occasion.
(5) Acute pulmonary insufficiency due to pulmonary embolization of the trophoblastic cells with or
without villi stroma. Symptoms usually begins within 46 hours
following evacuation.
(6) Coagulation failure due to pulmonary emboliza-tion of
trophoblastic cells as they cause fibrin and platelets deposition
within the vascular tree (see p. 626).
Late: The development of choriocarcinoma follow-ing hydatidiform
mole ranges between 2 and 10%. The known risk factors are
recorded in the box above which are more likely to be associated
with the malignant change.
PROGNOSIS: Immediate risk from hemorrhage and sepsis are
markedly diminished due to early diagnosis, blood transfusion and
treatment. About 15-20% of complete moles progress to persistent
GTD where there is a plateau or re-elevation of the hCG level. In
about 5% cases, metastatic disease develops. The risk of recurrence
of hydatidiform mole in future pregnancy is about 14%. However,
chance of fetal malformation is not increased following
chemotherapy. The improvement and long term prognosis may be
attributed to the following factors: (i) Recognition of high risk factors
related to choriocarcinoma (ii) Careful follow up with serum -hCG
(iii) Use of cytotoxic drug at the optimum time and in the right case.
Segera: (1) Perdarahan dan shock-Penyebab perdarahan adalah: (a)
Pemisahan vesikel dari keterikatannya dengan desidua. perdarahan
yang mungkin tersembunyi atau terungkap. (B) besar-besaran
perdarahan intraperitoneal yang mungkin fitur pertama dari mol

perforasi. (C) Selama evakuasi dari mol karena ke- (i) atonic rahim
atau (ii) cedera rahim.
(2) Sepsis: Peningkatan risiko sepsis adalah karena: (a) Karena tidak
ada membran pelindung, organisme vagina dapat merayap ke
dalam rongga rahim. (B) Kehadiran vesikel merosot, pengelupasan
desidua dan darah tua nikmat nidation pertumbuhan bakteri. (C)
Peningkatan gangguan operasi.
(3) Perforasi uterus: uterus mungkin terluka karena: (a) perforantes
mol-yang dapat menghasilkan perdarahan intraperitoneal besar (b)
Selama evakuasi vagina khusus oleh konvensional (D & E) Metode
atau selama kuretase berikut evakuasi hisap.
(4) Pre-eklampsia dengan kejang pada kesempatan langka.
(5) akut insufisiensi paru karena parunary embolisasi dari sel-sel trofoblas dengan atau
tanpa stroma vili. Gejala biasanya dimulai dalam waktu 4-6 jam
setelah evakuasi.
(6) kegagalan Koagulasi karena paru emboliza-tion sel trofoblas
karena mereka menyebabkan fibrin dan platelet deposisi dalam
pohon vaskular (lihat hal. 626).
Akhir: Perkembangan koriokarsinoma tindak ing mola hidatidosa
berkisar antara 2 dan 10%. faktor risiko yang diketahui dicatat
dalam kotak di atas yang lebih mungkin terkait dengan perubahan
ganas.
PROGNOSIS: risiko Segera dari perdarahan dan sepsis yang nyata
berkurang karena diagnosis dini, transfusi darah dan pengobatan.
Sekitar 15-20% mol lengkap maju ke GTD persisten di mana ada
sebuah dataran tinggi atau re-elevasi tingkat hCG. Pada sekitar 5%
kasus, penyakit metastasis berkembang. Risiko kekambuhan dari
mola hidatidosa di masa kehamilan adalah sekitar 1-4%. Namun,
kesempatan malformasi janin tidak meningkat setelah kemoterapi.
Perbaikan dan prognosis jangka panjang dapat dikaitkan dengan
faktor-faktor berikut: (i) Pengakuan faktor risiko tinggi terkait
dengan koriokarsinoma (ii) Hati-hati menindaklanjuti dengan -hCG
serum (iii) Penggunaan obat sitotoksik pada saat yang optimal dan
di kasus yang tepat.
SUPPORTIVE THERAPY: The patient usually presents with variable
amount of bleeding and often they are anemic and associated with
infection. (i) IV infusion with Ringers solution is started (ii) Blood
transfusion is given if the patient is anemic (iii) Parenteral antibiotic
is given if there is associated infection. (iv) Blood is kept reserved
during the evacuation as there is risk of hemorrhage.
DEFINITIVE MANAGEMENT: Suction evacuation (SE) is the method of
treatment. It is safe, rapid and effective in almost all cases. Suction

evacuation can safely be done even when the uterus is of 28 weeks

gestation.
Group A: Cervix is favorable (a) The preferred method is suction
evacuation. A negative pressure is applied up to 200250 mm Hg.
The procedure can be performed under diazepam sedation or
general anesthesia.
(b) Alternatively, conventional dilatation of the cervix followed by
evacuation is done. During evacuation procedure patient should
ideally be monitored by pulse oximeter (oxygen saturation). 500 mL
Ringers solution IV infusion is set up. Risk of hemorrhage is high
specially when the uterus is large. Senior surgeon should be present
during the SE procedure. Use of oxytocin helps the expulsion of
moles and reduces blood loss but its routine use is not
recommended due to the risks of embolization (see below).
(c) Digital exploration and removal of the mole by ovum forceps
under general anesthesia may also be an alternative procedure.
After the evacuation is completed, methergin 0.2 mg is given
intramuscularly.
Group B: Cervix is tubular and closedPrior slow dilatation of the
cervix is done by introducing laminaria tent followed by suction and
evacuation. Alternatively, vaginal misoprostol (PGE1) 400 g, 3
hours before surgery may be used.
Complications of vaginal evacuationApart from the injury to the
uterus, hemorrhage and shock, there are two more rare but fatal
complications(1) Acute pulmonary insufficiency due to pulmonary
embolization of the trophoblastic cells. Symptoms of acute chest
pain, tachycardia, tachypnea and dyspnea develop about 46 hours
following evacuation. Medical induction (oxytocin infusion) before
evacuation may increase the risk of pulmonary insufficiency (RCOG).
Arterial PO2 is monitored. Patient may need ventilatory assistance
and intensive care unit management. (2) Thyroid stormIn
presence of hyperthyroid state when evacuation is done under
general anesthesia, the acute features such as hyperthermia,
delirium, convulsions, coma and cardiovascular collapse develop.
The condition can be managed by administration of beta adrenergic
blocking agents.
Hysterectomy is indicated in: (i) Patients with age over 35 (ii)
Patient completed her family irrespective of age (iii) Uncontrolled
hemorrhage or perforation during surgical evacuation. Hysterectomy
reduces the risk of GTN by five-fold.
Hysterotomy is rarely done these days. It may be done in cases
with (i) Profuse vaginal bleeding (ii) Cervix is unfavorable for
immediate vaginal evacuation (iii) Accidental perforation of the
uterus during surgical evacuation.
It should be remembered that following hysterectomy, persistent
GTD is observed in 35% cases. As such, it does not eliminate the
necessity of follow up. The enlarged ovaries (theca lutein cysts)
found during operation should be left undisturbed as they will
regress following removal of mole. But, if complication arises, like

torsion, rupture or infarction, they should be removed. The uterus

following hysterectomy should be sent for histopathological
examination.
Following evacuation Anti. D immunoglobulin should be given to the
Rh-negative nonimmunized patient (see p. 334).
PLACE OF CURETTAGE FOLLOWING VAGINAL EVACUATION: Routine
curettage is not recommended. It is done in selected cases with
persistent vaginal bleeding (persistent GTN). Gentle curettage may
be done 57 days following evacuation. At this time the uterine wall
gets thicker, firmer and the cavity becomes smaller so that effective
curettage can be done without risk of damaging the uterus. The
objective of curettage is to remove the necrosed decidua and the
attached vesicles so as to accelerate involution and to reduce the
irregular bleeding. The materials should be sent for histology to note
the degree of trophoblastic hyperplasia and to see whether the
villus structure is present or not.
FOLLOW-UP: Routine follow-up is mandatory for all cases for at least
1 year. The occurrence of chorio- carcinoma is mostly confined to
this period. The prime objective is to diagnose persistent
trophoblastic disease (20-30%) that is considered malignant.
However, hCG levels following evacuation should regress to normal
within 3 months time.
MENDUKUNG TERAPI: Pasien biasanya datang dengan sejumlah
variabel perdarahan dan sering mereka mengalami anemia dan
berhubungan dengan infeksi. (I) infus IV dengan larutan Ringer
dimulai (ii) Transfusi darah diberikan jika pasien anemia (iii)
parenteral antibiotik diberikan jika ada terkait infeksi. (Iv) Darah
terus dicadangkan selama evakuasi karena ada risiko perdarahan.
DEFINITIVE MANAJEMEN: Suction evakuasi (SE) adalah metode
pengobatan. Hal ini aman, cepat dan efektif dalam hampir semua
kasus. Hisap evakuasi aman dapat dilakukan bahkan ketika rahim
adalah 28 minggu kehamilan.
Grup A: Cervix menguntungkan - (a) Metode yang disukai adalah
hisap evakuasi. Sebuah tekanan negatif diterapkan hingga 200-250
mm Hg. Prosedur ini dapat dilakukan dengan diazepam sedasi atau
anestesi umum.
(B) Atau, dilatasi konvensional serviks diikuti oleh evakuasi
dilakukan. Selama evakuasi pasien prosedur idealnya harus
dipantau oleh oksimeter pulsa (saturasi oksigen). 500 infus solusi IV
mL Ringer sudah diatur. Risiko perdarahan tinggi khususnya ketika
rahim besar. Dokter bedah Senior harus hadir selama prosedur SE.
Penggunaan oksitosin membantu pengusiran mol dan mengurangi
kehilangan darah tetapi penggunaan rutin tidak dianjurkan karena
resiko embolisasi (lihat di bawah).
(C) eksplorasi dan penghapusan mol dengan forceps ovum bawah
anestesi umum Digital juga dapat menjadi prosedur alternatif.

Setelah evakuasi selesai, methergin - 0,2 mg diberikan

intramuskular.
Grup B: Cervix adalah tubular dan ditutup-Sebelum dilatasi
lambat serviks dilakukan dengan memperkenalkan tenda laminaria
diikuti oleh hisap dan evakuasi. Atau, misoprostol vaginal (PGE1)
400 mg, 3 jam sebelum operasi dapat digunakan.
Komplikasi evakuasi-Apart vagina dari cedera rahim, perdarahan
dan syok, ada dua lebih jarang namun fatal yang complications- (1)
insufisiensi paru akut akibat embolisasi paru sel trofoblas. Gejala
akut nyeri dada, takikardia, takipnea dan dyspnea mengembangkan
sekitar 4-6 jam setelah evakuasi. induksi medis (oksitosin infus)
sebelum evakuasi dapat meningkatkan risiko insufisiensi paru
(RCOG). Arteri PO2 dipantau. Pasien mungkin perlu bantuan
ventilasi dan manajemen unit perawatan intensif. (2) Thyroid
kehadiran badai-In negara hipertiroid saat evakuasi dilakukan di
bawah anestesi umum, fitur akut seperti hipertermia, delirium,
kejang, koma dan kolaps kardiovaskular berkembang. Kondisi ini
dapat dikelola dengan pemberian agen memblokir beta adrenergik.
Histerektomi diindikasikan pada: (i) Pasien dengan usia lebih dari
35 (ii) Pasien selesai keluarganya terlepas dari usia (iii) perdarahan
yang tidak terkontrol atau perforasi selama evakuasi bedah.
Histerektomi mengurangi risiko GTN oleh lima kali lipat.
histerotomi jarang dilakukan hari ini. Hal itu dapat dilakukan pada
kasus-kasus dengan (i) sebesar-besarnya vagina pendarahan (ii)
Cervix adalah tidak menguntungkan untuk evakuasi vagina
langsung (iii) perforasi Terkadang rahim selama evakuasi bedah.
Harus diingat bahwa setelah histerektomi, GTD persisten diamati
dalam 3-5% kasus. Dengan demikian, hal itu tidak menghilangkan
perlunya tindak lanjut. Ovarium membesar (kista lutein teka)
ditemukan selama operasi harus dibiarkan tidak terganggu karena
mereka akan mundur setelah penghapusan mol. Tapi, jika
komplikasi timbul, seperti torsi, ruptur atau infark, mereka harus
dihapus. Rahim histerektomi berikut harus dikirim untuk
pemeriksaan histopatologi.
Berikut evakuasi Anti. D immunoglobulin harus diberikan kepada Rhnegatif pasien diimunisasi (lihat hal. 334).
TEMPAT kuretase BERIKUT VAGINA EVAKUASI: kuretase rutin tidak
dianjurkan. Hal ini dilakukan dalam kasus-kasus yang dipilih dengan
perdarahan vagina persisten (persistent GTN). kuretase lembut
dapat dilakukan 5-7 hari setelah evakuasi. Pada saat ini dinding
rahim mendapat lebih tebal, lebih kencang dan rongga menjadi
lebih kecil sehingga kuretase efektif dapat dilakukan tanpa risiko
merusak rahim. Tujuan dari kuretase adalah untuk menghapus
desidua nekrosis dan vesikula melekat sehingga mempercepat
involusi dan mengurangi perdarahan tidak teratur. Bahan-bahan
harus dikirim untuk pemeriksaan histologi untuk dicatat derajat
hiperplasia trofoblas dan untuk melihat apakah struktur villus hadir
atau tidak.

TINDAK LANJUT: Rutin tindak lanjut adalah wajib untuk semua kasus
selama minimal 1 tahun. Terjadinya karsinoma chorio- sebagian
besar terbatas pada periode ini. Tujuan utama adalah untuk
mendiagnosa penyakit trofoblas persisten (20-30%) yang dianggap
ganas. Namun, kadar hCG berikut evakuasi harus mundur ke normal
dalam waktu 3 bulan.
Intervals: Initially, the check up should be at an interval of one week
till the serum hCG level becomes negative. This usually happens by
48 weeks. Once negative within 56 days, the patient is followed up
at every one month interval for 6 months. Women who undergo
chemotherapy should be followed up for one year after hCG has
been normal. The patient must not become pregnant during the
period of follow-up.
Follow-up protocols: The follow-up protocols includes: (i) history and
clinical examination (ii) hCG assay.
Methods employed in each visit: (1) Enquire about relevant
symptoms like irregular vaginal bleeding, persistent cough,
breathlessness or hemoptysis.
(2) Abdominovaginal examination to note: (i) involution of the uterus
(ii) ovarian size (iii) malignant deposit if any, in the anterior vaginal
wall. The lutein cysts usually regress within two months. Pelvic
examination is done after one week of molar evacuation.
(3) Investigations: (i) Detection of hCG in urine or serumUrine or
serum assays are carried out at every visit. Initially, the less
sensitive and less costly immunological test may be carried out until
the test becomes negative. Thereafter, it is preferable to use a more
sensitive serum hCG level by radioimmunoassay. (ii) Chest X-ray: If
the pre- evacuation chest radiograph shows metastasis, it should be
repeated at 4 weeks interval, until remission is confirmed. It is then
repeated at 3 months interval during the rest of the follow-up
period. When pre-evacuation chest X-ray is normal, it is repeated
only when the hCG titer plateaus or rises.
PROPHYLACTIC CHEMOTHERAPY: Eighty percent of patients undergo
spontaneous remission. Sensitive -hCG assay can identify the rest
that develop malignancy. Moreover the drugs used are toxic. These
drugs in young females increase the risk of premature ovarian
failure and menopause. So it is not appropriate to treat all patients
as a routine prophylactically. However, it is used with advantages in
the following circumstances:
(i) If the hCG level fails to become normal by the stipulated time
(10-12 weeks) or there is re-elevation at 4-8 weeks (ii) Rising hCG
level after reaching normal levels (iii) Post evacuation hemorrhage
(presence of trophoblastic activity) (iv) Where follow up facilities are
not adequate (v) Evidences of metastases irrespective of the level of
hCG (vi) In cases, where the malignant sequelae is higher as judged
by the risk factors (see p. 194) and where proper follow-up facilities
are not available. Prophylactic chemotherapy in such cases is better

than no follow-up. Prophylactic chemotherapy is useful in high risk

group of women as it prevents metastasis and reduces morbidity.
Regimes: Methotrexate, 1 mg/kg/day IV or IM is given on Days 1, 3,
5 and 7 with Folinic acid 0.1 mg/kg IM on Days 2, 4, 6 and 8. It is to
be repeated every 7 days. A total 3 courses are given. hCG level
should decrease by at least 15%, 4-7 days after methotrexate.
Alternatively, intravenous actinomycin D 12 g/kg body weight daily
for 5 days may be given. It is less toxic than methotrexate. (See
authors Text Book of Gynecology, for details of Chemotherapy,
Chapter 22).
CONTRACEPTIVE ADVICE: The patient is traditionally advised not to
be pregnant for at least one year. A rise in hCG titers might cause
confusion between a fresh pregnancy or persistent GTD. However,
with vaginal probe ultrasound scan, pregnancy can be diagnosed
even as early as 56 weeks. Thus, if the patient so desires, she may
be pregnant after a minimum of 6 months, following the negative
hCG titer. But pregnancy is delayed at least up to one year for
gestational trophoblastic neoplasia and up to 2 years if there is
metastasis.
Use of contraception: IUD is contraindicated, because of its frequent
association of irregular bleeding a feature often coexists with
choriocarcinoma. Combined oral pills can be used after the hCG
value has become normal. Inj DMPA can be used safely (see p. 548).
Barrier method of contraception can also be used. Surgical
sterilization is another alternative when she has completed her
family.
Unfavorable manifestations: (1) Persistent ill health (2) Irregular
vaginal bleeding or continuing amenorrhea (3) Appearance of
respiratory symptoms (4) Sub-involution (5) Appearance of
secondary metastasis in the vagina (6) Chest radiograph showing
positive finding of cannon ball shadow (7) hCG titers remain
elevated or there is re-elevation after a negative report.
hCG levels should be checked 3 weeks after the end of any
pregnancy, subsequent to a molar one.
In partial hydatidiform mole, the affection of the chorionic villi is
focal. There is a fetus or at least an amniotic sac.
The karyotype is triploid either 69, XXY or 69, XYY with one maternal
but usually two paternal haploid chromo-somes. Microscopic
examination of the dilated chorionic villi shows predominant
hyperplasia of the syncytiotro-phoblast and presence of fetal blood
vessels with fetal red blood cells. The fetus, if present, dies in early
first trimester. Rarely, the baby may be born which is growth
retarded with multi-system abnormalities (Fig. 15.18).
The clinical picture does not differ markedly from complete mole
and too often confused with threatened or missed abortion. The hCG
titre is not markedly raised. With wider use of sonography, more and
more cases are being revealed. In partial mole, uterus is generally
not large for dates and malignant potential is very low.

Once the diagnosis is made and the fetus is not alive, termination of
pregnancy is to be done. Even if the fetus is alive, the patient should
be warned about the risks involved to the fetus if pregnancy is
continued.
Post-termination follow-up protocol should be the same as outlined
in complete mole. As the chance of malignancy is much less, the
follow up for 36 months is to be continued after hCG level returns
to normal.
Interval: Awalnya, pemeriksaan harus di selang waktu satu minggu
sampai tingkat serum hCG menjadi negatif. Hal ini biasanya terjadi
4-8 minggu. Setelah negatif dalam 56 hari, pasien ditindaklanjuti di
setiap interval satu bulan selama 6 bulan. Wanita yang menjalani
kemoterapi harus ditindaklanjuti selama satu tahun setelah hCG
telah normal. Pasien tidak harus menjadi hamil selama periode
follow-up.
Tindak lanjut protokol: protokol tindak lanjut meliputi: (i) sejarah dan
pemeriksaan klinis (ii) assay hCG.
Metode yang digunakan dalam setiap kunjungan: (1) Tanyakan
tentang gejala terkait seperti perdarahan tidak teratur vagina, batuk
terus-menerus, sesak napas atau hemoptisis.
(2) Pemeriksaan Abdominovaginal untuk dicatat: (i) involusi uterus
(ii) ukuran ovarium (iii) deposito ganas jika ada, pada dinding vagina
anterior. Kista lutein biasanya mundur dalam waktu dua bulan.
Pemeriksaan panggul dilakukan setelah satu minggu evakuasi
molar.
(3) Pemeriksaan penunjang: (i) Deteksi hCG dalam urin atau serumUrine atau serum tes yang dilakukan pada setiap kunjungan.
Awalnya, tes imunologi kurang sensitif dan lebih murah dapat
dilakukan sampai tes menjadi negatif. Setelah itu, adalah lebih baik
untuk menggunakan tingkat serum hCG lebih sensitif oleh
radioimmunoassay. (Ii) Chest X-ray: Jika rontgen dada evakuasi pra
menunjukkan metastasis, harus diulang pada interval 4 minggu,
sampai remisi dikonfirmasi. Hal ini kemudian diulang pada interval 3
bulan selama sisa masa tindak lanjut. Ketika dada pra-evakuasi Xray normal, hal ini diulang hanya ketika dataran tinggi titer hCG
atau naik.
PROFILAKSIS KEMOTERAPI: Delapan puluh persen pasien menjalani
remisi spontan. Sensitif uji -hCG dapat mengidentifikasi sisa yang
mengembangkan keganasan. Selain itu obat yang digunakan adalah
beracun. Obat ini pada wanita muda meningkatkan risiko kegagalan
ovarium prematur dan menopause. Jadi tidak tepat untuk
memperlakukan semua pasien sebagai rutinitas profilaksis. Namun,
digunakan dengan keuntungan dalam situasi berikut:
(I) Jika tingkat hCG gagal untuk menjadi normal pada waktu yang
ditentukan (10-12 minggu) atau ada re-elevasi di 4-8 minggu (ii)
Meningkatnya tingkat hCG setelah mencapai level normal (iii)
perdarahan Pos evakuasi ( adanya aktivitas trofoblas) (iv) dimana

menindaklanjuti fasilitas tidak memadai (v) bukti metastasis

terlepas dari tingkat hCG (vi) dalam kasus, di mana gejala sisa
ganas lebih tinggi sebagaimana dinilai oleh faktor-faktor risiko (lihat
hal. 194 ) dan mana yang tepat fasilitas tindak lanjut tidak tersedia.
kemoterapi profilaksis dalam kasus seperti ini lebih baik daripada
tidak ada tindak lanjut. kemoterapi profilaksis berguna dalam
kelompok risiko tinggi dari perempuan karena mencegah metastasis
dan mengurangi morbiditas.
Rezim: Methotrexate, 1 mg / kg / hari IV atau IM diberikan pada Hari
1, 3, 5 dan 7 dengan folinic asam 0,1 mg / kg IM pada Hari 2, 4, 6
dan 8. Hal ini harus diulang setiap 7 hari . Sebanyak 3 program
diberikan. tingkat hCG harus menurun setidaknya 15%, 4-7 hari
setelah methotrexate. Atau, intravena aktinomisin D 12 mg / kg
berat badan setiap hari selama 5 hari dapat diberikan. Hal ini
kurang beracun dari methotrexate. (Lihat penulis Buku Teks
Ginekologi, untuk rincian Kemoterapi, Bab 22).
SARAN KONTRASEPSI: Pasien secara tradisional disarankan untuk
tidak hamil selama setidaknya satu tahun. Kenaikan titer hCG dapat
menyebabkan kebingungan antara kehamilan segar atau GTD
persisten. Namun, dengan vagina pemeriksaan ultrasound scan,
kehamilan dapat didiagnosis bahkan sedini 5-6 minggu. Dengan
demikian, jika pasien sehingga keinginan, ia mungkin hamil setelah
minimal 6 bulan, setelah titer hCG negatif. Tapi kehamilan tertunda
setidaknya sampai satu tahun untuk neoplasia trofoblas gestasional
dan sampai 2 tahun jika ada metastasis.
Penggunaan kontrasepsi: IUD merupakan kontraindikasi, karena
asosiasi sering nya tidak teratur bleeding- fitur sering berdampingan
dengan koriokarsinoma. pil oral kombinasi dapat digunakan setelah
nilai hCG menjadi normal. Inj DMPA dapat digunakan dengan aman
(lihat hal. 548). metode penghalang kontrasepsi juga dapat
digunakan. sterilisasi bedah adalah alternatif lain ketika ia telah
menyelesaikan keluarganya.
Manifestasi yang tidak menguntungkan: (1) Persistent sakit (2)
perdarahan vagina yang tidak teratur atau melanjutkan amenore (3)
Penampilan gejala pernapasan (4) Sub-involusi (5) Penampilan
metastasis sekunder pada vagina (6) Rontgen dada menunjukkan
temuan positif dari "bola meriam" shadow (7) titer hCG tetap tinggi
atau ada re-elevasi setelah laporan negatif.
tingkat hCG harus diperiksa 3 minggu setelah akhir setiap
kehamilan, setelah satu molar.
Dalam mola hidatidosa parsial, kasih sayang dari villi chorionic
adalah fokus. Ada janin atau setidaknya kantung ketuban.
kariotipe yang triploid baik 69, XXY atau 69, XYY dengan satu ibu
tapi biasanya dua ayah haploid kromo-somes. pemeriksaan
mikroskopis dari villi chorionic melebar menunjukkan hiperplasia
dominan dari syncytiotro-phoblast dan adanya pembuluh darah
janin dengan sel darah merah janin. janin, jika ada, meninggal pada

awal trimester pertama. Jarang, bayi dapat lahir yang pertumbuhan

terbelakang dengan kelainan multi-sistem (Gambar. 15,18).
Gambaran klinis tidak berbeda nyata dari mola sempurna dan
terlalu sering bingung dengan aborsi terancam atau tidak terjawab.
HCG titer tidak nyata dibangkitkan. Dengan penggunaan yang lebih
luas dari sonografi, semakin banyak kasus yang terungkap. Pada
mola parsial, uterus umumnya tidak besar untuk tanggal dan
potensi ganas sangat rendah.
Setelah diagnosis dibuat dan janin tidak hidup, penghentian
kehamilan yang harus dilakukan. Bahkan jika janin masih hidup,
pasien harus diperingatkan tentang risiko yang terlibat untuk janin
bila kehamilan dilanjutkan.
Pasca penghentian protokol tindak lanjut harus sama seperti yang
dijelaskan dalam mola sempurna. Sebagai kesempatan keganasan
jauh lebih sedikit, tindak lanjut selama 3-6 bulan adalah untuk
dilanjutkan setelah tingkat hCG kembali normal.